WorldWideScience

Sample records for alveolate perkinsus marinus

  1. ANTIOXIDANT ENZYMES, POTENTIAL VIRULENT FACTORS, IN DIFFERENT STRAINS OF THE OYSTER PROTOZOAN PARASITE, PERKINSUS MARINUS

    Science.gov (United States)

    The oyster protozoan parasite, Perkinsus marinus, is one of the two important parasites causing severe mortality in the eastern oysters (Crassostrea virginica) on the US east coast. Our recent study suggests that P. marinus cells and its extracellular products (ECP) could scaveng...

  2. Heterologous Expression of Gene of Interest Using the Marine Protozoan Perkinsus marinus

    Science.gov (United States)

    Cold, E. R.

    2016-02-01

    Perkinsus marinus is a marine protozoan parasite that causes "Dermo" disease in eastern oysters (Crassostrea virginica). P. marinus is closely related to Plasmodium falciparum which causes malaria. A recent study has showed that P. marinus causes no pathology damage but an immune response in humanized mouse, providing the bases for a genetically modified P. marinus expressing Plasmodium genes to be used as a vaccination delivery system for malaria and other pathogenic diseases. A modified plasmid vector (pMOE-GFP) based on highly expressed gene tagged with green fluorescence protein and targeted to P. marinus cell wall was used to clone MSP8 and HAP2. MSP8 encodes for merozoite surface in P. falciparum and HAP2 is essential for fusion of male and female gametes; genetic disruption of the HAP2 locus revealed that parasite fertilization is prevented. Using electroporation, MSP8 and HAP2 plasmid were introduced into the P. marinus trophozoites. As controls pMOE-GFP was transfected into P. mediterraneus, P. atlanticus and P. chesapeaki. Transfection conditions included 5x107 Perkinsus trophozoites and 10 µg of plasmid using Nucleofector® technology (D-023 program). The cells were recovered in 3 mL of Perkinsus culture media and transfected trophozoites were examined for green fluorescence. To facilitate subcloning of cells expressing GFP, we optimized a DME: HAM's F12 -5% FBS -containing agar solid medium for plating Perkinsus. Examination of all transfected cells indicates expression of both MSP8 and HAP2. This is the first time that genes of a protozoan parasite have been expressed in a marine protozoan. It was also concluded that P. mediterraneus, P. atlanticus and P. chesapeaki were stable mutation and can be isolated for further research.

  3. Natural and cultured populations of the mangrove oyster Saccostrea palmula from Sinaloa, Mexico, infected by Perkinsus marinus.

    Science.gov (United States)

    Cáceres-Martínez, Jorge; Ortega, Mauricio García; Vásquez-Yeomans, Rebeca; García, Teresa de Jesús Pineda; Stokes, Nancy A; Carnegie, Ryan B

    2012-07-01

    The mangrove oyster Saccostrea palmula coexists with the pleasure oyster Crassostrea corteziensis in coastal lagoons of northwest Mexico. Recent discovery of Perkinsus marinus infecting the pleasure oyster in the region prompted evaluation of S. palmula as an alternative P. marinus host. An analysis to determine the possible presence of P. marinus in natural and cultured populations of S. palmula at four coastal lagoons in Sinaloa, Mexico was carried out during October-November 2010. Tissues from apparently healthy S. palmula were evaluated using Ray's fluid thioglycollate method (RFTM), which revealed a Perkinsus sp. to be present in all four locations at 6.7-20.0% prevalence. Histopathological analysis of these specimens showed tissue alterations and parasite forms consistent with moderate P. marinus infection, which was confirmed by ribosomal non-transcribed spacer (NTS)-based PCR assays on DNA samples from oysters positive by RFTM and histology. DNA sequencing of amplified NTS fragments (307 bp) produced a sequence 98-100% similar to GenBank-deposited sequences of the NTS from P. marinus. Fluorescent in situ hybridization for Perkinsus spp. and P. marinus corroborated the PCR results, showing clear hybridization of P. marinus in host tissues. This is the first record of P. marinus infecting a species from genus Saccostrea and the first record of the parasite from coastal lagoons in Sinaloa, Mexico. Copyright © 2012 Elsevier Inc. All rights reserved.

  4. A semiquantitative PCR assay for assessing Perkinsus marinus infections in the eastern oyster, Crassostrea virginica.

    Science.gov (United States)

    Marsh, A G; Gauthier, J D; Vasta, G R

    1995-08-01

    A 3.2-kb fragment of Perkinsus marinus DNA was cloned and sequenced. A noncoding domain was identified and targeted for the development of a semiquantitative polymerase chain reaction (PCR) assay for the presence of P. marinus in eastern oyster tissues. The assay involves extracting total DNA from oyster hemolymph and using 1 microgram of that DNA as template in a stringent PCR amplification with oligonucleotide primers that are specific for the P. marinus 3.2-kb fragment. With this assay, we can detect 10 pg of total P. marinus DNA per 1 microgram of oyster hemocyte DNA with ethidium bromide (EtBr) staining of agarose gels, 100 fg total P. marinus DNA with Southern blot autoradiography, and 10 fg of total P. marinus DNA with dot-blot hybridizations. We have used the sensitivity of the PCR assay to develop a method for estimating the level of P. marinus DNA in oyster hemolymph and have successfully applied this technique to gill tissues. Our semiquantitative assay uses a dilution series to essentially titrate the point at which a P. marinus DNA target is no longer amplified in a sample. We refer to this technique as "dilution endpoint" PCR. Using hemocytes obtained by withdrawing a 1-ml sample of hemolymph, this assay provides a nondestructive methodology for rapidly screening large numbers of adult oysters for the presence and quantification of P. marinus infection levels. This technique is applicable to other tissues (gills) and could potentially be applied to DNA extracts of whole larvae or spat.

  5. Detection of Perkinsus marinus in the oyster Crassostrea rhizophorae in southern Bahia by proteomic analysis

    Directory of Open Access Journals (Sweden)

    Thiago Ramos Pinto

    2017-01-01

    Full Text Available This study reports the presence of the pathogen Perkinsus marinus, notifiable to the World Organization for Animal Health (Office International des Èpizooties = OIE in the oyster Crassostrea rhizophorae in southern Bahia via proteomic analysis. We analyzed Crassostrea brasiliana from a long-line cultivation system and C. rhizophorae from an adjacent mangrove in Porto do Campo, Camamu Bay, Bahia, Brazil. The collections (n = 100 were performed in October 2012. In the laboratory, the oysters were measured and opened to remove the meat, which was steeped in dry ice. For extraction of proteins, adaptation of a protocol used for mussels was used, after which separation in the first dimension was taken by isoelectric focusing (IEF. The peptides were transferred to a Mass Spectrometer. The obtained spectra were analyzed with the ProteinLynx Global Server 4.2 software tool and also by MASCOT (Matrix Science and compared to the databases of the SWISSPROT and NCBI, respectively. The identification was evidenced by beta-tubulin, Perkinsus marinus ATCC 50983 and protein homology code in the database NCBI = gi | 294889481. This is the first record of P. marinus in Bahia and the fourth in Brazil.

  6. Effects of cyanobacteria Synechocystis spp. in the host-parasite model Crassostrea gasar–Perkinsus marinus

    Energy Technology Data Exchange (ETDEWEB)

    Queiroga, Fernando Ramos [Laboratório de Imunologia e Patologia de Invertebrados (LABIPI), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Marques-Santos, Luis Fernando [Laboratório de Biologia Celular e do Desenvolvimento (LABID), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Hégaret, Hélène [Laboratoire des Sciences de l' Environnement Marin (LEMAR), UMR 6539 CNRS UBO IRD IFREMER, Institut Universitaire Européen de la Mer, Technopôle Brest-Iroise, 29280, Plouzané (France); Sassi, Roberto [Laboratório de Ambientes Recifais e Biotecnologia de Microalgas (LARBIM), Departamento de Sistemática e Ecologia, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Farias, Natanael Dantas; Santana, Lucas Nunes [Laboratório de Imunologia e Patologia de Invertebrados (LABIPI), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); and others

    2017-06-15

    Highlights: • Synechocystis cyanobacteria cause functional weakness of oysters haemocytes. • Synechocystis cyanobacteria cause a strengthening of Perkinsus marinus. • Synechocystis cyanobacteria may contribute to an imbalance of P. marinus–Crassostrea gasar relationship. - Abstract: Perkinsosis is a disease caused by protozoan parasites from the Perkinsus genus. In Brazil, two species, P. beihaiensis and P. marinus, are frequently found infecting native oysters (Crassostrea gasar and C. rhizophorae) from cultured and wild populations in several states of the Northeast region. The impacts of this disease in bivalves from Brazil, as well as the interactions with environmental factors, are poorly studied. In the present work, we evaluated the in vitro effects of the cyanobacteria Synechocystis spp. on trophozoites of P. marinus and haemocytes of C. gasar. Four cyanobacteria strains isolated from the Northeast Brazilian coast were used as whole cultures (WCs) and extracellular products (ECPs). Trophozoites of P. marinus were exposed for short (4 h) and long (48 h and 7 days, the latter only for ECPs) periods, while haemocytes were exposed for a short period (4 h). Cellular and immune parameters, i.e. cell viability, cell count, reactive oxygen species production (ROS) and phagocytosis of inert (latex beads) and biological particles (zymosan and trophozoites of P. marinus) were measured by flow cytometry. The viability of P. marinus trophozoites was improved in response to WCs of Synechocystis spp., which could be a beneficial effect of the cyanobacteria providing nutrients and reducing reactive oxygen species. Long-term exposure of trophozoites to ECPs of cyanobacteria did not modify in vitro cell proliferation nor viability. In contrast, C. gasar haemocytes showed a reduction in cell viability when exposed to WCs, but not to ECPs. However, ROS production was not altered. Haemocyte ability to engulf latex particles was reduced when exposed mainly to ECPs of

  7. Effects of cyanobacteria Synechocystis spp. in the host-parasite model Crassostrea gasar–Perkinsus marinus

    International Nuclear Information System (INIS)

    Queiroga, Fernando Ramos; Marques-Santos, Luis Fernando; Hégaret, Hélène; Sassi, Roberto; Farias, Natanael Dantas; Santana, Lucas Nunes

    2017-01-01

    Highlights: • Synechocystis cyanobacteria cause functional weakness of oysters haemocytes. • Synechocystis cyanobacteria cause a strengthening of Perkinsus marinus. • Synechocystis cyanobacteria may contribute to an imbalance of P. marinus–Crassostrea gasar relationship. - Abstract: Perkinsosis is a disease caused by protozoan parasites from the Perkinsus genus. In Brazil, two species, P. beihaiensis and P. marinus, are frequently found infecting native oysters (Crassostrea gasar and C. rhizophorae) from cultured and wild populations in several states of the Northeast region. The impacts of this disease in bivalves from Brazil, as well as the interactions with environmental factors, are poorly studied. In the present work, we evaluated the in vitro effects of the cyanobacteria Synechocystis spp. on trophozoites of P. marinus and haemocytes of C. gasar. Four cyanobacteria strains isolated from the Northeast Brazilian coast were used as whole cultures (WCs) and extracellular products (ECPs). Trophozoites of P. marinus were exposed for short (4 h) and long (48 h and 7 days, the latter only for ECPs) periods, while haemocytes were exposed for a short period (4 h). Cellular and immune parameters, i.e. cell viability, cell count, reactive oxygen species production (ROS) and phagocytosis of inert (latex beads) and biological particles (zymosan and trophozoites of P. marinus) were measured by flow cytometry. The viability of P. marinus trophozoites was improved in response to WCs of Synechocystis spp., which could be a beneficial effect of the cyanobacteria providing nutrients and reducing reactive oxygen species. Long-term exposure of trophozoites to ECPs of cyanobacteria did not modify in vitro cell proliferation nor viability. In contrast, C. gasar haemocytes showed a reduction in cell viability when exposed to WCs, but not to ECPs. However, ROS production was not altered. Haemocyte ability to engulf latex particles was reduced when exposed mainly to ECPs of

  8. Gene expression analysis of a critical enzyme in intermediary metabolism in oyster pathogen Perkinsus marinus .

    Science.gov (United States)

    Noell, K.

    2016-02-01

    A key regulatory component in the Krebs cycle pathway is the mitochondrial aconitase enzyme which has been posited to balance energy needs and oxidative growth total storage via citrate utilization. The presence of a cytosolic aconitase (cAcon) activity which serves as a competitor for citrate substrate has been recognized for years. cAcon is a dual function protein with mutually exclusive roles as a post transcriptional regulator of animal cell iron metabolism or as the cytosolic isoform of the iron sulfur enzyme aconitase. We are interested in establishing the role of this orthologue in Perkinsus marnius metabolism through demonstrating its function as aconitase, by looking at gene expression under certain environmental conditions. P. marinus is a close evolutionary relative of the dinoflagellates and is the causative agent of Dermo disease, which has significantly impacted oyster populations along the eastern seaboard. An understanding of intermediary metabolism will yield important insights into how c-aconitase may be involved in stress response systems such as oxidative tension and metabolite deficiency, which could be used to help aquaculturists alleviate the severe impact of "dermo" on the on the oyster population. This study will present data regarding our preliminary analysis of the gene aconitase and its role in intermediary metabolism.

  9. Genetic signature analysis of Perkinsus marinus in Mexico suggests possible translocation from the Atlantic Ocean to the Pacific coast of Mexico.

    Science.gov (United States)

    Ek-Huchim, Juan Pablo; Aguirre-Macedo, Ma Leopoldina; Améndola-Pimenta, Monica; Vidal-Martínez, Victor Manuel; Pérez-Vega, Juan Antonio; Simá-Alvarez, Raúl; Jiménez-García, Isabel; Zamora-Bustillos, Roberto; Rodríguez-Canul, Rossanna

    2017-08-02

    The protozoan Perkinsus marinus (Mackin, Owen & Collier) Levine, 1978 causes perkinsosis in the American oyster Crassostrea virginica Gmelin, 1791. This pathogen is present in cultured C. virginica from the Gulf of Mexico and has been reported recently in Saccostrea palmula (Carpenter, 1857), Crassostrea corteziensis (Hertlein, 1951) and Crassostrea gigas (Thunberg, 1793) from the Mexican Pacific coast. Transportation of fresh oysters for human consumption and repopulation could be implicated in the transmission and dissemination of this parasite across the Mexican Pacific coast. The aim of this study was two-fold. First, we evaluated the P. marinus infection parameters by PCR and RFTM (Ray's fluid thioglycollate medium) in C. virginica from four major lagoons (Términos Lagoon, Campeche; Carmen-Pajonal-Machona Lagoon complex, Tabasco; Mandinga Lagoon, Veracruz; and La Pesca Lagoon, Tamaulipas) from the Gulf of Mexico. Secondly, we used DNA sequence analyses of the ribosomal non-transcribed spacer (rNTS) region of P. marinus to determine the possible translocation of this species from the Gulf of Mexico to the Mexican Pacific coast. Perkinsus marinus prevalence by PCR was 57.7% (338 out of 586 oysters) and 38.2% (224 out of 586 oysters) by RFTM. The highest prevalence was observed in the Carmen-Pajonal-Machona Lagoon complex in the state of Tabasco (73% by PCR and 58% by RFTM) and the estimated weighted prevalence (WP) was less than 1.0 in the four lagoons. Ten unique rDNA-NTS sequences of P. marinus [termed herein the "P. marinus (Pm) haplotype"] were identified in the Gulf of Mexico sample. They shared 96-100% similarity with 18 rDNA-NTS sequences from the GenBank database which were derived from 16 Mexican Pacific coast infections and two sequences from the USA. The phylogenetic tree and the haplotype network showed that the P. marinus rDNA-NTS sequences from Mexico were distant from the rDNA-NTS sequences of P. marinus reported from the USA. The ten r

  10. Humanized HLA-DR4 mice fed with the protozoan pathogen of oysters Perkinsus marinus (Dermo do not develop noticeable pathology but elicit systemic immunity.

    Directory of Open Access Journals (Sweden)

    Wathsala Wijayalath

    Full Text Available Perkinsus marinus (Phylum Perkinsozoa is a marine protozoan parasite responsible for "Dermo" disease in oysters, which has caused extensive damage to the shellfish industry and estuarine environment. The infection prevalence has been estimated in some areas to be as high as 100%, often causing death of infected oysters within 1-2 years post-infection. Human consumption of the parasites via infected oysters is thus likely to occur, but to our knowledge the effect of oral consumption of P. marinus has not been investigated in humans or other mammals. To address the question we used humanized mice expressing HLA-DR4 molecules and lacking expression of mouse MHC-class II molecules (DR4.EA(0 in such a way that CD4 T cell responses are solely restricted by the human HLA-DR4 molecule. The DR4.EA(0 mice did not develop diarrhea or any detectable pathology in the gastrointestinal tract or lungs following single or repeated feedings with live P. marinus parasites. Furthermore, lymphocyte populations in the gut associated lymphoid tissue and spleen were unaltered in the parasite-fed mice ruling out local or systemic inflammation. Notably, naïve DR4.EA(0 mice had antibodies (IgM and IgG reacting against P. marinus parasites whereas parasite specific T cell responses were undetectable. Feeding with P. marinus boosted the antibody responses and stimulated specific cellular (IFNγ immunity to the oyster parasite. Our data indicate the ability of P. marinus parasites to induce systemic immunity in DR4.EA(0 mice without causing noticeable pathology, and support rationale grounds for using genetically engineered P. marinus as a new oral vaccine platform to induce systemic immunity against infectious agents.

  11. Humanized HLA-DR4 mice fed with the protozoan pathogen of oysters Perkinsus marinus (Dermo) do not develop noticeable pathology but elicit systemic immunity.

    Science.gov (United States)

    Wijayalath, Wathsala; Majji, Sai; Kleschenko, Yuliya; Pow-Sang, Luis; Brumeanu, Teodor D; Villasante, Eileen Franke; Vasta, Gerardo R; Fernández-Robledo, José-Antonio; Casares, Sofia

    2014-01-01

    Perkinsus marinus (Phylum Perkinsozoa) is a marine protozoan parasite responsible for "Dermo" disease in oysters, which has caused extensive damage to the shellfish industry and estuarine environment. The infection prevalence has been estimated in some areas to be as high as 100%, often causing death of infected oysters within 1-2 years post-infection. Human consumption of the parasites via infected oysters is thus likely to occur, but to our knowledge the effect of oral consumption of P. marinus has not been investigated in humans or other mammals. To address the question we used humanized mice expressing HLA-DR4 molecules and lacking expression of mouse MHC-class II molecules (DR4.EA(0)) in such a way that CD4 T cell responses are solely restricted by the human HLA-DR4 molecule. The DR4.EA(0) mice did not develop diarrhea or any detectable pathology in the gastrointestinal tract or lungs following single or repeated feedings with live P. marinus parasites. Furthermore, lymphocyte populations in the gut associated lymphoid tissue and spleen were unaltered in the parasite-fed mice ruling out local or systemic inflammation. Notably, naïve DR4.EA(0) mice had antibodies (IgM and IgG) reacting against P. marinus parasites whereas parasite specific T cell responses were undetectable. Feeding with P. marinus boosted the antibody responses and stimulated specific cellular (IFNγ) immunity to the oyster parasite. Our data indicate the ability of P. marinus parasites to induce systemic immunity in DR4.EA(0) mice without causing noticeable pathology, and support rationale grounds for using genetically engineered P. marinus as a new oral vaccine platform to induce systemic immunity against infectious agents.

  12. Diversity of extracellular proteins during the transition from the ‘proto-apicomplexan’ alveolates to the apicomplexan obligate parasites

    KAUST Repository

    Templeton, Thomas J.

    2015-11-20

    The recent completion of high-coverage draft genome sequences for several alveolate protozoans – namely, the chromerids, Chromera velia and Vitrella brassicaformis ; the perkinsid Perkinsus marinus ; the apicomplexan, Gregarina niphandrodes , as well as high coverage transcriptome sequence information for several colpodellids, allows for new genome-scale comparisons across a rich landscape of apicomplexans and other alveolates. Genome annotations can now be used to help interpret fine ultrastructure and cell biology, and guide new studies to describe a variety of alveolate life strategies, such as symbiosis or free living, predation, and obligate intracellular parasitism, as well to provide foundations to dissect the evolutionary transitions between these niches. This review focuses on the attempt to identify extracellular proteins which might mediate the physical interface of cell–cell interactions within the above life strategies, aided by annotation of the repertoires of predicted surface and secreted proteins encoded within alveolate genomes. In particular, we discuss what descriptions of the predicted extracellular proteomes reveal regarding a hypothetical last common ancestor of a pre-apicomplexan alveolate – guided by ultrastructure, life strategies and phylogenetic relationships – in an attempt to understand the evolution of obligate parasitism in apicomplexans.

  13. An Agar-Based Method for Plating Marine Protozoan Parasites of the Genus Perkinsus.

    Science.gov (United States)

    Cold, Emma R; Freyria, Nastasia J; Martínez Martínez, Joaquín; Fernández Robledo, José A

    2016-01-01

    The genus Perkinsus includes protozoan parasites of mollusks responsible for losses in the aquaculture industry and hampering the recovery of natural shellfish beds worldwide, and they are a key taxon for understanding intracellular parasitism adaptations. The ability to propagate the parasite in liquid media, in the absence of the host, has been crucial for improving understanding of its biology; however, alternative techniques to grow the parasite are needed to explore other basic aspects of the Perkinsus spp. biology. We optimized a DME: Ham's F12-5% FBS- containing solid agar medium for plating Perkinsus marinus. This solid medium supported trophozoite propagation both by binary fission and schizogony. Colonies were visible to the naked eye 17 days after plating. We tested the suitability of this method for several applications, including the following: 1) Subcloning P. marinus isolates: single discrete P. marinus colonies were obtained from DME: Ham's F12-5% FBS- 0.75% agar plates, which could be further propagated in liquid medium; 2) Subcloning engineered Perkinsus mediterraneus MOE[MOE]: GFP by streaking cultures on plates; 3) Chemical susceptibility: Infusing the DME: Ham's F12-5% FBS- 0.75% agar plates with triclosan resulted in inhibition of the parasite propagation in a dose-dependent manner. Altogether, our plating method has the potential for becoming a key tool for investigating diverse aspects of Perkinsus spp. biology, developing new molecular tools, and for biotechnological applications.

  14. An Agar-Based Method for Plating Marine Protozoan Parasites of the Genus Perkinsus.

    Directory of Open Access Journals (Sweden)

    Emma R Cold

    Full Text Available The genus Perkinsus includes protozoan parasites of mollusks responsible for losses in the aquaculture industry and hampering the recovery of natural shellfish beds worldwide, and they are a key taxon for understanding intracellular parasitism adaptations. The ability to propagate the parasite in liquid media, in the absence of the host, has been crucial for improving understanding of its biology; however, alternative techniques to grow the parasite are needed to explore other basic aspects of the Perkinsus spp. biology. We optimized a DME: Ham's F12-5% FBS- containing solid agar medium for plating Perkinsus marinus. This solid medium supported trophozoite propagation both by binary fission and schizogony. Colonies were visible to the naked eye 17 days after plating. We tested the suitability of this method for several applications, including the following: 1 Subcloning P. marinus isolates: single discrete P. marinus colonies were obtained from DME: Ham's F12-5% FBS- 0.75% agar plates, which could be further propagated in liquid medium; 2 Subcloning engineered Perkinsus mediterraneus MOE[MOE]: GFP by streaking cultures on plates; 3 Chemical susceptibility: Infusing the DME: Ham's F12-5% FBS- 0.75% agar plates with triclosan resulted in inhibition of the parasite propagation in a dose-dependent manner. Altogether, our plating method has the potential for becoming a key tool for investigating diverse aspects of Perkinsus spp. biology, developing new molecular tools, and for biotechnological applications.

  15. Comparison of protein expression profiles between three Perkinsus spp., protozoan parasites of molluscs, through 2D electrophoresis and mass spectrometry.

    Science.gov (United States)

    Fernández-Boo, S; Chicano-Gálvez, E; Alhama, J; Barea, J L; Villalba, A; Cao, A

    2014-05-01

    The genus Perkinsus includes protozoan parasites of a wide range of marine molluscs worldwide, some of which have been responsible for heavy mollusc mortalities and dramatic economic losses. This study was performed with the aim of increasing the knowledge of Perkinsus spp. proteome. Proteins extracted from in vitro cultured cells of three species of this genus, P. marinus, P. olseni and P. chesapeaki, were analysed using 2D electrophoresis. Four gels from each species were produced. Qualitative and quantitative comparisons among gels were performed with Proteamweaver software. Cluster analysis grouped the four gels of each Perkinsus sp.; furthermore, P. marinus and P. olseni gels were grouped in a cluster different from P. chesapeaki. Around 2000 spots of each species were considered, from which 213 spots were common to the 3 species; P. chesapeaki and P. marinus shared 310 spots, P. chesapeaki and P. olseni shared 315 spots and P. marinus and P. olseni shared 242 spots. A number of spots were exclusive of each Perkinsus species: 1161 spots were exclusive of P. chesapeaki, 1124 of P. olseni and 895 of P. marinus. A total of 84 spots, including common and species-specific ones, were excised from the gels and analysed using MALDI-TOF and nESI-IT (MS/MS) techniques. Forty-two spots were successfully sequenced, from which 28 were annotated, most of them clustered into electron transport, oxidative stress and detoxification, protein synthesis, carbohydrate metabolism, signal transduction, metabolic process and proteolysis. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Two Perkinsus spp. infect Crassostrea gasar oysters from cultured and wild populations of the Rio São Francisco estuary, Sergipe, northeastern Brazil.

    Science.gov (United States)

    da Silva, Patricia Mirella; Scardua, Marcos Paiva; Vianna, Rogério Tubino; Mendonça, Raoani Cruz; Vieira, Cairé Barreto; Dungan, Christopher F; Scott, Gail P; Reece, Kimberly S

    2014-06-01

    Brazilian production of bivalve molluscs is small but expanding, especially in the northeastern region where the native oysters Crassostrea rhizophorae and C. gasar are abundant, and tropical weather promotes their rapid growth. Studies on bivalve pathology are scarce in Brazil, with only a few employing techniques for detecting protozoan pathogens listed by the World Organisation for Animal Health (OIE). In 2008, a Perkinsus sp. was reported for the first time in Brazil, infecting C. rhizophorae oysters from a wild population in Ceará state, NE Brazil. Recently P. marinus was detected in the same oyster species in nearby Paraíba state. These findings highlighted the need to expand knowledge on the presence and impacts of Perkinsus spp. on Brazilian oyster populations. The current investigation evaluated Perkinsus sp. infections among wild and cultured C. gasar mangrove oysters from the estuary of the Rio São Francisco, Sergipe state, NE Brazil. Our results show that Perkinsus sp. infections occurred commonly in oysters of both groups, at prevalences that were frequently higher among cultured oysters. Prevalences varied seasonally, with maximum values during summer (January) of 57% and 80% for wild and cultured oysters respectively, and minimum values during winter (July). Results of DNA sequencing, in situ hybridization assays, and phylogenetic analyses showed dual- and single-pathogen infections by P. marinus and/or P. olseni in the tested oysters. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. [Some parameters of bronchoalveolar lavages in alveolitis].

    Science.gov (United States)

    Makhmudova, S Iu

    2003-01-01

    Eighty nine patients with alveolitis [60 with extrinsic allergic alveolitis (EAA) and 29 with idiopathic fibrosing alveolitis (IFA)] were followed up. Cytological and immunological studies of bronchoalveolar lavage revealed that the patients with EAA had elevated counts of lymphocytes, moderately increased neutrophils and eosinophils, decreased alveolar macrophages, elevated SIgA and T lymphocytes. In the patients with IFA, only higher counts of neutrophils were significant.

  18. Autoantibodies in cryptogenic fibrosing alveolitis

    Directory of Open Access Journals (Sweden)

    du Bois Ron

    2001-02-01

    Full Text Available Abstract The pathogenesis of cryptogenic fibrosing alveolitis (CFA involves injury, an immune/inflammatory response and fibrosis. The cause of the injury is unknown, but the identification of serum autoantibodies makes an autoimmune aetiology attractive. The core study on which this commentary is based used novel cloning and serum screening technologies in order to identify new public and private autoantibodies in sera from 12 patients with CFA. Largely negative conclusions were drawn from that study. However, we suggest that the prevalence of autoantibodies may have been underestimated, that the study was timely and that this approach is worth pursuing further.

  19. Antifibrinolytic prevention of alveolitis sicca dolorosa.

    Science.gov (United States)

    Ritzau, M; Therkildsen, P

    1978-12-01

    In a double-blind study dental cones containing the antifibrinolytically active propylic ester of p-hydroxybenzoic acid (PEPH), sulfanilamide and sulfathiazol or placebo were placed in dental sockets following removal of impacted mandibular third molars on 95 consecutive patients, 50 women and 45 men. The duration of the operation, the type of surgeon, preoperative symptoms and the use of peroral anticonception were recorded. The patients were asked to return to the clinic on the seventh postoperative day, and it was then noted whether the healing was disturbed by Alveolitis Sicca Dolorosa (ASD) or not. Statistical analysis showed a significantly prophylactic effect of PEPH against ASD. The prophylactic effect was most pronounced in the group of male patients without preoperative symptoms and in the group of patients operated by dental students. It could not be demonstrated that the sulfa drugs in the cones were of any benefit to the healing of the socket.

  20. CT-semiotics and clinical aspects of extrinsic allergic alveolitis

    International Nuclear Information System (INIS)

    Skrynnikova, I.P.; Momot, N.V.; Vakulenko, I.P.; Tanasichuk-Gazhieva, N.V

    2003-01-01

    Extrinsic allergic alveolitis can be a difficult diagnostic problem. The comparison of the results of CT research with the clinical immunological and morphological data allowed to define the forms and diagnose the characteristic symptoms of the disease

  1. A photosynthetic alveolate closely related to apicomplexan parasites

    Czech Academy of Sciences Publication Activity Database

    Moore, R. B.; Oborník, Miroslav; Janouškovec, Jan; Chrudimský, Tomáš; Vancová, Marie; Green, D. H.; Wright, S. W.; Davies, N. W.; Bolch, Ch. J. S.; Heimann, K.; Šlapeta, J.; Hoegh-Guldberg, O.; Logsdon, J. M.; Carter, D. A.

    2008-01-01

    Roč. 451, 21-02-2008 (2008), s. 959-963 ISSN 0028-0836 R&D Projects: GA ČR GA206/06/1439 Institutional research plan: CEZ:AV0Z60220518 Keywords : alveolate * photosynthesis * Chromera velia * evolution * Apicomplexa Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.434, year: 2008

  2. COMPARISON OF IN VITRO-CULTURED AND WILD-TYPE PERKINSUS MARINUS. II: DOSING METHODS AND HOST RESPONSE

    Science.gov (United States)

    Endoparasites must breach host barriers to establish infection and then must survive host internal defenses to cause disease. Such barriers may frustrate attempts to experimentally transmit parasites by ?natural' methods. In addition, the host's condition may affect a study's out...

  3. Occurrence of Perkinsus olseni in the Venus clam Protothaca jedoensis in Korean waters.

    Science.gov (United States)

    Park, Kyung-Il; Ngo, Thao T T; Choi, Sang-Duk; Cho, Moonjae; Choi, Kwang-Sik

    2006-10-01

    This is the first report of the occurrence of Perkinsus olseni in the Venus clam Protothaca jedoensis off the western and southern coasts of South Korea. Histological observations revealed Perkinsus-like organisms in the mantle, gills, digestive tubules, and gonad. Haemocytic infiltration and tissue necrosis were also observed in heavily infected clams. Hypnospore formation of the Perkinsus-like organism was confirmed with Ray's fluid thioglycollate medium assay (RFTM). When incubated in filtered and aerated seawater, the hypnospore gave rise to cell division and subsequently discharged hundreds of motile zoospores. Genus- and species-specific polymerase chain reaction (PCR) assays and the DNA sequences of the internal transcribed spacer region (ITS) of the Perkinsus sp. isolated from the Venus clam were identical to those of P. olseni reported from the Manila clam Venerupis (=Ruditapes)philippinarum. Based on the DNA sequences and microscopic data, the Perkinsus-like pathogen isolated from P. jedoensis was identified as P. olseni, which parasitizes the Manila clam in European and Asian waters and Haliotis rubra (abalone) in Australian waters. The prevalence and infection intensity of a clam population collected from Yosu, Korea, was determined using RFTM and Choi's 2M NaOH digestion technique. The intensities averaged 10,768 and 7438 Perkinsus cells per gram tissue in 2003 and 2004, and the prevalence ranged from 37.0 to 53.9%, respectively.

  4. STRESS DISTRIBUTION IN THE STRATIFIED MASS CONTAINING VERTICAL ALVEOLE

    Directory of Open Access Journals (Sweden)

    Bobileva Tatiana Nikolaevna

    2017-08-01

    Full Text Available Almost all subsurface rocks used as foundations for various types of structures are stratified. Such heterogeneity may cause specific behaviour of the materials under strain. Differential equations describing the behaviour of such materials contain rapidly fluctuating coefficients, in view of this, solution of such equations is more time-consuming when using today’s computers. The method of asymptotic averaging leads to getting homogeneous medium under study to averaged equations with fixed factors. The present article is concerned with stratified soil mass consisting of pair-wise alternative isotropic elastic layers. In the results of elastic modules averaging, the present soil mass with horizontal rock stratification is simulated by homogeneous transversal-isotropic half-space with isotropy plane perpendicular to the standing axis. Half-space is loosened by a vertical alveole of circular cross-section, and virgin ground is under its own weight. For horizontal parting planes of layers, the following two types of surface conditions are set: ideal contact and backlash without cleavage. For homogeneous transversal-isotropic half-space received with a vertical alveole, the analytical solution of S.G. Lekhnitsky, well known in scientific papers, is used. The author gives expressions for stress components and displacements in soil mass for different marginal conditions on the alveole surface. Such research problems arise when constructing and maintaining buildings and when composite materials are used.

  5. Preparation of alveolate hydrophobic catalyst for tritium waste gas treatment

    International Nuclear Information System (INIS)

    Yang, Yong; Peng, Shuming; Wang, Heyi; Du, Yang; Li, Jiamao

    2016-01-01

    Highlights: • The catalyst is hydrophobic, it will not be poisoned by steam in room air at room temperature which is better than Pt-Al 2 O 3 . • At room temperature, the conversion of low concentration of H2 and tritium gas in room air over the catalyst is high. • The air resistance of catalyst is much lower than graininess Pt-Al 2 O 3 . • It is inorganic and will not burn. - Abstract: To prepare a catalyst for the detritiation of waste gases at high flow rates, a heat-resistant hydrophobic zeolitic molecular sieve coating was synthesized on the surface of alveolate cordierite by hydrothermal processing. The alveolate hydrophobic catalyst prepared from the support was essentially waterproof and not easily poisoned by moisture. At room temperature, the conversion of low concentrations of H 2 in humid air over the catalyst was higher than 95% at different space velocities (0–16,000 h −1 ) and different relative humidities. The reaction rate constant of the oxidation of tritium over alveolate hydrophobic catalyst is 0.182 s −1 at 293.3 K–293.7 K and 59%–60% RH, it is much higher than the catalyst of reference honeycomb catalyst.

  6. Infliximab-associated alveolitis after treatment for severe left-sided ulcerative colitis.

    LENUS (Irish Health Repository)

    Veerappan, Sundaram G

    2012-02-01

    Here we describe a patient with ulcerative colitis who developed alveolitis after infliximab therapy. With earlier case reports of development of alveolitis in rheumatoid arthritis patients after infliximab infusion, the temporal relationship between the infliximab therapy and the development of alveolitis in this case, raises the possibility that the two might be causally related. With an increasing trend towards treating moderate to severely active ulcerative colitis patients with infliximab as a rescue therapy, clinicians should be aware of this potentially serious complication.

  7. A novel monoclonal Perkinsus chesapeaki in vitro isolate from an Australian cockle, Anadara trapezia.

    Science.gov (United States)

    Reece, Kimberly S; Scott, Gail P; Dang, Cécile; Dungan, Christopher F

    2017-09-01

    A monoclonal Perkinsus chesapeaki isolate was established from 1 of 10 infected Australian Anadara trapezia cockles. Morphological features were similar to those of described P. chesapeaki isolates, and also included a unique vermiform schizont cell-type. Perkinsus olseni-specific PCR primers amplified DNAs from all 10 cockles. Perkinsus chesapeaki-specific primers also amplified DNAs from 4/10 cockles, including DNA from the isolate source cockle. Three different sets of DNA sequences from the monoclonal isolate grouped with the homologous, previously deposited, P. chesapeaki sequences in phylogenetic analyses. In situ hybridization assays detected both P. chesapeaki and P. olseni cells in histological sections from the source cockle for monoclonal isolate ATCC PRA-425. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Alveolitis seca: una revisión de la literatura

    OpenAIRE

    Vergara Buenaventura, Andrea

    2014-01-01

    La alveolitis seca es la complicación posoperatoria más frecuente como resultado de la alteración en la cicatrización de la herida alveolar después de una extracción dental. El manejo de esta afección tiene por objetivo el control del dolor durante el periodo de curación del cuadro, lo cual se logra fundamentalmente mediante medidas paliativas. El objetivo de esta revisión de la literatura es obtener suficiente información sobre las causas y otros factores que podrían estar involucrados en...

  9. The diagnostic importance of the bronchoalveolar lavage in lymphocytic alveolitis.

    Science.gov (United States)

    Mlika, Mona; Kria, Nourane; Braham, Emna; Chebbi, Chokri; El Mezni, Faouzi

    2017-01-01

    Multidisciplinary concertation is mandatory in order to assess interstitial pneumonias. The study of the bronchoalveolar lavage helps evoking a diagnosis according to the lavage profile. In lymphocytic alveolitis, immunocytochemistry, or in flux cytometry are necessary in order to identify the different clusters of lymphocytes implicated. Our objective was to evaluate the profile of 31 lymphocytic alveolitis using 2 different techniques which are the immunocytochemistry and the in flow cytometry in order to evaluate the efficacy of each technique and to compare the different results to the final diagnoses. We describe a retrospective study about 31 patients admitted to our hospital in order to explore an interstitial pneumonia between January and July 2014. Bronchial endoscopy and bronchoalveolar lavage were performed in all cases. The sensitivity of the in flow cytometry was estimated to 53% and its specificity reached 33%. On the other hand, the immunocytochemistry presented a specificity of 42.8% and a sensitivity of 42.8%. The final diagnoses retained consisted in sarcoidosis in 12 cases, infectious pneumonia in 10 cases, hypersensitivity pneumonia in 3 cases, cryptogenic pneumonia in 3 cases, idiopathic fibrosis in 2 cases, and adenocarcinoma in 1 case. The relevance of both techniques depends on many factors. They necessitate an available material, well-trained technicians, and experimented pathologists.

  10. Cryptogenic fibrosing alveolitis and lung cancer: the BTS study.

    Science.gov (United States)

    Harris, J M; Johnston, I D A; Rudd, R; Taylor, A J Newman; Cullinan, P

    2010-01-01

    The risk of lung cancer is often reported to be increased for patients with cryptogenic fibrosing alveolitis (CFA). Vital status was sought for all 588 members of the British Thoracic Society (BTS) cryptogenic fibrosing alveolitis (CFA) study 11 years after entry to the cohort. Observed deaths due to lung cancer were compared with expected deaths using age-, sex- and period-adjusted national rates. The roles of reported asbestos exposure and smoking were also investigated. 488 cohort members (83%) had died; 46 (9%) were certified to lung cancer (ICD9 162). The standardised mortality ratio (SMR) was 7.4 (95% CI 5.4 to 9.9). Stratified analysis showed increased lung cancer mortality among younger subjects, men and ever smokers. Using an independent expert panel, 25 cohort members (4%) were considered to have at least moderate exposure to asbestos; the risk of lung cancer was increased for these subjects (SMR 13.1 (95% CI 3.6 to 33.6)) vs 7.2 (95% CI 5.2 to 9.7) for those with less or no asbestos exposure). Ever smoking was reported by 448 (73%) of the cohort and was considerably higher in men than in women (92% vs 49%; p<0.001). Most persons who died from lung cancer were male (87%), and all but two (96%) had ever smoked. Ever smokers presented at a younger age (mean 67 vs 70 years; p<0.001) and with less breathlessness (12% smokers reported no breathlessness vs 5% never smokers; p = 0.02). These findings confirm an association between CFA and lung cancer although this relationship may not be causal. The high rate of smoking and evidence that smokers present for medical attention earlier than non-smokers suggest that smoking could be confounding this association.

  11. Thyroid anatomy and topography of toad (Bufo marinus ictericus)

    International Nuclear Information System (INIS)

    Santos, O.R. dos.

    1970-01-01

    The autoradiographic method is used for the study of the toad's thyroid of Bufo marinus ictericus by 131 I. Histolological proceedings are done. Comparative evaluations with bibliographic informations are presented. (M.A.C.) [pt

  12. Development of sea lamprey (Petromyzon marinus) larvicides

    Science.gov (United States)

    Howell, John H.; Lech, John J.; Allen, John L.

    1980-01-01

    Larvicides are used to control sea lamprey (Petromyzon marinus) in the Great Lakes. These larvicides are useful because they are more toxic to sea lamprey than fish species found in the same habitat. The lampricides come from two classes of chemical compounds: (1) halonitrophenols, and (2) halonitrosalicylanilides. Selectivity of the larvicides appears to be based on the differences in the ability of sea lamprey larvae and fishes to detoxify and/or excrete the chemicals. Glucuronide conjugation is an important mechanism for detoxification of these larvicides by fish, and selectivity of larvicides may be due to differences in glucuronyl transferase activity between lamprey and fishes. If more detailed information were available on uptake, metabolism, excretion, and the biochemistry and physiology of lamprey as compared to fishes, it might be possible to design chemicals that would be more selective than those now in use.

  13. New data on Perkinsus mediterraneus in the Balearic Archipelago: locations and affected species.

    Science.gov (United States)

    Valencia, J M; Bassitta, M; Picornell, A; Ramon, C; Castro, J A

    2014-11-13

    Perkinsus mediterraneus, a protozoan parasite that can cause perkinsosis (marine mollusc disease), was first detected in oysters Ostrea edulis from Mahon (Minorca, Balearic Islands, Spain) in 2004. Several years later it was also found in Andratx Harbour (Majorca, Balearic Islands) and in the Gulf of Manfredonia (Adriatic coast of Italy) in oyster populations. Since 2007, Perkinsus surveys have been conducted in different localities and shellfish species in the Balearic Archipelago. In the present work, we found P. mediterraneus in the Balearic Islands infecting oyster and other shellfish species. We describe infection with P. mediterraneus for the first time in Arca noae and Mimachlamys varia. The detection was carried out using Ray's fluid thioglycolate medium (RFTM), histology and polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) methodologies. The internal transcribed spacer (ITS) region (including ITS1, 5.8S and ITS2) of P. mediterraneus ribosomal DNA was sequenced from infected bivalve gills (or from the body in Chamelea gallina) from Balearic Archipelago localities. Twelve haplotypes with a strong genetic similarity between them (97-100%) were observed in our samples. These data were completed with 12 more haplotypes from GenBank sequences. The phylogenetic relationship between Balearic P. mediterraneus haplotypes found in this study, those previously obtained in Mahon Harbour, and the Perkinsus spp. sequences available in GenBank clearly grouped the different Perkinsus spp. in distinct clades supported by strong bootstrap values. Moreover, these analyses detected different P. mediterraneus groups in O. edulis from Minorca Island. No abnormal mortalities or decline in populations were detected during the survey, except for C. gallina, which is also affected by Marteilia refringens.

  14. Bilateral lymphocytic alveolitis: a common reaction after unilateral thoracic irradiation

    International Nuclear Information System (INIS)

    Martin, C.; Romero, S.; Arriero, J.M.; Hernandez, L.; Sanchez-Paya, J.; Massuti, B.

    1999-01-01

    The main aim of the present study was to assess the early diagnostic value of bronchoalveolar lavage (BAL) in radiation-induced lung injury in patients with breast carcinoma. Twenty-six females receiving postoperative radiotherapy for breast cancer were evaluated before and 0, 15, 30, 60 , and 180 days after radiotherapy. History, physical examination, chest radiographs, and pulmonary function tests were obtained. BAL, including lymphocyte subsets analysis, was limited to the second evaluation after radiotherapy. A group of 21 healthy females were used as control. Findings after radiotherapy in asymptomatic patients were compared with findings in a group of patients with radiation pneumonitis. Irradiated patients showed a significantly (p<0.01) greater percentage (29.5±15.7%) of BAL lymphocytes than controls (6.2±3.3%). No statistical differences existed in BAL findings between the irradiated and unirradiated sides of the chest. Percentages of BAL lymphocytes did not differ significantly between patients who developed subsequent pneumonitis (24.5±13.5%) and those who did not develop pneumonitis (32.8±16.5%). Patients with pneumonitis at the time of BAL had significantly higher (p<0.05) alveolar CD4 subset cells (24.8±10.2%) than asymptomatic patients (15.2±8.9%). Maximal reductions in total lung capacity (p<0.01), and residual volume (p<0.05) occurred 60 days after irradiation. The early lymphocytic alveolitis induced by unilateral thoracic radiotherapy in most patients with breast cancer is always bilateral and does not predict the subsequent development of radiological evidence of pneumonitis. (au)

  15. Bilateral lymphocytic alveolitis: a common reaction after unilateral thoracic irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Martin, C.; Romero, S.; Arriero, J.M.; Hernandez, L. [Hospital General Universitario, Servicios de Neumologia, Alicante (Spain); Sanchez-Paya, J. [Hospital General Universitario, Epidemiologia, Alicante (Spain); Massuti, B. [Hospital General Universitario, Oncologia, Alicante (Spain)

    1999-04-01

    The main aim of the present study was to assess the early diagnostic value of bronchoalveolar lavage (BAL) in radiation-induced lung injury in patients with breast carcinoma. Twenty-six females receiving postoperative radiotherapy for breast cancer were evaluated before and 0, 15, 30, 60 , and 180 days after radiotherapy. History, physical examination, chest radiographs, and pulmonary function tests were obtained. BAL, including lymphocyte subsets analysis, was limited to the second evaluation after radiotherapy. A group of 21 healthy females were used as control. Findings after radiotherapy in asymptomatic patients were compared with findings in a group of patients with radiation pneumonitis. Irradiated patients showed a significantly (p<0.01) greater percentage (29.5{+-}15.7%) of BAL lymphocytes than controls (6.2{+-}3.3%). No statistical differences existed in BAL findings between the irradiated and unirradiated sides of the chest. Percentages of BAL lymphocytes did not differ significantly between patients who developed subsequent pneumonitis (24.5{+-}13.5%) and those who did not develop pneumonitis (32.8{+-}16.5%). Patients with pneumonitis at the time of BAL had significantly higher (p<0.05) alveolar CD4 subset cells (24.8{+-}10.2%) than asymptomatic patients (15.2{+-}8.9%). Maximal reductions in total lung capacity (p<0.01), and residual volume (p<0.05) occurred 60 days after irradiation. The early lymphocytic alveolitis induced by unilateral thoracic radiotherapy in most patients with breast cancer is always bilateral and does not predict the subsequent development of radiological evidence of pneumonitis. (au) 38 refs.

  16. Update of information on perkinsosis in NW Mediterranean coast: Identification of Perkinsus spp. (Protista) in new locations and hosts.

    Science.gov (United States)

    Ramilo, Andrea; Carrasco, Noelia; Reece, Kimberly S; Valencia, José M; Grau, Amalia; Aceituno, Patricia; Rojas, Mauricio; Gairin, Ignasi; Furones, M Dolores; Abollo, Elvira; Villalba, Antonio

    2015-02-01

    This study addressed perkinsosis in commercially important mollusc species in the western Mediterranean area. Perkinsus olseni was found in Santa Gilla Lagoon (Sardinia) infecting Ruditapes decussatus, Cerastoderma glaucum and Venerupis aurea, in Balearic Islands infecting Venus verrucosa and in Delta de l'Ebre (NE Spain) parasitising Ruditapes philippinarum and R. decussatus. Perkinsus mediterraneus was detected infecting Ostrea edulis from the Gulf of Manfredonia (SE Italy) and Alacant (E Spain), V. verrucosa and Arca noae from Balearic Islands and Chlamys varia from Balearic Islands, Alacant and Delta de l'Ebre. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. The behavioural response of adult Petromyzon marinus to damage-released alarm and predator cues

    Science.gov (United States)

    Imre, István; Di Rocco, Richard; Belanger, Cowan; Brown, Grant; Johnson, Nicholas S.

    2014-01-01

    Using semi-natural enclosures, this study investigated (1) whether adult sea lamprey Petromyzon marinus show avoidance of damage-released conspecific cues, damage-released heterospecific cues and predator cues and (2) whether this is a general response to injured heterospecific fishes or a specific response to injured P. marinus. Ten replicate groups of 10 adult P. marinus, separated by sex, were exposed to one of the following nine stimuli: deionized water (control), extracts prepared from adult P. marinus, decayed adult P. marinus (conspecific stimuli), sympatric white sucker Catostomus commersonii, Amazon sailfin catfish Pterygoplichthys pardalis (heterospecific stimuli), 2-phenylethylamine (PEA HCl) solution, northern water snake Nerodia sipedon washing, human saliva (predator cues) and an adult P. marinus extract and human saliva combination (a damage-released conspecific cue and a predator cue). Adult P. marinus showed a significant avoidance response to the adult P. marinus extract as well as to C. commersonii, human saliva, PEA and the adult P. marinus extract and human saliva combination. For mobile P. marinus, the N. sipedon washing induced behaviour consistent with predator inspection. Exposure to the P. pardalis extract did not induce a significant avoidance response during the stimulus release period. Mobile adult female P. marinus showed a stronger avoidance behaviour than mobile adult male P. marinus in response to the adult P. marinus extract and the adult P. marinus extract and human saliva combination. The findings support the continued investigation of natural damage-released alarm cue and predator-based repellents for the behavioural manipulation of P. marinus populations in the Laurentian Great Lakes.

  18. Dento-alveolær kirurgi på børn og unge

    DEFF Research Database (Denmark)

    Grønbæk, Anni Birgitte; Pedersen, Flemming; Haubek, Dorte

    2015-01-01

    Erfaringer med dento-alveolær kirurgi på børn og unge Dento-alveolær kirurgi på børn og unge forudsætter, at det samlede team besidder børnekompetence, dvs. den nødvendige odontologiske indsigt, høj kompetence indenfor kommunikation med børn og forældre samt en positiv holdning til børn og foræld...

  19. Computer tomographic patterns in extrinsic allergic alveolitis - a comparison with conventional radiological findings

    Energy Technology Data Exchange (ETDEWEB)

    Hieckel, H.G.; Mueller, S.; Luening, M.

    1986-10-01

    Seventeen patients with extrinsic allergic alveolitis or bird-fancier's lung were examined by standard radiological techniques and classified after Hapke's classification. In addition, the patients were examined by CT. The CT patterns have been analysed and compared with standard radiological findings. The methodological advantages of CT are discussed. Radiological investigation is of limited value in the diagnosis of extrinsic allergic alveolitis. Conventional radiography remains the standard of initial X-ray examination. In early cases, however, CT may be a valuable addition within the diagnostic strategy of a diagnostic imaging department.

  20. Experimental alveolitis in rats: microbiological, acute phase response and histometric characterization of delayed alveolar healing.

    Science.gov (United States)

    Rodrigues, Moacyr Tadeu Vicente; Cardoso, Camila Lopes; Carvalho, Paulo Sérgio Perri de; Cestari, Tânia Mary; Feres, Magda; Garlet, Gustavo Pompermaier; Ferreira, Osny

    2011-01-01

    The pathogenesis of alveolitis is not well known and therefore experimental situations that mimic some features of this disease should be developed. In this study, the evolution of the experimentally induced infection in rat sockets is characterized, which leads to clinical signs of suppurative alveolitis with remarkable wound healing disturbs. Non-infected (Group I) and experimentally infected sockets in Rattus novergicus (Group II) were histometrically evaluated regarding the kinetics of alveolar healing. In addition, the characterization of the present bacteria in inoculation material and the serum levels of C-reactive protein (CRP) were performed. The detected species were Capnocytophaga ochracea, Fusobacterium nucleatum ss nucleatum, Prevotella melaninogenica, Streptococcus anginosus, Treponema socranskii and Streptococcus sanguis. All experimentally infected rats developed suppurative alveolitis, showing higher levels of CRP in comparison to those non-infected ones. Furthermore, infected rats presented a significant delayed wound healing as measured by the histometric analysis (higher persistent polymorphonuclear infiltrate and lower density of newly formed bone). These findings indicate that rat sockets with experimentally induced infection produced higher levels of serum CRP, showing the potential of disseminated infection and a disturb in the alveolar repair process in an interesting experimental model for alveolitis studies.

  1. A family with extrinsic allergic alveolitis caused by wild city pigeons: A case report

    NARCIS (Netherlands)

    G.J. du Marchie Sarvaas; P.J.F.M. Merkus (Peter); J.C. de Jongste (Johan)

    2000-01-01

    textabstractWe describe a family in which the mother died of unresolved lung disease and whose 5 children, some of whom had previous signs of asthma, were subsequently affected by extrinsic allergic alveolitis caused by contact with wild city pigeon antigens. The children

  2. Incidence and prevalence of cryptogenic fibrosing alveolitis in a Norwegian community

    DEFF Research Database (Denmark)

    von Plessen, C; Grinde, O; Gulsvik, A

    2003-01-01

    This study assesses the incidence and prevalence of cryptogenic fibrosing alveolitis (CFA) in a well-defined and stable Norwegian population of 250,000 inhabitants during a period of 15 years. We conducted a file survey of all patients (n = 376) aged 16 years or older with a clinician's diagnosis...

  3. [Solcoseryl--dental adhesive paste--in the treatment of postextraction alveolitis].

    Science.gov (United States)

    Kryst, L; Kowalik, S; Bartkowski, S; Henning, G

    1990-06-01

    After a study in three maxillofacial surgery teaching hospital departments the authors evaluated the usefulness of Solcoseryl dental adhesive paste as compared to Apernyl in the treatment of postextraction alveolitis. Solcoseryl paste was found to shorten the healing period by about 50% in comparison with Apernyl.

  4. Alveolitis: Revisión de la literatura y actualización

    Directory of Open Access Journals (Sweden)

    Odalys Martín Reyes

    2001-12-01

    Full Text Available La alveolitis es la complicación más frecuente de la extracción dentaria. Su frecuencia varía del 1 al 4 % y puede llegar del 20 al 30 % en extracciones de terceros molares mandibulares. Se describen algunos factores de riesgo que aumentan su incidencia, aunque se habla de un origen multifactorial. La clínica y los síntomas subjetivos nos permiten su diagnóstico y clasificación. Para tratar las alveolitis se han utilizado localmente distintos productos para inducir la formación del coágulo: antibióticos, anestésicos, analgésicos y antiinflamatorios, asociados o no con corticoides, analgésicos y antibióticos sistémicos. También la medicina natural y tradicional ocupa un lugar importante en el tratamiento de esta urgencia estomatológica, y se destacan terapéuticas como: la apiterapia, la acupuntura y la ozonoterapia, además tecnologías de avanzada como los soft láser.Alveolitis is the most frequent complication of tooth extraction. Its frequency varies from 1 to 4 % and may reach 20 to 30 % in extractions of mandibular third molars. Some risk factors increasing its incidence are described, although reference is made to a multifactorial origin. The clinic and the subjective symptoms allow us to make its diagnosis and to classify it. Different products have been used in the treatment of alveolitis to induce clot formation: antibiotics, anesthesics, analgesics and anti-inflammatories associated or not with corticoids, analgesics and systemic antibiotics. Natural and traditional medicine also play an important role in the treatment of this stomatological emergency and therepeutics such as the apiotherapy, the acupuncture, the ozone therapy and state-of-the art technologies as the soft laser are stressed.

  5. Evaluation and management of alveolitis and interstitial lung disease in scleroderma.

    Science.gov (United States)

    Latsi, Panagiota I; Wells, Athol U

    2003-11-01

    In the fibrosing alveolitis of systemic sclerosis, treatment decisions depend on prognostic evaluation, which continues to excite considerable interest and debate. Advances in the staging of fibrosing alveolitis of systemic sclerosis and recent therapeutic studies are discussed in this review. The decision about whether to start treatment is often the most difficult clinical challenge, because many patients have limited pulmonary fibrosis that will not necessarily progress. The estimation of disease extent (using high-resolution CT) and disease severity (using pulmonary function tests) is pivotal. Factors reducing the threshold for treatment, in addition to severe disease, include evidence of recent deterioration, a short duration of systemic disease, antitopoisomerase antibody positivity, and, in some cases, bronchoalveolar lavage findings (although the role of bronchoalveolar lavage remains contentious). Histologic appearances at surgical biopsy have little prognostic value, with the great majority of patients having nonspecific interstitial pneumonia. Best current initial treatment consists of either oral or intravenous cyclophosphamide, usually administered with low-dose corticosteroid therapy, although the risk of scleroderma renal crisis with low-dose steroid therapy requires further evaluation. Careful prognostic evaluation, including the staging of disease severity and the definition of longitudinal disease behavior (by serial imaging and pulmonary function tests), is central to the formulation of a logical management plan in fibrosing alveolitis of systemic sclerosis. Cyclophosphamide, the best initial treatment currently, is associated with significant toxicity, justifying therapeutic studies of other immunosuppressive agents and a wide range of anticytokine and antifibrotic agents.

  6. 4 and 6 interleukin's action in the pathogenesis of periodontitis, gingivitis and dental alveolitis.

    Science.gov (United States)

    Berezniakova, Alla I; Cheremisina, Valentуna F

    The paper presents the results of studying the role of interleukins 4 and 6 in the pathogenesis of periodontal tissue diseases, specifically, in periodontitis, gingivitis and alveolitis. To study the nature of participation of IL-4 and IL-6 in the mechanisms of development of periodontitis, gingivitis and alveolitis. Studies were carried out on 80 nonlinear male rats with a body weight of 200.0 to 220.0 g divided into four groups of 20 animals each. The serum level of cytokines was determined by an enzyme immunoassay on the Multiscane Biotech analyzer using test systems manufactured by Caltag laboratories (USA). Statistical processing of the obtained digital results was processed with the help of the program "Statistica 8.0". Indicators of the reliability of changes between the control and intact groups also used the Student's test and the Excel program. The confidence level was taken at p gingivitis, where it decreased by 74% and its level became less with alveolitis and periodontitis, since in these diseases the level of IL-6 was practically the same from the control (p gingivitis, on the contrary, indicates the realization of a pathological reaction of the organism. The change in the levels of pro- and anti-inflammatory interleukins, especially with gingivitis, indicates a decrease in the body's adaptive reserves and may affect the further dynamics of the inflammatory process in the periodontal tissues.

  7. De rode jonker : De eeuw van Marinus van der Goes van Naters (1900-2005)

    NARCIS (Netherlands)

    Mreijen, Anne-Marie Francine

    2018-01-01

    Marinus van der Goes van Naters (1900-2005). A Biography The history of the twentieth century is reflected in the life of the Dutch politician and lawyer Marinus (‘Dup’) van der Goes of Naters, also known as the ‘Red Squire’. He was a flamboyant and idiosyncratic politician, who during his lifetime

  8. Description of Colponema vietnamica sp.n. and Acavomonas peruviana n. gen. n. sp., two new alveolate phyla (Colponemidia nom. nov. and Acavomonidia nom. nov. and their contributions to reconstructing the ancestral state of alveolates and eukaryotes.

    Directory of Open Access Journals (Sweden)

    Denis V Tikhonenkov

    Full Text Available The evolutionary and ecological importance of predatory flagellates are too often overlooked. This is not only a gap in our understanding of microbial diversity, but also impacts how we interpret their better-studied relatives. A prime example of these problems is found in the alveolates. All well-studied species belong to three large clades (apicomplexans, dinoflagellates, and ciliates, but the predatory colponemid flagellates are also alveolates that are rare in nature and seldom cultured, but potentially important to our understanding of alveolate evolution. Recently we reported the first cultivation and molecular analysis of several colponemid-like organisms representing two novel clades in molecular trees. Here we provide ultrastructural analysis and formal species descriptions for both new species, Colponema vietnamica n. sp. and Acavomonas peruviana n. gen. n. sp. Morphological and feeding characteristics concur with molecular data that both species are distinct members of alveolates, with Acavomonas lacking the longitudinal phagocytotic groove, a defining feature of Colponema. Based on ultrastructure and molecular phylogenies, which both provide concrete rationale for a taxonomic reclassification of Alveolata, we establish the new phyla Colponemidia nom. nov. for the genus Colponema and its close relatives, and Acavomonidia nom. nov. for the genus Acavomonas and its close relatives. The morphological data presented here suggests that colponemids are central to our understanding of early alveolate evolution, and suggest they also retain features of the common ancestor of all eukaryotes.

  9. Commuter exposure to inhalable, thoracic and alveolic particles in various transportation modes in Delhi.

    Science.gov (United States)

    Kumar, Pramod; Gupta, N C

    2016-01-15

    A public health concern is to understand the linkages between specific pollution sources and adverse health impacts. Commuting can be viewed as one of the significant-exposure activity in high-vehicle density areas. This paper investigates the commuter exposure to inhalable, thoracic and alveolic particles in various transportation modes in Delhi, India. Air pollution levels are significantly contributed by automobile exhaust and also in-vehicle exposure can be higher sometime than ambient levels. Motorcycle, auto rickshaw, car and bus were selected to study particles concentration along two routes in Delhi between Kashmere Gate and Dwarka. The bus and auto rickshaw were running on compressed natural gas (CNG) while the car and motorcycle were operated on gasoline fuel. Aerosol spectrometer was employed to measure inhalable, thoracic and alveolic particles during morning and evening rush hours for five weekdays. From the study, we observed that the concentration levels of these particles were greatly influenced by transportation modes. Concentrations of inhalable particles were found higher during morning in auto rickshaw (332.81 ± 90.97 μg/m(3)) while the commuter of bus exhibited higher exposure of thoracic particles (292.23 ± 110.45 μg/m(3)) and car commuters were exposed to maximum concentrations of alveolic particles (222.37 ± 26.56 μg/m(3)). We observed that in evening car commuters experienced maximum concentrations of all sizes of particles among the four commuting modes. Interestingly, motorcycle commuters were exposed to lower levels of inhalable and thoracic particles during morning and evening hours as compared to other modes of transport. The mean values were found greater than the median values for all the modes of transport suggesting that positive skewed distributions are characteristics of naturally occurring phenomenon. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Aplicación de la ozonoterapia en el tratamiento de la alveolitis

    Directory of Open Access Journals (Sweden)

    OLGA CRUZ GUERRA

    1997-06-01

    Full Text Available La etiología de la alveolitis es desconocida, pero existen factores que aumentan su incidencia como los traumatismos, las infecciones, la disminución del suministro vascular del hueso circunvecino y el estado sistémico general. En un grupo de pacientes se utilizó aceite de girasol ozonizado, Oleozon (como único medicamento, en el tratamiento de la alveolitis, y se comparó con un grupo control en el que se empleó Alvogil, además de antibiótico oral. La muestra fue de 100 pacientes adultos distribuidos aleatoriamente. Se realizaron curas cada 72 horas y tantas visitas a consulta como el caso lo requiriera. El criterio de curación tomado en cuenta fue la formación de tejido de cicatrización y la disminución o eliminación del dolor. Se alcanzó el 46 % de pacientes curados con Oleozon y el 41 % con Alvogil, sin diferencias significativas entre ambos grupos. El mayor número de pacientes necesitó de 2 a 3 visitas a consulta en los 2 grupos, aunque se observó que había un mayor número de pacientes en el grupo tratado con aceite ozonizado, con diferencias significativas (p=0,004 con respecto al grupo control. No se observó intolerancia al Oleozon.The etiology of alveolitis is unknown but there are some factors increasing its incidence, such as: traumatisms, infections, the reduction of the vascular supply of the circunjacent bone and the general systemic status. Ozonized sunflower oil was used as the only drug to treat alveolitis in a group of patients, and a comparison was made with a control group in which Alvogil eas used in addition to an oral antibiotic. The sample was composed of 100 adult patients distributed at random. Cures were made every 72 hours, and there were as many visits to the dentist's office as it was required. The cure criterion taken into consideration was the formation of cicatrization tissue and the reduction or erradication of pain. 46 % of the patients were cured with Oleozon and 41 % with Alvogil. There

  11. Perkinsus olseni and P. chesapeaki detected in a survey of perkinsosis of various clam species in Galicia (NW Spain) using PCR-DGGE as a screening tool.

    Science.gov (United States)

    Ramilo, Andrea; Pintado, José; Villalba, Antonio; Abollo, Elvira

    2016-01-01

    A survey on perkinsosis was performed involving 15 locations scattered along the Galician coast (NW Spain) and four clam species with high market value (Ruditapes decussatus, Ruditapes philippinarum, Venerupis corrugata and Polititapes rhomboides). The prevalence of Perkinsus parasites was estimated by PCR using genus-specific primers. The highest percentage of PCR-positive cases for perkinsosis corresponded to clams R. decussatus and V. corrugata, while lower values were detected in R. philippinarum and no case was found in P. rhomboides. The discrimination of Perkinsus species was performed by PCR-RFLP and by a new PCR-DGGE method developed in this study. Perkinsus olseni was identified in every clam species, except in P. rhomboides, using both PCR-DGGE and PCR-RFLP. Additionally, Perkinsus chesapeaki was only detected by PCR-DGGE infecting two Manila clams R. philippinarum from the same location, reporting the first case in Galicia. P. chesapeaki identification was further confirmed by in situ hybridisation assay and phylogenetic analysis of ITS region and LSU rDNA. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Critical threshold size for overwintering sandeels (Ammodytes marinus)

    DEFF Research Database (Denmark)

    Deurs, Mikael van; Hartvig, Martin; Steffensen, John Fleng

    2011-01-01

    . In the present study, we estimated the energetic cost of overwintering from a bioenergetic model. The model was parameterised using respirometry-based measurements of standard metabolic rate in buried A. tobianus (a close relative to A. marinus) at temperatures from 5.3 to 18.3C and validated with two...... scales with body size and increases with temperature, and the two factors together determine a critical threshold size for passive overwintering below which the organism is unlikely to survive without feeding. This is because the energetic cost of metabolism exceeds maximum energy reserves......Several ecologically and commercially important fish species spend the winter in a state of minimum feeding activity and at lower risk of predation. To enable this overwintering behaviour, energetic reserves are generated prior to winter to support winter metabolism. Maintenance metabolism in fish...

  13. Incidence and prevalence of cryptogenic fibrosing alveolitis in a Norwegian community

    DEFF Research Database (Denmark)

    von Plessen, C; Grinde, O; Gulsvik, A

    2003-01-01

    This study assesses the incidence and prevalence of cryptogenic fibrosing alveolitis (CFA) in a well-defined and stable Norwegian population of 250,000 inhabitants during a period of 15 years. We conducted a file survey of all patients (n = 376) aged 16 years or older with a clinician's diagnosis...... of pulmonary fibrosis (ICD 8: 517 and ICD 9: 515 and 516). Cases with a history of exposure to fibrogenic agents or with collagen vascular disease were excluded and the remaining 158 cases were defined as CFA. The average annual incidence of hospitalised CFA was 4.3 per 100,000. No change was observed...... with age were also found when the diagnosis of CFA was exclusively based on cases with hospital file records of breathlessness, bilateral crackles and bilateral shadows on chest radiograph....

  14. CHANGES IN LUNG FUNCTION IN THE TREATMENT OF PATIENTS WITH EXOGENOUS ALLERGIC ALVEOLITIS

    Directory of Open Access Journals (Sweden)

    V. B. Nefedov

    2014-01-01

    Full Text Available Total lung capacity (TLC, lung capacity (LC, forced LC (FLC, intrathoracic volume (ITV, pulmonary residual volume (PRV, forced expiratory volume in one second (FEV1 , (FEV1 /LC%, peak expiratory flow (PEF, maximum expiratory flow rate (MEFR25, MEFR50, MEFR75, Raw, Rin, Rex, DLCO-SB, DLCO-SB/VА, РаО2 , and РаСО2 were determined in 43 patients with exogenous allergic alveolitis (EAA before, during, and after treatment with glucocorticosteroids, hemapheresis, ambroxol, and fluimucil. Lung function became better in more than half (53.5% of the patients and worse in one fourth (25.6%; a combination of positive and negative functional changes was detected in 14.0%. Improved lung function was noted in 75.0, 50.0, and 38.5% of the patients with acute, subacute, and chronic EAA, respectively. Deterioration of lung function was determined in 46.2, 22.2, and 8.3% of the patients with chronic, subacute, and acute alveolitis, respectively. Better lung function manifested itself mainly as positive changes in lung volumes and capacities and pulmonary gas exchange function, less frequently as improved bronchial patency in the patients with acute and subacute EAA whereas the rate of positive functional changes in lung volumes and capacities, bronchial patency, and pulmonary gas exchange function was equal in those with chronic EAA. Poorer lung function appeared as negative changes in lung volumes and capacities in the patients with acute EAA, as worse pulmonary gas exchange function and negative changes in lung volumes and capacities and deteriorated bronchial patency in those with subacute and chronic EAA.

  15. Evaluating potential artefacts of photo-reversal on behavioral studies with nocturnal invasive sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Barnett, Matthew; Imre, Istvan; Wagner, Michael C.; Di Rocco, Richard T.; Johnson, Nicholas; Brown, Grant E.

    2016-01-01

    Sea lampreys (Petromyzon marinus L., 1758) are nocturnal, so experiments evaluating their behaviour to chemosensory cues have typically been conducted at night. However, given the brief timeframe each year that adult P. marinus are available for experimentation, we investigated whether P. marinus exposed to a 12 h shifted diurnal cycle (reversed photoperiod) could be tested in a darkened arena during the day and show the same response to chemosensory cues as natural photoperiod P. marinus that were tested during the night. Ten replicates of 10 P. marinus, from each photoperiod, were exposed to deionized water (negative control), 2-phenylethylamine hydrochloride (PEA HCl, putative predator cue), or P. marinus whole-body extract (conspecific alarm cue). All P. marinus demonstrated a significant avoidance response to both cues. No significant differences were found in avoidance to PEA HCl between photoperiods. Avoidance of P. marinus whole-body extract was significantly stronger in natural compared with reversed photoperiod P. marinus. The use of reversed photoperiod subjects is suitable for examining the presence or absence of avoidance in response to novel chemosensory alarm cues, or the change in the magnitude of antipredator response. Studies investigating the natural magnitude of antipredator response should use natural photoperiod experimental subjects.

  16. Consumption and feeding preference of Echinogammarus marinus on two different algae: Fucus vesiculosus and Ulva intestinalis

    Science.gov (United States)

    Martins, Irene; Leite, Nuno; Constantino, Emanuel

    2014-01-01

    Echinogammarus marinus constitutes the most abundant amphipod species in Fucus spp. assemblages from many North Atlantic estuaries. However, there are some doubts about the real use of fucoids by the amphipod. Whilst some studies report the ingestion of Fucus vesiculosus by E. marinus, others suggest that the amphipod preference for fucoids is mostly related to sheltering rather than feeding, due to the high phlorotannin content of brown algae. The purpose of the present work was to disentangle this issue by checking the consumption rate and feeding preference of E. marinus on F. vesiculosus, its preferential habitat, and on Ulva intestinalis, a green algae abundant in the Mondego estuary (Western Coast of Portugal) and usually considered as highly palatable for herbivores. In a 2-stage laboratorial setup, fresh disks of the two types of algae were offered to E. marinus for three days. Consumption rates were estimated from differences between algal and animal initial and final fresh weights using a control correction factor, while preference was tested by differences in algal consumption rates when no choice was offered (stage 1) and when the two algae were offered simultaneously (stage 2). Results showed that E. marinus effectively consumed fresh F. vesiculosus in much higher amounts than U. intestinalis and significantly preferred to consume F. vesiculosus over U. intestinalis. Therefore, feeding habits must be one of the factors related to the close association of the amphipod with F. vesiculosus, although other factors may also be involved (e.g. sheltering).

  17. Mercury accumulation in sea lamprey (Petromyzon marinus) from Lake Huron

    Science.gov (United States)

    Madenjian, Charles P.; Johnson, Nicholas S.; Siefkes, Michael J.; Dettmers, John M.; Blum, Joel D.; Johnson, Marcus W.

    2014-01-01

    We determined whole-fish total mercury (Hg) concentrations of 40 male and 40 female adult sea lampreys (Petromyzon marinus) captured in the Cheboygan River, a tributary to Lake Huron, during May 2011. In addition, bioenergetics modeling was used to explore the effects of sex-related differences in activity and resting (standard) metabolic rate (SMR) on mercury accumulation. The grand mean for Hg concentrations was 519 ng/g (standard error of the mean = 46 ng/g). On average, males were 16% higher in Hg concentration than females. Bioenergetics modeling results indicated that 14% higher activity and SMR in males would account for this observed sex difference in Hg concentrations. We concluded that the higher Hg concentration in males was most likely due to higher rate of energy expenditure in males, stemming from greater activity and SMR. Our findings have implications for estimating the effects of sea lamprey populations on mercury cycling within ecosystems, as well as for the proposed opening of sea lamprey fisheries. Eventually, our results may prove useful in improving control of sea lamprey, a pest responsible for substantial damage to fisheries in lakes where it is not native.

  18. CFD Simulation and Experimental Validation of Fluid Flow and Particle Transport in a Model of Alveolated Airways.

    Science.gov (United States)

    Ma, Baoshun; Ruwet, Vincent; Corieri, Patricia; Theunissen, Raf; Riethmuller, Michel; Darquenne, Chantal

    2009-05-01

    Accurate modeling of air flow and aerosol transport in the alveolated airways is essential for quantitative predictions of pulmonary aerosol deposition. However, experimental validation of such modeling studies has been scarce. The objective of this study is to validate CFD predictions of flow field and particle trajectory with experiments within a scaled-up model of alveolated airways. Steady flow (Re = 0.13) of silicone oil was captured by particle image velocimetry (PIV), and the trajectories of 0.5 mm and 1.2 mm spherical iron beads (representing 0.7 to 14.6 mum aerosol in vivo) were obtained by particle tracking velocimetry (PTV). At twelve selected cross sections, the velocity profiles obtained by CFD matched well with those by PIV (within 1.7% on average). The CFD predicted trajectories also matched well with PTV experiments. These results showed that air flow and aerosol transport in models of human alveolated airways can be simulated by CFD techniques with reasonable accuracy.

  19. Traction bronchiectasis in cryptogenic fibrosing alveolitis: associated computed tomographic features and physiological significance

    Energy Technology Data Exchange (ETDEWEB)

    Desai, Sujal R. [Department of Radiology, King' s College Hospital, Denmark Hill, SE5 9RS, London (United Kingdom); Wells, Athol U.; Bois, Roland M. du [Interstitial Lung Disease Unit, Royal Brompton Hospital, Emmanuel Kaye Building, Manresa Road, Fulham, SW6 6LR, London (United Kingdom); Rubens, Michael B.; Hansell, David M. [Department of Radiology, Royal Brompton Hospital, Sydney Street, SW3 6NP, London (United Kingdom)

    2003-08-01

    Our objective was to evaluate the associated CT features and physiological consequences of traction bronchiectasis in patients with cryptogenic fibrosing alveolitis (CFA). The CT scans of 212 patients with CFA (158 men, 54 women; mean age 62.2{+-}10.6 years) were evaluated independently by two observers. The extent of fibrosis, the proportions of a reticular pattern and ground-glass opacification and the extent of emphysema were scored at five levels. The predominant CT pattern, coarseness of a reticular pattern and severity of traction bronchiectasis were graded semiquantitatively. Physiological indices were correlated with CT features. There was traction bronchiectasis on CT in 202 of 212 (95%) patients. Increasingly severe traction bronchiectasis was independently associated with increasingly extensive CFA (p<0.0005), a coarser reticular pattern (p<0.001), a lower proportion of ground-glass opacification (p<0.005) and less extensive emphysema (p<0.0005). Increasingly severe traction bronchiectasis was independently related to depression of DL{sub CO} (p<0.005), FVC (p=0.02) and pO{sub 2} (p<0.0005), but not indices of air-flow obstruction. In CFA, traction bronchiectasis increases with more extensive disease, a lower proportion of ground-glass opacification and a coarser reticular pattern, but it decreases with concurrent emphysema. Increasingly severe traction bronchiectasis is associated with additional physiological impairment for a given extent of pulmonary fibrosis and emphysema. (orig.)

  20. The complete genome sequence of Staphylothermus marinus reveals differences in sulfur metabolism among heterotrophic Crenarchaeota

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, iain J.; Dharmarajan, Lakshmi; Rodriguez, Jason; Hooper, Sean; Porat, Iris; Ulrich, Luke E.; Elkins, James G.; Mavromatis, Kostas; Sun, Hui; Land, Miriam; Lapidus, Alla; Lucas, Susan; Barry, Kerrie; Huber, Harald; Zhulin, Igor B.; Whitman, William B.; Mukhopadhyay, Biswarup; Woese, Carl; Bristow, James; Kyrpides, Nikos

    2008-09-05

    Staphylothermus marinus is an anaerobic, sulfur-reducing peptide fermenter of the archaeal phylum Crenarchaeota. It is the third heterotrophic, obligate sulfur reducing crenarchaeote to be sequenced and provides an opportunity for comparative analysis of the three genomes. The 1.57 Mbp genome of the hyperthermophilic crenarchaeote Staphylothermus marinus has been completely sequenced. The main energy generating pathways likely involve 2-oxoacid:ferredoxin oxidoreductases and ADP-forming acetyl-CoA synthases. S. marinus possesses several enzymes not present in other crenarchaeotes including a sodium ion-translocating decarboxylase likely to be involved in amino acid degradation. S. marinus lacks sulfur-reducing enzymes present in the other two sulfur-reducing crenarchaeotes that have been sequenced - Thermofilum pendens and Hyperthermus butylicus. Instead it has three operons similar to the mbh and mbx operons of Pyrococcus furiosus, which may play a role in sulfur reduction and/or hydrogen production. The two marine organisms, S. marinus and H. butylicus, possess more sodium-dependent transporters than T. pendens and use symporters for potassium uptake while T. pendens uses an ATP-dependent potassium transporter. T. pendens has adapted to a nutrient-rich environment while H. butylicus is adapted to a nutrient-poor environment, and S. marinus lies between these two extremes. The three heterotrophic sulfur-reducing crenarchaeotes have adapted to their habitats, terrestrial vs. marine, via their transporter content, and they have also adapted to environments with differing levels of nutrients. Despite the fact that they all use sulfur as an electron acceptor, they are likely to have different pathways for sulfur reduction.

  1. The complete genome sequence of Staphylothermus marinus reveals differences in sulfur metabolism among heterotrophic Crenarchaeota

    Directory of Open Access Journals (Sweden)

    Barry Kerrie

    2009-04-01

    Full Text Available Abstract Background Staphylothermus marinus is an anaerobic, sulfur-reducing peptide fermenter of the archaeal phylum Crenarchaeota. It is the third heterotrophic, obligate sulfur reducing crenarchaeote to be sequenced and provides an opportunity for comparative analysis of the three genomes. Results The 1.57 Mbp genome of the hyperthermophilic crenarchaeote Staphylothermus marinus has been completely sequenced. The main energy generating pathways likely involve 2-oxoacid:ferredoxin oxidoreductases and ADP-forming acetyl-CoA synthases. S. marinus possesses several enzymes not present in other crenarchaeotes including a sodium ion-translocating decarboxylase likely to be involved in amino acid degradation. S. marinus lacks sulfur-reducing enzymes present in the other two sulfur-reducing crenarchaeotes that have been sequenced – Thermofilum pendens and Hyperthermus butylicus. Instead it has three operons similar to the mbh and mbx operons of Pyrococcus furiosus, which may play a role in sulfur reduction and/or hydrogen production. The two marine organisms, S. marinus and H. butylicus, possess more sodium-dependent transporters than T. pendens and use symporters for potassium uptake while T. pendens uses an ATP-dependent potassium transporter. T. pendens has adapted to a nutrient-rich environment while H. butylicus is adapted to a nutrient-poor environment, and S. marinus lies between these two extremes. Conclusion The three heterotrophic sulfur-reducing crenarchaeotes have adapted to their habitats, terrestrial vs. marine, via their transporter content, and they have also adapted to environments with differing levels of nutrients. Despite the fact that they all use sulfur as an electron acceptor, they are likely to have different pathways for sulfur reduction.

  2. Bronchoalveolar lavage fluid cell counts in cryptogenic fibrosing alveolitis and their relation to therapy.

    Science.gov (United States)

    Haslam, P L; Turton, C W; Lukoszek, A; Salsbury, A J; Dewar, A; Collins, J V; Turner-Warwick, M

    1980-01-01

    Bronchoalveolar lavage was used to sample inflammatory cells from the lungs of 51 patients with cryptogenic fibrosing alveolitis (CFA) (24 smokers, 12 ex-smokers, and 15 non-smokers). The smokers with CFA have been compared with 15 smoking control subjects in whom there was no radiographic abnormality or clinical evidence of chronic bronchitis. Significantly lower volumes of lavage fluid were recovered from the smokers with CFA (p < 0.001) and the fluid contained lower percentages of macrophages (p < 0.01), reflecting increased percentages of eosinophils (p < 0.001) and neutrophils (p < 0.01). Similar changes were seen in the ex-smokers and non-smokers. There was also an increase in the percentages of lymphocytes when the whole group of CFA patients was compared with the control subjects (p less than or equal to 0.05). No significant differences were found when patients with "lone" CFA were compared with those having associated systemic disease. The only feature distinguishing smokers from non-smokers with CFA was the presence of pigmented cytoplasmic inclusions in the macrophages from the smokers (p < 0.001). However, there were lower numbers of pigmented macrophages in the smoking CFA patients by comparison with the control subjects suggesting either a change in phagocytic capacity or turnover rate in this disease. Profiles of differential cell counts in individual patients showed that increases of eosinophils over 3% or neutrophils over 4% or both with lymphocyte counts of less than 11% related to a poor clinical response to corticosteroids, but lymphocyte percentages greater than 11% related to improvement (p < 0.05). Images PMID:7434282

  3. [Prevalence of extrinsic allergic alveolitis in cattle breeders from the province of Reggio Emilia].

    Science.gov (United States)

    Ferri, F; Ruggieri, Maria Paola; Guidetti, G; Azzarone, G; Giammartini, Pasquina; Capanni, S; Mantovani, P; Bertani, Marisa

    2003-01-01

    Several new cases of Extrinsic Allergic Alveolitis or Farmer's Lung (FL) in farm workers were reported to Occupational Health Services in the province of Reggio Emilia (Italy). This prompted the Public Health Department to study the prevalence of the disease among milk-cow breeders involved in Parmigiano-Reggiano cheese production: who are the biggest hay users. A suitable questionnaire was sent to 1875 farmers in three of the six districts of the province. Half of them (935: 841 males, 94 females) answered; further contacts and medical history research revealed 33 case of "likely FL". Twenty-three (2 females) (10 "missing"), underwent pulmonary function tests, chest X-rays, precipitins tests against Saccharopolyspora Rectivirgula and other fungal antigens and (22 farmers) bronchoalveolar lavage (BAL). According to the "Società Italiana di Medicina del Lavoro e di Igiene Industriale" diagnostic standards, we found 20 subjects suffering from FL among farmers collecting hay in large cylindrical (round) bales, dried on field (2.6%) and among others still using small (traditional), prismatic bales (0.5%). The prevalence on the whole exposed population (6000-9000 people) was estimated between 1.5% and 3.0% (90-270 people); no difference was found in FL prevalence between flat and hilly or mountain areas; the method of collecting hay in big "round" bales, dried on field, seems to produce higher frequencies of FL cases if compared with the traditional ones (more frequent in mountain areas). The new hay packing methods, using forced air driers, are suggested as a possible solution.

  4. Minimal sulfur requirement for growth and sulfur-dependent metabolism of the hyperthermophilic archaeon Staphylothermus marinus

    Directory of Open Access Journals (Sweden)

    Xiaolei Hao

    2003-01-01

    Full Text Available Staphylothermus marinus is an anaerobic hyperthermophilic archaeon that uses peptides as carbon and energy sources. Elemental sulfur (S° is obligately required for its growth and is reduced to H2S. The metabolic functions and mechanisms of S° reduction were explored by examining S°-dependent growth and activities of key enzymes present in this organism. All three forms of S° tested—sublimed S°, colloidal S° and polysulfide—were used by S. marinus, and no other sulfur-containing compounds could replace S°. Elemental sulfur did not serve as physical support but appeared to function as an electron acceptor. The minimal S° concentration required for optimal growth was 0.05% (w/v. At this concentration, there appeared to be a metabolic transition from H2 production to S° reduction. Some enzymatic activities related to S°-dependent metabolism, including sulfur reductase, hydrogenase, glutamate dehydrogenase and electron transfer activities, were detected in cell-free extracts of S. marinus. These results indicate that S° plays an essential role in the heterotrophic metabolism of S. marinus. Reducing equivalents generated by the oxidation of amino acids from peptidolysis may be transferred to sulfur reductase and hydrogenase, which then catalyze the production of H2S and H2, respectively.

  5. Gene duplication, loss and selection in the evolution of saxitoxin biosynthesis in alveolates.

    Science.gov (United States)

    Murray, Shauna A; Diwan, Rutuja; Orr, Russell J S; Kohli, Gurjeet S; John, Uwe

    2015-11-01

    A group of marine dinoflagellates (Alveolata, Eukaryota), consisting of ∼10 species of the genus Alexandrium, Gymnodinium catenatum and Pyrodinium bahamense, produce the toxin saxitoxin and its analogues (STX), which can accumulate in shellfish, leading to ecosystem and human health impacts. The genes, sxt, putatively involved in STX biosynthesis, have recently been identified, however, the evolution of these genes within dinoflagellates is not clear. There are two reasons for this: uncertainty over the phylogeny of dinoflagellates; and that the sxt genes of many species of Alexandrium and other dinoflagellate genera are not known. Here, we determined the phylogeny of STX-producing and other dinoflagellates based on a concatenated eight-gene alignment. We determined the presence, diversity and phylogeny of sxtA, domains A1 and A4 and sxtG in 52 strains of Alexandrium, and a further 43 species of dinoflagellates and thirteen other alveolates. We confirmed the presence and high sequence conservation of sxtA, domain A4, in 40 strains (35 Alexandrium, 1 Pyrodinium, 4 Gymnodinium) of 8 species of STX-producing dinoflagellates, and absence from non-producing species. We found three paralogs of sxtA, domain A1, and a widespread distribution of sxtA1 in non-STX producing dinoflagellates, indicating duplication events in the evolution of this gene. One paralog, clade 2, of sxtA1 may be particularly related to STX biosynthesis. Similarly, sxtG appears to be generally restricted to STX-producing species, while three amidinotransferase gene paralogs were found in dinoflagellates. We investigated the role of positive (diversifying) selection following duplication in sxtA1 and sxtG, and found negative selection in clades of sxtG and sxtA1, clade 2, suggesting they were functionally constrained. Significant episodic diversifying selection was found in some strains in clade 3 of sxtA1, a clade that may not be involved in STX biosynthesis, indicating pressure for diversification

  6. Prevalencia del protozoario Perkinsus sp. en un cultivo de ostión japonés Crassostrea gigas en Sinaloa, México

    OpenAIRE

    Villanueva-Fonseca,Lizeth Carolina; Escobedo-Bonilla,César Marcial

    2013-01-01

    Crassostrea gigas es un molusco bivalvo de gran importancia comercial. En el noroeste de México su producción es afectada por mortalidades cuyo origen infeccioso no ha sido determinado claramente. En este trabajo se determinó la prevalencia e intensidad de la infección por Perkinsus sp. en un cultivo de C. gigas en el ciclo 2011-2012. El cultivo se hizo en un sistema de línea suspendida con densidades de 28 y 42 ostiones/canasta y se determinó un tamaño de muestra de 30 ostiones por mes. La d...

  7. PAR-2, IL-4R, TGF-beta and TNF-alpha in bronchoalveolar lavage distinguishes extrinsic allergic alveolitis from sarcoidosis

    Czech Academy of Sciences Publication Activity Database

    Matěj, R.; Smětáková, M.; Vašáková, M.; Nováková, J.; Šterclová, M.; Kukal, J.; Olejár, Tomáš

    2014-01-01

    Roč. 8, č. 2 (2014), s. 533-538 ISSN 1792-0981 Institutional support: RVO:67985823 Keywords : sarcoidosis * extrinsic allergic alveolitis * interleukin 4 receptor * transforming growth factor beta * tumor necrosis factor alpha * proteinase activated receptor 2 Subject RIV: EC - Immunology Impact factor: 1.269, year: 2014

  8. Lung inflammation in sarcoidosis: comparison of serum angiotensin-converting enzyme levels with bronchoalveolar lavage and gallium-67 scanning assessment of the T lymphocyte alveolitis

    International Nuclear Information System (INIS)

    Schoenberger, C.I.; Line, B.R.; Keogh, B.A.; Hunninghake, G.W.; Crystal, R.G.

    1982-01-01

    Serum angiotensin-converting enzyme (ACE) is elevated in many patients with pulmonary sarcoidosis and has been proposed as a measure of disease activity. The present study was designed to evaluate the possible relationship between serum ACE and direct measures of the intensity of the alveolitis of pulmonary sarcoidosis as measured by bronchoalveolar lavage and gallium-67 ( 67 Ga) scans. To accomplish this, 64 measurements of serum ACE, lavage T lymphocytes, and lung uptake of 67 Ga were performed in 41 patients with biopsy-proven sarcoidosis. Elevations of serum ACE were found on at least one occasion in 17 patients (41%). However, serum ACE was found to be a poor predictor of the intensity of alveolitis in sarcoidosis as assessed by the quantitation of bronchoalveolar lavage cells that were T lymphocytes and by 67 Ga scanning. Elevated serum ACE did not predict which patients would have elevated proportions of lavage T lymphocytes, which patients would demonstrate increased pulmonary uptake of 67 Ga, or which patients would have high-intensity alveolitis as defined by a combination of these criteria. These observations suggest that while serum ACE may be useful in diagnosing sarcoidosis, it does not reflect accurately the intensity of the alveolitis of the pulmonary component of this disease. (author)

  9. [Pilot-scale purification of lipopeptide from marine-derived Bacillus marinus].

    Science.gov (United States)

    Gu, Kangbo; Guan, Cheng; Xu, Jiahui; Li, Shulan; Luo, Yuanchan; Shen, Guomin; Zhang, Daojing; Li, Yuanguang

    2016-11-25

    This research was aimed at establishing the pilot-scale purification technology of lipopeptide from marine-derived Bacillus marinus. We studied lipopeptide surfactivity interferences on scale-up unit technologies including acid precipitation, methanol extraction, solvent precipitation, salting out, extraction, silica gel column chromatography and HZ806 macroporous absorption resin column chromatography. Then, the unit technologies were combined in a certain order, to remove the impurities gradually, and to gain purified lipopeptide finally, with high recovery rate throughout the whole process. The novel pilot-scale purification technology could effectively isolate and purify lipopeptide with 87.51% to 100% purity in hectograms from 1 ton of Bacillus marinus B-9987 fermentation broth with more than 81.73% recovery rate. The first practical hectogram production of highly purified lipopeptide derived from Bacillus marinus was achieved. With this new purification method, using complex media became possible in fermentation process to reduce the fermentation cost and scale-up the purification for lipopeptide production. For practicability and economy, foaming problem resulting from massive water evaporation was avoided in this technology.

  10. Private specificities can dominate the humoral response to self-antigens in patients with cryptogenic fibrosing alveolitis

    Directory of Open Access Journals (Sweden)

    Lake Richard A

    2001-02-01

    Full Text Available Abstract Background The pathogenetic mechanisms that underlie the interstitial lung disease cryptogenic fibrosing alveolitis (CFA may involve an immunological reaction to unidentified antigens in the lung, resulting in tissue damage. Method In order to identify the range of target autoantigens, we used expression cloning, employing serum from an index patient as the probe against an expressed cDNA library that was derived from a tumour cell line. We screened over 5 × 105 recombinants and obtained sequence information on three antigens that had provoked strong responses with immunoglobulin heavy chain class switching, presumably as a consequence of T-cell recognition. Results All of the antigens were identifiable by comparison with sequence data from the US National Center for Biotechnology Information. Alanyl tRNA synthetase (ATS was picked on six occasions; five of these incidences reflected independent recombination events, indicating that the library was not biased. Antibodies to ATS (anti-PL-12 represent the most common reactivity that defines the antisynthetase syndrome, which is typically expressed as polymyositis, dermatomyositis and interstitial lung disease (ILD. The index patient never showed symptoms other than those associated with alveolitis, even though sera obtained from him over a period of 2 years contained antibodies with the same specificity. Autoantibodies to ATS were never detected in serial bleeds from 11 other patients with CFA, and neither did we detect antibodies to the other two antigens identified from the serum of the index patient. Conclusion The humoral response in patients with CFA can be dominated by autoantibodies with private specificities. This suggests that the antibodies are epiphenomenal and are a secondary feature of tissue damage induced by some other mechanism.

  11. Heterokont predator Develorapax marinus gen. et sp. nov. – a model of the ochrophyte ancestor

    Directory of Open Access Journals (Sweden)

    Vladimir V. Aleoshin

    2016-08-01

    Full Text Available Heterotrophic lineages of Heterokonta (or stramenopiles, in contrast to a single monophyletic group of autotrophs, Ochrophyta, form several clades that independently branch off the heterokont stem lineage. The nearest neighbors of Ochrophyta in the phylogenetic tree appear to be almost exclusively bacterivorous, whereas the hypothesis of plastid acquisition by the ancestors of the ochrophyte lineage suggests an ability to engulf eukaryotic alga. In line with this hypothesis, the heteretrophic predator at the base of the ochrophyte lineage may be regarded as a model for the ochrophyte ancestor. Here we present a new genus and species of marine free-living heterotrophic heterokont Develorapax marinus, which falls into an isolated heterokont cluster, along with the marine flagellate Developayella elegans, and is able to engulf eukaryotic cells. Together with environmental sequences D. marinus and D. elegans form a class-level clade Developea nom. nov. represented by species adapted to different environmental conditions and with a wide geographical distribution. The position of Developea among Heterokonta in large-scale phylogenetic tree is discussed. We propose that members of the Developea clade represent a model for transition from bacterivory to a predatory feeding mode by selection for larger prey. Presumably, such transition in the grazing strategy is possible in the presence of bacterial biofilms, and has likely occured in the ochrophyte ancestor.

  12. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.).

    Science.gov (United States)

    Killorn, E E; Toews, D P

    2001-01-01

    Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Venous return from the posterior region of Bufo marinus was measured under resting conditions and in response to a systemic hypervolemia. Doppler flow probes were positioned on the renal portal and ventral abdominal veins, and flow was recorded as injections of artificial plasma equaling 100% of the animal's plasma volume were administered through the sciatic artery. Resting flow was found to be 5.54 +/- 2.03 ml min(-1) kg(-1) in the paired renal portal veins, and 7.31 +/- 0.89 ml min(-1) kg(-1) in the ventral abdominal vein. While renal portal flow was found to increase by a factor of 2.4 times during the first 10 min of hypervolemia, ventral abdominal flow only increased by a factor of 1.3. Our results quantify the contribution to circulation from posterior venous return in the toad Bufo marinus. A preferential movement of excess fluid through the renal portal pathway was also demonstrated, supporting the possibility of water elimination via the renal portal circulation, especially during periods of high water influx into the animals.

  13. Lupus erythematosus cell phenomenon in pediatric bronchoalveolar lavages: possible manifestation of early radioadaptive response in radiation induced alveolitis.

    Science.gov (United States)

    Zunic, S

    2013-01-01

    A ten-year (December 1992 - December 2002) evaluation of 225 pediatric bronchoalveolar lavage (BAL) differential cell counts showed appearance of the cells corresponding to the cytological entity - lupus erythematosus cell (LEC) in 47 specimens of which not a single case was associated with the coexistent autoimmune disease. There was a significant increase in the percentage of LEC in BAL samples of the examinees during the first 6 months after the bombing of targets in Serbia (July-December 1999) in comparison to the period 1992 to March 24, 1999, and after the bombing of targets in Serbia (2000-2002). Maintaining the character of occurrence of LEC in BAL as nonspecific (Zunic et al. 1996), the devastating power of alpha particles (originated from uranium decay) gives an opportunity to discuss this phenomenon more comprehensibly and perceive a new vista related to the pathogenesis of LEC phenomenon in BAL. Since the period after 1991 corresponds to the time after the first Gulf War, and later the bombing of targets in Bosnia, the possibility of occurrence of LEC in BAL as a manifestation of radiation alveolitis due to contamination by air transferred depleted uranium (DU) particles could not be excluded.

  14. Population dynamics of the Gyrinid beetle Gyrinus marinus Gyll. (Coleoptera, Gyrinidae) with special reference to its dispersal activities

    NARCIS (Netherlands)

    Eijk, van der R.H.

    1987-01-01

    Data concerning reproduction, survival and dispersal of the whirligig water beetle Gyrinus marinus Gyll . were collected between 1974 and 1983 by observations and experiments in the laboratory and in a field area with about 10 populations distributed over 15

  15. Biometría de Bufo marinus (Anura: Bufonidae del refugio nacional de vida silvestre Golfito, Costa Rica (ING

    Directory of Open Access Journals (Sweden)

    Jorge Cabrera Peña

    2016-03-01

    Full Text Available Biometrical analysis of Bufo marinus was carried out in the Golfito National Wildlife Refuge, Golfito, Puntarenas, Costa Rica, between May 1986 and June 1987. Statistical analysis of biometrical parameters indicated that this species has sexual dimorphism and females had greater size and weight.

  16. Biometría de Bufo marinus (Anura: Bufonidae) del refugio nacional de vida silvestre Golfito, Costa Rica

    OpenAIRE

    Cabrera Peña, Jorge; Solano López, Yanaide; Barrantes Barrantes, Rosibel; Rodriguez Ugalde, Daniel

    2016-01-01

    No determinado Biometrical analysis of Bufo marinus was carried out in the Golfito National Wildlife Refuge, Golfito, Puntarenas, Costa Rica, between May 1986 and June 1987. Statistical analysis of biometrical parameters indicated that this species has sexual dimorphism and females had greater size and weight.

  17. Biometría de Bufo marinus (Anura: Bufonidae) del refugio nacional de vida silvestre Golfito, Costa Rica (ING)

    OpenAIRE

    Jorge Cabrera Peña; Yanaide Solano López; Rosibel Barrantes Barrantes; Daniel Rodriguez Ugalde

    2016-01-01

    Biometrical analysis of Bufo marinus was carried out in the Golfito National Wildlife Refuge, Golfito, Puntarenas, Costa Rica, between May 1986 and June 1987. Statistical analysis of biometrical parameters indicated that this species has sexual dimorphism and females had greater size and weight.

  18. Carbon use efficiencies and allocation strategies in Prochlorococcus marinus strain PCC 9511 during nitrogen-limited growth

    Czech Academy of Sciences Publication Activity Database

    Felcmanová, Kristina; Lukeš, Martin; Kotabová, Eva; Lawrenz, Evelyn; Halsey, K.H.; Prášil, Ondřej

    2017-01-01

    Roč. 134, č. 1 (2017), s. 71-82 ISSN 0166-8595 R&D Projects: GA MŠk(CZ) LO1416; GA MŠk(CZ) LH11064 Institutional support: RVO:61388971 Keywords : Prochlorococcus marinus * Cyanobacteria * Primary production Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.864, year: 2016

  19. The influence of sediment type on the distribution of the lesser sandeel, Ammodytes marinus

    DEFF Research Database (Denmark)

    Wright, P.J.; Jensen, Henrik; Tuck, I.

    2000-01-01

    The lesser sandeel Ammodytes marinus (Raitt, 1934) is an important component of the North Sea ecosystem and the subject of the largest single species fishery in this region. However, little is known about the distribution of this species outside the areas where they are fished. This study examines...... between fractions from 2 to 10%. The apparent dislike for fine sediments was examined further by means of sediment choice experiments. These experiments confirmed the importance of the fine particle fraction in limiting distribution and indicated that sandeels would not be expected to inhabit such areas....... Given the constraints of sediment requirements, densities of sandeels in benthic samples appeared to be influenced by water depth. (C) 2000 Elsevier Science B.V. All rights reserved....

  20. Assessments of the lesser sandeel ( Ammodytes marinus ) in the North Sea based on revised stock divisions

    DEFF Research Database (Denmark)

    Pedersen, S.A.; Lewy, Peter; Wright, P.

    1999-01-01

    effort, catch per unit effort, yield, fishing and natural mortality. A better understanding of sandeel growth is important for stock and catch predictions because previous studies indicate that the variability of mean weight-at-age is one of the most important factors influencing the precision......Recent investigations suggest that the current treatment of North Sea sandeel (Ammodytes marinus) as a single unit stock may have little biological basis. In order to study regional effects of the fishery on North Sea lesser sandeel it may therefore be important to assess stock dynamics...... for the different aggregations. Based on a geographical division of the North Sea in a number of proposed assessment regions, regional as well as whole North Sea sandeel assessments are presented based on revised data (e.g, catch in numbers at age and effort). The assessments suggest regional differences in fishing...

  1. Cloning, expression, and characterization of a highly thermostable family 18 chitinase from Rhodothermus marinus.

    Science.gov (United States)

    Hobel, Cédric F V; Hreggvidsson, Gudmundur O; Marteinsson, Viggó T; Bahrani-Mougeot, Farah; Einarsson, Jón M; Kristjánsson, Jakob K

    2005-02-01

    A family 18 chitinase gene chiA from the thermophile Rhodothermus marinus was cloned and expressed in Escherichia coli. The gene consisted of an open reading frame of 1,131 nucleotides encoding a protein of 377 amino acids with a calculated molecular weight of 42,341 Da. The deduced ChiA was a non-modular enzyme with one unique glycoside hydrolase family 18 catalytic domain. The catalytic domain exhibited 43% amino acid identity with Bacillus circulans chitinase C. Due to poor expression of ChiA, a signal peptide-lacking mutant, chiADeltasp, was designed and used subsequently. The optimal temperature and pH for chitinase activity of both ChiA and ChiADeltasp were 70 degrees C and 4.5-5, respectively. The enzyme maintained 100% activity after 16 h incubation at 70 degrees C, with half-lives of 3 h at 90 degrees C and 45 min at 95 degrees C. Results of activity measurements with chromogenic substrates, thin-layer chromatography, and viscosity measurements demonstrated that the chitinase is an endoacting enzyme releasing chitobiose as a major end product, although it acted as an exochitobiohydrolase with chitin oligomers shorter than five residues. The enzyme was fully inhibited by 5 mM HgCl2, but excess ethylenediamine tetraacetic acid relieved completely the inhibition. The enzyme hydrolyzed 73% deacetylated chitosan, offering an attractive alternative for enzymatic production of chitooligosaccharides at high temperature and low pH. Our results show that the R. marinus chitinase is the most thermostable family 18 chitinase isolated from Bacteria so far.

  2. Morphological and functional aspects of the epidermis of the sea lamprey Petromyzon marinus throughout development.

    Science.gov (United States)

    Rodríguez-Alonso, R; Megías, M; Pombal, M A; Molist, P

    2017-07-01

    The development of the epidermis of sea lamprey Petromyzon marinus along the whole life cycle was studied using conventional staining techniques and lectin histochemistry. The epidermis undergoes variations in morphology and thickness throughout development. The simple cuboidal epithelium found in the epidermis of prolarvae becomes stratified cubic in the adult by increasing the number of cell layers. The cuticle thickness undergoes a steady increase during the larval period. There are changes in the glycoconjugate composition of the three main cell types of the P. marinus epidermis, mucous, granular and skein cells, which are more pronounced after metamorphosis. The Alcian blue-periodic acid Schiff (AB-PAS) histochemical method shows the presence of both acidic and neutral glycoconjugates in the mucous cells, indicating their secretory function. Moreover, lectin analysis reveals a mucous secretion containing glycoconjugates such as sulphated glycosaminoglycans (N-acetylglucosamine and N-acetylgalactosamine) and N-glycoproteins rich in mannose. Although granular cells are AB-PAS negative, they exhibit a similar glycoconjugate composition to the mucous cells. Moreover, granular cells show sialic acid positivity in larvae but this monosaccharide residue is not detected after metamorphosis. The skein cells, a unique cell of lampreys, are negative to AB-PAS staining but they mostly contain l-fucose and sialic acid residues, which also disappear after metamorphosis. The function of the granular and skein cells is still unknown but the role of their glycoconjugate composition is discussed. In addition, a different cellular origin is suggested for these two types of cells. © 2017 The Fisheries Society of the British Isles.

  3. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.

    Directory of Open Access Journals (Sweden)

    Toews Daniel P

    2001-10-01

    Full Text Available Abstract Background Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Results Venous return from the posterior region of Bufo marinus was measured under resting conditions and in response to a systemic hypervolemia. Doppler flow probes were positioned on the renal portal and ventral abdominal veins, and flow was recorded as injections of artificial plasma equaling 100% of the animal's plasma volume were administered through the sciatic artery. Resting flow was found to be 5.54 ± 2.03 ml min-1 kg-1 in the paired renal portal veins, and 7.31 ± 0.89 ml min-1 kg-1 in the ventral abdominal vein. While renal portal flow was found to increase by a factor of 2.4 times during the first 10 min of hypervolemia, ventral abdominal flow only increased by a factor of 1.3. Conclusions Our results quantify the contribution to circulation from posterior venous return in the toad Bufo marinus. A preferential movement of excess fluid through the renal portal pathway was also demonstrated, supporting the possibility of water elimination via the renal portal circulation, especially during periods of high water influx into the animals.

  4. Temperature effects on egg development and larval condition in the lesser sandeel, Ammodytes marinus

    Science.gov (United States)

    Régnier, Thomas; Gibb, Fiona M.; Wright, Peter J.

    2018-04-01

    Understanding the influence of temperature on egg development and larval condition in planktonic fish is a prerequisite to understanding the phenological impacts of climate change on marine food-webs. The lesser sandeel, Ammodytes marinus (Raitt 1934), is a key trophic link between zooplankton and many piscivorous fish, sea birds and mammals in the northeast Atlantic. Temperature-egg development relationships were determined for batches of lesser sandeel eggs. Hatching began as early as 19 days post fertilisation at 11 °C and as late as 36 days post fertilisation at 6 °C, which is faster than egg development rates reported for closely related species at the lower end of the tested temperature range. The average size of newly hatched larvae decreased with increasing incubation temperatures in early hatching larvae, but this effect was lost by the middle of the hatching period. While the study revealed important temperature effects on egg development rate, predicted variability based on the range of temperatures eggs experience in the field, suggests it is only a minor contributor to the observed inter-annual variation in hatch date.

  5. Measuring energetics and behaviour using accelerometry in cane toads Bufo marinus.

    Directory of Open Access Journals (Sweden)

    Lewis G Halsey

    Full Text Available Cane toads Bufo marinus were introduced to Australia as a control agent but now have a rapidly progressing invasion front and damage new habitats they enter. Predictive models that can give expansion rates as functions of energy supply and feeding ground distribution could help to maximise control efficiency but to date no study has measured rates of field energy expenditure in an amphibian. In the present study we used the accelerometry technique to generate behavioural time budgets and, through the derivation of ODBA (overall dynamic body acceleration, to obtain estimates of energetics in free ranging cane toads. This represents the first time that accelerometers have been used to not only quantify the behaviour of animals but also assign to those behaviours rates of energy expenditure. Firstly, laboratory calibrations between ODBA and metabolic rate were obtained and used to generate a common prediction equation for the subject toads (R(2 = 0.74. Furthermore, acceleration data recorded during different behaviours was studied to ascertain threshold values for objectively defining behaviour categories. Importantly, while subsequent accelerometer field deployments were relatively short they agreed with previous studies on the proportion of time that cane toads locomote yet suggest that the metabolic rate of cane toads in the wild may sometimes be considerably higher than might be assumed based on data for other species.

  6. Effects of sex pheromones and sexual maturation on locomotor activity in female sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Walaszczyk, Erin J.; Johnson, Nicholas S.; Steibel, Juan Pedro; Li, Weiming

    2013-01-01

    Synchronization of male and female locomotor rhythmicity can play a vital role in ensuring reproductive success. Several physiological and environmental factors alter these locomotor rhythms. As sea lamprey, Petromyzon marinus, progress through their life cycle, their locomotor activity rhythm changes multiple times. The goal of this study was to elucidate the activity patterns of adult female sea lamprey during the sexual maturation process and discern the interactions of these patterns with exposure to male pheromones. During these stages, preovulated and ovulated adult females are exposed to sex pheromone compounds, which are released by spermiated males and attract ovulated females to the nest for spawning. The locomotor behavior of adult females was monitored in a natural stream with a passive integrated tag responder system as they matured, and they were exposed to a sex pheromone treatment (spermiated male washings) or a control (prespermiated male washings). Results showed that, dependent on the hour of day, male sex pheromone compounds reduce total activity (p rhythm in a vertebrate, and they suggest that the interaction between maturity stage and sex pheromone exposure contributes to the differential locomotor rhythms found in adult female sea lamprey. This phenomenon may contribute to the reproductive synchrony of mature adults, thus increasing reproductive success in this species.

  7. PCB concentrations and activity of sea lamprey Petromyzon marinus vary by sex

    Science.gov (United States)

    Madenjian, Charles P.; Johnson, Nicholas S.; Binder, Thomas R.; Rediske, Richard R.; O'Keefe, James P.

    2013-01-01

    We determined the polychlorinated biphenyl (PCB) concentrations of 40 male and 40 female adult sea lampreys Petromyzon marinus captured in the Cheboygan River, a tributary to Lake Huron, during May 2011. In addition, we performed a laboratory experiment using passive integrated transponder tags to determine whether male adult sea lampreys were more active than female adult sea lampreys. Sex had a significant effect on PCB concentration, and PCB concentration at a given level of sea lamprey condition was approximately 25 % greater in males than in females. Adjusting for the difference in condition between the sexes, males averaged a 17 % greater PCB concentration compared with females. Results from the laboratory experiment indicated that males were significantly more active than females. The observed sex difference in PCB concentrations was not due to female sea lampreys releasing eggs at spawning because the sea lamprey is semelparous, and we caught the sea lampreys before spawning. Rather, we attributed the sex difference in PCB concentrations to a greater rate of energy expenditure in males compared with females. We proposed that this greater rate of energy expenditure was likely due to greater activity. Our laboratory experiment results supported this hypothesis. A greater resting metabolic rate may also have contributed to a greater rate of energy expenditure. Our findings should eventually be applicable toward improving control of sea lamprey, a pest responsible for considerable damage to fisheries in lakes where it is not native.

  8. Classification of sea lamprey (Petromyzon marinus) attack marks on Great Lakes lake trout (Salvelinus namaycush)

    Science.gov (United States)

    King, Everett Louis

    1980-01-01

    Criteria for the classification of marks inflicted by sea lamprey (Petromyzon marinus) into nine categories were developed from laboratory studies in an attempt to refine the classification system used in field assessment work. These criteria were based on characteristics of the attachment site that could be identified under field conditions by unaided visual means and by touching the attachment site. Healing of these marks was somewhat variable and was influenced by the size of lamprey, duration of attachment, severity of the wound at lamprey detachment, season and water temperature, and by other less obvious factors. Even under laboratory conditions staging of some wounds was difficult, especially at low water temperatures. If these criteria are to be used effectively and with precision in the field, close examination of individual fish may be required. If the feeding and density of specific year-classes of sea lampreys are to be accurately assessed on an annual basis, close attention to the wound size (as it reflects the size of the lamprey's oral disc) and character of wounds on fish will be required as well as consideration of the season of the year in which they are observed.Key words: sea lamprey, attack marks, lake trout, Great Lakes

  9. A synthesized mating pheromone component increases adult sea lamprey (Petromyzon marinus) trap capture in management scenarios

    Science.gov (United States)

    Johnson, Nicholas S.; Siefkes, Michael J.; Wagner, C. Michael; Dawson, Heather; Wang, Huiyong; Steeves, Todd; Twohey, Michael; Li, Weiming

    2013-01-01

    Application of chemical cues to manipulate adult sea lamprey (Petromyzon marinus) behavior is among the options considered for new sea lamprey control techniques in the Laurentian Great Lakes. A male mating pheromone component, 7a,12a,24-trihydroxy-3-one-5a-cholan-24-sulfate (3kPZS), lures ovulated female sea lamprey upstream into baited traps in experimental contexts with no odorant competition. A critical knowledge gap is whether this single pheromone component influences adult sea lamprey behavior in management contexts containing free-ranging sea lampreys. A solution of 3kPZS to reach a final in-stream concentration of 10-12 mol·L-1 was applied to eight Michigan streams at existing sea lamprey traps over 3 years, and catch rates were compared between paired 3kPZS-baited and unbaited traps. 3kPZS-baited traps captured significantly more sexually immature and mature sea lampreys, and overall yearly trapping efficiency within a stream averaged 10% higher during years when 3kPZS was applied. Video analysis of a trap funnel showed that the likelihood of sea lamprey trap entry after trap encounter was higher when the trap was 3kPZS baited. Our approach serves as a model for the development of similar control tools for sea lamprey and other aquatic invaders.

  10. Daytime avoidance of chemosensory alarm cues by adult sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Di Rocco, Richard; Belanger, Cowan; Imre, István; Brown, Grant; Johnson, Nicholas S.

    2014-01-01

    Sea lamprey (Petromyzon marinus) avoid damage-released and predator chemosensory cues at night, but their response to these cues during the day is unknown. Here, we explored (i) whether sea lamprey avoid these cues during the day and (ii) the effect of water temperature on the avoidance of chemosensory alarm cues in two diurnal laboratory experiments. We hypothesized that daytime activity would be temperature-dependent and that only sea lamprey vulnerable to predation (i.e., not hiding) would behaviourally respond to chemosensory alarm cues. Ten groups of ten sea lamprey were exposed to one of a variety of potential chemosensory cues. The experiments were conducted over a range of temperatures to quantify the effect of temperature on avoidance behaviour. Consistent with our hypothesis, a higher proportion of animals were active during daytime as water temperature increased. Moving sea lamprey showed an avoidance response to 2-phenylethylamine (a compound found in mammalian urine) and human saliva once water temperatures had risen to mean (±SD) = 13.7 (±1.4) °C. Resting and hiding sea lamprey did not show an avoidance response to any of the experimental stimuli.

  11. Comparative studies of bile salts. Bile salts of the lamprey Petromyzon marinus L

    Science.gov (United States)

    Haslewood, G. A. D.; Tökés, L.

    1969-01-01

    1. Bile salts of Petromyzon marinus L. ammocoetes appeared to consist solely or chiefly of a crystalline substance, whose chromatographic and i.r.-spectral characteristics suggested that it was a monosulphate ester of a bile alcohol having the 3α,7α,12α-trihydroxy pattern of substitution in a 5α-steroid nucleus. 2. This substance on cleavage with dioxan–trichloroacetic acid gave petromyzonol, n.m.r. and mass-spectral examination of which suggested the structure 5α-cholane-3α,7α,12α,24-tetrol. 3. 3α,7α,12α-Trihydroxy-5α-cholanoic acid (allocholic acid) from the lizards Anolis lineatopus lineatopus Gray and Cyclura carinata Harlan (family Iguanidae) was esterified with propan-1-ol and reduced by lithium aluminium hydride to 5α-cholane-3α,7α,12α,24-tetrol, identical with petromyzonol. 4. Chromic acid oxidation of petromyzonol sulphate from lamprey bile, followed by acid hydrolysis, gave 24-hydroxy-5α-cholane-3,7,12-trione; hence the sulphate ester group is at C-24. 5. Petromyzonol sulphate is both primitive and unique: a study of its biogenesis might improve our understanding of evolution at the molecular level. PMID:5810077

  12. Guiding out-migrating juvenile sea lamprey (Petromyzon marinus) with pulsed direct current

    Science.gov (United States)

    Johnson, Nicholas S.; Miehls, Scott M.

    2014-01-01

    Non-physical stimuli can deter or guide fish without affecting water flow or navigation and therefore have been investigated to improve fish passage at anthropogenic barriers and to control movement of invasive fish. Upstream fish migration can be blocked or guided without physical structure by electrifying the water, but directional downstream fish guidance with electricity has received little attention. We tested two non-uniform pulsed direct current electric systems, each having different electrode orientations (vertical versus horizontal), to determine their ability to guide out-migrating juvenile sea lamprey (Petromyzon marinus) and rainbow trout (Oncorhynchus mykiss). Both systems guided significantly more juvenile sea lamprey to a specific location in our experimental raceway when activated than when deactivated, but guidance efficiency decreased at the highest water velocities tested. At the electric field setting that effectively guided sea lamprey, rainbow trout were guided by the vertical electrode system, but most were blocked by the horizontal electrode system. Additional research should characterize the response of other species to non-uniform fields of pulsed DC and develop electrode configurations that guide fish over a range of water velocity.

  13. A new clarification method to visualize biliary degeneration during liver metamorphosis in sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Chung-Davidson, Yu-Wen; Davidson, Peter J.; Scott, Anne M.; Walaszczyk, Erin J.; Brant, Cory O.; Buchinger, Tyler; Johnson, Nicholas S.; Li, Weiming

    2014-01-01

    Biliary atresia is a rare disease of infancy, with an estimated 1 in 15,000 frequency in the southeast United States, but more common in East Asian countries, with a reported frequency of 1 in 5,000 in Taiwan. Although much is known about the management of biliary atresia, its pathogenesis is still elusive. The sea lamprey (Petromyzon marinus) provides a unique opportunity to examine the mechanism and progression of biliary degeneration. Sea lamprey develop through three distinct life stages: larval, parasitic, and adult. During the transition from larvae to parasitic juvenile, sea lamprey undergo metamorphosis with dramatic reorganization and remodeling in external morphology and internal organs. In the liver, the entire biliary system is lost, including the gall bladder and the biliary tree. A newly-developed method called “CLARITY” was modified to clarify the entire liver and the junction with the intestine in metamorphic sea lamprey. The process of biliary degeneration was visualized and discerned during sea lamprey metamorphosis by using laser scanning confocal microscopy. This method provides a powerful tool to study biliary atresia in a unique animal model.

  14. Stone-dwelling actinobacteria Blastococcus saxobsidens, Modestobacter marinus and Geodermatophilus obscurus proteogenomes

    KAUST Repository

    Sghaier, Haïtham

    2015-06-30

    The Geodermatophilaceae are unique model systems to study the ability to thrive on or within stones and their proteogenomes (referring to the whole protein arsenal encoded by the genome) could provide important insight into their adaptation mechanisms. Here we report the detailed comparative genome analysis of Blastococcus saxobsidens (Bs), Modestobacter marinus (Mm) and Geodermatophilus obscurus (Go) isolated respectively from the interior and the surface of calcarenite stones and from desert sandy soils. The genome-scale analysis of Bs, Mm and Go illustrates how adaptation to these niches can be achieved through various strategies including ‘molecular tinkering/opportunism’ as shown by the high proportion of lost, duplicated or horizontally transferred genes and ORFans. Using high-throughput discovery proteomics, the three proteomes under unstressed conditions were analyzed, highlighting the most abundant biomarkers and the main protein factors. Proteomic data corroborated previously demonstrated stone-related ecological distribution. For instance, these data showed starvation-inducible, biofilm-related and DNA-protection proteins as signatures of the microbes associated with the interior, surface and outside of stones, respectively.

  15. Hypersensitivity pneumonitis (extrinsic allergic alveolitis): high-resolution computed tomography findings; Pneumonite por hipersensibilidade (alveolite alergica extrinseca): achados na tomografia computadorizada de alta resolucao

    Energy Technology Data Exchange (ETDEWEB)

    Almeida Junior, Jose Guiomar de; Marchiori, Edson [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Faculdade de Ciencias Medicas. Dept. de Radiologia]. E-mail: edmarchiori@zipmail.com.br; Escuissato, Dante L. [Parana Univ., Curitiba, PR (Brazil). Dept. de Radiologia; Souza Junior, Arthur Soares [Faculdade de Medicina de Sao Jose do Rio Preto (FAMERP), SP (Brazil). Dept. de Radiologia; Gasparetto, Emerson L. [Parana Univ., Curitiba, PR (Brazil). Hospital de Clinicas; Nobre, Luiz Felipe [Santa Catarina Univ., Florianopolis, SC (Brazil); Irion, Klaus L. [Santa Casa de Misericordia de Porto Alegre, RS (Brazil). Pavilhao Pereira Filho. Servico de Radiologia

    2003-12-01

    Hypersensitivity pneumonitis, or extrinsic allergic alveolitis, is an immunologic disease of the lungs caused by inhaled chemicals or organics allergens. A lymphocytic inflammatory response in the peripheral airways and surrounding interstitial tissue occurs. In this study the high-resolution computed tomography findings of 13 patients with hypersensitivity pneumonitis were analyzed and discussed. The most frequent high-resolution computed tomography findings were: ground-glass opacities (92.3%), centrilobular nodules (38.4%) and air trapping (38.4%). Other findings included bronchiectasis (23.1%), consolidation (23.1%), crazy paving (7.7%), parenchymal bands (15.4%), linear opacities (7.7%), architectural distortion (7.7%), tracheal dilatation (7.7%), intralobular reticulate (7.7%), honeycombing (7.7%), emphysema (7.7%) and atelectasis (7.7%). In two of the 13 patients there was fibrosis (architectural distortion and honeycombing), which represents the chronic phase of the disease. (author)

  16. Predicting the variation in Echinogammarus marinus at its southernmost limits under global warming scenarios: can the sex-ratio make a difference?

    Science.gov (United States)

    Guerra, Alexandra; Leite, Nuno; Marques, João Carlos; Ford, Alex T; Martins, Irene

    2014-01-01

    Understanding the environmental parameters that constrain the distribution of a species at its latitudinal extremes is critical for predicting how ecosystems react to climate change. Our first aim was to predict the variation in the amphipod populations of Echinogammarus marinus from the southernmost limit of its distribution under global warming scenarios. Our second aim was to test whether sex-ratio fluctuations - a mechanism frequently displayed by amphipods - respond to the variations in populations under altered climate conditions. To achieve these aims, scenarios were run with a validated model of E. marinus populations. Simulations were divided into: phase I - simulation of the effect of climate change on amphipod populations, and phase II - simulation of the effect of climate change on populations with male and female proportions. In both phases, temperature (T), salinity (S) and temperature and salinity (T-S) were tested. Results showed that E. marinus populations are highly sensitive to increases in temperature (>2 °C), which has adverse effects on amphipod recruitment and growth. Results from the climate change scenarios coupled with the sex-ratio fluctuations depended largely on the degree of female bias within population. Temperature increase of 2 °C had less impact on female-biased populations, particularly when conjugated with increases in salinity. Male-biased populations were highly sensitive to any variation in temperature and/or salinity; these populations exhibited a long-term decline in density. Simulations in which temperature increased more than 4 °C led to a continuous decline in the E. marinus population. According to this work, E. marinus populations at their southernmost limit are vulnerable to global warming. We anticipate that in Europe, temperature increases of 2 °C will incite a withdrawal of the population of 5°N from the amphipod species located at southernmost geographical borders. This effect is discussed in relation to the

  17. Pyruvate transport in isolated cardiac mitochondria from two species of amphibian exhibiting dissimilar aerobic scope: Bufo marinus and Rana catesbeiana.

    Science.gov (United States)

    Duerr, Jeffrey M; Tucker, Kristina

    2007-08-01

    Cardiac mitochondria were isolated from Bufo marinus and Rana catesbeiana, two species of amphibian whose cardiovascular systems are adapted to either predominantly aerobic or glycolytic modes of locomotion. Mitochondrial oxidative capacity was compared using VO2 max and respiratory control ratios in the presence of a variety of substrates including pyruvate, lactate, oxaloacetate, beta-hydroxybutyrate, and octanoyl-carnitine. B. marinus cardiac mitochondria exhibited VO2 max values twice that of R. catesbeiana cardiac mitochondria when oxidizing carbohydrate substrates. Pyruvate transport was measured via a radiolabeled-tracer assay in isolated B. marinus and R. catesbeiana cardiac mitochondria. Time-course experiments described both alpha-cyano-4-hydroxycinnamate-sensitive (MCT-like) and phenylsuccinate-sensitive pyruvate uptake mechanisms in both species. Pyruvate uptake by the MCT-like transporter was enhanced in the presence of a pH gradient, whereas the phenylsuccinate-sensitive transporter was inhibited. Notably, anuran cardiac mitochondria exhibited activities of lactate dehydrogenase and pyruvate carboxylase. The presence of both transporters on the inner mitochondrial membrane affords the net uptake of monocarboxylates including pyruvate, beta-hydroxybutyrate, and lactate; the latter potentially indicating the presence of a lactate/pyruvate shuttle allowing oxidation of extramitochondrial NADH. Intramitochondrial lactate dehydrogenase and pyruvate carboxylase enables lactate to be oxidized to pyruvate or converted to anaplerotic oxaloacetate. Kinetics of the MCT-like transporter differed significantly between the two species, suggesting differences in aerobic scope may be in part attributable to differences in mitochondrial carbohydrate utilization. (c) 2007 Wiley-Liss, Inc.

  18. New polymorphic microsatellite markers derived from hemocyte cDNA library of Manila clam Ruditapes philippinarum challenged by the protozoan parasite Perkinsus olseni

    Science.gov (United States)

    Kang, Hyun-Sil; Hong, Hyun-Ki; Park, Kyung-Il; Cho, Moonjae; Youn, Seok-Hyun; Choi, Kwang-Sik

    2017-03-01

    Manila clam Ruditapes philippinarum is one of the most important benthic animals in the coastal north Pacific region, where clam populations have been mixed genetically through trade and aquaculture activities. Accordingly, identification of the genetically different clam populations has become one of the most important issues to manage interbreeding of the local and introduced clam populations. To identify genetically different populations of clam populations, we developed 11 expressed sequence tag (EST)-microsatellite loci (i.e., simple sequence repeat, SSR) from 1,128 clam hemocyte cDNA clones challenged by the protozoan parasite Perkinsus olseni. Genotype analysis using the markers developed in this study demonstrated that clams from a tidal flat on the west coast contained 6 to 19 alleles per locus, and a population from Jeju Island had 4 to 20 alleles per locus. The expected heterozygosity of the 2 clam populations ranged from 0.472 to 0.919 for clams from the west coast, and 0.494 to 0.919 for clams from Jeju Island, respectively. Among the 11 loci discovered in this study, 7 loci significantly deviated from the Hardy-Weinberg equilibrium after Bonferroni correction. The 5 loci developed in this study also successfully amplified the SSRs of R. variegatus, a clam species taxonomically very close to R. philippinarum, from Hong Kong and Jeju Island. We believe that the 11 novel polymorphic SSR developed in this study can be utilized successfully in Manila clam genetic diversity analysis, as well as in genetic discrimination of different clam populations.

  19. Characterization of a novel bile alcohol sulfate released by sexually mature male sea lamprey (Petromyzon marinus.

    Directory of Open Access Journals (Sweden)

    Ke Li

    Full Text Available A sulphate-conjugated bile alcohol, 3,12-diketo-4,6-petromyzonene-24-sulfate (DKPES, was identified using bioassay-guided fractionation from water conditioned with sexually mature male sea lamprey (Petromyzon marinus. The structure and relative stereochemistry of DKPES was established using spectroscopic data. The electro-olfactogram (EOG response threshold of DKPES was 10(-7 Molar (M and that of 3-keto petromyzonol sulfate (3 KPZS; a known component of the male sea lamprey sex pheromone was 10(-10 M. Behavioural studies indicated that DKPES can be detected at low concentrations by attracting sexually mature females to nests when combined with 3 KPZS. Nests baited with a mixture of DKPES and 3 KPZS (ratio 1∶29.8 attracted equal numbers of sexually mature females compared to an adjacent nest baited with 3 KPZS alone. When DKPES and 3 KPZS mixtures were applied at ratios of 2∶29.8 and 10∶29.8, the proportion of sexually mature females that entered baited nests increased to 73% and 70%, respectively. None of the sexually mature females released were attracted to nests baited with DKPES alone. These results indicated that DKPES is a component of the sex pheromone released by sexually mature male sea lamprey, and is the second biologically active compound identified from this pheromone. DKPES represents the first example that a minor component of a vertebrate pheromone can be combined with a major component to elicit critical sexual behaviors. DKPES holds considerable promise for increasing the effectiveness of pheromone-baited trapping as a means of sea lamprey control in the Laurentian Great Lakes.

  20. Moonlight receptor of the '1-h-midge' Clunio marinus studied by micro-XRF

    International Nuclear Information System (INIS)

    Falkenberg, G; Wellenreuther, G; Alraun, P; Fleissner, Ge; Fleissner, Gue; Neumann, D

    2013-01-01

    Melanin is a pigment widely occurring in animals, plants, fungi and algae. It does not only colour skin, hair and eyes but serves mainly as photoprotectant and prevents overload with minerals induced by inflammations, infections and degenerative diseases. Therefore, the mechanisms underlying melanisation gained increasing interest in the field of biomedical research and clinic. So far, the processes of melanogenesis are only partly analysed, nearly nothing is known on a putative switch between melanins of different types. Here we offer a model organism to study these mechanisms as part of a naturally cycling change of transparency of the retinal shielding pigment. A marine midge, Clunio marinus, living in coastal regions, underlies a complex timing of its development by solar and lunar climatic periodicities, which synchronise biological clocks. The question was how the animals can discriminate changing sunlight from moonlight intensities. For the first time, we could show a 'moonlight window' in the larval ocelli of this midge, and propose a hypothesis on the underlying mechanisms. Driven by a lunar clock the image forming ocelli become transparent and convert during moonlit nights to a sensitive photometer, which can record the dynamics of environmental light. High resolution X-ray fluorescence (XRF) measurements of the distribution of trace minerals in single melanosomes combined with their fine structural details in various states of the lunar cycle provide a first insight into the enzymatic pathways for the generation of a dark melanin (like eumelanin) and a light coloured melanin (like phaeomelanin). Essential advantage of this approach is the spatial and temporal resolution of the metals associated with melanisation processes, which could never before be demonstrated in these details. The data may stimulate further research projects in biomedicine

  1. A role for tight junction-associated MARVEL proteins in larval sea lamprey (Petromyzon marinus) osmoregulation.

    Science.gov (United States)

    Kolosov, Dennis; Bui, Phuong; Donini, Andrew; Wilkie, Mike P; Kelly, Scott P

    2017-10-15

    This study reports on tight junction-associated MARVEL proteins of larval sea lamprey ( Petromyzon marinus ) and their potential role in ammocoete osmoregulation. Two occludin isoforms (designated Ocln and Ocln-a) and a tricellulin (Tric) were identified. Transcripts encoding ocln , ocln-a and tric were broadly expressed in larval lamprey, with the greatest abundance of ocln in the gut, liver and kidney, ocln-a in the gill and skin, and tric in the kidney. Ocln and Ocln-a resolved as ∼63 kDa and ∼35 kDa MW proteins, respectively, while Tric resolved as a ∼50 kDa protein. Ocln immunolocalized to the gill vasculature and in gill mucous cells while Ocln-a localized to the gill pouch and gill epithelium. Both Ocln and Ocln-a localized in the nephron, the epidermis and the luminal side of the gut. In branchial tissue, Tric exhibited punctate localization, consistent with its presence at regions of tricellular contact. Following ion-poor water (IPW) acclimation of ammocoetes, serum [Na + ] and [Cl - ] decreased, but not [Ca 2+ ], and carcass moisture content increased. In association, Ocln abundance increased in the skin and kidney, but reduced in the gill of IPW-acclimated ammocoetes while Ocln-a abundance reduced in the kidney only. Tric abundance increased in the gill. Region-specific alterations in ocln , ocln-a and tric mRNA abundance were also observed in the gut. Data support a role for Ocln, Ocln-a and Tric in the osmoregulatory strategies of a basal vertebrate. © 2017. Published by The Company of Biologists Ltd.

  2. Modulation of membrane conductance in rods of Bufo marinus by intracellular calcium ion.

    Science.gov (United States)

    Oakley, B; Pinto, L H

    1983-06-01

    Double-barrel micropipettes were used to pressure-inject EGTA into the outer segments of rods in the isolated retina of Bufo marinus. We used these pipettes to point voltage clamp the cell to its resting membrane voltage during the injection of EGTA in order to prevent changes in membrane voltage from occurring. The input conductance of the rod was assessed by measuring the incremental membrane current required to hyperpolarize the membrane by less than or equal to 10 mV. When the retina was bathed in normal Ringer solution, the injection of EGTA during point voltage clamp evoked an inward membrane current and in increase in input conductance. This observation is consistent with an EGTA-evoked increase in conductance for an ion with an equilibrium potential more depolarized than the resting membrane potential. Injections of control solutions that did not contain EGTA had no effect. The effects of injected EGTA were not altered by variations in the pH or buffering capacity of the injection solution, or by the addition of equimolar Mg2+. Furthermore, injections of a solution containing equimolar Ca2+ and EGTA were without effect. Thus, the observed effects of injected EGTA were due to the lowering of the [Ca2+]i. Replacement of extracellular Na+ with choline+ abolished both the response to light and the EGTA-evoked increase in input conductance. A low [Na+]o solution containing 10(-8) M-Ca2+ reduced the response to injected EGTA by approximately the same amount as it reduced the response to light. Replacement of extracellular Cl- by methanesulphonate was without significant effect on either the response to light or to injected EGTA. These results are consistent with the interpretation that a lowered [Ca2+]i increases primarily the sodium conductance, gNa, of the plasma membrane of the rod outer segment. The conductance that is affected by a lowered [Ca2+]i appears to have the same specificity as the light-dependent conductance. This conclusion is consistent with a

  3. Timing the tides: genetic control of diurnal and lunar emergence times is correlated in the marine midge Clunio marinus.

    Science.gov (United States)

    Kaiser, Tobias S; Neumann, Dietrich; Heckel, David G

    2011-05-20

    The intertidal zone of seacoasts, being affected by the superimposed tidal, diurnal and lunar cycles, is temporally the most complex environment on earth. Many marine organisms exhibit lunar rhythms in reproductive behaviour and some show experimental evidence of endogenous control by a circalunar clock, the molecular and genetic basis of which is unexplored. We examined the genetic control of lunar and diurnal rhythmicity in the marine midge Clunio marinus (Chironomidae, Diptera), a species for which the correct timing of adult emergence is critical in natural populations. We crossed two strains of Clunio marinus that differ in the timing of the diurnal and lunar rhythms of emergence. The phenotype distribution of the segregating backcross progeny indicates polygenic control of the lunar emergence rhythm. Diurnal timing of emergence is also under genetic control, and is influenced by two unlinked genes with major effects. Furthermore, the lunar and diurnal timing of emergence is correlated in the backcross generation. We show that both the lunar emergence time and its correlation to the diurnal emergence time are adaptive for the species in its natural environment. The correlation implies that the unlinked genes affecting lunar timing and the two unlinked genes affecting diurnal timing could be the same, providing an unexpectedly close interaction of the two clocks. Alternatively, the genes could be genetically linked in a two-by-two fashion, suggesting that evolution has shaped the genetic architecture to stabilize adaptive combinations of lunar and diurnal emergence times by tightening linkage. Our results, the first on genetic control of lunar rhythms, offer a new perspective to explore their molecular clockwork.

  4. Morphological recovery in the reattached retina of the toad Bufo marinus: a new experimental model of retinal detachment.

    Science.gov (United States)

    Abdal Monaim, Moustafa; Suleiman, Jiab H; Ashraf, Muhammad

    2005-01-01

    The retinal pigment epithelium (RPE) of the toad (Bufo marinus) has been used in many studies as a model for understanding its role and interaction with the neural retina. The toad's retina has been used to establish a new in vitro model of experimental retinal detachment (RD) and replacement . It has been shown that the electrophysiological measures of retinal function recovered following complete RD. The toad was chosen because its RPE is similar to the mammalian RPE . In this report, light microscopy was used to characterize the morphologic changes that occur in the RPE and neural retina following RD/replacement and to correlate these findings with recovery of electrophysiologic function. Retinas from Bufo marinus were studied in vitro. The neural retina completely detached from the RPE and then replaced. At various times after replacement, neural retina-RPE tissues were processed for light microscopy. At 30 min after replacement, the subretinal space was greatly expanded, and the apical processes that normally ensheath the rod outer segments were short and no longer contacted the rod outer segments. The RPE was swollen, contained many vacuoles and the apical surface was rounded. By 2 h after replacement, the subretinal space was significantly resorbed and contained many shredded rod outer segments; RPE cells were still swollen, although less. During the next 5-10 h, the number of phagosomes in the RPE cytoplasm increased and the number of shredded rod outer segments in the subretinal space decreased. RPE cells regained their normal size and interdigitation of apical processes and rod outer segments were observed. These results demonstrate the re-establishment of morphological interactions between the RPE and neural retina within hours following RD/replacement. Morphological recovery coincides with recovery of electrophysiologic parameters. This is a good model to investigate the retinal pigment epithelium (RPE) and neural retina mechanisms involved in retinal

  5. Ensayo clínico randomizado a doble ciego de evaluación de la efectividad del gel bioadhesivo de clorhexidina al 0.2% en la prevención de alveolitis seca tras la exodoncia de terceros molares inferiores

    OpenAIRE

    Rubio Palau, Josep

    2014-01-01

    La alveolitis seca es una complicación frecuente tras la exodoncia de los terceros molares. Uno de los agentes más estudiados en su prevención es la clorhexidina. El objetivo de este estudio fue evaluar la eficacia del gel bioadhesivo de clorhexidina al 0,2% colocado intra-alveolar en la prevención de la alveolitis seca después de la extracción de los terceros molares mandibulares y analizar el impacto de los factores de riesgo como el tabaquismo y los anticonceptivos orales. El estudio es un...

  6. Patterns of invasion and colonization of the sea lamprey (Petromyzon marinus) in North America as revealed by microsatellite genotypes.

    Science.gov (United States)

    Bryan, M B; Zalinski, D; Filcek, K B; Libants, S; Li, W; Scribner, K T

    2005-10-01

    Invasions by exotic organisms have had devastating affects on aquatic ecosystems, both ecologically and economically. One striking example of a successful invader that has dramatically affected fish community structure in freshwater lakes of North America is the sea lamprey (Petromyzon marinus). We used eight microsatellite loci and multiple analytical techniques to examine competing hypotheses concerning the origins and colonization history of sea lamprey (n = 741). Analyses were based on replicated invasive populations from Lakes Erie, Huron, Michigan, and Superior, populations of unknown origins from Lakes Ontario, Champlain, and Cayuga, and populations of anadromous putative progenitor populations in North America and Europe. Populations in recently colonized lakes were each established by few colonists through a series of genetic bottlenecks which resulted in lower allelic diversity in more recently established populations. The spatial genetic structure of invasive populations differed from that of native populations on the Atlantic coast, reflecting founder events and connectivity of invaded habitats. Anadromous populations were found to be panmictic (theta(P) = 0.002; 95% CI = -0.003-0.006; P > 0.05). In contrast, there was significant genetic differentiation between populations in the lower and upper Great Lakes (theta(P) = 0.007; P colonization of freshwater habitats were examined using coalescent-based analyses, and demonstrated that populations likely originated from natural migrations via the St Lawrence River.

  7. Serinicoccus marinus gen. nov., sp. nov., a novel actinomycete with L-ornithine and L-serine in the peptidoglycan.

    Science.gov (United States)

    Yi, Hana; Schumann, Peter; Sohn, Kyounghee; Chun, Jongsik

    2004-09-01

    A Gram-positive bacterial strain containing L-ornithine as the diagnostic diamino acid was isolated from a sea-water-sample from the East Sea, Korea. A phylogenetic analysis based on 16S rRNA gene sequences showed that strain JC1078T represents a phyletic line within the suborder Micrococcineae of the order Actinomycetales, adjacent to the genus Ornithinimicrobium. The highest sequence similarity values to the isolate were observed against Ornithinimicrobium humiphilum (94.3 %) and Kytococcus sedentarius (94.1 %). The strain was strictly aerobic and moderately halophilic with optimal growth at 2-3 % (w/v) NaCl. Cells were non-motile, non-sporulating and coccoid-shaped. The cell wall contains L-ornithine, glutamic acid, alanine, glycine and serine. The major menaquinone was MK-8(H4). The predominant cellular fatty acids were of the iso- and anteiso-methyl-branched types. The polar lipids were phosphatidylglycerol, diphosphatidylglycerol, phosphatidylinositol and an unknown glycolipid. The acyl type of the glycan chain of peptidoglycan is acetyl. The DNA G + C content was 72 mol%. The combination of physiological, biochemical and chemotaxonomical data clearly separated the marine isolate from other members of the suborder Micrococcineae. On the basis of polyphasic evidence, it is proposed to classify strain JC1078T in a novel genus and species, for which the name Serinicoccus marinus gen. nov., sp. nov. is proposed. The type strain is JC1078T (= IMSNU 14026T = KCTC 9980T = DSM 15273T).

  8. Decomposition of sea lamprey Petromyzon marinus carcasses: temperature effects, nutrient dynamics, and implications for stream food webs

    Science.gov (United States)

    Weaver, Daniel M.; Coghlan, Stephen M.; Zydlewski, Joseph D.; Hogg, Robert S.; Canton, Michael

    2015-01-01

    Anadromous fishes serve as vectors of marine-derived nutrients into freshwaters that are incorporated into aquatic and terrestrial food webs. Pacific salmonines Oncorhynchus spp. exemplify the importance of migratory fish as links between marine and freshwater systems; however, little attention has been given to sea lamprey (Petromyzon marinus Linnaeus, 1758) in Atlantic coastal systems. A first step to understanding the role of sea lamprey in freshwater food webs is to characterize the composition and rate of nutrient inputs. We conducted laboratory and field studies characterizing the elemental composition and the decay rates and subsequent water enriching effects of sea lamprey carcasses. Proximate tissue analysis demonstrated lamprey carcass nitrogen:phosphorus ratios of 20.2:1 (±1.18 SE). In the laboratory, carcass decay resulted in liberation of phosphorus within 1 week and nitrogen within 3 weeks. Nutrient liberation was accelerated at higher temperatures. In a natural stream, carcass decomposition resulted in an exponential decline in biomass, and after 24 days, the proportion of initial biomass remaining was 27% (±3.0% SE). We provide quantitative results as to the temporal dynamics of sea lamprey carcass decomposition and subsequent nutrient liberation. These nutrient subsidies may arrive at a critical time to maximize enrichment of stream food webs.

  9. White sucker Catostomus commersonii respond to conspecific and sea lamprey Petromyzon marinus alarm cues but not potential predator cues

    Science.gov (United States)

    Jordbro, Ethan J.; Di Rocco, Richard T.; Imre, Istvan; Johnson, Nicholas; Brown, Grant E.

    2016-01-01

    Recent studies proposed the use of chemosensory alarm cues to control the distribution of invasive sea lamprey Petromyzon marinus populations in the Laurentian Great Lakes and necessitate the evaluation of sea lamprey chemosensory alarm cues on valuable sympatric species such as white sucker. In two laboratory experiments, 10 replicate groups (10 animals each) of migratory white suckers were exposed to deionized water (control), conspecific whole-body extract, heterospecific whole-body extract (sea lamprey) and two potential predator cues (2-phenylethylamine HCl (PEA HCl) and human saliva) during the day, and exposed to the first four of the above cues at night. White suckers avoided the conspecific and the sea lamprey whole-body extract both during the day and at night to the same extent. Human saliva did not induce avoidance during the day. PEA HCl did not induce avoidance at a higher concentration during the day, or at night at the minimum concentration that was previously shown to induce maximum avoidance by sea lamprey under laboratory conditions. Our findings suggest that human saliva and PEA HCl may be potential species-specific predator cues for sea lamprey.

  10. Behavioural response of adult sea lamprey (Petromyzon marinus) to predator and conspecific alarm cues: evidence of additive effects

    Science.gov (United States)

    Di Rocco, Richard T.; Imre, Istvan; Johnson, Nicholas; Brown, Grant B

    2016-01-01

    Sea lampreys Petromyzon marinus, an invasive pest in the Upper Great Lakes, avoid odours that represent danger in their habitat. These odours include conspecific alarm cues and predator cues, like 2-phenylethylamine hydrochloride (PEA HCl), which is found in the urine of mammalian predators. Whether conspecific alarm cues and predator cues function additively or synergistically when mixed together is unknown. The objectives of this experimental study were to determine if the avoidance response of sea lamprey to PEA HCl is proportional to the concentration delivered, and if the avoidance response to the combination of a predator cue (PEA HCl) and sea lamprey alarm cue is additive. To accomplish the first objective, groups of ten sea lampreys were placed in an artificial stream channel and presented with stepwise concentrations of PEA HCl ranging from 5 × 10−8 to 5 × 10−10 M and a deionized water control. Sea lampreys exhibited an increase in their avoidance behaviour in response to increasing concentrations of PEA HCl. To accomplish the second objective, sea lampreys were exposed to PEA HCl, conspecific alarm cue and a combination of the two. Sea lampreys responded to the combination of predator cue and conspecific alarm cue in an additive manner.

  11. [Comparative analysis of the semiotics of disseminated pulmonary tuberculosis and exogenous allergic alveolitis in accordance with the data of computed tomography].

    Science.gov (United States)

    Amansakhedov, R B; Limarova, I V; Perfiliev, A V; Abdullaev, R Yu; Sigaev, A T; Ergeshov, A E

    2016-01-01

    to improve the differential diagnosis of disseminated pulmonary tuberculosis (DPT) and exogenous allergic alveolitis (EAA) via comparative investigation of their computed tomography (CT) semiotics and identification of the most informative diagnostic criteria. 70 patients, including 40 patients with DPT in a phase of infiltration and 30 patients with acute EAA, were studied using a Somatom Emotion 16 multi-slice spiral CT scanner (Siemens). All the patients underwent spiral scanning from the upper chest aperture to the costodiaphragmatic recesses with a high CT algorithm at 0.8-mm slice thickness and a 1.5-mm step. Analysis of the spread of dissemination foci established that pathological changes were peribronchovascularly located in both nosological entities and characterized by a preponderance of septal and intrabronchial locations in DPT and by a centrilobular distribution in EAA. Centrilobular foci were more commonly poorly defined in EAA and mixed foci were observed in DPT. In the latter, peribronchovascular, centrilobular foci were revealed at a distance from the visceral pleura (the boundary of the deep and superficial lymphatic network, respectively) in 38% and more than half of the cases (62%) with the involvement of the visceral and parietal pleura; in EAA, the centrilobular foci were more often combined with the involvement of the visceral pleura in more than 92% of cases. The tree-in-bud sign was significantly more common in DPT. The latter was mostly characterized by apicocaudal regression of dissemination. In EAA, the foci were more frequently located asymmetrically. Monomorphic foci with destruction, as well as their polymorphism were seen in DPT; those without destruction were predominantly observed in EAA. CT ground glass and mosaic perfusion syndromes were significantly more often in EAA. In DPT, the visceral and parietal pleuras were involved in the process in 62% of cases and changes were also more common in the extrapleural fat. In addition to

  12. The modular xylanase Xyn10A from Rhodothermus marinus is cell-attached, and its C-terminal domain has several putative homologues among cell-attached proteins within the phylum Bacteroidetes

    DEFF Research Database (Denmark)

    Karlsson, Eva Nordberg; Hachem, Maher Abou; Ramchuran, Santosh

    2004-01-01

    . In the light of this, a revision of experimental data present on both Xyn10A and Man26A was performed, and the results all indicate a cell-anchoring role of the domain, suggesting that this domain represents a novel type of module that mediates cell attachment in proteins originating from members of the phylum......Until recently, the function of the fifth domain of the thermostable modular xylanase Xyn10A from Rhodothermus marinus was unresolved. A putative homologue to this domain was however identified in a mannanase (Man26A) from the same microorganism which raised questions regarding a common function...... cell attachment. To confirm this theory, R. marinus was grown, and activity assays showed that the major part of the xylanase activity was connected to whole cells. Moreover, immunocytochemical detection using a Xyn10A-specific antibody proved presence of Xyn10A on the R. marinus cell surface...

  13. Survival and metamorphosis of larval sea lamprey (Petromyzon marinus) residing in Lakes Michigan and Huron near river mouths

    Science.gov (United States)

    Johnson, Nicholas S.; Brenden, Travis O.; Swink, William D.; Lipps, Mathew A.

    2016-01-01

    Although population demographics of larval lampreys in streams have been studied extensively, demographics in lake environments have not. Here, we estimated survival and rates of metamorphosis for larval sea lamprey (Petromyzon marinus) populations residing in the Great Lakes near river mouths (hereafter termed lentic areas). Tagged larvae were stocked and a Bayesian multi-state tag-recovery model was used to investigate population parameters associated with tag recovery, including survival and metamorphosis probabilities. Compared to previous studies of larvae in streams, larval growth in lentic areas was substantially slower (Brody growth coefficient = 0.00132; estimate based on the recovery of six tagged larvae), survival was slightly greater (annual survival = 63%), and the length at which 50% of the larvae would be expected to metamorphose was substantially shorter (126 mm). Stochastic simulations were used to estimate the production of parasitic stage (juvenile) sea lamprey from a hypothetical population of larvae in a lentic environment. Production of juvenile sea lamprey was substantial because, even though larval growth in these environments was slow relative to stream environments, survival was high and length at metamorphosis was less. However, estimated production of juvenile sea lamprey was less for the lentic environment than for similar simulations for river environments where larvae grew faster. In circumstances where the cost to kill a larva with lampricide was equal and control funds are limited, sea lamprey control effort may be best directed toward larvae in streams with fast-growing larvae, because stream-produced larvae will most likely contribute to juvenile sea lamprey populations.

  14. Size control of in vitro synthesized magnetite crystals by the MamC protein of Magnetococcus marinus strain MC-1.

    Science.gov (United States)

    Valverde-Tercedor, C; Montalbán-López, M; Perez-Gonzalez, T; Sanchez-Quesada, M S; Prozorov, T; Pineda-Molina, E; Fernandez-Vivas, M A; Rodriguez-Navarro, A B; Trubitsyn, D; Bazylinski, Dennis A; Jimenez-Lopez, C

    2015-06-01

    Magnetotactic bacteria are a diverse group of prokaryotes that share the unique ability of biomineralizing magnetosomes, which are intracellular, membrane-bounded crystals of either magnetite (Fe3O4) or greigite (Fe3S4). Magnetosome biomineralization is mediated by a number of specific proteins, many of which are localized in the magnetosome membrane, and thus is under strict genetic control. Several studies have partially elucidated the effects of a number of these magnetosome-associated proteins in the control of the size of magnetosome magnetite crystals. However, the effect of MamC, one of the most abundant proteins in the magnetosome membrane, remains unclear. In this present study, magnetite nanoparticles were synthesized inorganically in free-drift experiments at 25 °C in the presence of different concentrations of the iron-binding recombinant proteins MamC and MamCnts (MamC without its first transmembrane segment) from the marine, magnetotactic bacterium Magnetococcus marinus strain MC-1 and three commercial proteins [α-lactalbumin (α-Lac), myoglobin (Myo), and lysozyme (Lyz)]. While no effect was observed on the size of magnetite crystals formed in the presence of the commercial proteins, biomimetic synthesis in the presence of MamC and MamCnts at concentrations of 10-60 μg/mL resulted in the production of larger and more well-developed magnetite crystals (~30-40 nm) compared to those of the control (~20-30 nm; magnetite crystals grown protein-free). Our results demonstrate that MamC plays an important role in the control of the size of magnetite crystals and could be utilized in biomimetic synthesis of magnetite nanocrystals.

  15. Application of a putative alarm cue hastens the arrival of invasive sea lamprey (Petromyzon marinus) at a trapping location

    Science.gov (United States)

    Hume, John B.; Meckley, Trevor D.; Johnson, Nicholas; Luhring, Thomas M; Siefkes, Michael J; Wagner, C. Michael

    2015-01-01

    The sea lamprey Petromyzon marinus is an invasive pest in the Laurentian Great Lakes basin, threatening the persistence of important commercial and recreational fisheries. There is substantial interest in developing effective trapping practices via the application of behavior-modifying semiochemicals (odors). Here we report on the effectiveness of utilizing repellent and attractant odors in a push–pull configuration, commonly employed to tackle invertebrate pests, to improve trapping efficacy at permanent barriers to sea lamprey migration. When a half-stream channel was activated by a naturally derived repellent odor (a putative alarm cue), we found that sea lamprey located a trap entrance significantly faster than when no odor was present as a result of their redistribution within the stream. The presence of a partial sex pheromone, acting as an attractant within the trap, was not found to further decrease the time to when sea lamprey located a trap entrance relative to when the alarm cue alone was applied. Neither the application of alarm cue singly nor alarm cue and partial sex pheromone in combination was found to improve the numbers of sea lamprey captured in the trap versus when no odor was present — likely because nominal capture rate during control trials was unusually high during the study period. Behavioural guidance using these odors has the potential to both improve control of invasive non-native sea lamprey in the Great Lakes as well as improving the efficiency of fish passage devices used in the restoration of threatened lamprey species elsewhere.

  16. Estudo sôbre hemoparasitos de Bufo marinus L. da Venezuela: 1. Hemogregarinas - - 2. Uma nova espécie de Toxoplasma

    Directory of Open Access Journals (Sweden)

    José Vicente Scorza

    1956-10-01

    Full Text Available Faz-se uma revisão das espécies de Haemogregarina, encontradas, até a presente data, em Bufo marinus L. da região Norte, Leste e Sul da Venezuela,descrevendo-se o ciclo agâmico da Haemogregarina darlingi Leger, 1918, o ciclo esquizogônico da Haemogregarina aquai Phisalix, 1930, propondo-se seja denominada Karyolysus aquai (Phisalix por realizar o ciclo agâmico nas células endoteliais. Descreve-se a Haemogregarina legeri nov. sp. Estuda-se um Toxoplasma no sangue e vísceras de Bufo marinus L., descrevendo-se a anatomia patológica dos órgãos afetados, discutindo-se o estado atual da sistemática das espécies de Toxoplasma, parasitos de vertebrados poikilotermos, propondo-se o nome de Toxoplasma serpai nov. sp. para êste protozoário.

  17. Alveolite alérgica extrínseca com expressão imunológica atípica Extrinsic allergic alveolitis with an atypical immune expression

    Directory of Open Access Journals (Sweden)

    Teresa Costa

    2009-03-01

    Full Text Available A alveolite alérgica extrínseca e a sarcoidose são ambas doenças granulomatosas pulmonares que se caracterizam pela presença de granulomas não necrotizantes. Ambas apresentam alterações típicas no lavado broncoalveolar, com relações CD4/CD8 opostas. No entanto, a sarcoidose não apresenta hoje em dia factores etiológicos bem definidos, como a alveolite alérgica extrínseca. As autoras apresentam dois casos clínicos com curso clínico, imagiológico, funcional e imunológico semelhante, embora com confirmação histopatológica não concordante com as alterações do LBA e com a particularidade de pertencerem a dois elementos da mesma família, convivente, e de terem surgido com poucas semanas de intervalo.Extrinsic allergic alveolitis and sarcoidosis are two granulomatosis of the lung characterized by non-necrotizing granuloma. Both have typical bronchoalveolar lavage immunology, with opposite CD4/CD8 relation. However, sarcoidosis does not have such well defined etiology as extrinsic allergic alveolitis. The authors present two cases with similar clinical course, imagiology, lung function and immunology, although they both had an histology that was not concordant with the bronchoalveolar lavage, and with the peculiarity of being two elements of the same family, co -inhabitants and with a clinical presentation only a few weeks apart.

  18. GABA and GABA-Alanine from the Red Microalgae Rhodosorus marinus Exhibit a Significant Neuro-Soothing Activity through Inhibition of Neuro-Inflammation Mediators and Positive Regulation of TRPV1-Related Skin Sensitization

    Directory of Open Access Journals (Sweden)

    Amandine Scandolera

    2018-03-01

    Full Text Available The aim of the present study was to investigate the neuro-soothing activity of a water-soluble hydrolysate obtained from the red microalgae Rhodosorus marinus Geitler (Stylonemataceae. Transcriptomic analysis performed on ≈100 genes related to skin biological functions firstly revealed that the crude Rhodosorus marinus extract was able to significantly negatively modulate specific genes involved in pro-inflammation (interleukin 1α encoding gene, IL1A and pain detection related to tissue inflammation (nerve growth factor NGF and its receptor NGFR. An in vitro model of normal human keratinocytes was then used to evaluate the ability of the Rhodosorus marinus extract to control the release of neuro-inflammation mediators under phorbol myristate acetate (PMA-induced inflammatory conditions. The extract incorporated at 1% and 3% significantly inhibited the release of IL-1α and NGF secretion. These results were confirmed in a co-culture system of reconstructed human epithelium and normal human epidermal keratinocytes on which a cream formulated with the Rhodosorus marinus extract at 1% and 3% was topically applied after systemic induction of neuro-inflammation. Finally, an in vitro model of normal human astrocytes was developed for the evaluation of transient receptor potential vanilloid 1 (TRPV1 receptor modulation, mimicking pain sensing related to neuro-inflammation as observed in sensitive skins. Treatment with the Rhodosorus marinus extract at 1% and 3% significantly decreased PMA-mediated TRPV1 over-expression. In parallel with these biological experiments, the crude Rhodosorus marinus extract was fractionated by centrifugal partition chromatography (CPC and chemically profiled by a recently developed 13C NMR-based dereplication method. The CPC-generated fractions as well as pure metabolites were tested again in vitro in an attempt to identify the biologically active constituents involved in the neuro-soothing activity of the Rhodosorus

  19. Effects of meal size, meal type, body temperature, and body size on the specific dynamic action of the marine toad, Bufo marinus.

    Science.gov (United States)

    Secor, Stephen M; Faulkner, Angela C

    2002-01-01

    Specific dynamic action (SDA), the accumulated energy expended on all physiological processes associated with meal digestion, is strongly influenced by features of both the meal and the organism. We assessed the effects of meal size, meal type, body temperature, and body size on the postprandial metabolic response and calculated SDA of the marine toad, Bufo marinus. Peak postprandial rates of O(2) consumption (.V(O2)) and CO(2) production (.V(CO2)) and SDA increased with meal size (5%-20% of body mass). Postprandial metabolism was impacted by meal type; the digestion of hard-bodied superworms (Zophobas larva) and crickets was more costly than the digestion of soft-bodied earthworms and juvenile rats. An increase in body temperature (from 20 degrees to 35 degrees C) altered the postprandial metabolic profile, decreasing its duration and increasing its magnitude, but did not effect SDA, with the cost of meal digestion remaining constant across body temperatures. Allometric mass exponents were 0.69 for standard metabolic rate, 0.85 for peak postprandial .V(O2), and 1.02 for SDA; therefore, the factorial scope of peak postprandial .V(O2) increased with body mass. The mass of nutritive organs (stomach, liver, intestines, and kidneys) accounted for 38% and 20% of the variation in peak postprandial .V(O2) and SDA, respectively. Toads forced to exercise experienced 25-fold increases in .V(O2) much greater than the 5.5-fold increase experience during digestion. Controlling for meal size, meal type, and body temperature, the specific dynamic responses of B. marinus are similar to those of the congeneric Bufo alvarius, Bufo boreas, Bufo terrestris, and Bufo woodhouseii.

  20. INTRAORAL RÖNTGEN TEKNİKLERİ VE ORTOPANTOMOGRAFİ (OPTG) İLE ÇEKİLEN FİLMLERDE ALVEOL KEMİĞİ GÖRÜNTÜLERİNİN KARŞILAŞTIRILMASI(*)-INTRAORAL RADIOGRAPHY TECHNIQUES AND COMPARISONS OF THE IMAGES OF ALVEOLAR BONE IN THE RADIOGRAPHIES TAKEN BY ORTHOPANTOMOGRAPH

    OpenAIRE

    ÖZBAYRAK, Semih

    2013-01-01

    INTRAORAL RADIOGRAPHY TECHNIQUES AND COMPARISONS OF THE IMAGES OF ALVEOLAR BONE IN THE RADIOGRAPHIES  TAKEN BY ORTHOPANTOMOGRAPH (OPTG)Anahtar Sözcükler: Alveol kemiği, açıortay-paralel teknik, ısırma grafikleri, ortopantomograflBu deneysel çalışmada alveol kemiğinin periodontal amaçlı çekilen röntgen filmlerindeki görüntüleri incelenmiştir. Horizontal ve vertikal kemik rezorpsiyonlarının görüntüleri açıortay-,paralel-teknik,ısırma radyografileri ve ortopantomografi yöntemlerinde karşılaştırm...

  1. Population ecology of the sea lamprey (Petromyzon marinus) as an invasive species in the Laurentian Great Lakes and an imperiled species in Europe

    Science.gov (United States)

    Hansen, Michael J.; Madenjian, Charles P.; Slade, Jeffrey W.; Steeves, Todd B.; Almeida, Pedro R.; Quintella, Bernardo R.

    2016-01-01

    The sea lamprey Petromyzon marinus (Linnaeus) is both an invasive non-native species in the Laurentian Great Lakes of North America and an imperiled species in much of its native range in North America and Europe. To compare and contrast how understanding of population ecology is useful for control programs in the Great Lakes and restoration programs in Europe, we review current understanding of the population ecology of the sea lamprey in its native and introduced range. Some attributes of sea lamprey population ecology are particularly useful for both control programs in the Great Lakes and restoration programs in the native range. First, traps within fish ladders are beneficial for removing sea lampreys in Great Lakes streams and passing sea lampreys in the native range. Second, attractants and repellants are suitable for luring sea lampreys into traps for control in the Great Lakes and guiding sea lamprey passage for conservation in the native range. Third, assessment methods used for targeting sea lamprey control in the Great Lakes are useful for targeting habitat protection in the native range. Last, assessment methods used to quantify numbers of all life stages of sea lampreys would be appropriate for measuring success of control in the Great Lakes and success of conservation in the native range.

  2. Investigating population structure of Sea Lamprey (Petromyzon marinus, L.) in Western Iberian Peninsula using morphological characters and heart fatty acid signature analyses.

    Science.gov (United States)

    Lança, Maria João; Machado, Maria; Mateus, Catarina S; Lourenço, Marta; Ferreira, Ana F; Quintella, Bernardo R; Almeida, Pedro R

    2014-01-01

    This study hypothesizes the existence of three groups of sea lamprey Petromyzon marinus L. in Portugal (North/Central group, Tagus group, and Guadiana group), possibly promoted by seabed topography isolation during the oceanic phase of the life cycle. Within this context, our purpose was to analyze the existence of a stock structure on sea lamprey populations sampled in the major Portuguese river basins using both morphological characters and heart tissue fatty acid signature. In both cases, the multiple discriminant analysis revealed statistically significant differences among groups, and the overall corrected classification rate estimated from cross-validation procedure was particularly high for the cardiac muscle fatty acid profiles (i.e. 83.8%). Morphometric characters were much more useful than meristic ones to discriminate stocks, and the most important variables for group differentiation were eye length, second dorsal fin length and branchial length. Fatty acid analysis showed that all lampreys from the southern Guadiana group were correctly classified and not mixing with individuals from any other group, reflecting a typical heart fatty acid signature. Our results revealed that 89.5% and 72.2% of the individuals from the Tagus and North/Central groups, respectively, were also correctly classified, despite some degree of overlap between individuals from these groups. The fatty acids that contributed to the observed segregation were C16:0; C17:0; C18:1ω9; C20:3ω6 and C22:2ω6. Detected differences are probably related with environmental variables to which lampreys may have been exposed, which leaded to different patterns of gene expression. These results suggest the existence of three different sea lamprey stocks in Portugal, with implication in terms of management and conservation.

  3. Investigating population structure of Sea Lamprey (Petromyzon marinus, L. in Western Iberian Peninsula using morphological characters and heart fatty acid signature analyses.

    Directory of Open Access Journals (Sweden)

    Maria João Lança

    Full Text Available This study hypothesizes the existence of three groups of sea lamprey Petromyzon marinus L. in Portugal (North/Central group, Tagus group, and Guadiana group, possibly promoted by seabed topography isolation during the oceanic phase of the life cycle. Within this context, our purpose was to analyze the existence of a stock structure on sea lamprey populations sampled in the major Portuguese river basins using both morphological characters and heart tissue fatty acid signature. In both cases, the multiple discriminant analysis revealed statistically significant differences among groups, and the overall corrected classification rate estimated from cross-validation procedure was particularly high for the cardiac muscle fatty acid profiles (i.e. 83.8%. Morphometric characters were much more useful than meristic ones to discriminate stocks, and the most important variables for group differentiation were eye length, second dorsal fin length and branchial length. Fatty acid analysis showed that all lampreys from the southern Guadiana group were correctly classified and not mixing with individuals from any other group, reflecting a typical heart fatty acid signature. Our results revealed that 89.5% and 72.2% of the individuals from the Tagus and North/Central groups, respectively, were also correctly classified, despite some degree of overlap between individuals from these groups. The fatty acids that contributed to the observed segregation were C16:0; C17:0; C18:1ω9; C20:3ω6 and C22:2ω6. Detected differences are probably related with environmental variables to which lampreys may have been exposed, which leaded to different patterns of gene expression. These results suggest the existence of three different sea lamprey stocks in Portugal, with implication in terms of management and conservation.

  4. Contaminant levels in Herring (Larus argentatus) and Great Black-backed Gull (Larus marinus) eggs from colonies in the New York harbor complex between 2012 and 2013.

    Science.gov (United States)

    Burger, Joanna; Elbin, Susan

    2015-03-01

    Birds living in coastal areas are exposed to severe storms and tidal flooding during the nesting season, but also to contaminants that move up the food chain from the water column and sediment to their prey items. We examine metals in Herring Gull (Larus argentatus) and Great Black-backed Gull (Larus marinus) eggs collected from the New York/New Jersey harbor estuary in 2012 and in 2013 to determine if there were significant yearly differences in metal levels. We test the null hypothesis that there were no significant yearly differences in metal levels. We investigate whether there were consistent differences in metals from 2012 to 2013 that might suggest a storm-related effect because Superstorm Sandy landed in New Jersey in October 2012 with high winds and extensive flooding, and view this research as exploratory. Except for arsenic, there were significant inter-year variations in the mean levels for all colonies combined for Herring Gull, and for lead, mercury and selenium for Great Black-backed Gulls. All metal levels in 2013 were less than in 2012, except for lead. These differences were present for individual colonies as well. Metal levels varied significantly among islands for Herring Gulls in both years (except for cadmium in 2013). No one colony had the highest levels of all metals for Herring Gulls. A long term data set on mercury levels in Herring Gulls indicated that the differences between 2012 and 2013 were greater than usual. Several different factors could account for these differences, and these are discussed.

  5. Intertwined evolutionary histories of marine Synechococcus and Prochlorococcus marinus.

    Science.gov (United States)

    Zhaxybayeva, Olga; Doolittle, W Ford; Papke, R Thane; Gogarten, J Peter

    2009-09-02

    Prochlorococcus is a genus of marine cyanobacteria characterized by small cell and genome size, an evolutionary trend toward low GC content, the possession of chlorophyll b, and the absence of phycobilisomes. Whereas many shared derived characters define Prochlorococcus as a clade, many genome-based analyses recover them as paraphyletic, with some low-light adapted Prochlorococcus spp. grouping with marine Synechococcus. Here, we use 18 Prochlorococcus and marine Synechococcus genomes to analyze gene flow within and between these taxa. We introduce embedded quartet scatter plots as a tool to screen for genes whose phylogeny agrees or conflicts with the plurality phylogenetic signal, with accepted taxonomy and naming, with GC content, and with the ecological adaptation to high and low light intensities. We find that most gene families support high-light adapted Prochlorococcus spp. as a monophyletic clade and low-light adapted Prochlorococcus sp. as a paraphyletic group. But we also detect 16 gene families that were transferred between high-light adapted and low-light adapted Prochlorococcus sp. and 495 gene families, including 19 ribosomal proteins, that do not cluster designated Prochlorococcus and Synechococcus strains in the expected manner. To explain the observed data, we propose that frequent gene transfer between marine Synechococcus spp. and low-light adapted Prochlorococcus spp. has created a "highway of gene sharing" (Beiko RG, Harlow TJ, Ragan MA. 2005. Highways of gene sharing in prokaryotes. Proc Natl Acad Sci USA. 102:14332-14337) that tends to erode genus boundaries without erasing the Prochlorococcus-specific ecological adaptations.

  6. Metamorphosis of the landlocked sea lamprey, Petromyzon marinus

    Science.gov (United States)

    Manion, Patrick J.; Stauffer, Thomas M.

    1970-01-01

    The external metamorphosis of the sea lamprey was divided into four stages, based primarily on the condition of the mouth: mouth reduced, mouth fused, mouth enclosed, and mouth elongated. During metamorphosis, the eye enlarged greatly, the snout and mouth region changed from a fleshy hood enclosing a sieve apparatus to a large sucking disc, the nasopore membrane and the branchial area shrank, the branchiopores changed in shape, the general color changed from dark brown and yellow to an intense blue-black dorsally and white ventrally, and the total length increased. Metamorphosis began in early to mid-July and did not take place after August. The duration of external metamorphosis was about 3 months for lampreys transforming under natural conditions. The mean lengths of metamorphosing lampreys from tributaries of lakes Superior and Michigan were 145 and 136 mm, respectively.

  7. Etiek en teologie – aktuele bespreking van Marinus Schoeman se ...

    African Journals Online (AJOL)

    ... is given of some of the most important issues in comparison to a Christian viewpoint. The following topics are discussed: Resentment; Revaluation of all values; Purpose driven universe; Critique of moral values; The aristocrat; Hannah Arendt's view on the publicpolitical realm and private sphere; Plurality and conformity.

  8. Budding of the Alveolate Alga Vitrella brassicaformis Resembles Sexual and Asexual Processes in Apicomplexan Parasites

    Czech Academy of Sciences Publication Activity Database

    Füssy, Z.; Masařová, P.; Kručinská, J.; Esson, H.J.; Oborník, Miroslav

    2017-01-01

    Roč. 168, č. 1 (2017), s. 80-91 ISSN 1434-4610 R&D Projects: GA MŠk(CZ) ED2.1.00/19.0392 Institutional support: RVO:61388971 Keywords : Vitrella brassicaformis * Vlife cycle * zoosporangium Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.794, year: 2016

  9. Budding of the Alveolate Alga Vitrella brassicaformis Resembles Sexual and Asexual Processes in Apicomplexan Parasites

    Czech Academy of Sciences Publication Activity Database

    Füssy, Zoltán; Masařová, Petra; Kručinská, Jitka; Esson, Heather; Oborník, Miroslav

    2017-01-01

    Roč. 168, č. 1 (2017), s. 80-91 ISSN 1434-4610 R&D Projects: GA ČR(CZ) GA16-24027S Institutional support: RVO:60077344 Keywords : Vitrella brassicaformis * life cycle * zoosporangium * zoospores * budding * ciliogenesis Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.794, year: 2016

  10. [Contribution of the Allergy Clinic to occupational asthma and allergic alveolitis].

    Science.gov (United States)

    Hartmann, A L

    1998-09-30

    Among the contributions of the Allergy Unit the following premier descriptions are to be mentioned particularly: humidifier fever, detergent enzymes, penicillium as cause of cheesewasher's asthma, rennet, wax moth, aureobasidium pullulans in cooling lubricant as cause of hypersensitivity pneumonitis in a hard metal grinder, pectinase, amylase, pepsin, indigenous bat, edible boletus. Starting with these and other occupational illnesses elucidated and described by the Allergy Unit, the importance of the exposure conditions for epidemiology, diagnosis, treatment and prevention is demonstrated. The risk indicator atopy has to be considered while selecting an occupation and a workplace, but should not be unjustly overestimated.

  11. Extrinsic allergic alveolitis: A not-very-well known condition in Nigeria

    African Journals Online (AJOL)

    Methods: Databases such as Medline, Elsevier, Emedicine and Pubmed were searched for relevant literature which included epidemiological data, clinical studies and case studies. The key areas discussed were the probable forms of the disease, pathology, pathogenesis and diagnosis. Results: EAA is often characterized ...

  12. Landscape-level variation in disease susceptibility related to shallow-water hypoxia.

    Directory of Open Access Journals (Sweden)

    Denise L Breitburg

    Full Text Available Diel-cycling hypoxia is widespread in shallow portions of estuaries and lagoons, especially in systems with high nutrient loads resulting from human activities. Far less is known about the effects of this form of hypoxia than deeper-water seasonal or persistent low dissolved oxygen. We examined field patterns of diel-cycling hypoxia and used field and laboratory experiments to test its effects on acquisition and progression of Perkinsus marinus infections in the eastern oyster, Crassostrea virginica, as well as on oyster growth and filtration. P. marinus infections cause the disease known as Dermo, have been responsible for declines in oyster populations, and have limited success of oyster restoration efforts. The severity of diel-cycling hypoxia varied among shallow monitored sites in Chesapeake Bay, and average daily minimum dissolved oxygen was positively correlated with average daily minimum pH. In both field and laboratory experiments, diel-cycling hypoxia increased acquisition and progression of infections, with stronger results found for younger (1-year-old than older (2-3-year-old oysters, and more pronounced effects on both infections and growth found in the field than in the laboratory. Filtration by oysters was reduced during brief periods of exposure to severe hypoxia. This should have reduced exposure to waterborne P. marinus, and contributed to the negative relationship found between hypoxia frequency and oyster growth. Negative effects of hypoxia on the host immune response is, therefore, the likely mechanism leading to elevated infections in oysters exposed to hypoxia relative to control treatments. Because there is considerable spatial variation in the frequency and severity of hypoxia, diel-cycling hypoxia may contribute to landscape-level spatial variation in disease dynamics within and among estuarine systems.

  13. Updating algal evolutionary relationships through plastid genome sequencing: did alveolate plastids emerge through endosymbiosis of an ochrophyte?

    Czech Academy of Sciences Publication Activity Database

    Ševčíková, T.; Horák, Aleš; Klimeš, V.; Zbránková, V.; Demir-Hilton, E.; Sudek, S.; Jenkis, J.; Schmutz, J.; Přibyl, Pavel; Fousek, Jan; Vlček, Čestmír; Lang, B.F.; Oborník, Miroslav; Worden, A.Z.; Eliáš, M.

    2015-01-01

    Roč. 5, MAY 28 2015 (2015), s. 10134 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA13-33039S; GA ČR GPP506/12/P931 Grant - others:GA MŠk(CZ) LO1208; GA MŠk(CZ) ED2.1.00/03.0100 Institutional support: RVO:60077344 ; RVO:67985939 ; RVO:68378050 Keywords : phylogenetic position * Chromera velia * Dinoflagellate Subject RIV: EG - Zoology; EF - Botanics (UMG-J); EF - Botanics (BU-J) Impact factor: 5.228, year: 2015

  14. Prey or predator – expanding the food web role of sandeel (Ammodytes marinus)

    DEFF Research Database (Denmark)

    Eigaard, Ole Ritzau; Deurs, Mikael van; Behrens, Jane

    2014-01-01

    in marine food webs. In 2012 and 2013 the stomachs of 748 sandeels from 36 different commercial sandeel hauls in the central North Sea were opened. 9% of these stomachs contained late stage sandeel larvae. In order to better understand the cannibalistic nature of sandeels, we made a detailed analysis...... of another 450 sandeels from a single haul with a high frequency of apparent cannibals. One-third of the stomachs contained a minimum of one young sandeel (mean length 2.7 cm; max. length 4.9 cm), 10 percent contained 5 or more, and one stomach contained 18. Analyses of sample DNA confirmed that predator...... in North Sea sandeel stocks, but it may also add a new element to the complexity of energy flow in marine food chains...

  15. An anti-steroidogenic inhibitory primer pheromone in male sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Chung-Davidson, Yu-Wen; Wang, Huiyong; Bryan, Mara B.; Wu, Hong; Johnson, Nicholas S.; Li, Weiming

    2013-01-01

    Reproductive functions can be modulated by both stimulatory and inhibitory primer pheromones released by conspecifics. Many stimulatory primer pheromones have been documented, but relatively few inhibitory primer pheromones have been reported in vertebrates. The sea lamprey male sex pheromone system presents an advantageous model to explore the stimulatory and inhibitory primer pheromone functions in vertebrates since several pheromone components have been identified. We hypothesized that a candidate sex pheromone component, 7α, 12α-dihydroxy-5α-cholan-3-one-24-oic acid (3 keto-allocholic acid or 3kACA), exerts priming effects through the hypothalamic-pituitary-gonadal (HPG) axis. To test this hypothesis, we measured the peptide concentrations and gene expressions of lamprey gonadotropin releasing hormones (lGnRH) and the HPG output in immature male sea lamprey exposed to waterborne 3kACA. Exposure to waterborne 3kACA altered neuronal activation markers such as jun and jun N-terminal kinase (JNK), and lGnRH mRNA levels in the brain. Waterborne 3kACA also increased lGnRH-III, but not lGnRH-I or -II, in the forebrain. In the plasma, 3kACA exposure decreased all three lGnRH peptide concentrations after 1 h exposure. After 2 h exposure, 3kACA increased lGnRHI and -III, but decreased lGnRH-II peptide concentrations in the plasma. Plasma lGnRH peptide concentrations showed differential phasic patterns. Group housing condition appeared to increase the averaged plasma lGnRH levels in male sea lamprey compared to isolated males. Interestingly, 15α-hydroxyprogesterone (15α-P) concentrations decreased after prolonged 3kACA exposure (at least 24 h). To our knowledge, this is the only known synthetic vertebrate pheromone component that inhibits steroidogenesis in males.

  16. 15alpha-Hydroxyprogesterone in male sea lampreys, Petromyzon marinus L

    Czech Academy of Sciences Publication Activity Database

    Bryan, M. B.; Scott, A. P.; Černý, Ivan; Young, B. A.; Li, W.

    2004-01-01

    Roč. 69, - (2004), s. 473-481 ISSN 0039-128X Institutional research plan: CEZ:AV0Z4055905 Keywords : steroid * 15alpha-hydroxyprogesterone * sea lamprey Subject RIV: CC - Organic Chemistry Impact factor: 2.337, year: 2004

  17. Etiek en teologie – \\'n aktuele bespreking van Marinus Schoeman se ...

    African Journals Online (AJOL)

    in comparison to a Christian viewpoint. The following topics are discussed: Resentment; Revaluation of all values; Purpose driven universe; Critique of moral values; The aristocrat; Hannah Arendt's view on the publicpolitical realm and private sphere; Plurality and conformity. HTS Theological Studies Vol. 63 (3) 2007: pp.

  18. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.)

    OpenAIRE

    Killorn, Erin E; Toews, Daniel P

    2001-01-01

    Background Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Results Venous return from the poste...

  19. Restoration of oyster reefs in an estuarine lake: population dynamics and shell accretion

    Science.gov (United States)

    Casas, Sandra M.; La Peyre, Jerome F.; La Peyre, Megan K.

    2015-01-01

    Restoration activities inherently depend on understanding the spatial and temporal variation in basic demographic rates of the species of interest. For species that modify and maintain their own habitat such as the eastern oyster Crassostrea virginica, understanding demographic rates and their impacts on population and habitat success are crucial to ensuring restoration success. We measured oyster recruitment, density, size distribution, biomass, mortality and Perkinsus marinus infection intensity quarterly for 3 yr on shallow intertidal reefs created with shell cultch in March 2009. All reefs were located within Sister Lake, LA. Reefs were placed in pairs at 3 different locations within the lake; pairs were placed in low and medium energy sites within each location. Restored reefs placed within close proximity (14.6 kg m-2) at the end of 3 yr. Shell accretion, on average, exceeded estimated rates required to keep pace with local subsidence and shell loss. Variation in recruitment, growth and survival drives local site-specific population success, which highlights the need to understand local water quality, hydrodynamics, and metapopulation dynamics when planning restoration.

  20. [Exposure to Saccharopolyspora rectivirgula among cattle breeders in the province of Reggio Emilia and the risk of extrinsic allergic alveolitis (farmer's lung)].

    Science.gov (United States)

    Ferri, F; Dottori, M; Bedogni, Lorena; Perini, S; Ligabue, M

    2003-01-01

    Nearly 2.350 dairy farms (and 137.000 milk cows) are located in the province of Reggio Emilia, Italy, to produce the famous Parmigiano-Reggiano" cheese. Feeding is hay-based both in the cold season and (together with grazing) in the warm season. This requires a large production of hay and frequent handling by the farmers. Hay is packed in large cylindrical bales, "round bales" (nearly 2.41 m3), or, rarely, in traditional small prisms-shaped bales (about 0.15 m3), only used on small farms. We estimated there were 6.000-9.000 the workers exposed to hay dust. The risks for the farmer's health due to the hay dust exposure are well known; in particular Farmer's Lung disease (FL) is rather frequent in this Region (1.5%-3.0% among people exposed). We studied hay and air pollution by Saccharopolyspora Rectivirgula (SR) in relation to these two different hay-packing techniques (hay dried in the open air) both in flat and in hilly areas. On 56 cattle-farms, hay and air samples were collected and analyzed using a six-stage Andersen sampler and a sedimentation chamber (SC) for hay samples with plastic Petri dishes containing culture medium. Round bales were richer in SR spores than the small prism-shaped bales (n = 37, mean = 6.20 logn ufc/m3 in SC, ds: 3.87 vs n = 15, mean = 2.40 logn ufc/m3 in SC; ds: 4.16) and they seem to produce higher air pollution (n = 30, mean = 5.30 logn ufc/m3; ds: 3.71 vs n = 15, mean = 2.32 logn ufc/m3; ds: 2.99). In hilly areas the pollution produced by round bales (in hay and air) was higher than in flat areas. On the contrary hay from small bales produced in hilly areas was poorest in SR spores. An heavy exposure to actinomycetes spores, therefore, comes from "round bales" hay handling, especially when the bales are produced in mountain areas. New drying systems, probably, can reduce this risk and raise hay quality.

  1. Cryptic infection of a broad taxonomic and geographic diversity of tadpoles by Perkinsea protists.

    Science.gov (United States)

    Chambouvet, Aurélie; Gower, David J; Jirků, Miloslav; Yabsley, Michael J; Davis, Andrew K; Leonard, Guy; Maguire, Finlay; Doherty-Bone, Thomas M; Bittencourt-Silva, Gabriela Bueno; Wilkinson, Mark; Richards, Thomas A

    2015-08-25

    The decline of amphibian populations, particularly frogs, is often cited as an example in support of the claim that Earth is undergoing its sixth mass extinction event. Amphibians seem to be particularly sensitive to emerging diseases (e.g., fungal and viral pathogens), yet the diversity and geographic distribution of infectious agents are only starting to be investigated. Recent work has linked a previously undescribed protist with mass-mortality events in the United States, in which infected frog tadpoles have an abnormally enlarged yellowish liver filled with protist cells of a presumed parasite. Phylogenetic analyses revealed that this infectious agent was affiliated with the Perkinsea: a parasitic group within the alveolates exemplified by Perkinsus sp., a "marine" protist responsible for mass-mortality events in commercial shellfish populations. Using small subunit (SSU) ribosomal DNA (rDNA) sequencing, we developed a targeted PCR protocol for preferentially sampling a clade of the Perkinsea. We tested this protocol on freshwater environmental DNA, revealing a wide diversity of Perkinsea lineages in these environments. Then, we used the same protocol to test for Perkinsea-like lineages in livers of 182 tadpoles from multiple families of frogs. We identified a distinct Perkinsea clade, encompassing a low level of SSU rDNA variation different from the lineage previously associated with tadpole mass-mortality events. Members of this clade were present in 38 tadpoles sampled from 14 distinct genera/phylogroups, from five countries across three continents. These data provide, to our knowledge, the first evidence that Perkinsea-like protists infect tadpoles across a wide taxonomic range of frogs in tropical and temperate environments, including oceanic islands.

  2. Persistence of skin marks on killer whales (Orcinus orca) caused by the parasitic sea lamprey (Petromyzon marinus) in Iceland

    OpenAIRE

    Samarra, Filipa I.P.; Fennell, Alexandra; Aoki, Kagari; Deecke, Volker B.; Miller, Patrick J.O.

    2012-01-01

    Lampreys have long been thought to be a cetacean ectoparasite, due to the observation of round marks on the skin of whales caught during whaling operations. Pike (1951), Nemoto (1955), and van Utrecht (1959) compared such marks on the skin of various cetacean species caught in the Pacific and Atlantic Oceans with the dentition of lampreys and concluded that most round marks had been caused by this parasite. However, lampreys were never collected from captured whales and, due to the lack of di...

  3. Sandeel ( Ammodytes marinus ) larval transport patterns in the North Sea from an individual-based hydrodynamic egg and larval model

    DEFF Research Database (Denmark)

    Christensen, Asbjørn; Jensen, Henrik; Mosegaard, Henrik

    2008-01-01

    is modelled by a stochastic, nonlinear degree-day model describing the extended hatch period. The larval growth model is parameterized by individually back-tracking the local physical environment of larval survivors from their catch location and catch time. Using a detailed map of sandeel habitats...

  4. Analysis of DNA damage in sea lamprey (Petromyzon marinus) spermatozoa by UV, hydrogen peroxide, and the toxicant bisazir

    International Nuclear Information System (INIS)

    Ciereszko, Andrzej; Wolfe, Tobie D.; Dabrowski, Konrad

    2005-01-01

    In this study we sought to demonstrate that Comet assay can be applied to sea lamprey sperm DNA fragmentation and used to describe the relationship between sperm DNA damage and sperm fertilizing ability. We show that the assay can be used reliably and accurately, and unlike in the case of mammals, there is no need for additional steps related to improvement of efficacy of lysis and DNA decondensation. This agrees with the presence of histone proteins in lamprey sperm. An increase in DNA fragmentation was noted during short-term storage of milt on ice (0-4 days). We demonstrated genotoxic effects of UV radiation and oxidative stress (exposure to hydrogen peroxide) and found that oxidative damage to sperm DNA was likely repaired after fertilization in the embryo. Repairing capacity of the oocyte toward sperm DNA lesions caused by UV was restricted. Toxic effect of p,p-bis-(1-aziridinyl)-N-methylphosphinothioic acid (p,p-bis(1-aziridinyl)-N-methylphosphinothioic amide), a sea lamprey chemosterilant, could not be linked to DNA fragmentation in the in vitro tests. Its genotoxicity in vivo may possibly be associated with other mechanisms of DNA degradation (oxidation or DNA-protein and DNA-DNA cross-linking). In conclusion, this study demonstrates that Comet assay can be successfully applied to monitor effects of environmental disturbances and imposed injuries in sea lamprey spermatozoa and possibly other species of ancient fish with acrosomal sperm

  5. Chronic hypoxia modulates NMDA-mediated regulation of the hypoxic ventilatory response in an amphibian, Bufo marinus.

    Science.gov (United States)

    McAneney, Jessica; Gheshmy, Afshan; Uthayalingam, Sarangan; Reid, Stephen G

    2006-08-01

    This study examined whether a hypoxia-tolerant amphibian, the Cane toad, undergoes mammalian-like ventilatory acclimatisation to hypoxia (VAH) and whether chronic hypoxia (CH) alters NMDA-mediated regulation of the acute hypoxic ventilatory response (HVR). Toads were exposed to 10 days of CH (10% O2) followed by acute hypoxic breathing trials or an intra-arterial injection of NaCN. Trials were conducted before and after i.p. treatment with an NMDA-receptor channel blocker (MK801). CH blunted the acute HVR but did not alter resting breathing. MK801 did not alter resting ventilation. In control animals, MK801 augmented breathing frequency (fR) during acute hypoxia by increasing the number of breaths per episode. This effect was attenuated following CH although MK801 did enhance the number of episodes per minute during acute hypoxia. MK801 enhanced the fR response to NaCN in both groups. The results indicate that CH did not produce mammalian-like VAH (i.e. increased resting ventilation and an augmented acute HVR) but did alter MK801-sensitive regulation of breathing pattern and the acute HVR.

  6. Anatomy of the lamprey ear: morphological evidence for occurrence of horizontal semicircular ducts in the labyrinth of Petromyzon marinus

    Science.gov (United States)

    Maklad, Adel; Reed, Caitlyn; Johnson, Nicholas S.; Fritzsch, Bernd

    2014-01-01

    In jawed (gnathostome) vertebrates, the inner ears have three semicircular canals arranged orthogonally in the three Cartesian planes: one horizontal (lateral) and two vertical canals. They function as detectors for angular acceleration in their respective planes. Living jawless craniates, cyclostomes (hagfish and lamprey) and their fossil records seemingly lack a lateral horizontal canal. The jawless vertebrate hagfish inner ear is described as a torus or doughnut, having one vertical canal, and the jawless vertebrate lamprey having two. These observations on the anatomy of the cyclostome (jawless vertebrate) inner ear have been unchallenged for over a century, and the question of how these jawless vertebrates perceive angular acceleration in the yaw (horizontal) planes has remained open. To provide an answer to this open question we reevaluated the anatomy of the inner ear in the lamprey, using stereoscopic dissection and scanning electron microscopy. The present study reveals a novel observation: the lamprey has two horizontal semicircular ducts in each labyrinth. Furthermore, the horizontal ducts in the lamprey, in contrast to those of jawed vertebrates, are located on the medial surface in the labyrinth rather than on the lateral surface. Our data on the lamprey horizontal duct suggest that the appearance of the horizontal canal characteristic of gnathostomes (lateral) and lampreys (medial) are mutually exclusive and indicate a parallel evolution of both systems, one in cyclostomes and one in gnathostome ancestors.

  7. Size control of in vitro synthesized magnetite crystals by the MamC protein of Magnetococcus marinus strain MC-1

    NARCIS (Netherlands)

    Valverde-Tercedor, C; Montalbán-López, M; Perez-Gonzalez, T; Sanchez-Quesada, M S; Prozorov, T; Pineda-Molina, E; Fernandez-Vivas, M A; Rodriguez-Navarro, A B; Trubitsyn, D; Bazylinski, Dennis A; Jimenez-Lopez, C

    Magnetotactic bacteria are a diverse group of prokaryotes that share the unique ability of biomineralizing magnetosomes, which are intracellular, membrane-bounded crystals of either magnetite (Fe3O4) or greigite (Fe3S4). Magnetosome biomineralization is mediated by a number of specific proteins,

  8. Albirhodobacter marinus gen. nov., sp. nov., a member of the family Rhodobacteraceae isolated from sea shore water of Visakhapatnam, India

    Digital Repository Service at National Institute of Oceanography (India)

    Nupur; Bhumika, V.; Srinivas, T.N.R.; AnilKumar, P.

    A novel marine, Gram-negative, rod-shaped bacterium, designated strain N9 sup(T), was isolated from a water sample of the sea shore at Visakhapatnam, Andhra Pradesh (India). Strain N9 sup(T) was found to be positive for oxidase and catalase...

  9. 15ŕ-Hydroxytestosterone produced in vitro and in vivo in the sea lamprey, .I.Petromyzon marinus./I..

    Czech Academy of Sciences Publication Activity Database

    Bryan, M. B.; Scott, A. P.; Černý, Ivan; Yun, S. S.; Li, W.

    2003-01-01

    Roč. 132, - (2003), s. 418-426 ISSN 0016-6480 Institutional research plan: CEZ:AV0Z4055905 Keywords : steroid * androgen * endocrinology Subject RIV: CC - Organic Chemistry Impact factor: 1.736, year: 2003

  10. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.)

    OpenAIRE

    Toews Daniel P; Killorn Erin E

    2001-01-01

    Abstract Background Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Results Venous return from ...

  11. Horizontal gene transfer of epigenetic machinery and evolution of parasitism in the malaria parasite Plasmodium falciparum and other apicomplexans.

    Science.gov (United States)

    Kishore, Sandeep P; Stiller, John W; Deitsch, Kirk W

    2013-02-11

    The acquisition of complex transcriptional regulatory abilities and epigenetic machinery facilitated the transition of the ancestor of apicomplexans from a free-living organism to an obligate parasite. The ability to control sophisticated gene expression patterns enabled these ancient organisms to evolve several differentiated forms, invade multiple hosts and evade host immunity. How these abilities were acquired remains an outstanding question in protistan biology. In this work, we study SET domain bearing genes that are implicated in mediating immune evasion, invasion and cytoadhesion pathways of modern apicomplexans, including malaria parasites. We provide the first conclusive evidence of a horizontal gene transfer of a Histone H4 Lysine 20 (H4K20) modifier, Set8, from an animal host to the ancestor of apicomplexans. Set8 is known to contribute to the coordinated expression of genes involved in immune evasion in modern apicomplexans. We also show the likely transfer of a H3K36 methyltransferase (Ashr3 from plants), possibly derived from algal endosymbionts. These transfers appear to date to the transition from free-living organisms to parasitism and coincide with the proposed horizontal acquisition of cytoadhesion domains, the O-glycosyltransferase that modifies these domains, and the primary family of transcription factors found in apicomplexan parasites. Notably, phylogenetic support for these conclusions is robust and the genes clearly are dissimilar to SET sequences found in the closely related parasite Perkinsus marinus, and in ciliates, the nearest free-living organisms with complete genome sequences available. Animal and plant sources of epigenetic machinery provide new insights into the evolution of parasitism in apicomplexans. Along with the horizontal transfer of cytoadhesive domains, O-linked glycosylation and key transcription factors, the acquisition of SET domain methyltransferases marks a key transitional event in the evolution to parasitism in

  12. A restoration suitability index model for the eastern oyster (Crassostrea virginica in the Mission-Aransas Estuary, TX, USA.

    Directory of Open Access Journals (Sweden)

    Jennifer Beseres Pollack

    Full Text Available Oyster reefs are one of the most threatened marine habitats on earth, with habitat loss resulting from water quality degradation, coastal development, destructive fishing practices, overfishing, and storm impacts. For successful and sustainable oyster reef restoration efforts, it is necessary to choose sites that support long-term growth and survival of oysters. Selection of suitable sites is critically important as it can greatly influence mortality factors and may largely determine the ultimate success of the restoration project. The application of Geographic Information Systems (GIS provides an effective methodology for identifying suitable sites for oyster reef restoration and removes much of the uncertainty involved in the sometimes trial and error selection process. This approach also provides an objective and quantitative tool for planning future oyster reef restoration efforts. The aim of this study was to develop a restoration suitability index model and reef quality index model to characterize locations based on their potential for successful reef restoration within the Mission-Aransas Estuary, Texas, USA. The restoration suitability index model focuses on salinity, temperature, turbidity, dissolved oxygen, and depth, while the reef quality index model focuses on abundance of live oysters, dead shell, and spat. Size-specific Perkinsus marinus infection levels were mapped to illustrate general disease trends. This application was effective in identifying suitable sites for oyster reef restoration, is flexible in its use, and provides a mechanism for considering alternative approaches. The end product is a practical decision-support tool that can be used by coastal resource managers to improve oyster restoration efforts. As oyster reef restoration activities continue at small and large-scales, site selection criteria are critical for assisting stakeholders and managers and for maximizing long-term sustainability of oyster resources.

  13. Structural, functional, and evolutionary aspects of galectins in aquatic mollusks: From a sweet tooth to the Trojan horse.

    Science.gov (United States)

    Vasta, G R; Feng, C; Bianchet, M A; Bachvaroff, T R; Tasumi, S

    2015-09-01

    Galectins constitute a conserved and widely distributed lectin family characterized by their binding affinity for β-galactosides and a unique binding site sequence motif in the carbohydrate recognition domain (CRD). In spite of their structural conservation, galectins display a remarkable functional diversity, by participating in developmental processes, cell adhesion and motility, regulation of immune homeostasis, and recognition of glycans on the surface of viruses, bacteria and protozoan parasites. In contrast with mammals, and other vertebrate and invertebrate taxa, the identification and characterization of bona fide galectins in aquatic mollusks has been relatively recent. Most of the studies have focused on the identification and domain organization of galectin-like transcripts or proteins in diverse tissues and cell types, including hemocytes, and their expression upon environmental or infectious challenge. Lectins from the eastern oyster Crassostrea virginica, however, have been characterized in their molecular, structural and functional aspects and some notable features have become apparent in the galectin repertoire of aquatic mollusks. These including less diversified galectin repertoires and different domain organizations relative to those observed in vertebrates, carbohydrate specificity for blood group oligosaccharides, and up regulation of galectin expression by infectious challenge, a feature that supports their proposed role(s) in innate immune responses. Although galectins from some aquatic mollusks have been shown to recognize microbial pathogens and parasites and promote their phagocytosis, they can also selectively bind to phytoplankton components, suggesting that they also participate in uptake and intracellular digestion of microalgae. In addition, the experimental evidence suggests that the protozoan parasite Perkinsus marinus has co-evolved with the oyster host to be selectively recognized by the oyster hemocyte galectins over algal food

  14. Comparative genomic analysis of multi-subunit tethering complexes demonstrates an ancient pan-eukaryotic complement and sculpting in Apicomplexa.

    Directory of Open Access Journals (Sweden)

    Christen M Klinger

    Full Text Available Apicomplexa are obligate intracellular parasites that cause tremendous disease burden world-wide. They utilize a set of specialized secretory organelles in their invasive process that require delivery of components for their biogenesis and function, yet the precise mechanisms underpinning such processes remain unclear. One set of potentially important components is the multi-subunit tethering complexes (MTCs, factors increasingly implicated in all aspects of vesicle-target interactions. Prompted by the results of previous studies indicating a loss of membrane trafficking factors in Apicomplexa, we undertook a bioinformatic analysis of MTC conservation. Building on knowledge of the ancient presence of most MTC proteins, we demonstrate the near complete retention of MTCs in the newly available genomes for Guillardiatheta and Bigelowiellanatans. The latter is a key taxonomic sampling point as a basal sister taxa to the group including Apicomplexa. We also demonstrate an ancient origin of the CORVET complex subunits Vps8 and Vps3, as well as the TRAPPII subunit Tca17. Having established that the lineage leading to Apicomplexa did at one point possess the complete eukaryotic complement of MTC components, we undertook a deeper taxonomic investigation in twelve apicomplexan genomes. We observed excellent conservation of the VpsC core of the HOPS and CORVET complexes, as well as the core TRAPP subunits, but sparse conservation of TRAPPII, COG, Dsl1, and HOPS/CORVET-specific subunits. However, those subunits that we did identify appear to be expressed with similar patterns to the fully conserved MTC proteins, suggesting that they may function as minimal complexes or with analogous partners. Strikingly, we failed to identify any subunits of the exocyst complex in all twelve apicomplexan genomes, as well as the dinoflagellate Perkinsus marinus. Overall, we demonstrate reduction of MTCs in Apicomplexa and their ancestors, consistent with modification during

  15. ORF Alignment: NC_005042 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ator ... [Prochlorococcus marinus subsp. marinus str. CCMP1375] ... Length = 85 ... Query: 9 ... KAIDS...LKALAEPIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS 68 ... KAIDSLKALAE...PIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS Sbjct: 1 ... KAIDSLKALAEPIRLEIIESLSSGEKCVCDLMQETGLAQSKISFHLKVLKDAGVITDRQS 60 ...

  16. Protein (Cyanobacteria): 432519 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available mal protein L18 Prochlorococcus marinus str. MIT 9211 MATLSKKQQTQKRHKRLRRHLNGTNHRPRLAVFRSNNHIYAQVIDDEAQSTICSASTLDKDLREKLKASGGSCDASMAVGALLAQRALAKGIEQVVFDRGGNLYHGRVKALAKSAREAGLKF ...

  17. Protein (Cyanobacteria): 384788 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available oneopterin aldolase Prochlorococcus marinus str. AS9601 METFLKIENIKLWARVGVLDEERELGQLFILDIFLWTHFEKCTIDDDIKKTVDYSKLVQILQNQSKKIYCYTIEKYSNAILEIIDQEFKISKIKIILTKCNPPITGFDGKVSIVRILENK ...

  18. Protein (Cyanobacteria): 384791 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available eopterin aldolase Prochlorococcus marinus str. MIT 9202 METFLKIENIKLWARVGVLDKERELGQLFILDIFLWTDFEKCTVNDDIKKTVDYSKLVQILKDQSNKIYCLTIEKYSNAILEIIDQEFKLSKVKIILTKCNPPITGFDGKVSIVRILENN ...

  19. Protein (Cyanobacteria): 384790 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available neopterin aldolase Prochlorococcus marinus str. MIT 9215 METFLKIENIKLWARVGVLDKERELGQPFILDIFLWTDFEKCTVNDDIKKTVDYSKLVQILKDQSNKIYCFTIEKYSNAILEIIDQEFKLSKVKIILTKCNAPITGFDGKVSIVRILENN ...

  20. Protein (Cyanobacteria): 470147 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available rase III subunit beta Prochlorococcus marinus str. MIT 9313 MEPKMSKDKEFAISKDSLRASWGNVPISAKIYQQIQAYLLQRQSMGLSTDVDELISTATDEFRDFQQRPEVKEALELVCADLASDQAFSGLSKDETTRAIVINFAIANYFNNCIGK ...

  1. Can muscle fatty acid signature be used to distinguish diets during the marine trophic phase of sea lamprey (Petromyzon marinus, L.)?

    Science.gov (United States)

    Lança, Maria João; Rosado, C; Machado, M; Ferreira, R; Alves-Pereira, I; Quintella, B R; Almeida, P R

    2011-05-01

    Characterization of muscle and liver fatty acid profiles, determination of liver lipogenic and lipolytic activities and estimation of liver fatty elongases and desaturases activities of sea lamprey were realized at the beginning of the spawning migration. The muscle fatty acid profile was consistent with the location of capture, and revealed that animals captured far upstream from the river mouth presented the lowest C18:1ω9 levels and the highest relative proportions of C20:4ω6, C20:5ω3 (EPA), C22:5ω3 (DPA) and C22:6ω3 (DHA). These results suggest: (i) the vital importance of the conservation of C20:4ω6 as a precursor of eicosanoids; (ii) the retention of EPA, DPA and DHA for metabolic energy for reproduction; and (iii) the utilization of C18:1ω9 for metabolic fuel use in the beginning of the spawning period. Hepatic lipolysis and lipogenesis revealed significant differences which could, eventually, result from the diet during the parasitic phase of sea lamprey life cycle. Present results revealed that the muscle act as a fat depot site which explains the few significant correlations observed for fatty acids between muscle and liver. Muscle neutral lipids fatty acid signature at the beginning of the spawning migration can be used to distinguish differences in the diet of sea lampreys during the marine trophic phase of their life cycle. Copyright © 2011 Elsevier Inc. All rights reserved.

  2. Structural lipid changes and Na(+)/K(+)-ATPase activity of gill cells' basolateral membranes during saltwater acclimation in sea lamprey (Petromyzon marinus, L.) juveniles.

    Science.gov (United States)

    Lança, Maria João; Machado, Maria; Ferreira, Ana Filipa; Quintella, Bernardo Ruivo; de Almeida, Pedro Raposo

    2015-11-01

    Seawater acclimation is a critical period for anadromous species and a process yet to be understood in lampreys. Considering that changes in lipid composition of the gill cells' basolateral membranes may disrupt the major transporter Na(+)K(+)-ATPase, the goal of this study was to detect changes at this level during juvenile sea lamprey seawater acclimation. The results showed that saltwater acclimation has a direct effect on the fatty acid composition of gill cells basolateral membrane's phospholipids. When held in full-strength seawater, the fatty acid profile of basolateral membrane's phospholipids suffered a restructure by increasing either saturation or the ratio between oleic acid and eicosapentaenoic acid. Simultaneously, the activity of Na(+)K(+)-ATPase revealed a significant and positive correlation with basolateral membrane's cholesterol content in the presence of highest salinity. Our results pointed out for lipid adjustments involving the functional transporter present on the gill cell basolateral membranes to ensure the role played by branchial Na(+)K(+)-ATPase in ion transport during saltwater acclimation process. The responses observed contributed to the strategy adopted by gill cell's basolateral membranes to compensate for osmotic and ionic stressors, to ensure the success of the process of seawater acclimation associated with the downstream trophic migration of juvenile sea lamprey. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Comparison of the fatty acid profile of muscle neutral lipids and phospholipids of up-river anadromous sea lamprey (Petromyzon marinus L. from three Portuguese river basins

    Directory of Open Access Journals (Sweden)

    Sara Pinela

    2009-12-01

    Full Text Available Composition of fatty acid profile of muscle neutral lipids (NL and phospholipids (PL of sea lamprey that enter the Portuguese rivers Minho, Tagus and Guadiana during their non-trophic spawning migration was analysed. The fatty acid profile exhibited differences in the percentage among NL and PL and between river basins. Similarities were found in the fatty acid profile of NL. Monounsaturated fatty acids (MUFA were the most representative, followed by saturated fatty acids (SFA and finally by polyunsaturated fatty acids (PUFA. Monoenic 16:1 and 18:1ω9 formed a considerable percentage of total fatty acids, followed by SFA 14:0 and 16:0. EPA and DHA were the dominant PUFA fatty acids. In terms of NL, the fatty acid that contributed for the discrimination between the three river basins was 18:1ω7. Individuals from the Minho river basin exhibited a different fatty acid profile of PL characterised by a low PUFA percentage when compared with lampreys from the Tagus and Guadiana river basins. Muscle PL fraction showed that the two monoenes, 16:1 and 18:1ω9, occurred at high percentage, followed by 16:0 and 14:0 (SFA. Among PUFA, DHA was the most representative fatty acid. The fatty acids that contributed to the separation between the three river basins were 16:0, 18:4ω3 and 24:1ω9. Although the results point in the direction of a possible difference between the fatty acid composition of the NL and PL fractions in the muscle samples from the three river basins, further studies, especially in tissues where fatty acid composition will be less sensitive to diet and environmental factors, are necessary to confirm this hypothesis.

  4. Structural lipid changes and NKA activity of gill cells´ basolateral membranes as response to increasing salinity and atrazine stressors in sea lamprey (Petromyzon marinus, L. juveniles

    Directory of Open Access Journals (Sweden)

    Maria João Lança

    2015-12-01

    Modulation of BLM lipids associated with NKA activity seems to be the strategy adopted by gill cells of juveniles to compensate for osmotic and ionic stressors and for contact/resistance to ATZ exposure.

  5. Cloning, phylogeny, and regional expression of a Y5 receptor mRNA in the brain of the sea lamprey (Petromyzon marinus).

    Science.gov (United States)

    Pérez-Fernández, Juan; Megías, Manuel; Pombal, Manuel A

    2014-04-01

    The NPY receptors known as Y receptors are classified into three subfamilies, Y1, Y2, and Y5, and are involved in different physiological functions. The Y5 receptor is the only member of the Y5 subfamily, and it is present in all vertebrate groups, except for teleosts. Both molecular and pharmacological studies show that Y5 receptor is highly conserved during vertebrate evolution. Furthermore, this receptor is widely expressed in the mammalian brain, including the hypothalamus, where it is thought to take part in feeding and homeostasis regulation. Lampreys belong to the agnathan lineage, and they are thought to have branched out between the two whole-genome duplications that occurred in vertebrates. Therefore, they are in a key position for studies on the evolution of gene families in vertebrates. Here we report the cloning, phylogeny, and brain expression pattern of the sea lamprey Y5 receptor. In phylogenetic studies, the lamprey Y5 receptor clusters in a basal position, together with Y5 receptors of other vertebrates. The mRNA of this receptor is broadly expressed in the lamprey brain, being especially abundant in hypothalamic areas. Its expression pattern is roughly similar to that reported for other vertebrates and parallels the expression pattern of the Y1 receptor subtype previously described by our group, as it occurs in mammals. Altogether, these results confirm that a Y5 receptor is present in lampreys, thus being highly conserved during the evolution of vertebrates, and suggest that it is involved in many brain functions, the only known exception being teleosts. Copyright © 2013 Wiley Periodicals, Inc.

  6. Ultra-performance liquid chromatography tandem mass spectrometry for simultaneous determination of natural steroid hormones in sea lamprey (Petromyzon marinus) plasma and tissues.

    Science.gov (United States)

    Wang, Huiyong; Bussy, Ugo; Chung-Davidson, Yu-Wen; Li, Weiming

    2016-01-15

    This study aims to provide a rapid, sensitive and precise UPLC-MS/MS method for target steroid quantitation in biological matrices. We developed and validated an UPLC-MS/MS method to simultaneously determine 16 steroids in plasma and tissue samples. Ionization sources of Electrospray Ionization (ESI) and Atmospheric Pressure Chemical Ionization (APCI) were compared in this study by testing their spectrometry performances at the same chromatographic conditions, and the ESI source was found up to five times more sensitive than the APCI. Different sample preparation techniques were investigated for an optimal extraction of steroids from the biological matrices. The developed method exhibited excellent linearity for all analytes with regression coefficients higher than 0.99 in broad concentration ranges. The limit of detection (LOD) was from 0.003 to 0.1ng/mL. The method was validated according to FDA guidance and applied to determine steroids in sea lamprey plasma and tissues (fat and testes) by the developed method. Copyright © 2015. Published by Elsevier B.V.

  7. Protein (Cyanobacteria): 5336 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ical protein P9515_09211 Prochlorococcus marinus str. MIT 9515 MEENVDSIGDSYINEKDTFKKDNKNTNKEKVAKEKSNEVNKEINEEKVAKENSNEVNIEINEE...KISEENSKEVNKDINKEKVAKEKSNEVNKEINEEKVAKENSNEVNIEINEEKVAKEKSNEVNKEINEEKISEENSKEVNKDINKEKVSKE

  8. Protein (Cyanobacteria): 123966154 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 42:828 ... hypothetical protein P9515_09211 Prochlorococcus marinus str. MIT 9515 MEENVDSIGDSYINEKDTFKKDNKNTNKEKVAKEKSNEVNKEINEE...KVAKENSNEVNIEINEEKISEENSKEVNKDINKEKVAKEKSNEVNKEINEEKVAKENSNEVNIEINEEKVAKEKSNEVNKEINEEKISEE

  9. Device for storage of cylindrical objects with quick loading-unloading system

    International Nuclear Information System (INIS)

    Besnier, J.

    1995-01-01

    This device comprises one or more co-axial rotative racks with radially distributed alveoles for the storage of cylindrical objects such as small jugs filled with radioactive samples. An opening is managed in each alveole for the ejection of the object towards a receptacle and alveoles are inclined with respect to the rotation axis of the rack to avoid casual fall of the objects. Selective ejection of the samples is obtained with ab toggle lever fitted inside each alveole and controlled by a single pneumatic jack. Details of manufacturing and description of parts are given. (J.S.). 6 refs., 2 figs

  10. Description of Two Species of Early Branching Dinoflagellates, Psammosa pacifica n. g., n. sp and P. atlantica n. sp

    Czech Academy of Sciences Publication Activity Database

    Okamoto, n.; Horák, Aleš; Keeling, P. J.

    2012-01-01

    Roč. 7, č. 6 (2012), e34900 E-ISSN 1932-6203 Institutional research plan: CEZ:AV0Z60220518 Keywords : ALVEOLATE GROUP-I * MARINE ALVEOLATE * OXYRRHIS-MARINA * INTRACELLULAR PARASITE * MICROBIAL EUKARYOTES * GENETIC DIVERSITY * FINE-STRUCTURE * PHYLOGENETIC POSITION * MITOCHONDRIAL GENOMES * EVOLUTIONARY HISTORY Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.730, year: 2012

  11. Sanguibacter gelidistatuariae sp. nov., a novel psychrotolerant anaerobe from an ice sculpture in Antarctica, and emendation of descriptions of the family Sanguibacteraceae, the genus Sanguibacter and species S. antarcticus, S. inulinus, S. kedieii, S. marinus, S. soli and S. suarezii.

    Science.gov (United States)

    Pikuta, Elena V; Lyu, Zhe; Williams, Melissa D; Patel, Nisha B; Liu, Yuchen; Hoover, Richard B; Busse, Hans-Jürgen; Lawson, Paul A; Whitman, William B

    2017-05-01

    A novel psychrotolerant bacterium, strain ISLP-3T, was isolated from a sample of naturally formed ice sculpture on the shore of Lake Podprudnoye in Antarctica. Cells were motile, stained Gram-positive, non-spore-forming, straight or slightly curved rods with the shape of a baseball bat. The new isolate was facultatively anaerobic and catalase-positive. Growth occurred at 3-35 °C with an optimum at 22-24 °C, 0-2 % (w/v) NaCl with an optimum at 0.3 % and pH 6.2-9.5 with an optimum at pH 7.5. Strain ISLP-3T grew on several carbon sources, with the best growth on cellobiose. The isolate possessed ureolytic activity but growth was inhibited by urea. The strain was sensitive to: ampicillin, gentamycin, kanamycin rifampicin, tetracycline and chloramphenicol. Major fatty acids were: anteiso-C15 : 0, iso-C16 : 0, C16 : 0, C14 : 0 and iso-C15 : 0. The predominant menaquinone was MK-9(H4). The genomic G+C content was 69.5 mol%. The 16S rRNA gene showed 99 % sequence similarity to that of Sanguibacter suarezii ST-26T, but their recA genes shared ≤91 % sequence similarity, suggesting that this new isolate represents a novel species within the genus Sanguibacter. This conclusion was supported by average nucleotide identity, which was ≤91 % to the most closely related strain. The name Sanguibacter gelidistatuariae sp. nov. is proposed for the novel species with the type strain ISLP-3T=ATCC TSD-17T=DSM 100501T=JCM 30887T). The complete genome draft sequence of ISLP-3T was deposited under IMG OID 2657245272. Emendments to the descriptions of related taxa have been made based on experimental data from our comparative analysis.

  12. Papel de la metilación del ADN en el control del desarrollo y la estabilidad genómica en dos especies de peces anádromas (Petromyzon marinus y Salmo trutta)

    OpenAIRE

    Covelo Soto, Lara

    2015-01-01

    La epigenética es un campo en auge actualmente dentro de la investigación en Genética y Biología Molecular dada su gran importancia en el control de la expresión génica y mantenimiento estructural y funcional del genoma de muchos organismos. La modificación epigenética más estudiada es la metilación de ADN (5mC), consistente en la adicción de un grupo metilo a la posición 5' de un residuo de citosina. En vertebrados la metilación ocurre cuando la citosina está formando el dinucleótido CpG. Di...

  13. Protein (Cyanobacteria): 33862119 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 9:1168 59919:1168 hypothetical protein PMM1563 Prochlorococcus marinus subsp. pastoris str. CCMP1986 MGEAKRRKSLGLPPKQKNTKSKSDESPRIFDWLPLTINQRDSLMKMSIKASWYGIGGLVILWVIVRFIGPAAGWWTPADSL

  14. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Prochlorococcus marinus str. MIT 9313] ... Length = 117 ... Query: 4 ... SIRIYSYSRCATCRKALTWLQEHQIVHDL...FDIVETPPSREMLSGASKQLASRKLLFNTSG 63 ... SIRIYSYSRCATCRKALTWLQEHQIVHDL...FDIVETPPSREMLSGASKQLASRKLLFNTSG Sbjct: 1 ... SIRIYSYSRCATCRKALTWLQEHQIVHDLFDIVETPPSREMLSGASKQLASRKLLFNTSG 60 ...

  15. Medicinal plants in the healing of dry socket in rats: microbiological and microscopic analysis.

    Science.gov (United States)

    de Melo Júnior, E J M; Raposo, M J; Lisboa Neto, J A; Diniz, M F A; Marcelino Júnior, C A C; Sant'Ana, A E G

    2002-03-01

    The effectiveness of medicinal herbs as antimicrobial agents was tested on isolated microorganisms from an induced alveolitis and on alveolitis in rats. Sixteen ethanolic extracts from plants were prepared and tested. The plant materials were selected from ethnobotanic data and the best result was obtained with Schinus terebinthifolius Raddi. The activity on Enterococcus, Bacillus corineforme, Streptococcus viridans and S. beta-hemolytic was better than the one presented by the antibiotic currently used for the treatment of alveolitis. The extract of Schinus terebinthifolius Raddi has shown good wound-healing activity by histological analysis.

  16. Correlation with gallium-67 scintigraphy, bronchoalveolar lavage and pathologic changes in sarcoid patients

    International Nuclear Information System (INIS)

    Abe, Shosaku; Nishimura, Masaharu; Munakata, Mitsuru; Nakano, Ikuo; Tsuneta, Yasuhiro

    1983-01-01

    The relationship between the intensity of Gallium-67 scintigraphy, lymphocyte counts in bronchoalveolar lavage and pathologic changes was studied in 18 patients with untreated pulmonary sarcoidosis. 1. Noncaseating granulomas were recognized with significantly greater frequency in radiographic stage II (100 percent, 6/6 cases) than in stage I (36 percent, 4/11 cases). Alveolitis showed little relation to the radiographic stage. 2. There was strong correlation between the intensity of Gallium-67 accumulation in the lung parenchyma and the incidence of noncaseating granulomas. However, alveolitis was not statistically significant. 3. A highly significant correlation was revealed between the counts of lymphocytes in bronchoalveolar lavage and alveolitis in sarcoid patients. In contrast, no relationship existed between the lymphocytic counts in bronchoalveolar lavage and intensity of the Gallium-67 accumulation. 4. These observation suggest that the Gallium-67 scintigraphy probably reflects the noncaseating granulomas and the lymphocytic counts in bronchoalveolar lavage reflect the alveolitis in pulmonary sarcoidosis. (author)

  17. Bronchoalveolar lavage cell counts as a predictor of short term outcome in pulmonary sarcoidosis.

    Science.gov (United States)

    Foley, N M; Coral, A P; Tung, K; Hudspith, B N; James, D G; Johnson, N M

    1989-01-01

    Sixty seven patients with biopsy proven pulmonary sarcoidosis were prospectively studied to determine whether single point bronchoalveolar lavage cell counts were a useful indicator of functional outcome and whether repeated lavage helped in management. The mean follow up period was 25 (range 13-37) months. No patient was having corticosteroid treatment at the time of initial bronchoalveolar lavage. "High intensity alveolitis" (lymphocyte count greater than or equal to 28%) was present at the initial lavage in 42 patients. These patients showed a significant improvement in their pulmonary function and chest radiographs over the follow up period whereas patients with "low intensity alveolitis" did not. Of the 42 patients with high intensity alveolitis, 31 had chronic sarcoidosis (duration over two years, mean 80 months). These patients showed a significant improvement in FVC but not in TLCO. Corticosteroids resulted in greater functional and radiological improvement in the patients with high intensity alveolitis than in those with low intensity alveolitis. Repeat bronchoalveolar lavage in 34 patients, mean 8.4 months after the original lavage, showed a weak inverse relation between a reduced lymphocyte count and change in forced vital capacity and isotope uptake on a gallium scan. These correlations were too weak to make repeated cell counts useful in management. Our results suggest that high intensity alveolitis may be a favourable prognostic factor for lung function in pulmonary sarcoidosis, even in patients with chronic disease, but that repeat lavage adds little to the management of the individual patient. PMID:2588210

  18. Protein (Cyanobacteria): 157414062 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_001484928.1 NC_009840 1117:4682 ... 1212:1747 ... 1217:2782 1218:2782 1219:651 9306...0:1440 ... 7-cyano-7-deazaguanine reductase Prochlorococcus marinus str. MIT 9215 MSTAKLDDSTQRPLYGERIIKESKIICF

  19. Gene : CBRC-PMAR-01-0400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available mprey LyEST Petromyzon marinus cDNA, mRNA sequence /gb=CO550833 /gi=51799157 /ug=Pma.4953 /len=759 4e-17 38% MTAPPLSLCVSVWILCLCVRLS...PRLSVILCLCARLSPRLSVILCLCVRLSPRLSVILCLCVRLTPRLSVILCLCARLSPRLSVILCLCVRLSPRLS...VILCLCVRLSPRLSVILCLCVRLSPRLSVILCLCVRLTPRLSVILCLCARLSPRLSVILCLCVRLSPRLSVILCLCVRLSPRLSVILCLCVRLSPRLSVILCLCVRPSPRLSVTPTVPVFLRLRAYASGGSPSILTCDFRTL ...

  20. Protein (Cyanobacteria): 123966873 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 42:1373 ... 7-cyano-7-deazaguanine reductase Prochlorococcus marinus str. MIT 9515 MSTPNLYDSTNKPLYGERLIEESKIIC... YP_001011954.1 NC_008817 1117:4682 ... 1212:1747 ... 1217:2782 1218:2782 1219:651 1675

  1. Protein (Cyanobacteria): 123969195 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 91:1394 ... 7-cyano-7-deazaguanine reductase Prochlorococcus marinus str. AS9601 MSTAKLEDSTQRPLYGERIIEESKIICFD... YP_001010053.1 NC_008816 1117:4682 ... 1212:1747 ... 1217:2782 1218:2782 1219:651 1468

  2. Lijst van de Nederlandsche visschen aanwezig in 's Rijks Museum van Natuurlijke Historie te Leiden, tevens eene vermelding van de tot nu toe in en bij Nederland waargenomen visschen

    NARCIS (Netherlands)

    Popta, C.M.L.

    1924-01-01

    Afd.: CHORDATA. Groep III: CEPHALOCHORDATA. Fam.: BRANCHIOSTOMATIDAE. Branchiostoma lanceolata (Pallas) — slakprik, niet aanwezig. Groep IV: CRANIATA. Klasse: Marsipobranchii. Fam.: PETROMYZONIDAE. Petromyzon marinus L. — zeeprik. 1 ex. beschadigd, Noordzee, uit het oude kabinet, in spir. no. 4277.

  3. Hydrogeological modelling of the Atlantis aquifer for management ...

    African Journals Online (AJOL)

    Hydrogeological modelling of the Atlantis aquifer for management support to the Atlantis Water Supply Scheme. Nebo Jovanovic, Richard DH Bugan, Gideon Tredoux, Sumaya Israel, Rodney Bishop, Vernon Marinus ...

  4. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Prochlorococcus marinus str. MIT 9313] ... Length = 122 ... Query: 44 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD 103 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD Sbjct: 1 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARCTGDGVLEATVWD 60 ... Query: 164 WY 165 ... WY Sbjct: 121 WY 122

  5. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Prochlorococcus marinus str. MIT 9313] ... Length = 121 ... Query: 1 ... MIQQESFLTVADNSGAKRIQCIRVLGSNRRYAHVGDVIVAAVKDAMP...NMXXXXXXXXXXX 60 ... MIQQESFLTVADNSGAKRIQCIRVLGSNRRYAHVGDVIVAAVKDAMP...NM ... Sbjct: 1 ... MIQQESFLTVADNSGAKRIQCIRVLGSNRRYAHVGDVIVAAVKDAMPNMSVKKSEVVKAV 60 ... Query: 121 I 121 ... I Sbjct: 121 I 121

  6. Gene : CBRC-PMAR-01-0427 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available romyzon marinus cDNA, mRNA sequence /gb=CO548425 /gi=51796737 /ug=Pma.8609 /len=962 3e-07 20% MHWHSCCTGIPAALALLLHWHCC...SIGIPAALALLLHWHCCCIGIPAALAFLLHWHCCCIGILAALALLLHCHCCCIGIPAALALLLHWHCCCIGIPAALALLLHWHCC...CIGIPAALALLLHWHSCCIGIAAALAFLLHWHCCCIVNAATLALLLHWHSCCIGIVATLALLLHWHCCYIAIVATLALLLNWHCCCIGIVAALALLHWHCCCIGIVATLAMLLHCHCCYIGIVATFALLLHWHSCCIDIVATLALLLHWHCCCIGIAAVLALLLH ...

  7. Gene : CBRC-PMAR-01-0569 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available romyzon marinus cDNA, mRNA sequence /gb=CO548425 /gi=51796737 /ug=Pma.8609 /len=962 3e-06 21% MCCIGIADTLALLLHWHCCCIGIAATLALLLHWHCC...YIGIVATLALLLRWHCCCIGIVDTLALLLHWHCCFIGIVAALALLLHWHCCCIGIVAALALLLHWHCC...YIGIVATLALLLHWHCCYIRIAATLALLLHWHCCCIGIAAALALLLHWHCCCIGIVDTLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLALLLHWHCC...YIGIAATLALLLHWHCCCIGIAATLTLLLHCHSCTVRAPAVADTLGLRPSPNLYKEFTFRG ...

  8. Gene : CBRC-PMAR-01-0532 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available mbryo Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EG335085 /gi=116021074 /ug=Pma.7533 /len=671 3e-05 23% MLLHWHCC...YIGIVTALASLLHWALLLHGHCCYIGIAATLALLLHWHCCYIGIAAALTLLLHCCCIGIVTALALLLHWHCC...CISIVATLALLLHWHCCYIGIAAALALLLHWHCCCIGIDAAMALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLH ...

  9. Gene : CBRC-PMAR-01-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...

  10. South African Journal of Geomatics - Vol 5, No 2 (2016)

    African Journals Online (AJOL)

    resolution orthophotos, point clouds and surface models for mapping wetlands · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marinus Axel Boon, Richard Greenfield, Solomon Tesfamichael ...

  11. Protein (Cyanobacteria): 158688 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_397847.1 1117:3219 1212:425 1217:425 1218:425 1219:425 74546:294 dehydrogenase with different specificiti...es Prochlorococcus marinus str. MIT 9312 MNLDLKDKFIIIAGGLGGIGLETVKDLISEGAEISILTQNES

  12. Protein (Cyanobacteria): 174468 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available s with different specificities Prochlorococcus marinus str. MIT 9202 MINSTKNDKTIGITGASGALGKELTKLFRQKGYKVIGFS...ZP_05138363.1 1117:3468 1212:440 1217:440 1218:440 1219:440 93058:866 dehydrogenase

  13. Histopathology and stress biomarkers in the clam Venerupis philippinarum from the Venice Lagoon (Italy).

    Science.gov (United States)

    Boscolo Papo, Michele; Bertotto, Daniela; Quaglio, Francesco; Vascellari, Marta; Pascoli, Francesco; Negrato, Elena; Binato, Giovanni; Radaelli, Giuseppe

    2014-07-01

    The aim of this study was to evaluate the histomorphology and the stress response in the bivalve Venerupis philippinarum sampled in four differently polluted sites of the Venice Lagoon (Palude del Monte, Marghera, Ca' Roman and Val di Brenta). This species is often used as bioindicator of environmental pollution since it can bioaccumulate a large variety of pollutants because of its filter feeding. Chemical analyses for heavy metals (Cd, Cu, Hg and Pb) and polycyclic aromatic hydrocarbons (PAHs) were performed on whole soft tissues of V. philippinarum. The histological evaluation of clams revealed the presence of Perkinsus sp. infection in animals from all sites, although a very high prevalence of parasites was evidenced in clams from Ca' Roman. Perkinsus sp. were systemically distributed in the mantle, in the intestine and digestive gland, in gonads and gills. The trophozoites of Perkinsus sp. were found isolated or in cluster surrounded by a heavy hemocitical response. Haemocytes always exhibited an immunopositivity to cytochrome P4501A (CYP1A), heat shock protein 70 (HSP70), 4-hydroxy-2-nonenal (HNE) and nitrotyrosine (NT) antibodies. The digestive gland of animals from Palude del Monte showed the highest malondialdehyde (MDA) concentration, whereas clams from Ca' Roman exhibited the highest quantity of metallothioneins. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. CT in the diagnosis of interstitial lung disease

    International Nuclear Information System (INIS)

    Bergin, C.J.; Mueller, N.L.

    1985-01-01

    The computed tomographic (CT) appearance of interstitial lung disease was assessed in 23 patients with known interstitial disease. These included seven patients with fibrosing alveolitis, six with silicosis, two with hypersensitivity pneumonitis, three with lymphangitic spread of tumor, two with sarcoidosis, one with rheumatoid lung disease, and two with neurofibromatosis. The CT appearance of the interstitial changes in the different disease entities was assessed. Nodules were a prominent CT feature in silicosis, sarcoidosis, and lymphangitic spread of malignancy. Distribution of nodules and associated interlobular septal thickening provided further distinguishing features in these diseases. Reticular densities were the predominant CT change in fibrosing alveolitis, rheumatoid lung disease, and extrinsic allergic alveolitis. CT can be useful in the investigation of selected instances of interstitial pulmonary disease

  15. AKCİĞER SURFAKTAN SİSTEMİ

    OpenAIRE

    Durgun, Zafer; Keskin, Ercan

    1997-01-01

    Pulmoner surfaktanlar tip ll alveoler epiteliyal hücrelerce salgılanan, alveol ve küçük hava yollarını kaplayan bir fosfolipid ve protein kompleksidir. Surfaktanların bilinen fonksiyonları (1) alveol duvarını uygun bir nemiilikle tutmak; (2) pasif akspirasyon esnasında daha kolay elastik büzülme için sabit esansiyel bir faktör olarak rol oynamak; (3) hava-sıvı tabakasında yüzey gerilimini azaltarak alveollerin stabilizasyonunu sağlamak ya da akspirasyon esnasında küçük alveollerin kollapsını ...

  16. Ekspresi Gen CYP19 Aromatase, Estrogen, Androgen pada penderita Periodontitis Agresif

    Directory of Open Access Journals (Sweden)

    Dahlia Herawati

    2016-11-01

    Full Text Available Kepadatan tulang tubuh ditentukan oleh gen CYP19 aromatase, hormon estrogen dan androgen. Pada periodontitis agresif terjadi perkembangan cepat kerusakan tulang alveolar, dan kerusakan tulang alveoler tersebut tidak diimbangioleh regenerasi tulang. Tujuan penelitian ini adalah menunjukkan ekspresi gen CYP19 aromatase, estrogen, androgen pada penderita periodontitis agresif agar dapat untuk menjadi pertimbangan pada saat melakukan perawatan periodontal. Metode penelitian, pemeriksaan ekspresi gen aromatse CYP19 berasal dari spesimen tulang alveolar menggunakan imunohistokimia, pengukuran hormon estrogen dan androgen dari serum menggunakan Vidas: Elfa. Hasil penelitian ekspresi gene CYP19 aromatase pada periodontitis agresif menunjukkan gambaran lebih rendah densitasnya dibandingkan pada nonperiodontitis. Estrogen dan androgen pad aperiodontitis agresif ada kecenderungan lebih rendah dibandingkan pada nonperiodontitis. Kesimpulan regenerasi tulang alveoler pad a periodontitis agresif terhambat karena sedikitnya gen CYP19 aromatase dan hormon estrogen dan androgen yang berperan pada pembentukan tulang alveoler kurang memadai.

  17. The lungs in rheumatoid arthritis - a clinical, radiographic and ...

    African Journals Online (AJOL)

    Five patients had digital clubbing, of whom 2 had fibrosing alveolitis and 1 bronchiectasis. No cause of the ..... Junk AG. Davidsen O. Graudal H. Prevalence of pulmonary involvement in rheumatoid arthrrtis and its relationship to some characterist,cs of the patients. Scand J RhelJmatol1982: 11: 217-224. 21. Hyland RH.

  18. Pædodontisk parodontologi

    DEFF Research Database (Denmark)

    Nørregaard, Marie-Louise Milvang; Kongstad, Johanne; Poulsen, Anne Havemose

    2015-01-01

    Pædodontisk parodontologi En tidlig alder for sygdomsdebut, høj sygdomsprogression, fravær af systemisk sygdom og involvering af flere tænder med et karakteristisk mønster for tab af den alveolære knogle er vigtige diagnostiske elementer ved den aggressive marginale parodontitis. Hos børn og unge...

  19. Genome Sequence of Ureaplasma diversum Strain ATCC 49782.

    Science.gov (United States)

    Marques, Lucas M; Guimarães, Ana M S; Martins, Hellen B; Rezende, Izadora S; Barbosa, Maysa S; Campos, Guilherme B; do Nascimento, Naíla C; Dos Santos, Andrea P; Amorim, Aline T; Santos, Verena M; Messick, Joanne B; Timenetsky, Jorge

    2015-04-16

    Here, we report the complete genome sequence of Ureaplasma diversum strain ATCC 49782. This species is of bovine origin, having an association with reproductive disorders in cattle, including placentitis, fetal alveolitis, abortion, and birth of weak calves. It has a small circular chromosome of 975,425 bp. Copyright © 2015 Marques et al.

  20. Cryptic infection of a broad taxonomic and geographic diversity of tadpoles by Perkinsea protists

    Czech Academy of Sciences Publication Activity Database

    Chambouvet, A.; Gower, D.J.; Jirků, Miloslav; Yabsley, M. J.; Davis, A. K.; Leonard, A.; Maguire, F.; Doherty-Bone, T. M.; Bittencourt-Silva, G.B.; Wilkinson, M.; Richards, T.A.

    2015-01-01

    Roč. 112, č. 34 (2015), E4743-E4751 ISSN 0027-8424 R&D Projects: GA ČR GAP506/10/2330 Institutional support: RVO:60077344 Keywords : frog decline * emerging disease * parasite * alveolates * molecular diversity Subject RIV: EG - Zoology Impact factor: 9.423, year: 2015

  1. Origin, structure and function of millions of chromosomes present in ...

    Indian Academy of Sciences (India)

    2015-06-04

    Jun 4, 2015 ... The differences in the genome organization of. O. trifallax and its relative alveolate species Paramecium tetraurelia and Plasmodium falciparum have been described. Aspects of programmed genome rearrangements, MAC genome structure and function requiring further analyses in different ciliate protest ...

  2. Assessment of virally vectored autoimmunity as a biocontrol strategy for cane toads.

    Directory of Open Access Journals (Sweden)

    Jackie A Pallister

    Full Text Available BACKGROUND: The cane toad, Bufo (Chaunus marinus, is one of the most notorious vertebrate pests introduced into Australia over the last 200 years and, so far, efforts to identify a naturally occurring B. marinus-specific pathogen for use as a biological control agent have been unsuccessful. We explored an alternative approach that entailed genetically modifying a pathogen with broad host specificity so that it no longer caused disease, but carried a gene to disrupt the cane toad life cycle in a species specific manner. METHODOLOGY/PRINCIPAL FINDINGS: The adult beta globin gene was selected as the model gene for proof of concept of autoimmunity as a biocontrol method for cane toads. A previous report showed injection of bullfrog tadpoles with adult beta globin resulted in an alteration in the form of beta globin expressed in metamorphs as well as reduced survival. In B. marinus we established for the first time that the switch from tadpole to adult globin exists. The effect of injecting B. marinus tadpoles with purified recombinant adult globin protein was then assessed using behavioural (swim speed in tadpoles and jump length in metamorphs, developmental (time to metamorphosis, weight and length at various developmental stages, protein profile of adult globin and genetic (adult globin mRNA levels measures. However, we were unable to detect any differences between treated and control animals. Further, globin delivery using Bohle iridovirus, an Australian ranavirus isolate belonging to the Iridovirus family, did not reduce the survival of metamorphs or alter the form of beta globin expressed in metamorphs. CONCLUSIONS/SIGNIFICANCE: While we were able to show for the first time that the switch from tadpole to adult globin does occur in B. marinus, we were not able to induce autoimmunity and disrupt metamorphosis. The short development time of B. marinus tadpoles may preclude this approach.

  3. Author Details

    African Journals Online (AJOL)

    Boon, Marinus Axel. Vol 5, No 2 (2016) - Articles Unmanned Aerial Vehicle (UAV) photogrammetry produces accurate high-resolution orthophotos, point clouds and surface models for mapping wetlands. Abstract PDF. ISSN: 2225-8531. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  4. Does Implicit Learning in Non-Demented Parkinson's Disease depend on the Level of Cognitive Functioning?

    Science.gov (United States)

    Vandenbossche, Jochen; Deroost, Natacha; Soetens, Eric; Kerckhofs, Eric

    2009-01-01

    We investigated the influence of the level of cognitive functioning on sequence-specific learning in Parkinson's disease (PD). This was done by examining the relationship between the scales for outcomes in Parkinson's disease-cognition [SCOPA-COG, Marinus, J., Visser, M., Verwey, N. A., Verhey, F. R. J., Middelkoop, H. A. M.,Stiggelbout, A., et…

  5. Differential effects of a local industrial sand lance fishery on seabird breeding performance

    DEFF Research Database (Denmark)

    Frederiksen, M.; Jensen, Henrik; Daunt, F.

    2008-01-01

    fluctuations. We evaluated the effects of an industrial sand lance (Ammodytes marinus) fishery off the North Sea coast of the United Kingdom, which has been opened and closed in a quasi-experimental fashion, on sand-lance-dependent breeding seabirds. Controlling for environmental variation ( sea surface...

  6. Development of a symptoms questionnaire for complex regional pain syndrome and potentially related illnesses: the Trauma Related Neuronal Dysfunction Symptoms Inventory

    NARCIS (Netherlands)

    Collins, S.; van Hilten, J.J.; Marinus, J.J.; Zuurmond, W.W.A.; de Lange, J.J.; Perez, R.S.G.M.

    2008-01-01

    Collins S, van Hilten JJ, Marinus J, Zuurmond WW, de Lange JJ, Perez RS. Development of a symptoms questionnaire for complex regional pain syndrome and potentially related illnesses: the Trauma Related Neuronal Dysfunction Symptoms Inventory. Objective: To develop a questionnaire to evaluate

  7. Apuntes sobre la reproduccion de algunos Bagres marinos

    NARCIS (Netherlands)

    Luengo, José A.

    1973-01-01

    Mouthbreeding in the male, and modifications of the pelvic fins of the female are recorded for the first time in Selenaspis herzbergii. The pelvic girdle of Selenaspis herzbergii is compared with those of Sciadeichthys proops, Arius spixii, and Bagre marinus. Data are given on eggs and fry in the

  8. Spatial patterns and trends in abundance of larval saneels in the North Sea: 1950 - 2005

    NARCIS (Netherlands)

    Lynam, C.P.; Halliday, N.C.; Hoffle, H.; Wright, P.J.; Damme, van C.J.G.; Pitois, S.G.

    2013-01-01

    Early recruitment indices based on larval fish data from the Continuous Plankton Recorder (CPR) have the potential to inform stock assessments of Ammodytes marinus in the North Sea. We evaluate whether the CPR data are reliable for sandeel larvae. Spatially, CPR larval data were comparable with

  9. Selective cutting, rehabilitation, and alternatives for forests of northeastern North America and elsewhere

    Science.gov (United States)

    Laura S. Kenefic

    2014-01-01

    In the 1928 Journal of Forestry, Marinus Westveld commented that logging in the Northeast dating to the mid-1800s had been selective cutting that removed desirable species of large sizes. Later, commercial clearcuts removed progressively smaller trees of merchantable quality and desirable species. Indiscriminate logging damaged young growing stock...

  10. Seasonal variations in the energy density of fishes in the North Sea

    DEFF Research Database (Denmark)

    Pedersen, Jens; Hislop, J.R.G.

    2001-01-01

    The energy density (E-D, kJ g(-1) wet mass) of saithe Pollachius virens, haddock Meleanogrammus aeglefinus, whiting Merlangius merlangus, Norway pout Trisopterus esmarki, herring Clupea harengus, sprat Sprattus sprattus, sandeel Ammodytes marinus and pearlsides Maurolicus Muelleri, from the North...

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    strains of bacteria such as the plant pathogen Xylella fastidiosa, marine Cyanobacteria Prochlorococcus marinus or animal and human pathogens such as species of Ehrlichia and Legionella. The short-range three-base periodicity, small sequence repeats and long-range correlations taken together constitute a genome ...

  12. Ze Slovníku středověké latiny: sporcia

    Czech Academy of Sciences Publication Activity Database

    Šedinová, Hana

    2017-01-01

    Roč. 140, č. 1/2 (2017), s. 233-245 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : porcus marinus * Latin lexicography * ancient and medieval zoology * Latin names of marine animals * Bartholomaeus de Solencia dictus Claretus * Pliny the Elder * Isidorus of Sevilla * Thomas of Cantimpré Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  13. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  14. Lueheia inscripta (Westrumb, 1821) (Acanthocephala: Plagiorhynchidae) in anurans (Leptodactylidae: Bufonidae) from Mexico

    OpenAIRE

    Salgado-Maldonado G.; Caspeta-Mandujano J.M.

    2010-01-01

    Juveniles of Lueheia inscripta (Westrumb, 1821) Travassos, 1919 (Acanthocephala: Plagiorhynchidae), an acanthocephalan with six lemnisci, are reported and described from mesenteries of frogs Leptodactylus fragilis Brochi, 1877 and a toad Bufo marinus (Linnaeus, 1758) from Morelos state, Mexico. These are new host records extending the known geographical distribution of this species from Brazil and Puerto Rico to Mexico.

  15. Lueheia inscripta (Westrumb, 1821) (Acanthocephala: Plagiorhynchidae) in anurans (Leptodactylidae: Bufonidae) from Mexico.

    Science.gov (United States)

    Salgado-Maldonado, G; Caspeta-Mandujano, J M

    2010-06-01

    Juveniles of Lueheia inscripta (Westrumb, 1821 Travassos, 1919 (Acanthocephala: Plagiorhynchidae), an acanthocephalan with six lemnisci, are reported and described from mesenteries of frogs Leptodactylus fragilis Brochi, 1877 and a toad Bufo marinus (Linnaeus, 1758) from Morelos state, Mexico. These are new host records extending the known geographical distribution of this species from Brazil and Puerto Rico to Mexico.

  16. Lueheia inscripta (Westrumb, 1821 (Acanthocephala: Plagiorhynchidae in anurans (Leptodactylidae: Bufonidae from Mexico

    Directory of Open Access Journals (Sweden)

    Salgado-Maldonado G.

    2010-06-01

    Full Text Available Juveniles of Lueheia inscripta (Westrumb, 1821 Travassos, 1919 (Acanthocephala: Plagiorhynchidae, an acanthocephalan with six lemnisci, are reported and described from mesenteries of frogs Leptodactylus fragilis Brochi, 1877 and a toad Bufo marinus (Linnaeus, 1758 from Morelos state, Mexico. These are new host records extending the known geographical distribution of this species from Brazil and Puerto Rico to Mexico.

  17. Dicty_cDB: Contig-U15056-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available osome 2 map 3622643... 38 3e-04 14 ( FC855047 ) CBHN8832.fwd CBHN Metridium senile tentacle...v CAAA Petromyzon marinus Petromyzon m... 42 0.004 2 ( FC852335 ) CBHN7301.rev CBHN Metridium senile tentacle

  18. Unigene BLAST: CBRC-PMAR-01-0197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,666) /gb=EF094725 /gi=126570532 /ug=Pma.9441 /len=666 0.053 30% ... ...CBRC-PMAR-01-0197 gnl|UG|Pma#S38438288 Petromyzon marinus isolate PmVLRA.22 variabl

  19. Unigene BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,738) /gb=EF094776 /gi=126570665 /ug=Pma.9391 /len=738 0.049 29% ... ...CBRC-PMAR-01-0572 gnl|UG|Pma#S38438237 Petromyzon marinus isolate PmVLRA.E4 variabl

  20. Unigene BLAST: CBRC-PMAR-01-0149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094756 /gi=126570624 /ug=Pma.9410 /len=660 4.8 43% ... ...CBRC-PMAR-01-0149 gnl|UG|Pma#S38438257 Petromyzon marinus isolate PmVLRA.C6 variabl

  1. Unigene BLAST: CBRC-PMAR-01-0669 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094732 /gi=126570554 /ug=Pma.9434 /len=660 4.1 50% ... ...CBRC-PMAR-01-0669 gnl|UG|Pma#S38438281 Petromyzon marinus isolate PmVLRA.30 variabl

  2. Unigene BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094807 /gi=126570727 /ug=Pma.9360 /len=660 0.049 27% ... ...CBRC-PMAR-01-0572 gnl|UG|Pma#S38438206 Petromyzon marinus isolate PmVLRA.H7 variabl

  3. Unigene BLAST: CBRC-PMAR-01-0433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094733 /gi=126570557 /ug=Pma.9433 /len=660 1.2 28% ... ...CBRC-PMAR-01-0433 gnl|UG|Pma#S38438280 Petromyzon marinus isolate PmVLRA.31 variabl

  4. Unigene BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094733 /gi=126570557 /ug=Pma.9433 /len=660 7e-04 30% ... ...CBRC-PMAR-01-0572 gnl|UG|Pma#S38438280 Petromyzon marinus isolate PmVLRA.31 variabl

  5. Unigene BLAST: CBRC-PMAR-01-0566 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,741) /gb=EF094755 /gi=126570621 /ug=Pma.9411 /len=741 3e-04 35% ... ...CBRC-PMAR-01-0566 gnl|UG|Pma#S38438258 Petromyzon marinus isolate PmVLRA.C5 variabl

  6. Unigene BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094779 /gi=126570671 /ug=Pma.9388 /len=660 0.037 26% ... ...CBRC-PMAR-01-0572 gnl|UG|Pma#S38438234 Petromyzon marinus isolate PmVLRA.E7 variabl

  7. Unigene BLAST: CBRC-PMAR-01-0149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,591) /gb=EF094746 /gi=126570596 /ug=Pma.9420 /len=591 4.8 43% ... ...CBRC-PMAR-01-0149 gnl|UG|Pma#S38438267 Petromyzon marinus isolate PmVLRA.B3 variabl

  8. Unigene BLAST: CBRC-PMAR-01-0149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,666) /gb=EF094716 /gi=126570506 /ug=Pma.9450 /len=666 2.2 35% ... ...CBRC-PMAR-01-0149 gnl|UG|Pma#S38438297 Petromyzon marinus isolate PmVLRA.9 variable

  9. Unigene BLAST: CBRC-PMAR-01-0852 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,666) /gb=EF094721 /gi=126570521 /ug=Pma.9445 /len=666 4e-08 27% ... ...CBRC-PMAR-01-0852 gnl|UG|Pma#S38438292 Petromyzon marinus isolate PmVLRA.17 variabl

  10. Unigene BLAST: CBRC-PMAR-01-0149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,663) /gb=EF094740 /gi=126570578 /ug=Pma.9426 /len=663 4.8 43% ... ...CBRC-PMAR-01-0149 gnl|UG|Pma#S38438273 Petromyzon marinus isolate PmVLRA.A5 variabl

  11. Effects of changes in sandeel availability on the reproductive output of seabirds

    DEFF Research Database (Denmark)

    Rindorf, Anna; Wanless, S.; Harris, M.P.

    2000-01-01

    The lesser sandeel Ammodytes marinus is a key prey species for many marine birds in the North Sea. This fish is currently the target of the largest single species fishery in the area, and this has led to concern about the potential impact of the fishery on seabirds. There are 2 critical issues...

  12. Evaluation of the role of Carnobacterium piscicola in spoilage of vacuum- and modified-atmosphere-packed cold-smoked salmon stored at 5 degrees C

    DEFF Research Database (Denmark)

    Paludan-Müller, Christine; Dalgaard, Paw; Huss, Hans Henrik

    1998-01-01

    -packed salmon was dominated by a Vibrio sp., resembling V. marinus, Enterobacteriaceae (Enterobacter agglomerans, Serratia liquefaciens and Rahnella aquatilis) and occasionally Aeromonas hydrophila. Irrespective of the addition of nisin and/or CO2- atmosphere, the LAB microflora was dominated by Carnobacterium...

  13. Paracoccus niistensis sp. nov., isolated from forest soil, India

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Deepa, C.K.; Li, Wen-Jun; Tang, Shu-Kun; Pandey, A.

    (T) belongs to the subclass alpha-Proteobacteria, being related to the genus Paracoccus, and sharing highest sequence similarity with Paracoccus chinensis NBRC 104937 sup(T) (99.4%), Paracoccus marinus NBRC 100640 sup(T) (97.3%), Paracoccus koreensis Ch05 sup...

  14. A novel pathway for the synthesis of inositol phospholipids uses cytidine diphosphate (CDP)-inositol as donor of the polar head group.

    Science.gov (United States)

    Jorge, Carla D; Borges, Nuno; Santos, Helena

    2015-07-01

    We describe a novel biosynthetic pathway for glycerophosphoinositides in Rhodothermus marinus in which inositol is activated by cytidine triphosphate (CTP); this is unlike all known pathways that involve activation of the lipid group instead. This work was motivated by the detection in the R. marinus genome of a gene with high similarity to CTP:L-myo-inositol-1-phosphate cytidylyltransferase, the enzyme that synthesizes cytidine diphosphate (CDP)-inositol, a metabolite only known in the synthesis of di-myo-inositol phosphate. However, this solute is absent in R. marinus. The fate of radiolabelled CDP-inositol was investigated in cell extracts to reveal that radioactive inositol was incorporated into the chloroform-soluble fraction. Mass spectrometry showed that the major lipid product has a molecular mass of 810 Da and contains inositol phosphate and alkyl chains attached to glycerol by ether bonds. The occurrence of ether-linked lipids is rare in bacteria and has not been described previously in R. marinus. The relevant synthase was identified by functional expression of the candidate gene in Escherichia coli. The enzyme catalyses the transfer of L-myo-inositol-1-phosphate from CDP-inositol to dialkylether glycerol yielding dialkylether glycerophosphoinositol. Database searching showed homologous proteins in two bacterial classes, Sphingobacteria and Alphaproteobacteria. This is the first report of the involvement of CDP-inositol in phospholipid synthesis. © 2014 Society for Applied Microbiology and John Wiley & Sons Ltd.

  15. HRCT of the lung in collagen vascular diseases

    International Nuclear Information System (INIS)

    Diederich, S.; Roos, N.; Schmitz-Linneweber, B.; Gaubitz, M.; Peters, P.E.

    1996-01-01

    Collagen vascular diseases, representing systemic soft tissue disorders, may cause a broad spectrum of pathologic changes of the respiratory tract. The type and extent of manifestations can vary considerably among individuals and entities. This survey describes the chest radiographic and, in particular, high-resolution computed tomographic and, in particular, high-resolution computed tomographic (HRCT) findings of individual lesions of the respiratory tract. It includes fibrosing alveolitis (alveolitis, interstitial pneumonia, pulmonary fibrosis) and bronchial (bronchitis/bronchiolitis, bronchiectasis), pleural and vascular manifestations, as well as lymphadenopathy and abnormalities related to therapy. We present typical patterns of changes in progressive systemic sclerosis (PSS, scleroderma), systemic lupus erythematosus (SLE), mixed connective tissue disease (MCTD, Sharp syndrome), Sjoegren syndrome, overlap syndrome and rheumatoid arthritis (RA). Furthermore, we describe findings which are specific for individual entities such as esophageal involvement in PSS, acute pneumonitis and pulmonary hemorrhage in SLE, lymphoproliferative disease in Sjoegren syndrome and necrobiotic nodules in RA. (orig.) [de

  16. Community composition of picoeukaryotes in the South China Sea during winter

    Science.gov (United States)

    Lin, Yun-Chi; Chiang, Kuo-Ping; Kang, Lee-Kuo

    2017-07-01

    Picoeukaryotes, the smallest protists, are highly diverse and abundant in the ocean. However, little information is available about their community composition in the tropical northwestern Pacific Ocean. This study collected surface and deep chlorophyll maximum (DCM) waters from the South China Sea (SCS) to study the picoeukaryotic composition by constructing clone libraries of the 18S rRNA gene. The libraries were dominated by the heterotrophic organisms, alveolates and Rhizaria, which accounted for 46% and 16% of total clones, respectively. MALV-I was the most abundant group in alveolates, and Rhizaria appears to be a key organism in the SCS, particularly within DCM layers. These results indicate that parasitism is significant in the oligotrophic and tropical SCS. Apart from core-dinoflagellates, chlorophytes, haptophytes, cryptophytes and pelagophytes were other important contributors to primary production in pico-sized fraction based on quantitative and qualitative data.

  17. Alternatives to vitamin B1 uptake revealed with discovery of riboswitches in multiple marine eukaryotic lineages

    OpenAIRE

    McRose, Darcy; Guo, Jian; Monier, Adam; Sudek, Sebastian; Wilken, Susanne; Yan, Shuangchun; Mock, Thomas; Archibald, John M; Begley, Tadhg P; Reyes-Prieto, Adrian; Worden, Alexandra Z

    2014-01-01

    Vitamin B1 (thiamine pyrophosphate, TPP) is essential to all life but scarce in ocean surface waters. In many bacteria and a few eukaryotic groups thiamine biosynthesis genes are controlled by metabolite-sensing mRNA-based gene regulators known as riboswitches. Using available genome sequences and transcriptomes generated from ecologically important marine phytoplankton, we identified 31 new eukaryotic riboswitches. These were found in alveolate, cryptophyte, haptophyte and rhizarian phytopla...

  18. Estudio de las complicaciones postoperatorias tras la extracción quirúrgica de 190 terceros molares mandibulares incluidos

    OpenAIRE

    Peñarrocha Diago, Miguel; Sáez Cuesta, U.; Sanchis Bielsa, José María; Bagán Sebastián, José Vicente; Gay Escoda, Cosme

    2000-01-01

    Presentamos un estudio de las complicaciones surgidas en la extracción quirúrgica de 190 terceros molares inferiores incluidos. No se produjeron complicaciones intraoperatorias. Encontramos en 25 casos complicaciones postoperatorias (13%), las más frecuentes fueron edema persistente en 17 casos (9%) y alveolitis seca en 4 casos (2%). Otras complicaciones recogidas fueron 2 pacientes con parestesia del nervio dentario inferior, 1 con parestesia del nervio lingual y 1 caso de hemorragia postope...

  19. The diffuse interstitial lung disease - with emphasis in the idiopathic interstitial pneumonias

    International Nuclear Information System (INIS)

    Bustillo P, Jose G; Pacheco, Pedro M; Matiz, Carlos; Ojeda, Paulina; Carrillo B, Jorge A.

    2003-01-01

    The term diffuse interstitial lung disease, it refers to those diseases that commit the interstice basically, the space between the membrane basal epithelial and endothelial, although the damage can also commit the outlying air spaces and the vessels; the supplement is centered in the diffuse interstitial lung illness of unknown cause; well-known as idiopathic interstitial pneumonias, making emphasis in the more frequents, the pulmonary fibrosis idiopathic or cryptogenic fibrosant alveolitis

  20. Portable Low-Volume Therapy for Severe Blood Loss

    Science.gov (United States)

    2014-06-01

    components of BHB/M. To further optimize BHB/M we plan to continue to study the effect of melatonin in preserving mitochondrial function in the naturally...12 References 1. Pati, S., et al., Bone marrow derived mesenchymal stem cells inhibit inflammation and preserve vascular endothelial integrity...3 Severe Alveolitis (>5X), Alveolar edema, Inflammatory infiltrate, Hemorrhage Epithelial lifting and vacuolization from the tip to lower portion

  1. Detection of Saccharopolyspora rectivirgula by quantitative Real-Time PCR

    OpenAIRE

    Schäfer, Jenny; Kämpfer, Peter; Jäckel, Udo

    2011-01-01

    The thermophilic actinomycete species Saccharopolyspora rectivirgula has been associated with the exogen allergic alveolitis (EAA). EAA is caused by the inhalation of high amounts of airborne spores that can be found for example in environments of agricultural production, compost facilities, mushroom cultivation rooms, or rooms with technical air moistening. Because of the medical relevance of S. rectivirgula, a reliable detection system is needed. Therefore, a quantitative real-time polymera...

  2. Pneumonitis and lethal pulmonary fibrosis (Hamman-Rich syndrome) due to Parathione (E605) poisoning

    International Nuclear Information System (INIS)

    Lotz, W.; Fasske, E.; Forschungsinstitut Borstel

    1986-01-01

    A patient with chronic Parathione (E 605) poisoning was observed over a period of 55 days. During that time he developed progressive changes, which were identical to those of progressive idiopathic pulmonary fibrosis. The rapid development of an alveolitis, followed by a lethal pulmonary fibrosis, differed in no way, macroscopically nor microscopically, from the lung changes in paraquat poisoning (paraquat lung). The radiologic course has been correlated with the clinical and post mortem findings. (orig.) [de

  3. Valoración de un gel de clorhexidina en el control del dolor postextracción dental

    OpenAIRE

    López López, José, 1958-; Roselló Llabrés, Xavier; Jané Salas, Enric

    1998-01-01

    Presentamos un estudio doble ciego practicado en 248 extracciones (premolares y molares) para valorar la utilidad de un gel de clorhexidrina en el control del dolor postextracción dental, en la necesidad de medicación analgésica adicional y en la presencia o no de alveolitis. El grupo que utiliza el gel como coadyuvante en la extracción presenta un menor dolor con una p

  4. Changes in Morphology of Alveolar Buccal Walls Following Atraumatic Internal Root Fragmentation

    OpenAIRE

    Engelke, Wilfried; Beltrán, Víctor; Decco, Oscar; Valdivia-Gandur, Iván; Navarro, Pablo; Fuentes, Ramón

    2015-01-01

    The buccal alveolar wall represents the most important structure to provide shape and volume of the alveolous following tooth extraction. The aim of the study was the evaluation of buccal alveolar bone structures following minimally invasive surgery. In 15 patients (3 male, 12 female), aged 20–67 years, 3 central incisors, 5 lateral incisors, and 7 bicuspids were removed using flapless enucleation. The enucleation comprised endoscopically assisted mesiodistal root sectioning with inw...

  5. Local cellular response to stress of the lower lung

    Energy Technology Data Exchange (ETDEWEB)

    Tonnel, A.B.; Gosset, P.; Joseph, M.; Fournier, E.; Steenhouwer, F.; Mallart-Voisin, A.

    1983-01-01

    The cell populations in the alveoli are exposed to the environment and react differently to each type of challenge (mineral particles, toxic gases, infections, antigenic substances. . .). Amongst the best studied of these irritant factors is tobacco smoke which in the long term leads to a number of changes both in the distribution of alveolar cells and also their function and morphology. Amongst acute and sub-acute pathogens, bacterial infections produce a rapid poly-morpho-nuclear neutrophilia and then a lymphocytosis; oxygen and oxidising agents in general lead to a neutrophilia which amplifies the pulmonary parenchymal changes related to the release of toxic metabolites of oxygen. The inhalation of antigenic substances also disturbs the behaviour of alveolar cells: activation of macrophages in the presence of allergy in those sensitized to IgE and immediate attraction of neutrophils preceding a T lymphocyte alveolitis in hypersensitivity pneumonia. It is possible to categorise several patterns of reaction in intra-pulmonary cells when challenged by some insult, a direct cytotoxic action, the accumulation of inflammatory cells and immunological competence corresponding to the concept of ''a neutrophil alveolitis'' or a ''T cell alveolitis'' with the development of emphysematous lesions. An understanding of the cellular make-up present in the alveoli when reacting to an external pathogen enables a better approach to the pathophysiological mechanisms in question.

  6. 2005 dossier: granite. Tome: architecture and management of the geologic disposal; Dossier 2005: granite. Tome architecture et gestion du stockage geologique

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the geologic disposal of high-level and long-lived radioactive wastes in granite formations. Content: 1 - Approach of the study: main steps since the December 30, 1991 law, ANDRA's research program on disposal in granitic formations; 2 - high-level and long-lived (HLLL) wastes: production scenarios, waste categories, inventory model; 3 - disposal facility design in granitic environment: definition of the geologic disposal functions, the granitic material, general facility design options; 4 - general architecture of a disposal facility in granitic environment: surface facilities, underground facilities, disposal process, operational safety; 5 - B-type wastes disposal area: primary containers of B-type wastes, safety options, concrete containers, disposal alveoles, architecture of the B-type wastes disposal area, disposal process and feasibility aspects, functions of disposal components with time; 6 - C-type wastes disposal area: C-type wastes primary containers, safety options, super-containers, disposal alveoles, architecture of the C-type wastes disposal area, disposal process in a reversibility logics, functions of disposal components with time; 7 - spent fuels disposal area: spent fuel assemblies, safety options, spent fuel containers, disposal alveoles, architecture of the spent fuel disposal area, disposal process in a reversibility logics, functions of disposal components with time; 8 - conclusions: suitability of the architecture with various types of French granites, strong design, reversibility taken into consideration. (J.S.)

  7. Radiodiagnosis of yeast alveolits (a clinicoexperimental study)

    International Nuclear Information System (INIS)

    Amosov, I.S.; Smirnov, V.A.

    1984-01-01

    A clinicoroetgenological study was made of 115 workers engaged in the yeast production for different periods of time. Disorders of the respiration biomechanics were revealed depending on the period of service. These data were obtained as a result of the use of roentgenopneumopolygraphy. An experimental study was conducted to establish the nature of lesions in the bronchopulmonary system in allergic alveolitis. The effect of finely divided yeast dust on the bronchopulmonary system was studied on 132 guinea-pigs usinq microbronchography and morphological examination. As a result of the study it has been established that during the inhalation of yeast dust, notnceable dystrophy of the bronchi develops, the sizes of alveoli enlarge and part of them undergo emphysematous distension with the rupture of the interalveolar septa. In the course of the study, it has been shown that yeast dust is little agreessive, yeast alveolitis develops after many years of work. The clinical symptoms are non-specific and insignificant. X-ray and morphological changes are followed by the physical manifestations of yeast alveolitis

  8. Parasites of the hard clam Meretrix meretrix Linnaeus from Western Johor Straits, Malaysian

    Science.gov (United States)

    Azmi, Nur Fauzana; Ghaffar, Mazlan Abd.; Cob, Zaidi Che

    2014-09-01

    This study describes the apicomplexa as well as other parasites infecting organs/tissues of the hard clam Meretrix meretrix Linnaeus, from Merambong Shoal, Western Johor Straits, Malaysia. Samples were collected randomly by hand picking, in November and December 2013. Histological techniques were performed, stained using Masson's Trichrome protocol and observed under light microscope. The results showed that gonad and gill were the most infected organs followed by digestive gland, intestine and adductor muscle. No pathology condition was observed in the mantle. Histophatological examination showed that the gregarine, Nematopsis, unidentified coccidian and Perkinsus were found in the gill and gonad, and also in the numerous hemocytes. Other pathological conditions such as bacteria-like inclusion and intracellular bacteria were also observed in the same organs. Further investigations are needed particularly on other molluscs present at the study area. Understanding the morphology and pathology of parasites infecting mollusks are very important for management of the resources.

  9. Resting respiratory behavior in minimally instrumented toads - effects of very long apneas on blood gases and pH

    Directory of Open Access Journals (Sweden)

    F. C. Coelho

    Full Text Available Resting respiratory behavior of Bufo marinus in minimally instrumented toads is described for a period of 24 hours in which the animals are left undisturbed. Torpor-related long apneas are described and their implications for blood gas levels are investigated. Results show that the resting ventilation rate of Bufo marinus is much lower than that reported so far. Levels of arterial oxygen, carbon dioxide, and pH are monitored during artificial long apneas induced by anesthesia. The toads showed an unexpected ability to unload carbon dioxide by non-respiratory means, even while being kept on dry plastic box with no access to water. Oxygen arterial partial pressure dropped to very low levels after one hour of apnea. This suggests that these animals may endure very well severe hypoxia for long periods of time while in torpor.

  10. Resting respiratory behavior in minimally instrumented toads - effects of very long apneas on blood gases and pH

    Directory of Open Access Journals (Sweden)

    Coelho F. C.

    2003-01-01

    Full Text Available Resting respiratory behavior of Bufo marinus in minimally instrumented toads is described for a period of 24 hours in which the animals are left undisturbed. Torpor-related long apneas are described and their implications for blood gas levels are investigated. Results show that the resting ventilation rate of Bufo marinus is much lower than that reported so far. Levels of arterial oxygen, carbon dioxide, and pH are monitored during artificial long apneas induced by anesthesia. The toads showed an unexpected ability to unload carbon dioxide by non-respiratory means, even while being kept on dry plastic box with no access to water. Oxygen arterial partial pressure dropped to very low levels after one hour of apnea. This suggests that these animals may endure very well severe hypoxia for long periods of time while in torpor.

  11. Bufo alvarius: a potent hallucinogen of animal origin.

    Science.gov (United States)

    Weil, A T; Davis, W

    1994-01-01

    Anthropologists have long speculated that ancient peoples of Mesoameria used a toad, Bufo marinus, as a ritual intoxicant. This hypothesis rests on many iconographic and mythological representations of toads and on a number of speculative ethnographic reports. The authors reject B. marinus as a candidate for such use because of the toxicity of its venom. A more likely candidate is the Sonoran desert toad, Bufo alvarius, which secretes large amounts of the potent known hallucinogen, 5-methoxy-N,N-dimethyltryptamine (5-MeO-DMT). The authors demonstrate that the venom of B. alvarius, although known to be toxic when consumed orally, may be safely smoked and is powerfully psychoactive by that route of administration. These experiments are the first documentation of an hallucinogenic agent from the animal kingdom, and they provide clear evidence of a psychoactive toad that could have been employed by Precolumbian peoples of the New World.

  12. Kudoa spp. (Myxozoa, Multivalvulida) parasitizing fish caught in Aracaju, Sergipe, Brazil.

    Science.gov (United States)

    Eiras, Jorge Costa; Fujimoto, Rodrigo Yudi; Madi, Rubens Riscala; Jeraldo, Veronica de Lourdes Sierpe; Melo, Cláudia Moura de; Souza, Jônatas Dos Santos de; Diniz, José Antonio Picanço; Diniz, Daniel Guerreiro

    2016-01-01

    This study reports on Kudoa spp. (Myxozoa, Multivalvulida) from the fish species Lutjanus analis, Bagre marinus, Aspistor luniscutis and Lutjanus jocu, which were caught in Aracaju, state of Sergipe, Brazil. The parasites formed oval plasmodia around the esophagus of L. analis, and elongated plasmodia inside the skeletal muscle of B. marinus, A. luniscutis and L. jocu. Host myoliquefaction was not observed in all the cases studied. The current study provides a morphological and morphometric description of each parasite as well as a comparison with all the species described worldwide. Lack of molecular data impaired specific identification of the parasites. The importance of these parasites is discussed and the need for further studies on infections in Brazilian fish is emphasized because of the high economic impact of some Kudoa species which cause liquefaction in hosts' muscles and render these fish unsuitable for consumption.

  13. Chromosomes of South American Bufonidae (Amphibia, Anura Chromosomes of South American Bufonidae (Amphibia, Anura

    Directory of Open Access Journals (Sweden)

    Brum Zorrilla N.

    1973-09-01

    Full Text Available Karyotypes of eight of South American Bufonidae were studied: B.ictericus, B. spinulosus spinulosus, B. arenarum, B. g. fernandezae, B. g. d'orbignyi, B. crucifer, B. paracnemis and B. marinus. In all species 2n = 22 chromosomes were found. Neither heteromorphic pairs of chromosomes nor bivalents with characteristic morphology and behavior of sex chromosomesduring male meiosis were observed in any species.Karyotypes of eight of South American Bufonidae were studied: B.ictericus, B. spinulosus spinulosus, B. arenarum, B. g. fernandezae, B. g. d'orbignyi, B. crucifer, B. paracnemis and B. marinus. In all species 2n = 22 chromosomes were found. Neither heteromorphic pairs of chromosomes nor bivalents with characteristic morphology and behavior of sex chromosomesduring male meiosis were observed in any species.

  14. The Role of High Pressure and Inert Gases in the Production and Reversal of the High Pressure Neurological Syndrome.

    Science.gov (United States)

    1982-08-06

    as a beating of the pleopods of Marino- optimum mixture for the point where function of percentage of nitrous oxide mixed gammarus marinus (12) by...physiologic saline solution 52* 1.30 z .055 24 -13 :t 6.5 before injection; a-chloralose (Aldrich) was dissolved in saline solution containing ethylene glycol...in saline solu- tion containing 20 per cent polyoxyethylated caster oil. * Values obtained on decompression. After injection, the mice in their cages

  15. A common bottlenose dolphin (Tursiops truncatus) prey handling technique for marine catfish (Ariidae) in the northern Gulf of Mexico

    OpenAIRE

    Ronje, Errol I.; Barry, Kevin P.; Sinclair, Carrie; Grace, Mark A.; Barros, N?lio; Allen, Jason; Balmer, Brian; Panike, Anna; Toms, Christina; Mullin, Keith D.; Wells, Randall S.

    2017-01-01

    Few accounts describe predator-prey interactions between common bottlenose dolphins (Tursiops truncatus Montagu 1821) and marine catfish (Ariopsis felis Linnaeus 1766, Bagre marinus Mitchill 1815). Over the course of 50,167 sightings of bottlenose dolphin groups in Mississippi Sound and along the Florida coast of the Gulf of Mexico, severed catfish heads were found floating and exhibiting movements at the surface in close proximity to 13 dolphin groups that demonstrated feeding behavior. Thes...

  16. Primary structure of a multimeric protein, homologous to the PEP-utilizing enzyme family and isolated from a hyperthermophilic archaebacterium.

    Science.gov (United States)

    Cicicopol, C; Peters, J; Kellermann, J; Baumeister, W

    1994-12-19

    A large protein complex (approx. 2000 kDa) was found in the cytosol of the hyperthermophilic archaebacterium Staphylothermus marinus. The purified protein was shown to be a homomultimer of 93 kDa subunits, the primary structure of which was determined by nucleotide sequence analysis. The protein belongs to the family of phosphoenolpyruvate-utilizing enzymes and represents the first member characterized in archaebacteria. Its homomultimeric organisation differs from the typically dimeric structure of its eubacterial and eukaryotic counterparts.

  17. Phylogenetic distribution of a male pheromone that may exploit a nonsexual preference in lampreys

    Science.gov (United States)

    Buchinger, Tyler J.; Bussy, Ugo; Li, Ke; Wang, Huiyong; Huertas, Mar; Baker, Cindy F.; Jia, Liang; Hayes, Michael C.; Li, Weiming; Johnson, Nicholas

    2017-01-01

    Pheromones are among the most important sexual signals used by organisms throughout the animal kingdom. However, few are identified in vertebrates, leaving the evolutionary mechanisms underlying vertebrate pheromones poorly understood. Pre-existing biases in receivers’ perceptual systems shape visual and auditory signaling systems, but studies on how receiver biases influence the evolution of pheromone communication remain sparse. The lamprey Petromyzon marinus uses a relatively well-understood suite of pheromones and offers a unique opportunity to study the evolution of vertebrate pheromone communication. Previous studies indicate that male signaling with the mating pheromone 3-keto petromyzonol sulfate (3kPZS) may exploit a nonsexual attraction to juvenile-released 3kPZS that guides migration into productive rearing habitat. Here, we infer the distribution of male signaling with 3kPZS using a phylogenetic comparison comprising six of ten genera and two of three families. Our results indicate that only P. marinus and Ichthyomyzon castaneus release 3kPZS at high rates. Olfactory and behavioral assays with P. marinus, I. castaneus and a subset of three other species that do not use 3kPZS as a sexual signal indicate that male signaling might drive the evolution of female adaptations to detect 3kPZS with specific olfactory mechanisms and respond to 3kPZS with targeted attraction relevant during mate search. We postulate that 3kPZS communication evolved independently in I. castaneus and P. marinus, but cannot eliminate the alternative that other species lost 3kPZS communication. Regardless, our results represent a rare macroevolutionary investigation of a vertebrate pheromone and insight into the evolutionary mechanisms underlying pheromone communication.

  18. Cane toads a threat to West Indian wildlife: mortality of Jamaican boas attributable to toad ingestion

    Science.gov (United States)

    Byron S. Wilson; Susan E. Koenig; Rick van Veen; Erika Miersma; D. Craig. Rudolph

    2011-01-01

    The notorious ‘‘cane toad’’ (Bufo marinus) is considered to be one of the 100 worst invasive species in the world. A native of South and Central America, Mexico, and the Rio Grande Valley of the United States, this large toad was intentionally introduced to islands in the Caribbean, and subsequently throughout the southern Pacific, as a biological control agent to...

  19. Evidence for partial overlap of male olfactory cues in lampreys

    Science.gov (United States)

    Buchinger, Tyler J.; Li, Ke; Huertas, Mar; Baker, Cindy F.; Jia, Liang; Hayes, Michael C.; Li, Weiming; Johnson, Nicholas S.

    2016-01-01

    Animals rely on a mosaic of complex information to find and evaluate mates. Pheromones, often comprised of multiple components, are considered to be particularly important for species-recognition in many species. While the evolution of species-specific pheromone blends is well-described in many insects, very few vertebrate pheromones have been studied in a macro-evolutionary context. Here, we report a phylogenetic comparison of multi-component male odours that guide reproduction in lampreys. Chemical profiling of sexually mature males from eleven species of lamprey, representing six of ten genera and two of three families, indicated the chemical profiles of sexually mature male odours are partially shared among species. Behavioural assays conducted with four species sympatric in the Laurentian Great Lakes indicated asymmetric female responses to heterospecific odours, where Petromyzon marinus were attracted to male odour collected from all species tested but other species generally preferred only the odour of conspecifics. Electro-olfactogram recordings from P. marinusindicated that although P. marinus exhibited behavioural responses to odours from males of all species, at least some of the compounds that elicited olfactory responses were different in conspecific male odours compared to heterospecific male odours. We conclude that some of the compounds released by sexually mature males are shared among species and elicit olfactory and behavioural responses in P. marinus, and suggest that our results provide evidence for partial overlap of male olfactory cues among lampreys. Further characterization of the chemical identities of odour components is needed to confirm shared pheromones among species.

  20. Characterization of Escherichia coli populations from gulls, landfill trash, and wastewater using ribotyping.

    Science.gov (United States)

    Nelson, M; Jones, S H; Edwards, C; Ellis, J C

    2008-08-19

    Due to their opportunistic and gregarious nature, gulls may be important reservoirs and vectors for anthropogenically derived fecal pathogens in coastal areas. We used ribotyping, a genotypic bacterial source tracking method, to compare populations of Escherichia coli among herring gulls Larus argentatus, great black-backed gulls L. marinus, wastewater, and landfill trash in New Hampshire and Maine, USA. Concentrations of E. coli in gull feces varied widely among individuals, but were generally high (6.0 x 10(1) to 2.5 x 10(9) g(-1) wet weight). Of 39 E. coli isolates from L. argentatus, 67% had banding patterns that were > or = 90% similar to those from wastewater and trash, whereas only 39% of 36 L. marinus isolates exhibited > or = 90% similarity to these sources. Strains of E. coli from gulls matched (> or = 90% similarity) more strains from wastewater (39% matching) than from trash (15% matching). E. coli isolates from L. marinus feces exhibited a greater diversity of banding patterns than did isolates from L. argentatus. There were more unique E. coli banding patterns in trash samples than in wastewater, and higher diversity indices in the former compared to the latter. These findings suggest that both species of gulls, especially L. argentatus, obtain fecal bacteria from wastewater and landfill trash, which they may transport to recreational beaches and waters. Our results also indicate that E. coli populations may vary widely between gull species, and between the anthropogenic habitats that they frequent, i.e. landfills and wastewater treatment facilities.

  1. Combined effects of predator cues and competition define habitat choice and food consumption of amphipod mesograzers.

    Science.gov (United States)

    Beermann, Jan; Boos, Karin; Gutow, Lars; Boersma, Maarten; Peralta, Ana Carolina

    2018-03-01

    Predation has direct impact on prey populations by reducing prey abundance. In addition, predator presence alone can also have non-consumptive effects on prey species, potentially influencing their interspecific interactions and thus the structure of entire assemblages. The performance of potential prey species may, therefore, depend on both the presence of predators and competitors. We studied habitat use and food consumption of a marine mesograzer, the amphipod Echinogammarus marinus, in the presence/absence of a fish mesopredator and/or an amphipod competitor. The presence of the predator affected both habitat choice and food consumption of the grazer, indicating a trade-off between the use of predator-free space and food acquisition. Without the predator, E. marinus were distributed equally over different microhabitats, whereas in the presence of the predator, most individuals chose a sheltered microhabitat and reduced their food consumption. Furthermore, habitat choice of the amphipods changed in the presence of interspecific competitors, also resulting in reduced feeding rates. The performance of E. marinus is apparently driven by trait-mediated direct and indirect effects caused by the interplay of predator avoidance and competition. This highlights the importance of potential non-consumptive impacts of predators on their prey organisms. The flexible responses of small invertebrate consumers to the combined effects of predation and competition potentially lead to changes in the structure of coastal ecosystems and the multiple species interactions therein.

  2. 2005 dossier: clay. Tome: phenomenological evolution of the geologic disposal

    International Nuclear Information System (INIS)

    2005-01-01

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the phenomenological processes taking place in an argilite-type geologic disposal facility for high-level and long-lived (HLLL) radioactive wastes. Content: 1 - introduction: goal, input data, time and space scales, long-time forecasting of the phenomenological evolution; 2 - the Meuse/Haute-Marne site, the HLLL wastes and the disposal concepts: impact of the repository architecture; 3 - initial state of the geologic environment prior to the building up of the repository: general framework, geologic formations, tectonics and fractures, surface environment, geologic synthesis; 4 - phenomenological processes: storage-related processes, geodynamics-related processes, time scales of processes and of radionuclides migration, independence and evolution similarities of the repository and of the geologic environment; 5 - heat loads: heat transfers between containers and geologic formations, spatial organization of the thermal load, for C-type wastes and spent fuels, for B-type wastes, synthesis of the repository thermal load; 6 - flows and liquid solution and gas transfers: hydraulic behaviour of surrounding Jurassic formations (Tithonian, Kimmeridgian, Callovian, Oxfordian); 7 - chemical phenomena: chemical evolution of ventilated facilities (alveoles, galleries, boreholes), chemical evolution of B-type waste alveoles and of gallery and borehole sealing after closure, far field chemical evolution of Callovo-Oxfordian argilites and of other surrounding formations; 8 - mechanical evolution of the disposal and of the surrounding geologic environment: creation of an initial excavated damaged zone (EDZ), mechanical evolution of ventilated galleries, alveoles and sealing before and after closure, large-scale mechanical evolution; 9 - geodynamical evolution of the Callovo-Oxfordian and other surrounding formations and of the surface environment: internal

  3. Rapamycin attenuates bleomycin-induced pulmonary fibrosis in rats and the expression of metalloproteinase-9 and tissue inhibitors of metalloproteinase-1 in lung tissue.

    Science.gov (United States)

    Jin, Xiaoguang; Dai, Huaping; Ding, Ke; Xu, Xuefeng; Pang, Baosen; Wang, Chen

    2014-01-01

    Idiopathic pulmonary fibrosis (IPF) is the most common and devastating form of interstitial lung disease (ILD) in the clinic. There is no effective therapy except for lung transplantation. Rapamycin is an immunosuppressive drug with potent antifibrotic activity. The purpose of this study was to examine the effects of rapamycin on bleomycin-induced pulmonary fibrosis in rats and the relation to the expression of metalloproteinase-9 (MMP-9) and tissue inhibitor of metalloproteinase-1 (TIMP-1). Sprague-Dawley rats were treated with intratracheal injection of 0.3 ml of bleomycin (5 mg/kg) in sterile 0.9% saline to make the pulmonary fibrosis model. Rapamycin was given at a dose of 0.5 mg/kg per gavage, beginning one day before bleomycin instillation and once daily until animal sacrifice. Ten rats in each group were sacrificed at 3, 7, 14, 28 and 56 days after bleomycin administration. Alveolitis and pulmonary fibrosis were semi-quantitatively assessed after HE staining and Masson staining under an Olympus BX40 microscope with an IDA-2000 Image Analysis System. Type I and III collagen fibers were identified by Picro-sirius-polarization. Hydroxyproline content in lung tissue was quantified by a colorimetric-based spectrophotometric assay, MMP-9 and TIMP-1 were detected by immunohistochemistry and by realtime quantitative reverse transcriptase polymerase chain reaction (RT-PCR). Bleomycin induced alveolitis and pulmonary fibrosis of rats was inhibited by rapamycin. Significant inhibition of alveolitis and hydroxyproline product were demonstrated when daily administration of rapamycin lasted for at least 14 days. The inhibitory efficacy on pulmonary fibrosis was unremarkable until rapamycin treatment lasted for at least 28 days (P pulmonary fibrosis, which is associated with decreased expression of MMP-9 and TIMP-1.

  4. Diversity of Picoeukaryotes at an Oligotrophic Site off the Northern Red Sea Coast

    KAUST Repository

    Espinosa, Francisco Jose Acosta

    2012-05-01

    Picoeukaryotes are protist 3 µm belonging to a wide diversity of taxonomic groups, and they are an important constituent of the ocean microbiota, performing essential ecological roles in marine trophic chains and in nutrient and carbon budgets. Despite this, the true extent of their diversity is currently unknown, and in the last decade molecular surveys have uncovered a substantial number of previously unknown groups from all taxonomic levels. No studies on this group have been done so far on the Red Sea, a unique marine environment characterized by oligotrophic conditions and high irradiance, salinity and water temperature. We sampled the surface waters of a site near the northern Red Sea coast, and analyzed the picoeukaryotic diversity through the construction of PCR clone libraries using the 18S ribosomal gene. The community captured by our library is dominated by three main groups, the alveolates (32%), chlorophytes (32%) and Stramenopiles (20.55%). Members of Radiolaria, Cercozoans and Haptophyta were also found, although in low abundances. Photosynthetic organisms are especially diverse and abundant in the sample, with heterotrophic organism mostly composed by the mostly parasitic novel alveolates and bacterivorous stramenopiles. Novel clades were detected among the Novel Alveolates- II and the photosynthetic stramenopiles taxa, which suggests that they may be part of a number of groups unique to the basin and adapted to the high salinity and temperature conditions. This is the first study done on the Red Sea focusing on the diversity of the complete picoeukaryotic fraction, and provides a stepping stone in the characterization of the picoeukaryotic component of the microbial diversity of the basin.

  5. Inflammatorisches Verhalten von Typ-II Zellen unter mechanischer Belastung (Zell Stretch in vitro)

    OpenAIRE

    Aslan- Akineden, Sevil

    2006-01-01

    In der vorliegenden Arbeit wurde untersucht, ob alveoläre Typ-II Zellen unter mechanischem Stress (z.B. unter künstlicher Beatmung) in der Intensivmedizin auf bakterielle Stimulantien (z.B. LPS) sensibler reagieren und damit vermehrt inflammatorische Cytokine freisetzen, die wiederum das Auftreten von ARDS und MSOF (Multiple System Organ Failure) begünstigen. Zu diesem Zweck wurden Typ-II Zellen aus Rattenlungen isoliert (und L2–Zellen) und der Einfluss mechanischer Dehnung auf das proinflam...

  6. Concurrent conjunctivitis and placentitis in aborted bovine fetuses.

    Science.gov (United States)

    Murray, R D

    1991-11-01

    Consistent histopathological lesions were found in 10 out of 136 aborted fetuses examined during a three year period, using a multi-disciplinary diagnostic investigation technique. Fetuses exhibited a generalized mononuclear inflammatory cell infiltration, accompanied by distinctive lesions of conjunctival hyperplasia and goblet cell formation, alveolitis, and necrotic placentitis. In two cases where amnion was also examined, a chronic amnionitis was present. No consistent laboratory findings could be related to these cases. The fetal and placental lesions described were similar to those associated with experimental inoculation of Ureaplasma diversum in pregnant cows, and with field isolations of the same organism in aborting cattle.

  7. Telonemia, a new protist phylum with affinity to chromist lineages

    DEFF Research Database (Denmark)

    Shalchian-Tabrizi, K.; Eikrem, W.; Klaveness, D.

    2006-01-01

    , such as the alveolates and heterokonts. Using the same approach on coastal samples, we have identified a novel group of protist small subunit (SSU) rDNA sequences that do not correspond to any phylogenetic group previously identified. Comparison with other sequences obtained from cultures of heterotrophic protists...... showed that the environmental sequences grouped together with Telonema, a genus known since 1913 but of uncertain taxonomic affinity. Phylogenetic analyses using four genes (SSU, Hsp90, alpha-tubulin and beta-tubulin), and accounting for gamma- and covarion-distributed substitution rates, revealed...

  8. Terapi Kombinasi Root Debridement dan Antibiotik terhadap Periodontitis Agresif

    Directory of Open Access Journals (Sweden)

    Dahlia Herawati

    2016-10-01

    Full Text Available Latar Belakang. Kerusakan periodontal yang signifikan secara klinis selama dewasa atau awal masa dewasa dikenal sebagai periodontitis agresif. Perawatan standar scaling dan root planing sering kurang memuaskan hasilnya sehingga perlu mempelajari periodontitis agresif secara tuntas dan terapi yang harus diberikan sehingga perawatan bisa memberikan hasil yang optimal. Tujuan. Untuk mengupas tentang periodontitis agresif agar bisa menegakkan diagnosis, serta mendapatkan hasil yang optimal dalam perawatannya. Ringkasan Pembahasan. Gigi goyah disebabkan oleh sedikit atau rapuhnya tulang alveoler pendukung gigi sehingga gigi tidak bisa menjalankan fungsinya. Periodontitis agresif menyerang seseorang, diketahui oleh dokter gigi sering tidak dari awal, akan tetapi setelah penyakit tersebut berlanjut. Skrening melalui foto Rontgen pada penderita periodontitis usia awal dewasa berguna untuk mengetahui secara dini periodontitis agresif. Pada perawatan regeneratif dengan mengganti tulang alveoler yang hilang, terlebih dahulu menghentikan aktivitas periodontitis agresif, yaitu dengan memberikan antibiotik dikombinasi dengan root debridement baik secara bedah maupun non bedah. Kesimpulan. 1. Mengenali dan merawat periodontitis agresif secara dini dapat mencegah kerusakan jaringan periodontal yang berat. 2. Perawatan periodontitis agresif terutama mengeliminir bakteri dengan kombinasi tindakan mekanis root debridement dan pemberian antibiotik yang tepat dalam jagka waktu yang cukup secara konsisten. 3. Pemberian antibiotik sebaiknya berdasarkan tes laboratorium bakteri resiten.   Background. Periodontal destruction is clinically significant during adulthood or early adulthood is known as aggressive periodontitis. Nursing standard scaling and root planing is often less satisfactory result, so need to study of periodontits aggressive thoroughly and therapy should be given so that treatments can provide result that optimal. The Purpose. To investigated the

  9. ANTISYNTHETASE SYNDROME IS THE MOST SEVERE SUBTYPE OF POLYMYOSITIS/DERMATOMYOSITIS:DESCRIPTION OF CASES

    Directory of Open Access Journals (Sweden)

    Olga Alekseyevna Antelava

    2009-01-01

    Full Text Available Polymyositis (PM and dermatomyositis (DM are autoimmune skeletal muscle diseases of unknown etiology, which are referred to as systemic connective tissue diseases and united under the common term Tidiopathic inflammatory myopathiesy. The most severe subtype of PM/DM is the antisynthetase syndrome that is characterized by a certain sympathocomplex, including interstitial lung lesion that is one of the most common visceral changes. Of interest are the specific features of the antisynthetase syndrome, its onset, the course and pulmonary manifestations of fibrosing alveolitis, unlike the classical course of PM/DM. Two clinical cases of the antisynthetase syndrome are given.

  10. Progressive dyspnea due to pulmonary carcinoid tumorlets

    Directory of Open Access Journals (Sweden)

    Anastasios Kallianos

    2017-01-01

    Full Text Available This is a case description of a female patient, 77 years-old, who presented with progressive dyspnea and cough. She had a mild hypoxemia in the arterial blood gases (PaO2 72 mmHg and normal spirometry. The chest computer tomography revealed diffuse “ground glass” opacities, segmental alveolitis, bronchiectasis, fibrotic lesions and numerous micronodules. A thoracoscopy was performed and the obtained biopsy showed carcinoid tumorlets, with positive CK8/18, CD56, TTF-1 and synaptophysin immunohistochemical markers. Pulmonary carcinoid tumorlets are rare, benign lesions and individuals with tumorlets are typically asymptomatic. Our report presents a symptomatic clinical case of carcinoid tumorlet.

  11. Steady streaming: A key mixing mechanism in low-Reynolds-number acinar flows

    Science.gov (United States)

    Kumar, Haribalan; Tawhai, Merryn H.; Hoffman, Eric A.; Lin, Ching-Long

    2011-01-01

    Study of mixing is important in understanding transport of submicron sized particles in the acinar region of the lung. In this article, we investigate transport in view of advective mixing utilizing Lagrangian particle tracking techniques: tracer advection, stretch rate and dispersion analysis. The phenomenon of steady streaming in an oscillatory flow is found to hold the key to the origin of kinematic mixing in the alveolus, the alveolar mouth and the alveolated duct. This mechanism provides the common route to folding of material lines and surfaces in any region of the acinar flow, and has no bearing on whether the geometry is expanding or if flow separates within the cavity or not. All analyses consistently indicate a significant decrease in mixing with decreasing Reynolds number (Re). For a given Re, dispersion is found to increase with degree of alveolation, indicating that geometry effects are important. These effects of Re and geometry can also be explained by the streaming mechanism. Based on flow conditions and resultant convective mixing measures, we conclude that significant convective mixing in the duct and within an alveolus could originate only in the first few generations of the acinar tree as a result of nonzero inertia, flow asymmetry, and large Keulegan–Carpenter (KC) number. PMID:21580803

  12. Metabolic pathway redundancy within the apicomplexan-dinoflagellate radiation argues against an ancient chromalveolate plastid

    KAUST Repository

    Waller, Ross F.

    2015-12-08

    The chromalveolate hypothesis presents an attractively simple explanation for the presence of red algal-derived secondary plastids in 5 major eukaryotic lineages: “chromista” phyla, cryptophytes, haptophytes and ochrophytes; and alveolate phyla, dinoflagellates and apicomplexans. It posits that a single secondary endosymbiotic event occurred in a common ancestor of these diverse groups, and that this ancient plastid has since been maintained by vertical inheritance only. Substantial testing of this hypothesis by molecular phylogenies has, however, consistently failed to provide support for the predicted monophyly of the host organisms that harbour these plastids—the “chromalveolates.” This lack of support does not disprove the chromalveolate hypothesis per se, but rather drives the proposed endosymbiosis deeper into the eukaryotic tree, and requires multiple plastid losses to have occurred within intervening aplastidic lineages. An alternative perspective on plastid evolution is offered by considering the metabolic partnership between the endosymbiont and its host cell. A recent analysis of metabolic pathways in a deep-branching dinoflagellate indicates a high level of pathway redundancy in the common ancestor of apicomplexans and dinoflagellates, and differential losses of these pathways soon after radiation of the major extant lineages. This suggests that vertical inheritance of an ancient plastid in alveolates is highly unlikely as it would necessitate maintenance of redundant pathways over very long evolutionary timescales.

  13. Mast cell and histamine content of human bronchoalveolar lavage fluid.

    Science.gov (United States)

    Agius, R M; Godfrey, R C; Holgate, S T

    1985-01-01

    Bronchoalveolar lavage was performed in 97 patients including control patients with bronchial carcinoma (24) and patients with sarcoidosis (20), cryptogenic fibrosing alveolitis (9), and asthma (4), and others. Cytocentrifuged slides were stained by two methods: May-Grünwald Giemsa and toluidine blue. In the last 32 subjects the bronchoalveolar lavage fluid was separated into supernatant and cell pellet for the subsequent assay of the performed mast cell mediator, histamine. Comparison of the two methods of staining showed a bias towards toluidine blue. Controls had a differential mean (SE) mast cell count of 0.07% (0.01%). Higher counts were noted in cryptogenic fibrosing alveolitis--0.61% (0.15%) (p less than 0.001)--and in sarcoidosis--0.14% (0.02%) (p less than 0.05). There was a strong correlation between absolute mast cell counts and cell lysate histamine concentration (r = 0.78, p less than 0.001). Less strong, significant, correlations between supernatant histamine concentration and absolute mast cell counts (r = 0.48, p less than 0.01) or cell lysate histamine concentration (r = 0.72, p less than 0.01) were also found. Derived mean values of histamine per mast cell ranged from 3.7 to 10.9 picograms. The mean histamine content of lavage fluid supernatant as a percentage of the total lavage fluid histamine was 24.9% (3.3%). The possible clinical significance of these findings is discussed. Images PMID:4060097

  14. Lung morphometry, collagen and elastin content: changes after hyperoxic exposure in preterm rabbits

    Directory of Open Access Journals (Sweden)

    Renata Suman Mascaretti

    2009-11-01

    Full Text Available INTRODUCTION: Elastic and collagen fiber deposition increases throughout normal lung development, and this fiber network significantly changes when development of the lung is disturbed. In preterm rats and lambs, prolonged hyperoxic exposure is associated with impaired alveolization and causes significant changes in the deposition and structure of elastic fibers. OBJECTIVES: To evaluate the effects of hyperoxic exposure on elastic and collagen fiber deposition in the lung interstitial matrix and in alveolarization in preterm rabbits. METHODS: After c-section, 28-day preterm New-Zealand-White rabbits were randomized into 2 study groups, according to the oxygen exposure, namely: Room air (oxygen = 21% or Oxygen (oxygen > 95%. The animals were killed on day 11 and their lungs were analyzed for the alveolar size (Lm, the internal surface area (ISA, the alveoli number, and the density and distribution of collagen and elastic fibers. RESULTS: An increase in the Lm and a decrease in the alveoli number were observed among rabbits that were exposed to hyperoxia with no differences regarding the ISA. No difference in the density of elastic fibers was observed after oxygen exposure, however there were fewer collagen fibers and an evident disorganization of fiber deposition. DISCUSSION: This model reproduces anatomo-pathological injuries representing the arrest of normal alveolar development and lung architecture disorganization by just a prolonged exposition to oxygen. CONCLUSIONS: In the preterm rabbit, prolonged oxygen exposure impaired alveolization and also lowered the proportion of collagen fibers, with an evident fiber network disorganization.

  15. A Rare Case of Non-Small Cell Carcinoma of Lung Presenting as Miliary Mottling

    Directory of Open Access Journals (Sweden)

    Ballaekere Jayaram Subhashchandra

    2013-03-01

    Full Text Available Miliary mottling on chest radiography is seen in miliary tuberculosis, certain fungal infections, sarcoidosis, coal miner’s pneumoconiosis, silicosis, hemosiderosis, fibrosing alveolitis, acute extrinsic allergic alveolitis, pulmonary eosinophilic syndrome, pulmonary alveolar proteinosis, and rarely in hematogenous metastases from the primary cancers of the thyroid, kidney, trophoblasts, and some sarcomas. Although very infrequent, miliary mottling can be seen in primary lung cancers. Herein, we report the case of a 28-year-old female with chest X-ray showing miliary mottling. Thoracic computed tomography (CT features were suggestive of tuberculoma with miliary tuberculosis. CT-guided fine needle aspiration cytology confirmed the diagnosis as lower-lobe, left lung non-small cell carcinoma (adenocarcinoma. It is rare for the non-small cell carcinoma of the lung to present as miliary mottling. The rarity of our case lies in the fact that a young, non-smoking female with miliary mottling was diagnosed with non-small cell carcinoma of the lung.

  16. [Dental technician's pneumoconiosis; a case report].

    Science.gov (United States)

    Karaman Eyüboğlu, Canan; Itil, Oya; Gülşen, Aşkin; Kargi, Aydanur; Cimrin, Arif

    2008-01-01

    Since 1939, it has been known that, silicosis and extrinsic allergic alveolitis can be seen among dental technicians. The interstitial disease caused by the exposure to complex substances used by dental technicians is classified as a special group called dental technician's pneumoconiosis. A 36-year-old man, who has no smoking history, presented with severe dyspnea. He had worked in different dental laboratories for 22 years, but he did not have respiratory symptoms until five years ago. After that date, he had hospitalized and had been examined for respiratory pathologies for many times. He had came to our clinic, because of the progression of his dyspnea. Diffuse pulmonary parenchymal infiltrates which can be related with pneumoconiosis and chronic type 1 respiratory deficiency had been diagnosed as the result of the examinations. While he has no history of smoking or any other risk factors or diseases in his medical history, the case was accepted as dental technician's pneumoconiosis. The factors related with the pathogenesis of dental technician's pneumoconiosis are; the complex compound of the substances (metal dusts, silica, plaster, wax and resins, chemical liquids, methyl methacrylate) used in this sector and their effects on the lung parenchyma. Extrinsic allergic alveolitis related with methyl methacrylate has been reported. The most important factor to acquire an occupational lung disease is a complex occupational exposure. The insufficient workplace airing and the lack of preventive measures added on this exposure, the risks become much more greater.

  17. Astragalus injection attenuates bleomycin-induced pulmonary fibrosis via down-regulating Jagged1/Notch1 in lungs.

    Science.gov (United States)

    Zhou, Yan; Liao, Shiping; Zhang, Zhongwei; Wang, Bo; Wan, Lihong

    2016-03-01

    Inhibition of Notch signalling is a potential therapeutic strategy for pulmonary fibrosis. This study was designed to investigate the antifibrosis effects and possible mechanism of astragalus injection (AI) on bleomycin (BLM)-induced pulmonary fibrosis in rats. Pulmonary fibrosis was induced by intratracheal instillation of bleomycin (5 mg/kg) in male SD rats. All rats received daily intraperitoneally administration of dexamethasone (DEX, 3 mg/kg), astragalus injection (AI, 8 g/kg) or saline 1 day after bleomycin instillation daily for 28 days. Histological changes in the lung were evaluated by haematoxylin and eosin and Masson's trichrome staining. The expression of α-smooth muscle protein (α-SMA) was assayed by immunohistochemical (IHC). The mRNA and protein level of Jagged1, Notch1 and transforming growth factor-β1 (TGF-β1) was analysed by qPCR and Western blot. BLM-induced severe alveolitis and pulmonary fibrosis; together with significant elevation of α-SMA, TGF-β1, Jagged1 and Notch1. Astragalus injection (AI, 8 g/kg) administration notably attenuated the degree of alveolitis and lung fibrosis, and markedly reduced the elevated levels of α-SMA, TGF-β1, Jagged1 and Notch1 in lungs. Astragalus injection (AI, 8 g/kg) may exert protective effects on bleomycin-induced pulmonary fibrosis via downregulating Jagged1/Notch1 in lung. © 2016 Royal Pharmaceutical Society, Journal of Pharmacy and Pharmacology.

  18. Anti-depressants make amphipods see the light.

    Science.gov (United States)

    Guler, Yasmin; Ford, Alex T

    2010-09-01

    The effects of serotonin altering parasites, serotonin, the anti-depressant fluoxetine, plus two other highly prescribed pharmaceuticals (carbamazepine and diclofenac) on the behaviour of the marine amphipod, Echinogammarus marinus were investigated. Acanthocephalan parasites are known to alter the swimming behaviour in their amphipod hosts through changes in serotonergic activity resulting in increased predation. Behavioural assays were adapted to record changes in phototaxis and geotaxis behaviour in male E. marinus following 7, 14 and 21 days exposure to serotonin and each pharmaceutical compound at 4 concentrations compared to a control (between 10 ng/L and 10 microg/L). E. marinus infected with acanthocephalans parasites had both significantly higher phototaxis and geotaxis scores than those of uninfected specimens. Phototaxis and geotaxis behaviour increased significantly in a concentration-dependent manner with exposure to serotonin. Fluoxetine significantly altered phototaxis and geotaxis activity in what appeared to be a non-monotonic concentration response curve with the greatest behavioural changes observed at 100 ng/L. The main patterns of these behavioural responses were consistent between two trials and the 3 weeks exposure with specimens spending more time within the light and occurring higher in the water column. No obvious trends could be concluded in the phototaxis and geotaxis scores from individuals exposed to carbamazepine or diclofenac as might be expected from their known mode of action. From this study phototaxis and geotaxis behaviour have been observed to be affected by exposure to serotonin modulators. Parasite studies have shown strong links between changes in behaviour and increased predation risk correlating with changes in serotonergic activity. This study has highlighted the potential for highly prescribed anti-depressant drugs to change the behaviour of an ecologically relevant marine species in ways which could conceivably lead to

  19. Analyses of length and age distributions using continuation-ratio logits

    DEFF Research Database (Denmark)

    Rindorf, Anna; Lewy, Peter

    2001-01-01

    allows statistical testing of the effects of both continuous and discrete variables. Further, by utilising the smoothness of length and age distributions as a function of length, the method provides more accurate estimates of these distributions than traditional methods. The observations are assumed...... to be multinomially distributed, but cases in which the variance exceeds that of this distribution may also be analysed. The implementation of the method in existing statistical analysis software is straightforward and is demonstrated using length and age distributions of the lesser sandeel, Ammodytes marinus Raitt...

  20. Does copepod size determine food consumption of particulate feeding fish?

    DEFF Research Database (Denmark)

    Deurs, Mikael van; Koski, Marja; Rindorf, Anna

    2014-01-01

    The climate-induced reduction in the mean copepod size, mainly driven by a decrease in the abundance of the large Calanus finmarchicus around 1987, has been linked to the low survival of fish larvae in the North Sea. However, to what extent this sort of reduction in copepod size has any influence...... on adult particulate feeding fish is unknown. In the present study, we investigated the hypothesis that the availability of the large copepods determines food consumption and growth conditions of lesser sandeel (Ammodytes marinus) in the North Sea. Analysis of stomach content suggested that food...

  1. Research in Biological and Medical Sciences Including Biochemistry, Communicable Disease and Immunology, Internal Medicine, Physiology, Psychiatry, Surgery, and Veterinary Medicine. Volume 1

    Science.gov (United States)

    1979-09-01

    circuit current by Dithiohrei- tol tDTT) and Dehydroascorbic Acid ( DHA ) in B. marinus. Abstr. Amer. Soc. Neph 12:1979. 20. McNeil, J., Butkus, D. and...aud Sorkin, M.I., Pathophysiology of a vasomotor and nephrotoxic model of acute renal failure in the dog. Kid . Int. 10:586- j92, 1976. Z. Schrier, R.W...Acute Renal Failure. Kid . Int. 15:205-216, 1979. 3. Fiamenbaum, W. Pathophysiology of Acute Renal Failure. Arch. Int. Med. 131:911-928, 1973. 4

  2. Complete genome sequence of the mitochondrial DNA of the river lamprey, Lethenteron japonicum.

    Science.gov (United States)

    Kawai, Yuri L; Yura, Kei; Shindo, Miyuki; Kusakabe, Rie; Hayashi, Keiko; Hata, Kenichiro; Nakabayashi, Kazuhiko; Okamura, Kohji

    2015-01-01

    Lampreys are eel-like jawless fishes evolutionarily positioned between invertebrates and vertebrates, and have been used as model organisms to explore vertebrate evolution. In this study we determined the complete genome sequence of the mitochondrial DNA of the Japanese river lamprey, Lethenteron japonicum, using next-generation sequencers. The sequence was 16,272 bp in length. The gene content and order were identical to those of the sea lamprey, Petromyzon marinus, which has been the reference among lamprey species. However, the sequence similarity was less than 90%, suggesting the need for the whole-genome sequencing of L. japonicum.

  3. Status report of the Pacific lamprey (Lampetra tridentata) in the Columbia River Basin

    International Nuclear Information System (INIS)

    Close, D.A.; Fitzpatrick, M.; Li, H.; James, G.

    1995-07-01

    The widespread decline of Pacific lamprey (Lampetra tridentata) in the Pacific Northwest, especially in the Columbia River system has led to concerns and questions from a number of regional agencies, Native American tribes, and the public. To address these concerns, new research efforts must focus on specific problems associated with this understudied species. The preservation and restoration of this species is critical for a number of reasons, including its importance to the tribes and its importance as an indicator of ecosystem health. Historically lamprey have been labeled a pest species due to the problems associated with the exotic sea lamprey, (Petromyzon marinus), invading the Great Lakes

  4. A Suspected Parasite Spill-Back of Two Novel Myxidium spp. (Myxosporea) Causing Disease in Australian Endemic Frogs Found in the Invasive Cane Toad

    Czech Academy of Sciences Publication Activity Database

    Hartigan, A.; Fiala, Ivan; Dyková, Iva; Jirků, Miloslav; Okimoto, B.; Rose, K.; Phalen, D. N.; Šlapeta, J.

    2011-01-01

    Roč. 6, č. 4 (2011), e18871 E-ISSN 1932-6203 R&D Projects: GA AV ČR KJB600960701 Grant - others:GA ČR(CZ) GP204/09/P519 Program:GP Institutional research plan: CEZ:AV0Z60220518 Keywords : EW-SOUTH-WALES * BUFO-MARINUS * BIOLOGICAL INVASIONS * INFECTIOUS-DISEASES * NORTH-AMERICA * TREE FROG * MYXOZOA * SEQUENCES * PHYLOGENY * ECOLOGY Subject RIV: EG - Zoology Impact factor: 4.092, year: 2011

  5. Dicty_cDB: Contig-U02523-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lorococcus marinus str. NATL2A, complete gen... 48 0.82 1 ( AF211148 ) Carsonella ruddii natural-host Russelliana interm...:none) Leishmania major strain Friedlin... 75 4e-12 CP000384_4494( CP000384 |pid:none) Mycobacterium sp. MCS, compl...elaginella moellendorffii mixe... 34 0.16 2 ( GD178393 ) EST04602 Watermelon fruit normalization and subtr...... 50 0.21 1 ( EJ643566 ) 1093012125502 Global-Ocean-Sampling_GS-29-01-01-1... 34 ...e, co... 48 0.82 1 ( EK325308 ) 1095467004903 Global-Ocean-Sampling_GS-31-01-01-1

  6. Dicty_cDB: AFK590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available coccus marinus MED4 complete genome; segment 5/5. 36 0.41 6 AP000343 |AP000343.1 Homo sapiens genomic DNA, chromosome 22q11.2...11.2, clone KB1269D1. 46 0.80 1 AP000356 |AP000356.1 Homo sapiens genomic DNA, chromosome 22q11.2..., clone KB1995A5. 46 0.80 1 AP000357 |AP000357.1 Homo sapiens genomic DNA, chromosome 22q11.2,..., clone KB282B12. 46 0.80 1 AP000344 |AP000344.1 Homo sapiens genomic DNA, chromosome 22q

  7. Spatial patterns and trends in abundance of larval sandeels in the North Sea: 1950–2005

    DEFF Research Database (Denmark)

    Lynam, Christopher P.; Halliday, Nicholas C.; Höffle, Hannes

    2013-01-01

    Early recruitment indices based on larval fish data from the Continuous Plankton Recorder (CPR) have the potential to inform stock assessments of Ammodytes marinus in the North Sea. We evaluate whether the CPR data are reliable for sandeel larvae. Spatially, CPR larval data were comparable...... 0-group trawl data at the east Fair Isle ground (since 1984), and with recruitment data (since 1983) for the Dogger Banks stock assessment area. Therefore, CPR data may provide an early recruit index of relative abundance for the Dogger Banks assessment area, where the majority of the commercial...... years and/or with abundant 1-year-old sandeel that are likely to be cannibalistic....

  8. Status Report of the Pacific Lamprey (Lampetra Trzdentata) in the Columbia River Basin.

    Energy Technology Data Exchange (ETDEWEB)

    Close, David A.; Parker, Blaine; James, gary

    1995-07-01

    The widespread decline of Pacific lamprey (Lampetra tridentata) in the Pacific Northwest, especially in the Columbia River system has led to concerns and questions from a number of regional agencies, Native American tribes, and the public. To address these concerns, new research efforts must focus on specific problems associated with this understudied species. The preservation and restoration of this species is critical for a number of reasons, including its importance to the tribes and its importance as an indicator of ecosystem health. Historically lamprey have been labeled a pest species due to the problems associated with the exotic sea lamprey, (Petromyzon marinus), invading the Great Lakes.

  9. Differential effects of a local industrial sand lance fishery on seabird breeding performance

    DEFF Research Database (Denmark)

    Frederiksen, M.; Jensen, Henrik; Daunt, F.

    2008-01-01

    fluctuations. We evaluated the effects of an industrial sand lance (Ammodytes marinus) fishery off the North Sea coast of the United Kingdom, which has been opened and closed in a quasi-experimental fashion, on sand-lance-dependent breeding seabirds. Controlling for environmental variation ( sea surface...... or to the fact that only one study colony in the control zone was exposed to high fishery effort within the typical foraging range of Kittiwakes during the breeding season. The strong impact on Kittiwakes, but not on diving species, could result from ( 1) inherently high sensitivity to reduced prey availability...

  10. Productivity and recovery of forage fish under climate change and fishing: North Sea sandeel as a case study

    DEFF Research Database (Denmark)

    Lindegren, Martin; van Deurs, Mikael; MacKenzie, Brian

    2018-01-01

    Forage fish occupy a central position in marine food-webs worldwide by mediating the transfer of energy and organic matter from lower to higher trophic levels. The lesser sandeel (Ammodytes marinus) is one of the ecologically and economically most important forage fish species in the North......-east Atlantic, acting as a key prey for predatory fish and sea birds, as well as supporting a large commercial fishery. In this case study, we investigate the underlying factors affecting recruitment and how these in turn affect productivity of the North Sea sandeel using long-term data and modelling. Our...

  11. Gram-positive bacteria of marine origin: a numerical taxonomic study on Mediterranean isolates.

    Science.gov (United States)

    Ortigosa, M; Garay, E; Pujalte, M J

    1997-12-01

    A numerical taxonomic study was performed on 65 Gram-positive wild strains of heterotrophic, aerobic, marine bacteria, and 9 reference strains. The isolates were obtained from oysters and seawater sampled monthly over one year, by direct plating on Marine Agar. The strains were characterized by 96 morphological, biochemical, physiological and nutritional tests. Clustering yielded 13 phena at 0.62 similarity level (Sl coefficient). Only one of the seven phena containing wild isolates could be identified (Bacillus marinus). A pronounced salt requirement was found in most isolates.

  12. Stimulation of osteoblast activity by induction of Aloe vera and xenograft combination

    Directory of Open Access Journals (Sweden)

    Utari Kresnoadi

    2011-12-01

    Full Text Available Background: Tooth extraction is generally followed by alveolar ridge resorption that later can cause flat ridge. Aloe vera have biogenic stimulator and hormone activities for wound healing. Purpose: This study was aimed to know osteoblast activities in alveolar bone after induction of Aloe vera and XCB combination. Methods: Fifty four of Cavia cabaya were divided into three main groups. Group I was control group. Group II was filled with xenograft concelous bovine (XCB and group III was filled with the combination of Aloe vera gel and XCB. Then, each group was divided into three sub groups according to timing, they are 14, 30, and 60 days after tooth extraction and application. Histology and morphology examination were performed on the harvested specimens. Results: There were significant differences between the control group and the other groups filled with the combination of Aloe vera and XCB. Conclusion: In conclusion, the application of Aloe vera gel and xenograft combination decrease the number of osteoclast and increase the number of osteoblast in post tooth extraction alveolar bone structure indicating the new growth of alveolar bone.Latar belakang: Pencabutan gigi pada umumnya selalu diikuti resopsi tulang alveolar, sehingga bila terjadi dalam waktu yang lama ridge akan menjadi flat. Aloe vera adalah bahan stimulasi biogenik dan mempunyai aktivitas hormon untuk proses penyembuhan luka. Tujuan: Tujuan dari penelitian ini adalah untuk mengetahui aktivitas osteoblas pada tulang alveol dengan pemberian kombinasi Aloe vera gel dan xenograft concelous bovine (XCB. Metode: Lima puluh empat ekor Cavia cabaya, dibagi menjadi 3 kelompok besar, kelompok pertama adalah kelompok kontrol yaitu hanya dilakukan pencabutan saja tanpa perlakuan, kelompok ke-2 yaitu kelompok yang setelah dicabut diberi XCB saja dan kelompok ke-3 yaitu kelompok yang setelah pencabutan diberi kombinasi Aloe vera gel dengan XCB pada luka bekas pencabutan gigi. Kemudian masing

  13. The increasing of fibroblast growth factor 2, osteocalcin, and osteoblast due to the induction of the combination of Aloe vera and 2% xenograft concelous bovine

    Directory of Open Access Journals (Sweden)

    Utari Kresnoadi

    2012-12-01

    Full Text Available Background: To make a successfull denture prominent ridge is needed, preservation on tooth extraction socket is needed in order to prevent alveol bone resorption caused by revocation trauma. An innovative modification of the material empirically suspected to be able reduce inflammation caused by the revocation trauma is a combination of Aloe vera and xenograft concelous bovine (XCB and Aloe vera is a biogenic stimulator and accelerating the growth of alveolar ridge bone after tooth extraction. Purpose: The research was aimed to determine of the increasing alveol bone formation by inducing the combination of Aloe vera and 2% xenograft concelous bovine. Methods: To address the problems, the combination of Aloe vera and xenograft concelous bovine was induced into the tooth extraction sockets of Cavia cabayas which devided on 8 groups. Groups control, filled with XCB, Aloe vera and Aloe vera and XCB combination, at 7 days and 30 days after extraction. Afterwards, immunohistochemical examination was conducted to examine the expressions of FGF-2 and osteocalcin, as the product of the growth of osteoblasts. Results: There were significantly increases expression of FGF-2 and osteocalcyn on group which filled with XCB, Aloe vera and combined Aloe vera and XCB. Conclusion: It may be concluded that the induction of the combination of Aloe vera and xenograft concelous bovine into the tooth sockets can enhance the growth expressions of FGF-2 and osteocalcin as the product of osteoblasts, thus, the growth of alveolar bone was increased.Latar belakang: Untuk keberhasilan pembuatan gigitiruan diperlukan ridge yang prominent, maka diperlukan suatu preservasi soket pencabutan gigi untuk mencegah terjadinya resopsi tulang alveolar akibat trauma pencabutan. Suatu inovasi modifikasi bahan yang diduga secara empiris dapat mengurangi keradangan karena trauma pencabutan adalah berupa kombinasi Aloe vera dan xenograft concelous bovine (XCB. Aloe vera yang merupakan

  14. Preliminary results of mercury levels in raw and cooked seafood and their public health impact.

    Science.gov (United States)

    Costa, Fernanda do N; Korn, Maria Graças A; Brito, Geysa B; Ferlin, Stacy; Fostier, Anne H

    2016-02-01

    Mercury is toxic for human health and one of the main routes of exposure is through consumption of contaminated fish and shellfish. The objective of this work was to assess the possible mercury contamination of bivalves (Anomalocardia brasiliana, Lucina pectinata, Callinectes sapidus), crustacean (C. sapidus) and fish (Bagre marinus and Diapterus rhombeus) collected on Salinas da Margarida, BA (Brazil), a region which carciniculture, fishing and shellfish extraction are the most important economic activities. The effect of cooking on Hg concentration in the samples was also studied. The results showed that Hg concentration was generally higher in the cooked samples than in raw samples. This increase can be related to the effect of Hg pre-concentration, formation of complexes involving mercury species and sulfhydryl groups present in tissues and/or loss of water and fat. The highest concentrations were found in B. marinus samples ranging 837.0-1585.3 μg kg(-1), which exceeded those recommended by Brazilian Health Surveillance Agency (ANVISA). In addition, Hg values found in the other samples also suggest the monitoring of the Hg concentrations in seafood consumed from the region. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Variation in storage alpha-glucans of the Porphyridiales (Rhodophyta).

    Science.gov (United States)

    Shimonaga, Takahiro; Konishi, Mai; Oyama, Yasunori; Fujiwara, Shoko; Satoh, Aya; Fujita, Naoko; Colleoni, Christophe; Buléon, Alain; Putaux, Jean-Luc; Ball, Steven G; Yokoyama, Akiko; Hara, Yoshiaki; Nakamura, Yasunori; Tsuzuki, Mikio

    2008-01-01

    Storage glucans were analyzed in the Porphyridiales which include the most primitive and phylogenetically diverged species in the Rhodophyta, to understand early evolution of the glucan structure in the Rhodophyta. The storage glucans of both Galdieria sulphuraria and Cyanidium caldarium consisted of glycogen, while those of Rhodosorus marinus, Porphyridium purpureum, P. sordidum and Rhodella violacea could be defined as semi-amylopectin. X-ray diffraction analysis of the glucans demonstrated variation in the crystalline structure: the patterns in P. purpureum and R. violacea were of A- and B-types, respectively, while alpha-glucans of R. marinus and P. sordidum displayed structures with lower crystallinity. Electron microscopic observations indicated that the alpha-glucans of P. sordidum consisted of two kinds of granules; a minor component of more dense granules with crystalline leaflets and a major component of softer ones without crystalline structure. Gel permeation chromatography showed that all the species containing the semi-amylopectin-type glucans also contained amylose, although the relative amounts of this fraction were different depending on the species. Our results are consistent with two distinct evolution scenarios defined either by the independent acquisition of semi-crystalline starch-like structures in the different plant lineages or more probably by the loss of starch and reversion to glycogen synthesis in cyanidian algae growing in hot and acid environments.

  16. Isolation, cultivation and genomic analysis of magnetosome biomineralization genes of a new genus of South-seeking magnetotactic cocci within the Alphaproteobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Morillo, Viviana [Universidade Federal do Rio de Janeiro; Abreu, Fernanda [Universidade Federal do Rio de Janeiro; Araujo, Ana C [Universidade Federal do Rio de Janeiro; de Almeida, Luiz G [Laboratorio Nacional de Computacao Cientifica; Enrich-Prast, Alex [Universidade Federal do Rio de Janeiro; Farina, Marcos [Universidade Federal do Rio de Janeiro; de Vasconcelos, Ana T [Laboratorio Nacional de Computacao Cientifica; Bazylinski, Dennis A [Ames Laboratory; Lins, Ulysses [Universidade Federal do Rio de Janeiro

    2014-01-01

    Although magnetotactic bacteria (MTB) are ubiquitous in aquatic habitats, they are still considered fastidious microorganisms with regard to growth and cultivation with only a relatively low number of axenic cultures available to date. Here, we report the first axenic culture of an MTB isolated in the Southern Hemisphere (Itaipu Lagoon in Rio de Janeiro, Brazil). Cells of this new isolate are coccoid to ovoid in morphology and grow microaerophilically in semi-solid medium containing an oxygen concentration ([O2]) gradient either under chemoorganoheterotrophic or chemolithoautotrophic conditions. Each cell contains a single chain of approximately 10 elongated cuboctahedral magnetite (Fe3O4) magnetosomes. Phylogenetic analysis based on the 16S rRNA gene sequence shows that the coccoid MTB isolated in this study represents a new genus in the Alphaproteobacteria; the name Magnetofaba australis strain IT-1 is proposed. Preliminary genomic data obtained by pyrosequencing shows that M. australis strain IT-1 contains a genomic region with genes involved in biomineralization similar to those found in the most closely related magnetotactic cocci Magnetococcus marinus strain MC-1. However, organization of the magnetosome genes differs from M. marinus.

  17. Gull contributions of phosphorus and nitrogen to a Cape Cod kettle pond

    Science.gov (United States)

    Portnoy, J.W.; Soukup, M.A.

    1990-01-01

    Nutrient excretion rates and the annual contribution of P from the feces of the gulls Larus argentatus and L. marinus (and of N from L. argentatus) to the nutrient budget of Gull Pond (Wellfleet), a soft water seepage lake, have been estimated. Intensive year-round gull counts by species were combined with determinations of defecation rate and the nutrient content of feces to quantitatively assess the P loading rates associated with regular gull use of this coastal pond on a seasonal and annual basis. Total P loading from gulls was estimated to be 52 kg yr?1, with 17 kg from L. argentatus and 35 kg from L. marinus, resulting from about 5.0 ? 106 h yr?1 and 1.7 ? 106 h yr?1 of pond use. This compares with P loading estimates of 67 kg yr?1 from upgradient septic systems, 2 kg yr?1 from precipitation and 3 kg yr?1 from unpolluted ground water. Fifty-six percent of annual gull P loading was associated with migratory activity in late fall. Estimated annual N loading by L. argentatus was 14 kg TKN, 206 g NO3-N, and 1.85 g g NH3-N.

  18. Isolation, cultivation and genomic analysis of magnetosome biomineralization genes of a new genus of South-seeking magnetotactic cocci within the Alphaproteobacteria.

    Science.gov (United States)

    Morillo, Viviana; Abreu, Fernanda; Araujo, Ana C; de Almeida, Luiz G P; Enrich-Prast, Alex; Farina, Marcos; de Vasconcelos, Ana T R; Bazylinski, Dennis A; Lins, Ulysses

    2014-01-01

    Although magnetotactic bacteria (MTB) are ubiquitous in aquatic habitats, they are still considered fastidious microorganisms with regard to growth and cultivation with only a relatively low number of axenic cultures available to date. Here, we report the first axenic culture of an MTB isolated in the Southern Hemisphere (Itaipu Lagoon in Rio de Janeiro, Brazil). Cells of this new isolate are coccoid to ovoid in morphology and grow microaerophilically in semi-solid medium containing an oxygen concentration ([O2]) gradient either under chemoorganoheterotrophic or chemolithoautotrophic conditions. Each cell contains a single chain of approximately 10 elongated cuboctahedral magnetite (Fe3O4) magnetosomes. Phylogenetic analysis based on the 16S rRNA gene sequence shows that the coccoid MTB isolated in this study represents a new genus in the Alphaproteobacteria; the name Magnetofaba australis strain IT-1 is proposed. Preliminary genomic data obtained by pyrosequencing shows that M. australis strain IT-1 contains a genomic region with genes involved in biomineralization similar to those found in the most closely related magnetotactic cocci Magnetococcus marinus strain MC-1. However, organization of the magnetosome genes differs from M. marinus.

  19. Primary structure and conformational analysis of peptide methionine-tyrosine, a peptide related to neuropeptide Y and peptide YY isolated from lamprey intestine

    DEFF Research Database (Denmark)

    Conlon, J M; Bjørnholm, B; Jørgensen, Flemming Steen

    1991-01-01

    A peptide belonging to the pancreatic-polypeptide-fold family of regulatory peptides has been isolated from the intestine of an Agnathan, the sea lamprey (Petromyzon marinus). The primary structure of the peptide (termed peptide methionine-tyrosine) was established as Met-Pro-Pro-Lys-Pro-Asp-Asn-......A peptide belonging to the pancreatic-polypeptide-fold family of regulatory peptides has been isolated from the intestine of an Agnathan, the sea lamprey (Petromyzon marinus). The primary structure of the peptide (termed peptide methionine-tyrosine) was established as Met......%) or with pig pancreatic polypeptide (42%). Molecular modelling and dynamic simulation, based upon sequence similarity with turkey pancreatic polypeptide, indicates that the conformations of the polyproline-helix-like region (residues 1-8) and the alpha-helical region (residues 15-30) in turkey pancreatic...... polypeptide are conserved in peptide methionine-tyrosine, and that non-bonded interactions between these domains have preserved the overall polypeptide fold in the molecule. The substitution of the otherwise totally conserved Gly9 residue by serine in lamprey peptide methionine-tyrosine, however, results...

  20. [Smartphone application for blood gas interpretation].

    Science.gov (United States)

    Obiols, Julien; Bardo, Pascale; Garnier, Jean-Pierre; Brouard, Benoît

    2013-01-01

    Ninety four per cent of health professionals use their smartphone for business purposes and more than 50% has medical applications. The «Blood Gas» application was created to be part of this dynamic and participate to e-health development in France. The «Blood Gas» application facilitates interpretation of the results of blood gas analysis using an algorithm developed with reference to a medical bibliography. It can detect some complex or intricate acid-base disorders in evaluating the effectiveness of the secondary response. The application also studied the respiratory status of the patient by calculating the PaO2/FiO2 ratio and the alveol-arterial gradient. It also indicates the presence of a shunt effect. Finally, a specific module to calculate the SID (strong ion difference) depending on the model of Stewart can detect complex acid-base disorders.

  1. Morphology, Ultrastructure and Life Cycle of Vitrella brassicaformis n. sp., n. gen., a Novel Chromerid from the Great Barrier Reef

    KAUST Repository

    Oborník, Miroslav

    2012-03-01

    Chromerida are photoautotrophic alveolates so far only isolated from corals in Australia. It has been shown that these secondary plastid-containing algae are closely related to apicomplexan parasites and share various morphological and molecular characters with both Apicomplexa and Dinophyta. So far, the only known representative of the phylum was Chromera velia. Here we provide a formal description of another chromerid, Vitrella brassicaformis gen. et sp. nov., complemented with a detailed study on its ultrastructure, allowing insight into its life cycle. The novel alga differs significantly from the related chromerid C. velia in life cycle, morphology as well as the plastid genome. Analysis of photosynthetic pigments on the other hand demonstrate that both chromerids lack chlorophyll c, the hallmark of phototrophic chromalveolates. Based on the relatively high divergence between C. velia and V. brassicaformis, we propose their classification into distinct families Chromeraceae and Vitrellaceae. Moreover, we predict a hidden and unexplored diversity of the chromerid algae. © 2011 Elsevier GmbH.

  2. Early aggressive intra-venous pulse cyclophosphamide therapy for interstitial lung disease in a patient with systemic sclerosis. A case report.

    LENUS (Irish Health Repository)

    Peshin, R

    2009-06-01

    Interstitial lung disease is an important cause of mortality and morbidity in patients with systemic sclerosis (SSc). There are currently no recommended guidelines for management of these patients. This is probably due to the rarity of this condition, as well as clinical trials with only a small number of cases. There are published case report and case series along with the two main trials, viz. Scleroderma Lung Study and the Fibrosing Alveolitis Study, but again, there is no consensus on treatment protocols. In this report, we present a case of aggressive interstitial lung disease in a patient with SSc, which improved dramatically on treatment with intra-venous cyclophosphamide and high dose prednisolone therapy.

  3. [Air-conditioner disease. Results of an industrial medicine survey (author's transl)].

    Science.gov (United States)

    Molina, C; Aiache, J M; Bedu, M; Menaut, P; Wahl, D; Brestowski, J; Grall, Y

    1982-07-03

    The results of a survey conducted in a company employing 1850 persons working in air-conditioned premises are reported. One hundred and five persons were examined, including 790 who mostly complained of respiratory disorders and 20 controls. Regular check-ups during the last two years have failed to reveal any serious disease. The most frequent complaints were rhinitis and tracheitis, especially among female employees. No alveolitis was observed. The finding of Bacillus subtilis in samples of ambient air and air-conditioner filters in conjunction with the presence of precipitating antibodies against crude extracts from these samples, suggested that the respiratory disorders might have been due to this microorganism. A multifactorial analysis demonstrated a statistically significant correlation between clinical symptoms and immunological disorders. The air-conditioner disease, therefore, may present as a benign condition.

  4. Diverse Bacterial PKS Sequences Derived From Okadaic Acid-Producing Dinoflagellates

    Directory of Open Access Journals (Sweden)

    Kathleen S. Rein

    2008-05-01

    Full Text Available Okadaic acid (OA and the related dinophysistoxins are isolated from dinoflagellates of the genus Prorocentrum and Dinophysis. Bacteria of the Roseobacter group have been associated with okadaic acid producing dinoflagellates and have been previously implicated in OA production. Analysis of 16S rRNA libraries reveals that Roseobacter are the most abundant bacteria associated with OA producing dinoflagellates of the genus Prorocentrum and are not found in association with non-toxic dinoflagellates. While some polyketide synthase (PKS genes form a highly supported Prorocentrum clade, most appear to be bacterial, but unrelated to Roseobacter or Alpha-Proteobacterial PKSs or those derived from other Alveolates Karenia brevis or Crytosporidium parvum.

  5. Pulmonary eosinophilia associated to treatment with natalizumab

    Directory of Open Access Journals (Sweden)

    Elena Curto

    2016-01-01

    Full Text Available Natalizumab (Tysabri® is a leukocytes chemotaxis inhibitor that decreases the leukocytes passage through the hematoencephalic barrier and it is currently used in relapsing-remitting forms of multiple sclerosis (MS. We present a patient with allergic rhinoconjunctivitis diagnosed with MS who started treatment with natalizumab. She began to show mild asthmatic symptoms until she needed admission to the hospital due to respiratory insufficiency. Blood tests showed peripheral eosinophilia and the thoracic computed tomography scan demonstrated pulmonary infiltrates. The bronchoscopy with the bronchoalveolar lavage resulted in eosinophilic alveolitis. No evidence of bacterial, fungal and parasitic infection, connective tissue disease, or vasculitis were observed. After discontinuation of natalizumab, the patient improved without other treatments. As MS is a prevalent disease and the use of natalizumab is increasing, we consider important to point out that this drug can be associated with pulmonary eosinophilia, especially in patients with allergic rhinoconjunctivitis or asthma.

  6. Aspergillus-Related Lung Disease

    Directory of Open Access Journals (Sweden)

    Alia Al-Alawi

    2005-01-01

    Full Text Available Aspergillus is a ubiquitous dimorphic fungus that causes a variety of human diseases ranging in severity from trivial to life-threatening, depending on the host response. An intact host defence is important to prevent disease, but individuals with pre-existing structural lung disease, atopy, occupational exposure or impaired immunity are susceptible. Three distinctive patterns of aspergillus-related lung disease are recognized: saprophytic infestation of airways, cavities and necrotic tissue; allergic disease including extrinsic allergic alveolitis, asthma, allergic bronchopulmonary aspergillosis, bronchocentric granulomatosis and chronic eosinophilic pneumonia; and airway and tissue invasive disease -- pseudomembranous tracheobronchitis, acute bronchopneumonia, angioinvasive aspergillosis, chronic necrotizing aspergillosis and invasive pleural disease. A broad knowledge of these clinical presentations and a high index of suspicion are required to ensure timely diagnosis and treatment of the potentially lethal manifestations of aspergillus-related pulmonary disease. In the present report, the clinical, radiographic and pathological aspects of the various aspergillus-related lung diseases are briefly reviewed.

  7. The effects of Ureplasma diversum inoculated into the amniotic cavity in cows.

    Science.gov (United States)

    Miller, R B; Ruhnke, H L; Doig, P A; Poitras, B J; Palmer, N C

    1983-09-01

    Ureaplasma diversum was inoculated into the amniotic cavity in four cows. Two calves were aborted and two were born alive. One of the latter died shortly after birth and the other was killed. The cows remained clinically normal except that three retained their placenta. On microscopic examination there was a severe placentitis and an alveolitis was present in the lungs of all calves. Ureaplasma was recovered from four placentas and three lungs. Cows remained infected for a maximum of 132 days following inoculation and the organism was recovered in urine and vulvar swabs for a maximum of 17 and 60 days respectively following expulsion of the calf. Ureaplasma diversum has been isolated from natural cases of abortion with similar lesions. This experiment strongly supports a causal relationship between abortion, birth of calves with pneumonia and U. diversum infection.

  8. Characterization of Microfibrillar-associated Protein 4 in the Development of Pulmonary Emphysema-like Changes

    DEFF Research Database (Denmark)

    Holm, Anne Trommelholt

    fibre i ECM og binder både til fibrillin-1 og elastin, hvilket kan betyde at det spiller en rolle i at danne eller bevare integriteten af de elastiske fibre. Vores formål var at undersøge in vivo pulmonale konsekvenser af MFAP4-mangel. Lunge-funktionsmålingerne af unge og ældre Mfap4-deficiente mus...... undersøgelse af de histologiske snit af lungevævet. Sammenholdt tyder vores resultater på, at Mfap4-deficiente mus udvikler homogen alveolær lufvejsforstørrelse uden tilstedeværelse af inflammation. Humane studier viser, at aldersrelaterede ændringer af lunge-arkitektur og funktion er forbundet med en øget...

  9. The Chinese Herbal Medicine Formula mKG Suppresses Pulmonary Fibrosis of Mice Induced by Bleomycin

    Directory of Open Access Journals (Sweden)

    Ying Gao

    2016-02-01

    Full Text Available Pulmonary fibrosis (PF is a serious progressive lung disease and it originates from inflammation-induced parenchymal injury with excessive extracellular matrix deposition to result in the destruction of the normal lung architecture. Modified Kushen Gancao Formula (mKG, derived from traditional Chinese herbal medicine, has a prominent anti-inflammatory effect. The present study is to explore the inhibitory effects of mKG on bleomycin (BLM-induced pulmonary fibrosis in mice. mKG significantly decreased pulmonary alveolitis, fibrosis scores, and interleukin-6 (IL-6, interleukin-17 (IL-17, transforming growth factor-β (TGF-β and hydroxyproline (HYP levels in lung tissue of mice compared with BLM treatment. It markedly alleviated the increase of HYP content in the lung tissues and pathologic changes of pulmonary fibrosis caused by BLM instillation. In conclusion, mKG has an anti-fibrotic effect and might be employed as a therapeutic candidate agent for attenuating pulmonary fibrosis.

  10. Genetic diversity of the crustacean parasite Hematodinium (Alveolata, Syndinea).

    Science.gov (United States)

    Hamilton, Kristina M; Morritt, D; Shaw, Paul W

    2010-01-01

    In the absence of distinct morphological characteristics, knowledge of genetic relationships within and between protist parasite species is important for determining reservoir hosts and understanding the biology of the causative agents of emerging diseases. The genus Hematodinium is a member of Syndinea, an ubiquitous alveolate group found in all oceanic environments. Hematodinium parasites cause epizootics in crustaceans, yet their life cycle, genotypic variety and their phylogeny is poorly understood. By combining phylogenetic methods with analyses of secondary structures of variable ribosomal RNA genes we show that Hematodinium from the east and west North-Atlantic is comprised of distinct ribotypes or clades. These did not correspond to a specific area, but varied in host specificity. For example, a Hematodinium 'Langoustine' clade was only found in Nephrops norvegicus langoustines, whereas other clades were specific to crabs or seem to be generalist parasites. Copyright (c) 2009 Elsevier GmbH. All rights reserved.

  11. Chronic hypersensitivity pneumonitis

    Directory of Open Access Journals (Sweden)

    Pereira CA

    2016-09-01

    Full Text Available Carlos AC Pereira,1 Andréa Gimenez,2 Lilian Kuranishi,2 Karin Storrer 2 1Interstitial Lung Diseases Program, 2Pulmonology Postgraduate, Federal University of São Paulo, São Paulo, Brazil Abstract: Hypersensitivity pneumonitis (HSP is a common interstitial lung disease resulting from inhalation of a large variety of antigens by susceptible individuals. The disease is best classified as acute and chronic. Chronic HSP can be fibrosing or not. Fibrotic HSP has a large differential diagnosis and has a worse prognosis. The most common etiologies for HSP are reviewed. Diagnostic criteria are proposed for both chronic forms based on exposure, lung auscultation, lung function tests, HRCT findings, bronchoalveolar lavage, and biopsies. Treatment options are limited, but lung transplantation results in greater survival in comparison to idiopathic pulmonary fibrosis. Randomized trials with new antifibrotic agents are necessary. Keywords: interstitial lung diseases, extrinsic allergic alveolitis, diffuse lung disease, lung immune response, HRCT, farmers lung

  12. [Cryptogenic organising pneumonia].

    Science.gov (United States)

    Lazor, Romain

    2005-06-01

    Organising Pneumonia (formerly called Bronchiolitis Obliterans with Organising Pneumonia) is a particular form of inflammatory and fibroproliferative lung disease. Its idiopathic form called Cryptogenic Organising Pneumonia, was recently defined by an ATS/ERS consensus conference. The disease onset is subacute with cough, dyspnea, fever, asthenia, weight loss, crackles, and elevation of biological inflammatory markers. Bronchoalveolar lavage reveals a mixed alveolitis with elevated lymphocyte, neutrophil, and eosinophil counts. Chest imaging usually shows multifocal alveolar opacities predominating in the subpleural regions, often with a migratory pattern. Lung biopsy reveals budding connective tissue filling the distal airspaces. Diagnosis is established by combining clinical, radiological and histological criteria. Similarities with other disease processes can lead to delayed or erroneous diagnosis. Most patients respond well to corticosteroid therapy. Relapses are frequent but can generally be controlled with moderate doses of prednisone and do not worsen the prognosis. The therapeutic strategy aims at reducing the steroid doses while maintaining an optimal disease control.

  13. Histological investigation of a 10% metronidazole and 2% lidocaine dressing on wound healing in rats.

    Science.gov (United States)

    Rodrigues, T S; Poi, W R; Panzarini, S R; Bezerra, C S; Silva, J L

    2006-01-01

    Alveolitis is considered a disturbance of the alveolar healing process that is characterized by blood clot disintegration, alveolar wall infection and extreme pain. Several substances have been investigated to improve healing and guarantee postoperative comfort to patients. The aim of this study was to evaluate, microscopically, in rats, the healing process in non-infected tooth sockets, after application of a 10% metronidazole and 2% lidocaine dressing, using lanolin as vehicle and mint as flavoring. Forty-five rats (Rattus norvegicus albinus, Wistar) had their right incisor extracted and were randomly assigned to 3 groups (n=15): Group I (control): the sockets were filled with blood clot; Group II: application of adrenaline solution at 1:1 000 with an absorbent paper point during 1 min plus filling of the socket with a 10% metronidazole and 2% lidocaine dressing, with lanolin as vehicle, and mint as flavoring; Group III: filling of the socket with the 10% metronidazole and 2% lidocaine dressing, with lanolin as vehicle and mint as flavoring. After 6, 15 and 28 days postoperatively, 5 animals per group were euthanized with an injectable anesthetic overdose. Histological and statistical analyses were performed. The results showed that the 10% metronidazole and 2% lidocaine dressing with lanolin as vehicle and mint as flavoring yielded similar response as that of the normal repair group and may be used to prevent the onset of alveolitis in those cases in which any predisposing factor is present. The use of this dressing has shown a good postoperative patient's comfort and does not cause a significant delay in the alveolar healing process.

  14. Presentación de un estudio en 680 pacientes operados de terceros molares retenidos

    Directory of Open Access Journals (Sweden)

    Felicia Morejón Álvarez

    2000-08-01

    Full Text Available Se realizó un estudio en 680 pacientes operados de terceros molares retenidos que fueron atendidos en el Servicio de Cirugía Maxilofacial del Hospital Docente Clinicoquirúrgico "Abel Santamaría" en el período comprendido entre el 6 de octubre de 1998 y el 6 de octubre de 1999, con el objetivo de determinar las complicaciones posoperatorias más frecuentes encontradas en los pacientes operados. Se plantean y analizan los resultados obtenidos y se establecen comparaciones con estudios anteriores. El procedimiento quirúrgico de los terceros molares retenidos constituye una de las actividades operatorias más frecuentes dentro del marco de la cirugía maxilofacial, y a partir de la cual pueden aparecer complicaciones que exigen su diagnóstico oportuno y tratamiento. Como complicaciones posoperatorias más frecuentes se encontraron la alveolitis en el 29,6 %, la celulitis facial posquirúrgica en el 22,7 %, la hemorragia en el 18,2 % y el trismo mandibular, en el 13,7 % de los casos.680 patients who were operated on of impacted third molars at the Maxillofacial Surgery Service of "Abel Santamaría" Clinical and Surgical Teaching Hospital, between October 6, 1998, and October 6, 1999, were studied aimed at determining the most frequent postoperative complications found in the operated on patients.The results obtained were analyzed and compared with those of previous studies. The surgical procedure of the impacted third molars is one of the commonest surgical activities within the framework of maxillofacial surgery. Complications needing a suitable diagnosis and treatment may appear. The most frequent postoperative complications are alveolitis in 29.6%, postsurgical facial cellulitis in 22.7%, hemorrhage in 18.2% and mandibular trismus in 13.7% of the cases.

  15. IBA levels and substrates in the rooting of UENF/CALIMAN 02 hybrid papaya minicuttings in a semi-hydroponic system

    Directory of Open Access Journals (Sweden)

    Márcio José Vieira de Oliveira

    2018-02-01

    Full Text Available Abstract Mini-cutting is a technique with large applications in various crops, mainly due to the increase in the percentage and quality of adventitious roots, reducing time for the formation of clonal seedlings. The aim of this study was to evaluate IBA levels and substrates on the rooting of UENF/CALIMAN 02 hybrid papaya mini-cuttings. To perform the experiment, papaya mini-cuttings were taken from mother plants grown in pots in greenhouse, induced to produce shoots through pruning and growth regulator applications. Mini-cuttings were fixed in vermiculite or coconut fiver substrates placed in alveolate trays with 4.5x4.5x5.0 cm cells, and styrofoam trays were placed in plastic trays where different IBA levels were added in a modified Hoagland solution. After 45 days, rooted buds were transplanted to plastic pots of 600 mL of volume with soil, sand, well-cured bovine fertilizer, in the proportion of 3:1:1, remaining for 45 days. When they were taken from pots, roots were carefully washed, and the length of shoots, length of the largest root, dried mass of shoots and radicular system and root percentage were measured. The experiment was set up in a randomized complete block 5 x 2 factorial design, with 5 IBA levels: 0; 2.5; 5.0; 7.5 and 10 mg L-1, two substrates: vermiculite and coconut fiber, three replicates, with six plants per replicate. IBA levels of 5.0 mg L-1 and substrate vermiculite are the most adequate for the rooting of ‘UENF/CALIMAN 02’ papaya mini-cuttings in semi-hydroponic system in alveolate styrofoam trays with 4.5x4.5x5.0 cm cells.

  16. 2005 dossier: clay. Tome: architecture and management of the geologic disposal facility

    International Nuclear Information System (INIS)

    2005-01-01

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the design of a geologic disposal facility for high-level and long-lived radioactive wastes in argilite formations. Content: 1 - approach of the study: goal, main steps of the design study, iterative approach, content; 2 - general description: high-level and long-lived radioactive wastes, purposes of a reversible disposal, geologic context of the Meuse/Haute-Marne site - the Callovo-Oxfordian formation, design principles of the disposal facility architecture, role of the different disposal components; 3 - high-level and long-lived wastes: production scenarios, description of primary containers, inventory model, hypotheses about receipt fluxes of primary containers; 4- disposal containers: B-type waste containers, C-type waste containers, spent fuel disposal containers; 5 - disposal modules: B-type waste disposal modules, C-type waste disposal modules, spent-fuel disposal modules; 6 - overall underground architecture: main safety questions, overall design, dimensioning factors, construction logic and overall exploitation of the facility, dimensioning of galleries, underground architecture adaptation to different scenarios; 7 - boreholes and galleries: general needs, design principles retained, boreholes description, galleries description, building up of boreholes and galleries, durability of facilities, backfilling and sealing up of boreholes and galleries; 8 - surface facilities: general organization, nuclear area, industrial and administrative area, tailings area; 9 - nuclear exploitation means of the facility: receipt of primary containers and preparation of disposal containers, transfer of disposal containers from the surface to the disposal alveoles, setting up of containers inside alveoles; 10 - reversible management of the disposal: step by step disposal process, mastery of disposal behaviour and action capacity, observation and

  17. Clearance of inhaled technetium-99m-DTPA as a clinical index of pulmonary vascular disease in systemic sclerosis

    Energy Technology Data Exchange (ETDEWEB)

    Kon, O.M.; Daniil, Z.; Bois, R.M. du [Royal Brompton Hospital, Interstitial Lung Disease Unit, London (United Kingdom); Black, C.M. [Royal Free Hospital, Dept. of Rheumatology, London (United Kingdom)

    1999-01-01

    This study evaluated the utility of the clearance time of inhaled diethylenetriamine pentaacetate (DTPA) to distinguish pulmonary vascular disease from early fibrosing alveolitis (FA) in patients with systemic sclerosis (SSc) It was hypothesized that this would be preserved in patients with vascular disease compared with FA, despite similar gas-transfer deficits and matching lung volumes, because of the preservation of alveolar epithelial integrity. All patients had SSc and were categorized into a control group (C; n=9), pulmonary vascular group (VAS; n=14) or FA group (n=14) dependent on the appearance on a computed tomography (CT) scan and the transfer factor of the lung for carbon monoxide (TL,CO) (VAS and FA {<=}70%, C {>=}80%). All patients had a forced vital capacity (FVC) of >80%. The TL,CO (median) was similar in the VAS (57.5%) and FA (60%) groups. There was a significant difference in median DTPA clearance half-times between FA (21.25 min) and VAS (46.5 min) (p=0.014) and between FA and C (84.5 min) (p=0.0004). No difference was found between VAS and C (p=0.0778). Follow-up data from the VAS group showed no subsequent development of FA on the CT scan and no decrease in FVC (n=13, mean 42 months). These results suggest that clearance of diethylenetriamine pentaacetate is preserved in patients likely to have pulmonary vascular disease and may be useful in distinguishing fibrosing alveolitis from vascular disease in systemic sclerosis. (au) 22 refs.

  18. High-resolution computed tomography and rheumatoid arthritis: semi-quantitative evaluation of lung damage and its correlation with clinical and functional abnormalities.

    Science.gov (United States)

    Yilmazer, Baris; Gümüştaş, Sevtap; Coşan, Fulya; İnan, Nagihan; Ensaroğlu, Fatih; Erbağ, Gökhan; Yıldız, Füsun; Çefle, Ayşe

    2016-03-01

    We aimed to establish risk factors for radiological lung damage associated with rheumatoid arthritis (RA) and determine whether clinical findings and pulmonary function test were correlated with Warrick score calculated on the basis of high-resolution computed tomography or not. One hundred thirty RA patients who were followed at rheumatology outpatient clinic were included through retrospective screening. To evaluate radiological involvement, the semi-quantitative evaluation proposed by Warrick was used to assign a score for each lesion based on the severity and extent of the pulmonary damage. In addition to the total score, indices for alveolitis and fibrosis were created. The correlations between each score and clinical and functional parameters were tested for all patients. We showed that age was an independent explanatory variable of radiological lung damage. Percentage of predicted lung diffusion capacity for carbon monoxide (DLco) below 75 % and presence of respiratory symptoms were found to contribute more to radiological lung damage. Warrick score was positively correlated with age at study onset (r = 0.43, p < 0.001). In addition, a negative correlation was found between Warrick score and DLco % predicted (r = -0.357, p = 0.001). Alveolitis index was negatively correlated with DLco % predicted (r = -0.321, p = 0.003). It is considered that this semi-quantitative method may have added value in early diagnosis, appropriate treatment decisions and follow-up when taken into account together with risk factors associated with pulmonary damage in RA.

  19. Honeycomb development on Alexander Island, glacial history of George VI Sound and palaeoclimatic implications (Two Step Cliffs/Mars Oasis, W Antarctica)

    Science.gov (United States)

    André, Marie-Françoise; Hall, Kevin

    2005-02-01

    Analysis of three generations of glacial deposits and of a range of geomorphic features including widespread honeycombs and tafonis at Two Step Cliffs/Mars Oasis (71°52‧S, 68°15‧W) provides new insights into the geomorphological evolution of West Antarctica, with special respect to alveolar weathering. At Two Step Terrace, indicators of the inherited character of cavernous weathering were found, such as 97% non-flaking and varnished backwalls, and 80% tafoni floors that are till-covered and/or sealed by lithobiontic coatings. Based on the NE predominant aspect of the alveolized boulder faces, tafoni initiation is attributed to coastal salt spray weathering by halite coming from the George VI Sound during the 6.5 ka BP open water period. The present-day activity of these inherited cavities is restricted to roof flaking attributed to a combination of processes involving thermal stresses. This 6.5 ka BP phase of coastal alveolization is the first step of a six-stage Holocene geomorphological scenario that includes alternatively phases of glacial advance or stationing, and phases of vegetal colonization and/or rock weathering and aeolian abrasion on the deglaciated outcrops. This geomorphic scenario is tentatively correlated with the available palaeoenvironmental record in the Antarctic Peninsula region, with two potential geomorphic indicators of the Holocene Optimum being identified: (1) clusters of centimetric honeycombs facing the sound (marine optimum at 6.5 ka BP); (2) salmon-pink lithobiontic coatings preserved inside cavities and at the boulder surface (terrestrial optimum at 4 3 ka BP).

  20. A case study for effects of operational taxonomic units from intracellular endoparasites and ciliates on the eukaryotic phylogeny: phylogenetic position of the haptophyta in analyses of multiple slowly evolving genes.

    Directory of Open Access Journals (Sweden)

    Hisayoshi Nozaki

    Full Text Available Recent multigene phylogenetic analyses have contributed much to our understanding of eukaryotic phylogeny. However, the phylogenetic positions of various lineages within the eukaryotes have remained unresolved or in conflict between different phylogenetic studies. These phylogenetic ambiguities might have resulted from mixtures or integration from various factors including limited taxon sampling, missing data in the alignment, saturations of rapidly evolving genes, mixed analyses of short- and long-branched operational taxonomic units (OTUs, intracellular endoparasite and ciliate OTUs with unusual substitution etc. In order to evaluate the effects from intracellular endoparasite and ciliate OTUs co-analyzed on the eukaryotic phylogeny and simplify the results, we here used two different sets of data matrices of multiple slowly evolving genes with small amounts of missing data and examined the phylogenetic position of the secondary photosynthetic chromalveolates Haptophyta, one of the most abundant groups of oceanic phytoplankton and significant primary producers. In both sets, a robust sister relationship between Haptophyta and SAR (stramenopiles, alveolates, rhizarians, or SA [stramenopiles and alveolates] was resolved when intracellular endoparasite/ciliate OTUs were excluded, but not in their presence. Based on comparisons of character optimizations on a fixed tree (with a clade composed of haptophytes and SAR or SA, disruption of the monophyly between haptophytes and SAR (or SA in the presence of intracellular endoparasite/ciliate OTUs can be considered to be a result of multiple evolutionary reversals of character positions that supported the synapomorphy of the haptophyte and SAR (or SA clade in the absence of intracellular endoparasite/ciliate OTUs.

  1. Histopathological approach to patterns of interstitial pneumonia in patient with connective tissue disorders.

    Science.gov (United States)

    Nicholson, Andrew G; Colby, Thomas V; Wells, Athol U

    2002-03-01

    It is well established that some patients with connective tissue disorders will suffer from pulmonary disease at some stage in their disease progression. This article concentrates on the interstitial pneumonias, seen in association with most types of connective tissue disorder, particularly in the ligh of non-specific interstitial pneumonia (NSIP) being recognised as a distinct histological pattern. Most published articles on this subject precede recognition of NSIP and, as such, the relative incidence of patterns of interstitial pneumonia, as defined by the International Consensus Classification Committee for Interstitial Lung Disease (ICCILD), as well as the clinical and prognostic significance of these patterns is undergoing further scrutiny. In this review, the recognised histological patterns, namely usual interstitial pneumonia (UIP), non-specific interstitial pneumonia (NSIP), diffuse alveolar damage (DAD), organising pneumonia (OP), reactive pulmonary lymphoid hyperplasia, desquamative interstitial pneumonia (DIP) and respiratory bronchiolitis-associated interstitial lung disease (RBILD) are reviewed systematically in relation to the various subgroups of connective tissue disorders. As yet, there are few published studies, but current evidence suggests that many cases previously classified as fibrosing alveolitis are likely to show a pattern of NSIP rather than UIP, particularly in relation to systemic sclerosis. The histological pattern of usual interstitial pneumonia, the most frequently seen pattern in biopsies from patients with idiopathic pulmonary fibrosis/cryptogenic fibrosing alveolitis, appears to be comparatively rare. Furthermore, any biopsy showing a combination of histological patterns, a pattern of non-specific interstitial pneumonia or a pattern of lymphoid interstitial pneumonia/follicular bronchiolitis should be thoroughly investigated for a background connective tissue disorder, if previously unsuspected. Finally, the recently published

  2. Analgesia acupuntural en las extracciones dentarias

    Directory of Open Access Journals (Sweden)

    Juana María Abreu Correa

    1997-12-01

    Full Text Available Se compararon los resultados de la exodoncia con anestesia y con analgesia con acupuntura en 2 grupos de 60 pacientes cada uno, en los cuales se evaluaron los efectos de ambos tratamientos a las 24, 48 y 72 horas de realizada la extracción. Los aspectos evaluados fueron las complicaciones posextracción y la presencia de dolor, molestias o inflamación con posterioridad a ésta. En el grupo de los pacientes a los que se les aplicó la anestesia a las 24 horas, 51 tenían inflamación y a las 72 horas 31 continuaban con ligero enrojecimiento e inflamación, 3 casos presentaron alveolitis fungosa. Entre los que recibieron la acupuntura a las 24 horas, 26 tenían ligero enrojecimiento que desapareció antes de las 72 horas sin otras complicaciones.The results of exodontia with anesthesia and with acupuncture analgesia are compared in two groups of 60 patients each, in which the effects of both treatments were evaluated 24, 48 and 72 hours after the extraction. The aspects evaluated were the postextraction complications and the presence of pain, disturbance or inflammation after it. In the group of patients that received anesthesia, 51 had inflammation 24 hours after the extraction, whereas 31 still had a mild redness and inflammation 72 hours later. 3 patients presented fungous alveolitis. Among those who were treated with acupuncture, 26 showed a mild redness 24 hours after the extraction that dissapeared before the 72 hours without other complications.

  3. When is a cell not a cell? A theory relating coenocytic structure to the unusual electrophysiology of Ventricaria ventricosa (Valonia ventricosa).

    Science.gov (United States)

    Shepherd, V A; Beilby, M J; Bisson, M A

    2004-06-01

    Ventricaria ventricosa and its relatives have intrigued cell biologists and electrophysiologists for over a hundred years. Historically, electrophysiologists have regarded V. ventricosa as a large single plant cell with unusual characteristics including a small and positive vacuole-to-outside membrane potential difference. However, V. ventricosa has a coenocytic construction, with an alveolate cytoplasm interpenetrated by a complex vacuole containing sulphated polysaccharides. We present a theory relating the coenocytic structure to the unusual electrophysiology of V. ventricosa. The alveolate cytoplasm of V. ventricosa consists of a collective of uninucleate cytoplasmic domains interconnected by fine cytoplasmic strands containing microtubules. The cytoplasm is capable of disassociating into single cytoplasmic domains or aggregations of domains that can regenerate new coenocytes. The cytoplasmic domains are enclosed by outer (apical) and inner (basolateral) faces of a communal membrane with polarised K(+)-transporting functions, stabilised by microtubules and resembling a tissue such as a polarised epithelium. There is evidence for membrane trafficking through endocytosis and exocytosis and so "plasmalemma" and "tonoplast" do not have fixed identities. Intra- and extracellular polysaccharide mucilage has effects on electrophysiology through reducing the activity of water and through ion exchange. The vacuole-to-outside potential difference, at which the cell membrane conductance is maximal, reverses its sign from positive under hypertonic conditions to negative under hypotonic conditions. The marked mirror symmetry of the characteristics of current as a function of voltage and conductance as a function of voltage is interpreted as a feature of the communal membrane with polarised K(+) transport. The complex inhomogeneous structure of the cytoplasm places in doubt previous measurements of cytoplasm-to-outside potential difference.

  4. Plant-type trehalose synthetic pathway in cryptosporidium and some other apicomplexans.

    Directory of Open Access Journals (Sweden)

    Yonglan Yu

    Full Text Available BACKGROUND: The trehalose synthetic pathway is present in bacteria, fungi, plants and invertebrate animals, but is absent in vertebrates. This disaccharide mainly functions as a stress protectant against desiccation, heat, cold and oxidation. Genes involved in trehalose synthesis have been observed in apicomplexan parasites, but little was known about these enzymes. Study on trehalose synthesis in apicomplexans would not only shed new light into the evolution of this pathway, but also provide data for exploring this pathway as novel drug target. METHODOLOGY/PRINCIPAL FINDINGS: We have observed the presence of the trehalose synthetic pathway in Cryptosporidium and other apicomplexans and alveolates. Two key enzymes (trehalose 6-phosphate synthase [T6PS; EC 2.4.1.15] and trehalose phosphatase [TPase; EC 3.1.3.12] are present as Class II bifunctional proteins (T6PS-TPase in the majority of apicomplexans with the exception of Plasmodium species. The enzyme for synthesizing the precursor (UDP-glucose is homologous to dual-substrate UDP-galactose/glucose pyrophosphorylases (UGGPases, rather than the "classic" UDP-glucose pyrophosphorylase (UGPase. Phylogenetic recontructions indicate that both T6PS-TPases and UGGPases in apicomplexans and other alveolates are evolutionarily affiliated with stramenopiles and plants. The expression level of T6PS-TPase in C. parvum is highly elevated in the late intracellular developmental stage prior to or during the production of oocysts, implying that trehalose may be important in oocysts as a protectant against environmental stresses. Finally, trehalose has been detected in C. parvum oocysts, thus confirming the trehalose synthetic activity in this parasite. CONCLUSIONS/SIGNIFICANCE: A trehalose synthetic pathway is described in the majority of apicomplexan parasites including Cryptosporidium and the presence of trehalose was confirmed in the C. parvum oocyst. Key enzymes in the pathway (i.e., T6PS-TPase and UGGPase

  5. How reliably can northeast Atlantic sand lances of the genera Ammodytes and Hyperoplus be distinguished? A comparative application of morphological and molecular methods

    Directory of Open Access Journals (Sweden)

    Ralf Thiel

    2016-09-01

    Full Text Available Accurate stock assessments for each of the dominant species of sand lances in the northeast Atlantic Ocean and adjacent areas are not available due to the lack of a reliable identification procedure; therefore, appropriate measures of fisheries management or conservation of sand lances cannot be implemented. In this study, detailed morphological and molecular features are assessed to discriminate between four species of sand lances belonging to the genera Ammodytes and Hyperoplus. Morphological characters described by earlier authors as useful for identification of the genera are confirmed, and two additional distinguishing characters are added. A combination of the following morphological characters is recommended to distinguish between the genera Hyperoplus and Ammodytes: the protrusibility of the premaxillae, the presence of hooked ends of the prevomer, the number of dermal plicae, and the pectoral-fin length as a percentage of the standard length. The discriminant function analysis revealed that morphometric data are not very useful to distinguish the species of each of the two genera. The following meristic characters improve the separation of H. lanceolatus from H. immaculatus: the number of lower arch gill rakers, total number of gill rakers, numbers of caudal vertebrae and total vertebrae, and numbers of dorsal-fin and anal-fin rays. It is confirmed that A. tobianus differs from A. marinus by its belly scales that are organised in tight chevrons, scales which are present over the musculature at the base of the caudal fin, as well as by the lower numbers of dermal plicae, dorsal-fin rays, and total vertebrae. In contrast to the morphological data, mitochondrial COI sequences (DNA barcodes failed to separate unambiguously the four investigated species. Ammodytes tobianus and H. lanceolatus showed an overlap between intraspecific and interspecific K2P genetic distances and cannot be reliably distinguished using the common DNA barcoding

  6. Protozoan parasites of bivalve molluscs: literature follows culture.

    Directory of Open Access Journals (Sweden)

    José A Fernández Robledo

    Full Text Available Bivalve molluscs are key components of the estuarine environments as contributors to the trophic chain, and as filter -feeders, for maintaining ecosystem integrity. Further, clams, oysters, and scallops are commercially exploited around the world both as traditional local shellfisheries, and as intensive or semi-intensive farming systems. During the past decades, populations of those species deemed of environmental or commercial interest have been subject to close monitoring given the realization that these can suffer significant decline, sometimes irreversible, due to overharvesting, environmental pollution, or disease. Protozoans of the genera Perkinsus, Haplosporidium, Marteilia, and Bonamia are currently recognized as major threats for natural and farmed bivalve populations. Since their identification, however, the variable publication rates of research studies addressing these parasitic diseases do not always appear to reflect their highly significant environmental and economic impact. Here we analyzed the peer- reviewed literature since the initial description of these parasites with the goal of identifying potential milestone discoveries or achievements that may have driven the intensity of the research in subsequent years, and significantly increased publication rates. Our analysis revealed that after initial description of the parasite as the etiological agent of a given disease, there is a time lag before a maximal number of yearly publications are reached. This has already taken place for most of them and has been followed by a decrease in publication rates over the last decade (20- to 30- year lifetime in the literature. Autocorrelation analyses, however, suggested that advances in parasite purification and culture methodologies positively drive publication rates, most likely because they usually lead to novel molecular tools and resources, promoting mechanistic studies. Understanding these trends should help researchers in

  7. The Greenland shark (Somniosus microcephalus)

    DEFF Research Database (Denmark)

    Nielsen, Julius

    This PhD project has aimed at investigating longevity of the Greenland shark. The largest Greenland sharks measure at least 550 cm, and ever since Poul Marinus Hansen in 1963 presented that a recaptured medium-sized Greenland shark had grown 8 cm in 16 year, longevity of the species has been...... subject for speculation. Conventional age determination techniques for teleost or elasmobranchs are not applicable on the Greenland shark and its longevity has thus remained a mystery for decades. Inspired by alternative age estimation techniques applied on other sharks and whales, I have used bomb...... radiocarbon dating and a Bayesian calibration model to estimate longevity of the Greenland shark. The analyzed tissue stems from the eye lens nucleus – unique material which presumably reflects age 0 of the shark, as it has not undergone metabolic changes during the animal’s life. By studying 28 Greenland...

  8. Adaptive Evolution of Phosphorus Metabolism in Prochlorococcus

    DEFF Research Database (Denmark)

    Casey, John R; Mardinoglu, Adil; Nielsen, Jens

    2016-01-01

    Inorganic phosphorus is scarce in the eastern Mediterranean Sea, where the high-light-adapted ecotype HLI of the marine picocyanobacterium Prochlorococcus marinus thrives. Physiological and regulatory control of phosphorus acquisition and partitioning has been observed in HLI both in culture...... and in the field; however, the optimization of phosphorus metabolism and associated gains for its phosphorus-limited-growth (PLG) phenotype have not been studied. Here, we reconstructed a genome-scale metabolic network of the HLI axenic strain MED4 (iJC568), consisting of 568 metabolic genes in relation to 794...... reactions involving 680 metabolites distributed in 6 subcellular locations. iJC568 was used to quantify metabolic fluxes under PLG conditions, and we observed a close correspondence between experimental and computed fluxes. We found that MED4 has minimized its dependence on intracellular phosphate, not only...

  9. Pangenomic Definition of Prokaryotic Species and the Phylogenetic Structure of Prochlorococcus spp.

    Directory of Open Access Journals (Sweden)

    Mikhail A. Moldovan

    2018-03-01

    Full Text Available The pangenome is the collection of all groups of orthologous genes (OGGs from a set of genomes. We apply the pangenome analysis to propose a definition of prokaryotic species based on identification of lineage-specific gene sets. While being similar to the classical biological definition based on allele flow, it does not rely on DNA similarity levels and does not require analysis of homologous recombination. Hence this definition is relatively objective and independent of arbitrary thresholds. A systematic analysis of 110 accepted species with the largest numbers of sequenced strains yields results largely consistent with the existing nomenclature. However, it has revealed that abundant marine cyanobacteria Prochlorococcus marinus should be divided into two species. As a control we have confirmed the paraphyletic origin of Yersinia pseudotuberculosis (with embedded, monophyletic Y. pestis and Burkholderia pseudomallei (with B. mallei. We also demonstrate that by our definition and in accordance with recent studies Escherichia coli and Shigella spp. are one species.

  10. Dicty_cDB: Contig-U15005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 297067_1( AK297067 |pid:none) Homo sapiens cDNA FLJ56680 complet... 35 8.0 ( P53769 ) RecName: Full=Pre-mRNA-spli...517835 ) 1093015531431 Global-Ocean-Sampling_GS-35-01-01-1... 48 0.013 2 ( AX344559 ) Sequence 10 from Paten...ete genome. 30 0.039 13 ( AF467886 ) Crioceris duodecimpunctata mitochondrion, complet... 32...hlorococcus marinus str. MIT 9215, complete g... 40 0.053 26 ( EJ119257 ) 1092343365613 Global-Ocean-Samplin...e) Monopterus albus zinc finger prote... 36 4.7 ( O60106 ) RecName: Full=LON peptidase N-terminal domain and

  11. New Mediterranean Biodiversity Records (December 2012

    Directory of Open Access Journals (Sweden)

    M. THESSALOU-LEGAKI

    2012-12-01

    Isl., Aegean Sea and the bryozoan Electra tenella (Livorno harbour and Messina Straits area. The alien fish Siganus luridus, Siganus rivulatus, Fistularia commersonii, Sphyraena chrysotaenia and Sargocentron rubrum are also reported from the islands of Karpathos and Chalki, and Pteragogus pelycus from Heraklion Bay, Crete. In addition, new localities for four rare Mediterranean inhabitants are given: the cephalopod Thysanoteuthis rhombus (NW Sardinia and the fish: Lampris guttatus (Calabria, S Italy, Petromyzon marinus (Gokova Bay and Remora australis (Saronikos Gulf, while the opisthobranch gastropod Cerberilla bernadettae is reported for the first time from the E Mediterranean (Cyprus. Finally, three species of the Aegean ascidiofauna are recorded for the first time: Lissoclinum perforatum, Ciona roulei and Ecteinascidia turbinata. Furthermore, it was established that Phallusia nigra has extended its distributional range to the north of the Aegean Sea.

  12. Connectivity in the early life history of sandeel inferred from otolith microchemistry

    Science.gov (United States)

    Gibb, Fiona M.; Régnier, Thomas; Donald, Kirsty; Wright, Peter J.

    2017-01-01

    Connectivity is a central issue in the development, sustainability and effectiveness of networks of Marine Protected Areas (MPAs). In populations with site attached adults, connectivity is limited to dispersal in the pelagic larval stage. While biophysical models have been widely used to infer early dispersal, empirical evidence through sources such as otolith microchemistry can provide a means of evaluating model predictions. In the present study, connectivity in the lesser sandeel, Ammodytes marinus, was investigated using LA-ICP-MS otolith microchemistry. Otoliths from juveniles (age 0) were examined from four Scottish spawning areas predicted to differ in terms of larval retention rates and connectivity based on past biophysical models. There were significant spatial differences in otolith post-settled juvenile chemistry among locations at a scale of 100-400 km. Differences in near core chemistry pointed to three chemically distinct natal sources, as identified by a cluster analysis, contributing to settlement locations.

  13. Geographical, and seasonal variation in the diet of harbour porpoises (Phocoena phocoena in Icelandic coastal waters

    Directory of Open Access Journals (Sweden)

    Gísli A Víkingsson

    2003-07-01

    Overall capelin (Mallotus villosus comprised the predominant prey, followed by sandeel (Ammodytidae sp., then gadids, cephalopods and redfish (Sebastes marinus, while other taxa were of less importance. Differences were detected in diet composition among 5 areas around Iceland with redfish and gadids more prominent in the northern areas. Off SW Iceland there was considerable seasonal variation in the porpoise diet, where capelin appeared to be dominant in late winter and spring and sandeel in the summer through early winter. Predominance of capelin in the diet coincided with the spawning migration of capelin from northern waters along the east, south and west coasts of Iceland. Mature females appeared to have a more diverse diet than other reproductive classes. The length distributions of fish consumed by the porpoises ranged from 1 to 51 cm although most fish prey were less than 30 cm.

  14. Spatial differences in growth of lesser sandeel in the North Sea

    DEFF Research Database (Denmark)

    Rindorf, Anna; Wright, Peter J.; Jensen, Henrik

    2016-01-01

    Lesser sandeel, Ammodytes marinus, is a key prey to a variety of North Sea predators, including species such as single load seabirds which are highly sensitive to prey size and condition. Whilst differences in weight at age across the North Sea have been investigated previously, the scale and cause...... of this variation as well as the potential link to spatial differences in predator performance remains unknown. This study presents an analysis of spatial patterns in length and condition of the lesser sandeel in the North Sea and the relationship of these with physical and biological factors. Both mean length...... considerably both spatially and temporally, resulting in 4 fold and 1.9 fold variations in the number of sandeels required to obtain a specific weight, respectively. Hence, the value of sandeel as prey to single load predators varies considerably with values in central and northeastern North Sea being...

  15. Distribution of the early larval stages of cod, plaice and lesser sandeel across haline fronts in the North Sea

    DEFF Research Database (Denmark)

    Munk, Peter; Wright, P.J.; Pihl, Niels Jørgen

    2002-01-01

    A number of commercially important fish species spawn in the coastal areas of the North Sea in the late winter, including cod (Gadus morhua), plaice (Pleuronectes platessa) and lesser sandeel (Ammodytes marinus). The distribution of the early stages of these species overlap to some extent......, suggesting that adult spawning and dispersal of eggs and larvae are influenced by the same hydrographic features. The present study describes the results of a field survey in March 1997 which covered concentrations of small larval cod, plaice and lesser sandeel in the central and southern North Sea...... zones between freshwater-influenced water masses and shelf water of the central North Sea, and larval abundances peaked in the vicinity of the haline fronts. (C) 2002 Elsevier Science Ltd. All rights reserved....

  16. Miniaturized Bioaffinity Assessment Coupled to Mass Spectrometry for Guided Purification of Bioactives from Toad and Cone Snail

    Directory of Open Access Journals (Sweden)

    Ferry Heus

    2014-02-01

    Full Text Available A nano-flow high-resolution screening platform, featuring a parallel chip-based microfluidic bioassay and mass spectrometry coupled to nano-liquid chromatography, was applied to screen animal venoms for nicotinic acetylcholine receptor like (nAChR affinity by using the acetylcholine binding protein, a mimic of the nAChR. The potential of this microfluidic platform is demonstrated by profiling the Conus textile venom proteome, consisting of over 1,000 peptides. Within one analysis (<90 min, 500 ng venom injected, ligands are detected and identified. To show applicability for non-peptides, small molecular ligands such as steroidal ligands were identified in skin secretions from two toad species (Bufo alvarius and Bufo marinus. Bioactives from the toad samples were subsequently isolated by MS-guided fractionation. The fractions analyzed by NMR and a radioligand binding assay with α7-nAChR confirmed the identity and bioactivity of several new ligands.

  17. Exotic Amphibians in the Pet Shops of Taiwan

    Directory of Open Access Journals (Sweden)

    Ping-Chun Lucy Hou

    2006-06-01

    Full Text Available Pet trade is an important mechanism for introducing alien species. We surveyed a total of 434 pet shops in major cities of Taiwan and found 49 species of alien amphibians belonging to 14 families and 31 genera. Two of the alien species, Rana catesbeiana and Kaloula pulchra, have established in the fields and the other three, Bufo marinus, Xenopus laevis, and Dendrobates auratus, have invasion records in other countries. There were 16 CITES Appendix II species. The most frequently displayed species were the horned frogs, eratophrys spp. And the most abundant species was the American Bullfrog, Rana catesbeiana. We urge the authority of Taiwan establishing regulations on pet trade and enforcing the wildlife conservation law to reduce the risks of alien species invasions.

  18. Patchy zooplankton grazing and high energy conversion efficiency: ecological implications of sandeel behavior and strategy

    DEFF Research Database (Denmark)

    Deurs, Mikael van; Christensen, Asbjørn; Rindorf, Anna

    2013-01-01

    of prey. Here we studied zooplankton consumption and energy conversion efficiency of lesser sandeel (Ammodytes marinus) in the central North Sea, using stomach data, length and weight-at-age data, bioenergetics, and hydrodynamic modeling. The results suggested: (i) Lesser sandeel in the Dogger area depend......Sandeel display strong site-fidelity, and spend most of their life buried in the seabed. This strategy carries important ecological implications. Sandeels save energy when they are not foraging but in return are unable to move substantially and therefore possibly are sensitive to local depletion...... largely on relatively large copepods in early spring. (ii) Lesser sandeel is an efficient converter making secondary production into fish tissue available for higher trophic levels. Hence, changes in species composition towards a more herring dominated system, as seen in recent times, may lead...

  19. Evolutionary conservation of divergent pro-inflammatory and homeostatic responses in Lamprey phagocytes.

    Directory of Open Access Journals (Sweden)

    Jeffrey J Havixbeck

    Full Text Available In higher vertebrates, phagocytosis plays a critical role in development and immunity, based on the internalization and removal of apoptotic cells and invading pathogens, respectively. Previous studies describe the effective uptake of these particles by lower vertebrate and invertebrate phagocytes, and identify important molecular players that contribute to this internalization. However, it remains unclear if individual phagocytes mediate internalization processes in these ancient organisms, and how this impacts the balance of pro-inflammatory and homeostatic events within their infection sites. Herein we show that individual phagocytes of the jawless vertebrate Petromyzon marinus (sea lamprey, like those of teleost fish and mice, display the capacity for divergent pro-inflammatory and homeostatic responses following internalization of zymosan and apoptotic cells, respectively. Professional phagocytes (macrophages, monocytes, neutrophils were the primary contributors to the internalization of pro-inflammatory particles among goldfish (C. auratus and lamprey (P. marinus hematopoietic leukocytes. However, goldfish showed a greater ability for zymosan phagocytosis when compared to their jawless counterparts. Coupled to this increase was a significantly lower sensitivity of goldfish phagocytes to homeostatic signals derived from apoptotic cell internalization. Together, this translated into a significantly greater capacity for induction of antimicrobial respiratory burst responses compared to lamprey phagocytes, but also a decreased efficacy in apoptotic cell-driven leukocyte homeostatic mechanisms that attenuate this pro-inflammatory process. Overall, our results show the long-standing evolutionary contribution of intrinsic phagocyte mechanisms for the control of inflammation, and illustrate one effective evolutionary strategy for increased responsiveness against invading pathogens. In addition, they highlight the need for development of

  20. Chronic hypoxia and chronic hypercapnia differentially regulate an NMDA-sensitive component of the acute hypercapnic ventilatory response in the cane toad (Rhinella marina).

    Science.gov (United States)

    McAneney, Jessica; Gheshmy, Afshan; Manga, Jasmin; Reid, Stephen G

    2011-08-01

    This study addressed the hypotheses that exposure to chronic hypoxia (CH) and chronic hypercapnia (CHC) would modify the acute hypercapnic ventilatory response in the cane toad (Rhinella marina; formerly Bufo marinus or Chaunus marinus) and its regulation by NMDA-mediated processes. Cane toads were exposed to 10 days of CH (10% O(2)) or CHC (3.5% CO(2)) followed by acute in vivo hypercapnic breathing trials, conducted before and after an injection of the NMDA-receptor channel blocker, MK801 into the dorsal lymph sac. CH, CHC and MK801 did not alter ventilation under acute normoxic normocapnic conditions. CH blunted the increase in breathing frequency during acute hypercapnia while CHC had no effect. The effect of CH on breathing frequency was mediated by a decrease in the number of breaths per breathing episode. Neither CH nor CHC altered breath area (volume). MK801 augmented breathing frequency (via an increase in breaths per episode) and total ventilation during acute hypercapnia in control toads and toads exposed to CH; there was no effect of MK801 on the increase in breathing frequency or total ventilation, during acute hypercapnia in toads exposed to CHC. The results indicate that CH and CHC differentially alter breathing pattern. Furthermore, they indicate an absence of NMDA-mediated glutamatergic tone during normoxic normocapnia but that NMDA-mediated processes attenuate the increase in breathing frequency during acute hypercapnia under control conditions and following CH but not following CHC. Given that MK801 was administered systemically, the effects could be acting anywhere in the reflex pathway from CO(2)-sensing to respiratory motor output.

  1. Active urea transport by the skin of Bufo viridis: Amiloride- and phloretin-sensitive transport sites

    Energy Technology Data Exchange (ETDEWEB)

    Rapoport, J.; Abuful, A.; Chaimovitz, C.; Noeh, Z.; Hays, R.M. (Soroka Medical Center, Beersheva (Israel) Albert Einstein College of Medicine, New York, NY (USA))

    1988-09-01

    Urea is actively transported inwardly (J{sub i}) across the skin of the green toad Bufo viridis. J{sub i} is markedly enhanced in toads adapted to hypertonic saline. The authors studied urea transport across the skin of Bufo viridis under a variety of experimental conditions, including treatment with amiloride and phloretin, agents that inhibit urea permeability in the bladder of Bufo marinus. Amiloride (10{sup {minus}4} M) significantly inhibited J{sub i} in both adapted and unadapted animals and was unaffected by removal of sodium from the external medium. Phloretin (10{sup {minus}4} M) significantly inhibited J{sub i} in adapted animals by 23-46%; there was also a reduction in J{sub i} in unadapted toads at 10{sup {minus}4} and 5 {times} 10{sup {minus}4} M phloretin. A dose-response study revealed that the concentration of phloretin causing half-maximal inhibition (K{sub {1/2}}) was 5 {times} 10{sup {minus}4} M for adapted animals. J{sub i} was unaffected by the substitution of sucrose for Ringer solution or by ouabain. They conclude (1) the process of adaptation appears to involve an increase in the number of amiloride- and phloretin-inhibitable urea transport sites in the skin, with a possible increase in the affinity of the sites for phloretin; (2) the adapted skin resembles the Bufo marinus urinary bladder with respect to amiloride and phloretin-inhibitable sites; (3) they confirm earlier observations that J{sub i} is independent of sodium transport.

  2. Organization of lamprey variable lymphocyte receptor C locus and repertoire development.

    Science.gov (United States)

    Das, Sabyasachi; Hirano, Masayuki; Aghaallaei, Narges; Bajoghli, Baubak; Boehm, Thomas; Cooper, Max D

    2013-04-09

    Jawless vertebrates are pivotal representatives for studies of the evolution of adaptive immunity due to their unique position in chordate phylogeny. Lamprey and hagfish, the extant jawless vertebrates, have an alternative lymphocyte-based adaptive immune system that is based on somatically diversifying leucine-rich repeat (LRR)-based antigen receptors, termed variable lymphocyte receptors (VLRs). Lamprey T-like and B-like lymphocyte lineages have been shown to express VLRA and VLRB types of anticipatory receptors, respectively. An additional VLR type, termed VLRC, has recently been identified in arctic lamprey (Lethenteron camtschaticum), and our analysis indicates that VLRC sequences are well conserved in sea lamprey (Petromyzon marinus), L. camtschaticum, and European brook lamprey (Lampetra planeri). Genome sequences of P. marinus were analyzed to determine the organization of the VLRC-encoding locus. In addition to the incomplete germ-line VLRC gene, we have identified 182 flanking donor genomic sequences that could be used to complete the assembly of mature VLRC genes. Donor LRR cassettes were classifiable into five basic structural groups, the composition of which determines their order of use during VLRC assembly by virtue of sequence similarities to the incomplete germ-line gene and to one another. Bidirectional VLRC assembly was predicted by comparisons of mature VLRC genes with the sequences of donor LRR cassettes and verified by analysis of partially assembled intermediates. Biased and repetitive use of certain donor LRR cassettes was demonstrable in mature VLRCs. Our analysis provides insight into the unique molecular strategies used for VLRC gene assembly and repertoire diversification.

  3. Surfactant in the gas mantle of the snail Helix aspersa.

    Science.gov (United States)

    Daniels, C B; Wood, P G; Loptako, O V; Codd, J R; Johnston, S D; Orgeig, S

    1999-01-01

    Surfactant occurs in cyclically inflating and deflating, gas-holding structures of vertebrates to reduce the surface tension of the inner fluid lining, thereby preventing collapse and decreasing the work of inflation. Here we determined the presence of surfactant in material lavaged from the airspace in the gas mantle of the pulmonate snail Helix aspersa. Surfactant is characterized by the presence of disaturated phospholipid (DSP), especially disaturated phosphatidylcholine (PC), lavaged from the airspace, by the presence of lamellated osmiophilic bodies (LBs) in the airspaces and epithelial tissue, and by the ability of the lavage to reduce surface tension of fluid in a surface balance. Lavage had a DSP/phospholipid (PL) ratio of 0.085, compared to 0.011 in membranes, with the major PL being PC (45.3%). Cholesterol, the primary fluidizer for pulmonary surfactant, was similar in lavage and in lipids extracted from cell homogenates (cholesterol/PL: 0.04 and 0. 03, respectively). LBs were found in the tissues and airspaces. The surface activity of the lavage material is defined as the ability to reduce surface tension under compression to values much lower than that of water. In addition, surface-active lipids will vary surface tension, increasing it upon inspiration as the surface area expands. By these criteria, the surface activity of lavaged material was poor and most similar to that shown by pulmonary lavage of fish and toads. Snail surfactant displays structures, a biochemical PL profile, and biophysical properties similar to surfactant obtained from primitive fish, teleost swim bladders, the lung of the Dipnoan Neoceratodus forsteri, and the amphibian Bufo marinus. However, the cholesterol/PL and cholesterol/DSP ratios are more similar to the amphibian B. marinus than to the fish, and this similarity may indicate a crucial physicochemical relationship for these lipids.

  4. A molecular timescale of eukaryote evolution and the rise of complex multicellular life

    Directory of Open Access Journals (Sweden)

    Venturi Maria L

    2004-01-01

    Full Text Available Abstract Background The pattern and timing of the rise in complex multicellular life during Earth's history has not been established. Great disparity persists between the pattern suggested by the fossil record and that estimated by molecular clocks, especially for plants, animals, fungi, and the deepest branches of the eukaryote tree. Here, we used all available protein sequence data and molecular clock methods to place constraints on the increase in complexity through time. Results Our phylogenetic analyses revealed that (i animals are more closely related to fungi than to plants, (ii red algae are closer to plants than to animals or fungi, (iii choanoflagellates are closer to animals than to fungi or plants, (iv diplomonads, euglenozoans, and alveolates each are basal to plants+animals+fungi, and (v diplomonads are basal to other eukaryotes (including alveolates and euglenozoans. Divergence times were estimated from global and local clock methods using 20–188 proteins per node, with data treated separately (multigene and concatenated (supergene. Different time estimation methods yielded similar results (within 5%: vertebrate-arthropod (964 million years ago, Ma, Cnidaria-Bilateria (1,298 Ma, Porifera-Eumetozoa (1,351 Ma, Pyrenomycetes-Plectomycetes (551 Ma, Candida-Saccharomyces (723 Ma, Hemiascomycetes-filamentous Ascomycota (982 Ma, Basidiomycota-Ascomycota (968 Ma, Mucorales-Basidiomycota (947 Ma, Fungi-Animalia (1,513 Ma, mosses-vascular plants (707 Ma, Chlorophyta-Tracheophyta (968 Ma, Rhodophyta-Chlorophyta+Embryophyta (1,428 Ma, Plantae-Animalia (1,609 Ma, Alveolata-plants+animals+fungi (1,973 Ma, Euglenozoa-plants+animals+fungi (1,961 Ma, and Giardia-plants+animals+fungi (2,309 Ma. By extrapolation, mitochondria arose approximately 2300-1800 Ma and plastids arose 1600-1500 Ma. Estimates of the maximum number of cell types of common ancestors, combined with divergence times, showed an increase from two cell types at 2500 Ma to ~10

  5. A molecular timescale of eukaryote evolution and the rise of complex multicellular life

    Science.gov (United States)

    Hedges, S. Blair; Blair, Jaime E.; Venturi, Maria L.; Shoe, Jason L.

    2004-01-01

    BACKGROUND: The pattern and timing of the rise in complex multicellular life during Earth's history has not been established. Great disparity persists between the pattern suggested by the fossil record and that estimated by molecular clocks, especially for plants, animals, fungi, and the deepest branches of the eukaryote tree. Here, we used all available protein sequence data and molecular clock methods to place constraints on the increase in complexity through time. RESULTS: Our phylogenetic analyses revealed that (i) animals are more closely related to fungi than to plants, (ii) red algae are closer to plants than to animals or fungi, (iii) choanoflagellates are closer to animals than to fungi or plants, (iv) diplomonads, euglenozoans, and alveolates each are basal to plants+animals+fungi, and (v) diplomonads are basal to other eukaryotes (including alveolates and euglenozoans). Divergence times were estimated from global and local clock methods using 20-188 proteins per node, with data treated separately (multigene) and concatenated (supergene). Different time estimation methods yielded similar results (within 5%): vertebrate-arthropod (964 million years ago, Ma), Cnidaria-Bilateria (1,298 Ma), Porifera-Eumetozoa (1,351 Ma), Pyrenomycetes-Plectomycetes (551 Ma), Candida-Saccharomyces (723 Ma), Hemiascomycetes-filamentous Ascomycota (982 Ma), Basidiomycota-Ascomycota (968 Ma), Mucorales-Basidiomycota (947 Ma), Fungi-Animalia (1,513 Ma), mosses-vascular plants (707 Ma), Chlorophyta-Tracheophyta (968 Ma), Rhodophyta-Chlorophyta+Embryophyta (1,428 Ma), Plantae-Animalia (1,609 Ma), Alveolata-plants+animals+fungi (1,973 Ma), Euglenozoa-plants+animals+fungi (1,961 Ma), and Giardia-plants+animals+fungi (2,309 Ma). By extrapolation, mitochondria arose approximately 2300-1800 Ma and plastids arose 1600-1500 Ma. Estimates of the maximum number of cell types of common ancestors, combined with divergence times, showed an increase from two cell types at 2500 Ma to

  6. Diversity of picoeukaryotes at an oligotrophic site off the Northeastern Red Sea Coast.

    Science.gov (United States)

    Acosta, Francisco; Ngugi, David Kamanda; Stingl, Ulrich

    2013-08-20

    Picoeukaryotes are protists ≤ 3 μm composed of a wide diversity of taxonomic groups. They are an important constituent of the ocean's microbiota and perform essential ecological roles in marine nutrient and carbon cycles. Despite their importance, the true extent of their diversity has only recently been uncovered by molecular surveys that resulted in the discovery of a substantial number of previously unknown groups. No study on picoeukaryote diversity has been conducted so far in the main Red Sea basin-a unique marine environment characterized by oligotrophic conditions, high levels of irradiance, high salinity and increased water temperature. We sampled surface waters off the coast of the northeastern Red Sea and analyzed the picoeukaryotic diversity using Sanger-based clone libraries of the 18S rRNA gene in order to produce high quality, nearly full-length sequences. The community captured by our approach was dominated by three main phyla, the alveolates, stramenopiles and chlorophytes; members of Radiolaria, Cercozoa and Haptophyta were also found, albeit in low abundances. Photosynthetic organisms were especially diverse and abundant in the sample, confirming the importance of picophytoplankton for primary production in the basin as well as indicating the existence of numerous ecological micro-niches for this trophic level in the upper euphotic zone. Heterotrophic organisms were mostly composed of the presumably parasitic Marine Alveolates (MALV) and the presumably bacterivorous Marine Stramenopiles (MAST) groups. A small number of sequences that did not cluster closely with known clades were also found, especially in the MALV-II group, some of which could potentially belong to novel clades. This study provides the first snapshot of the picoeukaryotic diversity present in surface waters of the Red Sea, hence setting the stage for large-scale surveying and characterization of the eukaryotic diversity in the entire basin. Our results indicate that the

  7. Comparative study of the acute lung toxicity of pure cobalt powder and cobalt-tungsten carbide mixture in rat.

    Science.gov (United States)

    Lasfargues, G; Lison, D; Maldague, P; Lauwerys, R

    1992-01-01

    Alveolitis progressing to lung fibrosis has been reported in workers exposed to cobalt containing dust (e.g., tungsten carbide-cobalt mixture as produced by the hard metal industry) but rarely following exposure to pure cobalt dust (e.g., in cobalt-producing factories). We have previously demonstrated that tungsten carbide-cobalt mixture is more toxic toward rat alveolar macrophages in vitro than pure cobalt metal powder. The present study was undertaken to compare in female rats the acute pulmonary response (lung weight, lung histology, cellular and biochemical analyses of bronchoalveolar lavage fluid, and mortality) following the intratracheal instillation of pure cobalt (Co) particles (median particle size, d50:4 microns), pure tungsten carbide (WC) particles (d50:2 microns), tungsten carbide-cobalt (WC-Co) powder (d50:2 microns; cobalt 6.3%, tungsten 84%, carbon 5.4%) and crystalline silica (d50 less than 5 micron) used as pneumotoxic reference material. WC alone (15.67 mg/100 g body wt) behaves as an inert dust producing only a mild accumulation of macrophages in the alveolar duct walls. Co alone (1.0 mg/100 g) only causes a moderate inflammatory response. An identical amount of Co given as WC-Co mixture (16.67 mg/100 g; corresponding to 1.0 mg Co/100 g) produces a severe alveolitis and fatal pulmonary edema. Cellular and biochemical characteristics of bronchoalveolar lavage fluid collected 24 hr after the intratracheal instillation of WC (1.0 mg/100 g) or Co (0.06 mg/100 g) are not significantly different from those of control animals instilled with sterile saline. On the contrary, bronchoalveolar lavage fluid changes following administration of the WC-Co mixture (1.0 mg/100 g; corresponding to 0.06 mg Co/100 g) are very similar to those induced by crystalline silica (1.0 mg/100 g). The amount of cobalt excreted in urine is significantly higher when the animals are exposed to WC-Co powder as compared to an equivalent amount of pure cobalt particles

  8. Denticle-embedded ampullary organs in a Cretaceous shark provide unique insight into the evolution of elasmobranch electroreceptors

    Science.gov (United States)

    Vullo, Romain; Guinot, Guillaume

    2015-10-01

    Here, we report a novel type of dermal denticle (or placoid scale), unknown among both living and fossil chondrichthyan fishes, in a Cretaceous lamniform shark. By their morphology and location, these dermal denticles, grouped into clusters in the cephalic region, appear to have been directly associated with the electrosensory ampullary system. These denticles have a relatively enlarged (˜350 μm in diameter), ornamented crown with a small (˜100 μm) asterisk- or cross-shaped central perforation connected to a multi-alveolate internal cavity. The formation of such a complex structure can be explained by the annular coalescence and fusion, around an ampullary vesicle, of several developmental units still at papillary stage (i.e. before mineralization), leading to a single denticle embedding an alveolar ampulla devoid of canal. This differs from larger typical ampullae of Lorenzini with a well-developed canal opening in a pore of the skin and may represent another adaptive response to low skin resistance. Since it has been recently demonstrated that ampullary organs arise from lateral line placodes in chondrichthyans, this highly specialized type of dermal denticle (most likely non-deciduous) may be derived from the modified placoid scales covering the superficial neuromasts (pit organs) of the mechanosensory lateral line system of many modern sharks.

  9. Systemic sarcoidosis complicated of acute renal failure: about 12 cases.

    Science.gov (United States)

    Mahfoudhi, Madiha; Mamlouk, Habiba; Turki, Sami; Kheder, Adel

    2015-01-01

    The sarcoidosis is a systemic granulomatosis affecting most frequently the lungs and the mediastinum. An acute renal failure reveals exceptionally this disease. It's a retrospective study implicating 12 cases of sarcoidosis complicated of acute renal failure. The aim of this study is to determine epidemiological, clinical, biological and histological profile in these cases and then to indicate the interest to consider the diagnosis of sarcoidosis in cases of unexplained renal failure. Extra-renal complications, therapeutic modalities and the outcome were determined in all patients. Our series involved 12 women with an average age of 40 years. Biological investigations showed an abnormal normocalcemia in 7 cases, a hypercalcemia in 5 cases, a hypercalciuria in 10 cases and polyclonal hypergammaglobulinemia in 7 cases. An acute renal failure was found in all patients with a median creatinin of 520 umol/L. For all patients, the renal echography was normal however, the kidney biopsy showed tubulo-interstitial nephritis. The extra-renal signs highlighting pulmonary interstitial syndrome in 5 cases, a sicca syndrome in 4 cases, mediastinal lymph nodes in 2 cases, a lymphocytic alveolitis in 3 cases, an anterior granulomatous uveitis in 2 cases and a polyarthritis in 5 cases. Five patients benefited of hemodialysis. The treatment consisted of corticosteroid in all cases. The follow up was marked by complete resolution of clinical and biological signs. The diagnosis of renal sarcoidosis must be done quickly to prevent renal failure.

  10. Phospholipogenic Pharmaceuticals Are Associated with a Higher Incidence of Histological Findings than Nonphospholipogenic Pharmaceuticals in Preclinical Toxicology Studies

    Directory of Open Access Journals (Sweden)

    Linda R. Barone

    2012-01-01

    Full Text Available While phospholipidosis is thought to be an adaptive response to chemical challenge, many phospholipogenic compounds are known to display adverse effects in preclinical species and humans. To investigate the link between phospholipogenic administration and incidence of preclinical histological signals, an internal AstraZeneca in vivo toxicology report database was searched to identify phospholipogenic and nonphospholipogenic compounds. The datasets assembled comprised 46 phospholipogenic and 62 nonphospholipogenic compounds. The phospholipogenic potential of these compounds was confirmed by a pathologist's interpretation and was supported by well-validated in silico and in vitro models. The phospholipogenic dataset contained 37 bases, 4 neutral compounds, 3 zwitterions, and 1 acid, whereas the nonphospholipogenic dataset contained 9 bases, 34 neutrals, 1 zwitterion, and 18 acids. Histologic findings were tracked for adrenal gland; bone marrow; kidney; liver; lung; lymph node; spleen; thymus; and reproductive organs. On average, plasma exposures were higher in animals dosed with the nonphospholipogenics. Phospholipogenics yielded proportionally more histologic changes (exclusive of phospholipidosis itself in all organs. Statistically significant higher frequencies of liver necrosis, alveolitis/pneumonitis, as well as lymphocytolysis in the thymus, lymph nodes, and spleen occurred in response to phospholipogenics compared to that for nonphospholipogenics.

  11. [The accidental aspiration and ingestion of petroleum in a "fire eater"].

    Science.gov (United States)

    Ewert, R; Lindemann, I; Romberg, B; Petri, F; Witt, C

    1992-10-16

    A 26-year-old man, practicing for a variety performance as "fire-eater", accidentally inhaled and ingested about 10 ml petroleum. Soon afterwards he developed dyspnoea, an urge to cough, fever up to 39 degrees C and loss of retentiveness. He was treated as an out-patient with doxycycline, 100 mg daily, and aspirin, 500 mg three times daily. While this reduced the dyspnoea, the elevated temperature persisted and he had haemoptysis. Chest x-ray and computed tomography 12 days after the aspiration revealed areas of atelectasis and of liquefaction necroses. Bronchoscopic and cytological examinations showed eosinophilic alveolitis and mucosal necrosis in both main bronchi. The symptoms were improved by two inhalations of beclomethasone four times daily, and systemic treatment with prednisolone, 50 mg daily, together with parenteral antibiotic administration (cefotaxime, 1.0 g twice daily). The focal lung lesions regressed completely within a few weeks. Five months after the aspiration computed tomography merely demonstrated discrete scarring of the previously necrotic lesions. This case illustrates that, even with extensive necrotic lung changes after petroleum aspiration, conservative treatment is justified and likely to be effective.

  12. Importance of Physical and Physiological Parameters in Simulated Particle Transport in the Alveolar Zone of the Human Lung

    Directory of Open Access Journals (Sweden)

    Dogan Ciloglu

    2017-01-01

    Full Text Available The trajectory and deposition efficiency of micron-sized (1–5 µm particles, inhaled into the pulmonary system, are accurately determined with the aid of a newly developed model and modified simulation techniques. This alveolar model, which has a simple but physiologically appropriate geometry, and the utilized fluid structure interaction (FSI methods permit the precise simulation of tissue wall deformation and particle fluid interactions. The relation between tissue movement and airflow in the alveolated duct is solved by a two-way fluid structure interaction simulation technique, using ANSYS Workbench (Release 16.0, ANSYS INC., Pittsburgh, PA, USA, 2015. The dynamic transport of particles and their deposition are investigated as a function of aerodynamic particle size, tissue visco-elasticity, tidal breathing period, gravity orientation and particle–fluid interactions. It is found that the fluid flows and streamlines differ between the present flexible model and rigid models, and the two-way coupling particle trajectories vary relative to one-way particle coupling. In addition, the results indicate that modelling the two-way coupling particle system is important because the two-way discrete phase method (DPM approach despite its complexity provides more extensive particle interactions and is more reliable than transport results from the one-way DPM approach. The substantial difference between the results of the two approaches is likely due to particle–fluid interactions, which re-suspend the sediment particles in the airway stream and hence pass from the current generation.

  13. Time course of pulmonary response of rats to inhalation of crystalline silica: histological results and biochemical indices of damage, lipidosis, and fibrosis.

    Science.gov (United States)

    Porter, D W; Ramsey, D; Hubbs, A F; Battelli, L; Ma, J; Barger, M; Landsittel, D; Robinson, V A; McLaurin, J; Khan, A; Jones, W; Teass, A; Castranova, V

    2001-01-01

    Previous studies have determined that alpha-quartz (crystalline silica) can cause pulmonary inflammation, damage, and fibrosis. However, the temporal relationship between silica inhalation and pulmonary inflammation, damage, and fibrosis has not been fully examined. To address this gap in our knowledge of silica-induced pulmonary fibrosis, a chronic inhalation study using rats was designed. Specifically, rats were exposed to a silica aerosol (15 mg/m3 silica, 6 h/d, 5 d/wk, 116 d), and measurements of pulmonary inflammation, damage, and fibrosis were monitored throughout the study. We report (1) data demonstrating that the silica aerosol generation and exposure system produced a consistent silica aerosol of respirable size particles; (2) the time course of silica deposition in the lung; (3) calculations that demonstrate that the rats were not in pulmonary overload; (4) histopathological data demonstrating time-dependent enhancement of silica-induced alveolitis, epithelial hypertrophy and hyperplasia, alveolar lipoproteinosis, and pulmonary fibrosis in the absence of overload; and (5) biochemical data documenting the development of lipidosis, lung damage, and fibrosis.

  14. A study of the behaviour of 0.5 μm aerosol particles in the human lung

    International Nuclear Information System (INIS)

    Subba Ramu, M.C.

    1974-01-01

    The evaluation of the tissue dose of inhaled aerosol particles (including radioactive particles) requires a study of the behaviour of particles in the human lung. Half-micron particles (unit density spheres) of di-2-ethyl hexyl subacate have been used for carrying out the study since their deposition is mostly in the pulmonary region and they are good tracers of air flow in the lung. The deposition measured is the lowest reported so far and is affected by physiological parameters like the tidal volume, the breathing frequency and the resting expiratory level. Steady-state and single-breath aerosol experiments show that the particles inhaled remain airborne in the lung during several breaths and support the view that mechanical mixing is completely absent in the alveolated airways of the lung. Studies of the effect of breath-holding on the deposition of 0.5 μm particles in the lung show that these particles may be used for the calculation of the diameter of the alveolar space in life. (author)

  15. Bronchoalveolar lavage in patients with interstitial lung diseases: side effects and factors affecting fluid recovery.

    Science.gov (United States)

    Dhillon, D P; Haslam, P L; Townsend, P J; Primett, Z; Collins, J V; Turner-Warwick, M

    1986-05-01

    One hundred and seventy patients with interstitial lung diseases undergoing bronchoalveolar lavage (BAL), were contrasted with 51 patients undergoing fibreoptic bronchoscopy alone to define the factors which predispose to post-lavage side-effects. Transient post-bronchoscopy fall in the peak expired flow (PEF) greater than or equal to 20% occurred in both groups (24% and 23% respectively), and thus was probably related to the bronchoscopy procedure. Post-lavage pyrexia (greater than or equal to 1 degree C) occurred only in the patients undergoing BAL (26%), p less than 0.001. Only 4% with pyrexia required antibiotics, and only 2% with falls in PEF needed bronchodilator therapy. The only significant clinical association was more frequent pyrexia in patients on treatment with prednisolone, particularly in women (p less than 0.01). Pyrexia was also associated with higher lavage fluid introduction volumes (greater than 240 ml). Side effects did not relate to the percentages of lavage fluid recovered, although smokers had lower recoveries and, recoveries tended to be higher in sarcoidosis than cryptogenic fibrosing alveolitis. Serial lavages in 25 patients caused no significant increase in side effects.

  16. Lipopolysaccharide induced inflammation in the perivascular space in lungs

    Directory of Open Access Journals (Sweden)

    Pabst Reinhard

    2008-07-01

    Full Text Available Abstract Background Lipopolysaccharide (LPS contained in tobacco smoke and a variety of environmental and occupational dusts is a toxic agent causing lung inflammation characterized by migration of neutrophils and monocytes into alveoli. Although migration of inflammatory cells into alveoli of LPS-treated rats is well characterized, the dynamics of their accumulation in the perivascular space (PVS leading to a perivascular inflammation (PVI of pulmonary arteries is not well described. Methods Therefore, we investigated migration of neutrophils and monocytes into PVS in lungs of male Sprague-Dawley rats treated intratracheally with E. coli LPS and euthanized after 1, 6, 12, 24 and 36 hours. Control rats were treated with endotoxin-free saline. H&E stained slides were made and immunohistochemistry was performed using a monocyte marker and the chemokine Monocyte-Chemoattractant-Protein-1 (MCP-1. Computer-assisted microscopy was performed to count infiltrating cells. Results Surprisingly, the periarterial infiltration was not a constant finding in each animal although LPS-induced alveolitis was present. A clear tendency was observed that neutrophils were appearing in the PVS first within 6 hours after LPS application and were decreasing at later time points. In contrast, mononuclear cell infiltration was observed after 24 hours. In addition, MCP-1 expression was present in perivascular capillaries, arteries and the epithelium. Conclusion PVI might be a certain lung reaction pattern in the defense to infectious attacks.

  17. Ultrastructural types of alveolar macrophages in bronchoalveolar lavages from patients with pulmonary sarcoidosis.

    Science.gov (United States)

    Burkhardt, Olaf; Lode, Hartmut; Welte, Tobias; Merker, Hans-Joachim

    2007-01-01

    By routine applied quantitative BAL methods are particularly helpful for the diagnosis of pulmonary sarcoidosis. Here the morphology of the alveolar cells does not play a role. However, morphological and especially electron microscopic investigations might contribute to the clarification of the aetiology of this disease. In a prospective study we investigated the bronchoalveolar lavages (BALs) from 10 patients with recently histologically diagnosed, untreated pulmonary sarcoidosis. Commonly applied cytological and immunological BAL diagnostic techniques were accompanied by morphological investigations of alveolar cells, especially alveolar macrophages, using light and electron microscopy. All patients showed lymphocytic alveolitis with an increased number of CD4 positive lymphocytes as well as an increased CD4/CD8 ratio. A striking light microscopic finding was the great morphological variety of the alveolar macrophages. Electron microscopy revealed typical lymphocytes, neutrophils, and eosinophils as well as three different types of alveolar macrophages in all 10 patients: type I (approx. 30%) with a normal macrophage morphology, a vacuole-rich type II (approx. 30%) with myelin-like structures and type III (approx. 40%) with electron-dense inclusions. The occurrence of intracellular myelin figures in type II macrophages is a hint for increased phagocytotic processes of surfactant with or without its overproduction in the sense of a secondary alveolar proteinosis. Numerous electron-dense inclusions in type III also indicate an increased macrophage activity that leads to an increased release of cytokines, which in turn can trigger an inflammatory reaction.

  18. New Insights into the Diversity of Marine Picoeukaryotes

    Science.gov (United States)

    Not, Fabrice; del Campo, Javier; Balagué, Vanessa; de Vargas, Colomban; Massana, Ramon

    2009-01-01

    Over the last decade, culture-independent surveys of marine picoeukaryotic diversity based on 18S ribosomal DNA clone libraries have unveiled numerous sequences of novel high-rank taxa. This newfound diversity has significantly altered our understanding of marine microbial food webs and the evolution of eukaryotes. However, the current picture of marine eukaryotic biodiversity may be significantly skewed by PCR amplification biases, occurrence of rDNA genes in multiple copies within a single cell, and the capacity of DNA to persist as extracellular material. In this study we performed an analysis of the metagenomic dataset from the Global Ocean Survey (GOS) expedition, seeking eukaryotic ribosomal signatures. This PCR-free approach revealed similar phylogenetic patterns to clone library surveys, suggesting that PCR steps do not impose major biases in the exploration of environmental DNA. The different cell size fractions within the GOS dataset, however, displayed a distinct picture. High protistan diversity in the Marine Stramenopiles) appeared as potentially prominent grazers and we observed a significant decrease in the contribution of alveolate and radiolarian sequences, which overwhelmingly dominated rDNA libraries. The rRNA approach appears to be less affected by taxon-specific rDNA copy number and likely better depicts the biogeochemical significance of marine protists. PMID:19787059

  19. Chronic inflammation and pain inside the mandibular jaw and a 10-year forgotten amalgam filling in an alveolar cavity of an extracted molar tooth.

    Science.gov (United States)

    Kaufmann, Thomas; Bloch, Catrin; Schmidt, Wolfgang; Jonas, Ludwig

    2005-01-01

    A 55-year-old woman, suffered from severe pain in her mandibular jaw for several years. A metallic artifact of about 2(3) mm was detected by a panorama radiography in an edentulous region with a surrounding inflammation in close contact to the canal of the mandibular nerve. Inflammated tissue with the central metallic inclusion was removed from the bone under local anesthesia and operation. Postoperatively, pain and missensitivity disappeared within 1 week. Although the patient had no macroscopically visible so-called amalgam tattoo, the metallic cube was identified as amalgam by the detection of mercury, silver, tin, copper, and zinc using energy dispersive X-ray analysis (EDX) in a scanning electron microscope (SEM). Nevertheless, brown to black pigments in the connective tissue matrix and inside histiocytes, fibroblasts, and multinucleated foreign giant cells of the surrounding inflammatory tissue were observed by light and electron microscopy. However, the elemental analysis by EDX in SEM or by electron energy loss spectroscopy in transmission electron microscope detected only silver, tin, and sulfur but no mercury in these precipitates and in the residual bodies of phagocytes. The presented case demonstrates a seldom complication of amalgam deposition in the tissue. The authors assume that the chronic pain results from a forgotten amalgam filling inside an alveole after extraction of a molar tooth, causing a chronic inflammation by resolving mercury and other toxic elements out of the metallic artifact.

  20. Stereotactic radiotherapy for lung cancer: Non-invasive real-time tumor tracking; Radiotherapie stereotaxique de carcinomes bronchiques primitifs: suivi non invasif de la cible en temps reel

    Energy Technology Data Exchange (ETDEWEB)

    Bibault, J.E.; Prevost, B.; Mirabel, X.; Lacornerie, T.; Dubus, F.; Lartigau, E. [Departement universitaire de radiotherapie, universite Lille 2, CyberKnife Nord-Ouest, centre Oscar-Lambret, 59 - Lille (France); Dansin, E. [Departement d' oncologie generale, centre Oscar-Lambret, 59 - Lille (France)

    2010-12-15

    Purpose: Stereotactic radiation therapy using the CyberKnife{sup R} has been introduced in France in 2006. Two treatment modalities are currently available: the first one (Synchrony{sup R}) is a real-time fiducial-based target tracking system, while the other (Xsight Lung Tracking [XLT] System{sup R}) is completely fiducial-free. Patients and methods: Sixty-eight patients were treated for a pulmonary tumor between June 2007 and November 2009. Since august 2008, the XLT System{sup R} was used for 26 patients. We report the necessary conditions for the XLT System (position, laterality and size of the tumor), the toxicity and outcome of this treatment. Results: Twenty-two patients were analyzed. Median follow-up was 6 months (min = 3; max = 16). Local control rate was 100%. The main toxicity was grade grade 1 pulmonary alveolitis (27%). No grade 3 or 4 toxicities were reported. Conclusion: The high local control rate and low toxicity obtained with the CyberKnife{sup R} XLT System{sup R} suggest that such treatment is an alternative for inoperable patients. (authors)

  1. Diferenciais celulares e subpopulações linfocitárias no LBA da pneumonia de hipersensibilidade

    Directory of Open Access Journals (Sweden)

    Ulrich Costabel

    2000-05-01

    Full Text Available RESUMO: Fazse uma profunda revisão das características do Lavado Broncoalveolar nas Pneumonias de Hipersensibilidade (PH. Discute-se o perfil do LBA nas diferentes fases de PH, da relação T4/T8 e dos marcadores de actividades dos linfocitos. Seguidamente são apresentados os resultados do LBA em indivíduos expostos assintomáticos e os padrões de alveolite que aparecem no follow-up destes doentes. Finalmente defendese a relevância diagnóstica de LBA na Pneumonia de Hipersensibilidade.REV PORT PNEUMOL 2000; VI (3: 187-193 ABSTRACT: A thorough review on BAL data in hipersensitivity pneumonitis (HP is made. The HAL cell profile on the different phases of HP is discussed, the CD4/CD8 ratio, the lung Tcell murkers of activation. Then the BAL findings in asymptomatic exposed Individual are addressed as the pattern of alveolitis during follow-up. Finally the diugnostic relevance of the BAL findings in HP is defended.REV PORT PNEUMOL 2000; VI (3: 187-193 Palavras-chave: LBA, subpopulações linfocitárias, pneumonia de hipersensiblidade, Key-words: BAL, Limphocyte subsets, Hypersensitivity pneumonitis

  2. Third-molar extraction with ultrasound bone surgery: a case-control study.

    Science.gov (United States)

    Mozzati, Marco; Gallesio, Giorgia; Russo, Andrea; Staiti, Giorgio; Mortellaro, Carmen

    2014-05-01

    The aim of this case-control study was to evaluate the postoperative period and healing between 2 surgical methods (traditional and ultrasound bone surgery) that are used for mandibular third-molar extraction. Fifteen patients with impaction of both of the lower third molars and indications for their extractions were used in this study. Bilateral-mandibular third-molar extractions were performed at the same surgical time: traditional surgery with burrs was used on 1 side (control site), and ultrasound surgery was used on the other side (test [T] site). After surgery, the patients were examined at 7 and 14 days and at 1 and 3 months to evaluate tissue healing. The following was assessed at every follow-up: pain, trismus, swelling, and alveolar bone level. The study included 15 patients, and 30 mandibular third-molar extractions were performed. We found only 1 postoperative complication: 1 patient had alveolitis in the control site. Complete recoveries without any complications were reported in all of the patients at the T sites. Complete recoveries without any complication were reported in all patients at the T sites. The only disadvantage of the piezoelectric technique was the length of operation time, which was increased by approximately 8 minutes; however, this effect was offset by reducing the morbidity. Our preliminary study showed that Piezosurgery is an excellent tool for reducing the risk of complications and improving the postoperative period.

  3. The Plasmodiophora brassicae genome reveals insights in its life cycle and ancestry of chitin synthases

    Science.gov (United States)

    Schwelm, Arne; Fogelqvist, Johan; Knaust, Andrea; Jülke, Sabine; Lilja, Tua; Bonilla-Rosso, German; Karlsson, Magnus; Shevchenko, Andrej; Dhandapani, Vignesh; Choi, Su Ryun; Kim, Hong Gi; Park, Ju Young; Lim, Yong Pyo; Ludwig-Müller, Jutta; Dixelius, Christina

    2015-01-01

    Plasmodiophora brassicae causes clubroot, a major disease of Brassica oil and vegetable crops worldwide. P. brassicae is a Plasmodiophorid, obligate biotrophic protist in the eukaryotic kingdom of Rhizaria. Here we present the 25.5 Mb genome draft of P. brassicae, developmental stage-specific transcriptomes and a transcriptome of Spongospora subterranea, the Plasmodiophorid causing powdery scab on potato. Like other biotrophic pathogens both Plasmodiophorids are reduced in metabolic pathways. Phytohormones contribute to the gall phenotypes of infected roots. We report a protein (PbGH3) that can modify auxin and jasmonic acid. Plasmodiophorids contain chitin in cell walls of the resilient resting spores. If recognized, chitin can trigger defense responses in plants. Interestingly, chitin-related enzymes of Plasmodiophorids built specific families and the carbohydrate/chitin binding (CBM18) domain is enriched in the Plasmodiophorid secretome. Plasmodiophorids chitin synthases belong to two families, which were present before the split of the eukaryotic Stramenopiles/Alveolates/Rhizaria/Plantae and Metazoa/Fungi/Amoebozoa megagroups, suggesting chitin synthesis to be an ancient feature of eukaryotes. This exemplifies the importance of genomic data from unexplored eukaryotic groups, such as the Plasmodiophorids, to decipher evolutionary relationships and gene diversification of early eukaryotes. PMID:26084520

  4. The evolution of ERMIONE in mitochondrial biogenesis and lipid homeostasis: An evolutionary view from comparative cell biology.

    Science.gov (United States)

    Wideman, Jeremy G; Muñoz-Gómez, Sergio A

    2016-08-01

    The ER-mitochondria organizing network (ERMIONE) in Saccharomyces cerevisiae is involved in maintaining mitochondrial morphology and lipid homeostasis. ERMES and MICOS are two scaffolding complexes of ERMIONE that contribute to these processes. ERMES is ancient but has been lost in several lineages including animals, plants, and SAR (stramenopiles, alveolates and rhizaria). On the other hand, MICOS is ancient and has remained present in all organisms bearing mitochondrial cristae. The ERMIONE precursor evolved in the α-proteobacterial ancestor of mitochondria which had the central subunit of MICOS, Mic60. The subsequent evolution of ERMIONE and its interactors in eukaryotes reflects the integrative co-evolution of mitochondria and their hosts and the adaptive paths that some lineages have followed in their specialization to certain environments. By approaching the ERMIONE from a perspective of comparative evolutionary cell biology, we hope to shed light on not only its evolutionary history, but also how ERMIONE components may function in organisms other than S. cerevisiae. This article is part of a Special Issue entitled: The cellular lipid landscape edited by Tim P. Levine and Anant K. Menon. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Pathogenic lineage of Perkinsea associated with mass mortality of frogs across the United States

    Science.gov (United States)

    Isidoro Ayza, Marcos; Lorch, Jeffrey M.; Grear, Daniel A.; Winzeler, Megan; Calhoun, Daniel L.; Barichivich, William J.

    2017-01-01

    Emerging infectious diseases such as chytridiomycosis and ranavirus infections are important contributors to the worldwide decline of amphibian populations. We reviewed data on 247 anuran mortality events in 43 States of the United States from 1999–2015. Our findings suggest that a severe infectious disease of tadpoles caused by a protist belonging to the phylum Perkinsea might represent the third most common infectious disease of anurans after ranavirus infections and chytridiomycosis. Severe Perkinsea infections (SPI) were systemic and led to multiorganic failure and death. The SPI mortality events affected numerous anuran species and occurred over a broad geographic area, from boreal to subtropical habitats. Livers from all PCR-tested SPI-tadpoles (n = 19) were positive for the Novel Alveolate Group 01 (NAG01) of Perkinsea, while only 2.5% histologically normal tadpole livers tested positive (2/81), suggesting that subclinical infections are uncommon. Phylogenetic analysis demonstrated that SPI is associated with a phylogenetically distinct clade of NAG01 Perkinsea. These data suggest that this virulent Perkinsea clade is an important pathogen of frogs in the United States. Given its association with mortality events and tendency to be overlooked, the potential role of this emerging pathogen in amphibian declines on a broad geographic scale warrants further investigation.

  6. Commentary: research on the mechanisms of the occupational lung diseases

    International Nuclear Information System (INIS)

    Rom, W.N.

    1984-01-01

    In this commentary, the pathogenesis of alveolitis is examined and elucidated by animal models. The use of broncho alveolar lavage (BAL) and Ga-67 citrate whole-body scanning as a measure of the activity of alveolar inflammation in workers is discussed. Gallium scan indices have been reported to be elevated in asbestosis, silicosis, and coal workers' pneumoconiosis; diseases which may now be evaluated at earlier, potentially reversible stages. Research in emphysema and other lung diseases associated with α 1 antitrypsin deficiency may help explain why coal miners develop focal emphysema. Furthermore, investigation of genetic factors may reveal why workers with similar exposures have a different susceptibility for the development of pneumoconiosis or lung cancer. Occupational asthma may not respond to removal of the worker from exposure because reactive airways may be a predisposing factor for chronic ashthma and chronic obstructive lung disease. A continuing challenge will be disease risk in new industries such as electronics and alternate energy industries and new diseases in worker groups not previously studied, such as the variety of pneumoconioses among dental laboratory technicians who work with exotic metal alloys. 52 references

  7. Two new species of the millipede genus Glyphiulus Gervais, 1847 from Laos (Diplopoda, Spirostreptida, Cambalopsidae)

    Science.gov (United States)

    Likhitrakarn, Natdanai; Golovatch, Sergei I.; Inkhavilay, Khamla; Sutcharit, Chirasak; Srisonchai, Ruttapon; Panha, Somsak

    2017-01-01

    Abstract Two new species of Glyphiulus are described and illustrated from northern Laos. The epigean Glyphiulus subbedosae Likhitrakarn, Golovatch & Panha, sp. n. is the second member of the granulatus-group to be found in that country and it seems to be especially similar to G. bedosae Golovatch, Geoffroy, Mauriès & VandenSpiegel, 2007. However, it differs from the latter species by a row of several strong setae near the median marginal ridge on the paraprocts, combined with the gnathochilarium being considerably less densely setose on the caudal face, and the anterior gonopods showing a pair of smaller, apical, but larger lateral teeth on the coxosternal plate. Glyphiulus semicostulifer Likhitrakarn, Golovatch & Panha, sp. n. is the fourth member of the javanicus-group to be discovered in Laos, taken from a cave. It seems to be particularly similar to G. costulifer Golovatch, Geoffroy, Mauriès & VandenSpiegel, 2007, but is distinguished by the more sparsely alveolate background fine structure of the metazonae, coupled with the gnathochilarium being considerably less densely setose on the caudal face, much stronger paramedian prongs and 4-segmented telopodites on ♂ coxae 1, the slightly longer and more slender apicoparamedian sternal projections on the anterior gonopods, and the much longer flagella of the posterior gonopods. An identification key to and a distribution map of Glyphiulus species in Laos are also presented. PMID:29308027

  8. Intraspecific sequence variation in 16S rRNA gene of Ureaplasma diversum isolates.

    Science.gov (United States)

    Marques, L M; Buzinhani, M; Guimaraes, A M S; Marques, R C P; Farias, S T; Neto, R L; Yamaguti, M; Oliveira, R C; Timenetsky, J

    2011-08-26

    Ureaplasma diversum infection in bulls may result in seminal vesiculitis, balanoposthitis and alterations in spermatozoids. In cows, it can cause placentitis, fetal alveolitis, abortion and the birth of weak calves. U. diversum ATCC 49782 (serogroups A), ATCC 49783 (serogroup C) and 34 field isolates were used for this study. These microorganisms were submitted to Polymerase Chain Reaction for 16S gene sequence determination using Taq High Fidelity and the products were purified and bi-directionally sequenced. Using the sequence obtained, a fragment containing four hypervariable regions was selected and nucleotide polymorphisms were identified based on their position within the 16S rRNA gene. Forty-four single nucleotide polymorphisms (SNP) were detected. The genotypic variability of the 16S rRNA gene of U. diversum isolates shows that the taxonomy classification of these organisms is likely much more complex than previously described and that 16S rRNA gene sequencing may be used to suggest an epidemiologic pattern of different origin strains. Copyright © 2011 Elsevier B.V. All rights reserved.

  9. Airborne infections and modern building technology

    Energy Technology Data Exchange (ETDEWEB)

    LaForce, F.M.

    1986-01-01

    Over the last 30 yr an increased appreciation of the importance of airborne infection has evolved. The concept of droplet nuclei, infectious particles from 0.5 to 3 ..mu.. which stay suspended in air for long periods of time, has been accepted as an important determinant of infectivity. Important airborne pathogens in modern buildings include legionella pneumophila, Aspergillus sp., thermophilic actinomycetes, Mycobacterium tuberculosis, measles, varicella and rubella. Perhaps, the most important microbiologic threat to most buildings is L. pneumophila. This organism can multiply in water cooling systems and contaminate effluent air which can be drawn into a building and efficiently circulated throughout by existing ventilation systems. Hospitals are a special problem because of the concentration of immunosuppressed patients who are uniquely susceptible to airborne diseases such as aspergillosis, and the likelihood that patients ill from diseases that can be spread via the airborne route will be concentrated. Humidifiers are yet another problem and have been shown to be important in several outbreaks of allergic alveolitis and legionellosis. Control of airborne infections is largely an effort at identifying and controlling reservoirs of infection. This includes regular biocide treatment of cooling towers and evaporative condensers and identification and isolation of patients with diseases that may be spread via the airborne route.

  10. The value of family history in the diagnosis of hypersensitivity pneumonitis in children

    Directory of Open Access Journals (Sweden)

    Joana Cardoso

    2014-04-01

    Full Text Available Hypersensitivity pneumonitis (HP, or extrinsic allergic alveolitis, is an immunologically mediated disease resulting from the inhalation of organic substances that trigger an inflammatory response in the alveolar wall, bronchioles, and interstitium in susceptible individuals. Although HP is predominantly an occupational disease, seen in adulthood, cases in children have been described. The diagnosis of HP requires a high degree of suspicion. The treatment consists in avoiding contact with the antigen, and, in some cases, systemic corticosteroids might be necessary in order to prevent its progression to pulmonary fibrosis. We report the clinical cases of three children with a history of contact with birds and a family history of HP. All three patients presented with cough and dyspnea on exertion. The disease was diagnosed on the basis of the clinical history and ancillary diagnostic test results consistent with the diagnosis, including a predominance of lymphocytes (> 60%, CD8+ T lymphocytes in particular in bronchoalveolar lavage fluid and a ground-glass pattern seen on HRCT of the chest. Early diagnosis is crucial in order to prevent HP from progressing to pulmonary fibrosis. Hereditary factors seem to influence the onset of the disease.

  11. The respiratory tract deposition model proposed by the ICRP Task Group

    International Nuclear Information System (INIS)

    James, A.C.; Briant, J.K.; Stahlhofen, W.; Rudolf, G.; Gehr, P.

    1990-11-01

    The Task Group has developed a new model of the deposition of inhaled aerosols in each anatomical region of the respiratory tract. The model is used to evaluate the fraction of airborne activity that is deposited in respiratory regions having distinct retention characteristics and clearance pathways: the anterior nares, the extrathoracic airways of the naso- and oropharynx and larynx, the bronchi, the bronchioles, and the alveolated airways of the lung. Drawn from experimental data on total and regional deposition in human subjects, the model is based on extrapolation of these data by means of a detailed theoretical model of aerosol transport and deposition within the lung. The Task Group model applies to all practical conditions, and for aerosol particles and vapors from atomic size up to very coarse aerosols with an activity median aerodynamic diameter of 100 μm. The model is designed to predict regional deposition in different subjects, including adults of either sex, children of various ages, and infants, and also to account for anatomical differences among Caucasian and non-Caucasian subjects. The Task Group model represents aerosol inhalability and regional deposition in different subjects by algebraic expressions of aerosol size, breathing rates, standard lung volumes, and scaling factors for airway dimensions. 35 refs., 13 figs., 2 tabs

  12. Antibióticos para prevenir las complicaciones posteriores a la extracción de dientes

    Directory of Open Access Journals (Sweden)

    2014-05-01

    Hay pruebas de que los antibióticos profilácticos reducen el riesgo de infección, alveolitis y dolor posterior a la extracción del tercer molar y dan lugar a un aumento de los efectos adversos leves y transitorios. No está claro si las pruebas de esta revisión son generalizables a los pacientes con enfermedades concomitantes o inmunodeficiencia, o a los pacientes sometidos a la extracción de dientes debido a la caries grave o a la periodontitis. Sin embargo, los pacientes en mayor riesgo de infección presentan mayor probabilidad de beneficiarse con los antibióticos profilácticos debido a que es probable que las infecciones en este grupo sean más frecuentes, se asocien con complicaciones y sean más difíciles de tratar. Debido al aumento de la prevalencia de bacterias resistentes al tratamiento con los antibióticos disponibles actualmente, los médicos deben considerar cuidadosamente la probabilidad de que el tratamiento de 12 pacientes sanos con antibióticos para prevenir una infección cause más daños que beneficios.

  13. Ultra-low-dose CT imaging of the thorax: decreasing the radiation dose by one order of magnitude

    International Nuclear Information System (INIS)

    Lambert, Lukas; Banerjee, Rohan; Votruba, Jiri; El-Lababidi, Nabil; Zeman, Jiri

    2016-01-01

    Computed tomography (CT) is an indispensable tool for imaging of the thorax and there is virtually no alternative without associated radiation burden. The authors demonstrate ultra-low-dose CT of the thorax in three interesting cases. In an 18-y-old girl with rheumatoid arthritis, CT of the thorax identified alveolitis in the posterior costophrenic angles (radiation dose = 0.2 mSv). Its resolution was demonstrated on a follow-up scan (4.2 mSv) performed elsewhere. In an 11-y-old girl, CT (0.1 mSv) showed changes of the right collar bone consistent with chronic recurrent multifocal osteomyelitis. CT (0.1 mSv) of a 9-y-old girl with mucopolysaccharidosis revealed altogether three hamartomas, peribronchial infiltrate, and spine deformity. In some indications, the radiation dose from CT of the thorax can approach that of several plain radiographs. This may help the pediatrician in deciding whether 'gentle' ultra-low-dose CT instead of observation or follow-up radiographs will alleviate the uncertainty of the diagnosis with little harm to the child. (author)

  14. Heterotrophic Protists in Hypersaline Microbial Mats and Deep Hypersaline Basin Water Columns

    Directory of Open Access Journals (Sweden)

    Joan M. Bernhard

    2013-05-01

    Full Text Available Although hypersaline environments pose challenges to life because of the low water content (water activity, many such habitats appear to support eukaryotic microbes. This contribution presents brief reviews of our current knowledge on eukaryotes of water-column haloclines and brines from Deep Hypersaline Anoxic Basins (DHABs of the Eastern Mediterranean, as well as shallow-water hypersaline microbial mats in solar salterns of Guerrero Negro, Mexico and benthic microbialite communities from Hamelin Pool, Shark Bay, Western Australia. New data on eukaryotic diversity from Shark Bay microbialites indicates eukaryotes are more diverse than previously reported. Although this comparison shows that eukaryotic communities in hypersaline habitats with varying physicochemical characteristics are unique, several groups are commonly found, including diverse alveolates, strameonopiles, and fungi, as well as radiolaria. Many eukaryote sequences (SSU in both regions also have no close homologues in public databases, suggesting that these environments host unique microbial eukaryote assemblages with the potential to enhance our understanding of the capacity of eukaryotes to adapt to hypersaline conditions.

  15. Variable beta-glucans production by different states of Eurotium amstelodami explains differences in inflammatory responses in airway cells.

    Science.gov (United States)

    Bellanger, Anne-Pauline; Millon, Laurence; Rognon, Bénédicte; Roussel, Sandrine; Botterel, Françoise; Bretagne, Stéphane; Reboux, Gabriel

    2011-09-01

    Eurotium amstelodami, a mold frequently identified in housing and farm air samples, is a suspected cause of respiratory diseases such as allergic alveolitis, atopic asthma, and organic dust toxic syndrome. This fungus is present in the air in three different states (ascospores, conidia, and hyphae). The aim of this study was to test in vitro the differential inflammatory response of airway cells exposed to 1,3 betaglucanase-treated protein extract (BGPE), from E. amstelodami ascospores, conidia, and hyphae. Confluent cells from the A549 cell line were inoculated with calibrated BGPE issued from the three fungal forms. The levels of eight cytokines and chemokines involved in inflammatory responses were measured after 8 h of exposure. Beta-d-glucan (BDG) was quantified in total fungal extract as well as in the BGPE from the three fungal states. Hyphal BGPE were the only ones to induce a marked inflammatory response and they contain higher quantities of BDG. The present study adds to the growing body of evidence that beta-glucan from fungal hyphae play a crucial role in respiratory diseases. © 2011 The Authors. APMIS © 2011 APMIS.

  16. Two year follow-up of a garbage collector with allergic bronchopulmonary aspergillosis (ABPA).

    Science.gov (United States)

    Allmers, H; Huber, H; Baur, X

    2000-04-01

    Separate collection of biodegradable garbage and recyclable waste is expected to become mandatory in some western countries. A growing number of persons engaged in garbage collection and separation might become endangered by high loads of bacteria and fungi. Case history and examination A 29 year old garbage collector involved in emptying so-called biological garbage complained of dyspnea, fever, and flu-like symptoms during work beginning in the summer of 1992. Chest x-ray showed streaky shadows near both hili reaching into the upper regions. IgE- and IgG-antibodies (CAP, Pharmacia, Sweden) were strongly positive for Aspergillus fumigatus with 90.5 kU/L and 186%, respectively. Total-IgE was also strongly elevated with 5430 kU/L. Bronchial challenge testing with commercially available Aspergillus fumigatus extract resulted in an immediate-type asthmatic reaction. Two years later he was still symptomatic and antibodies persisted at lower levels. Our diagnosis was allergic bronchopulmonary aspergillosis (ABPA) including asthmatic responses as well as hypersensitivity pneumonitis (extrinsic allergic alveolitis) due to exposure to moldy household waste. A growing number of persons engaged in garbage collection and handling are exposed and at risk to develop sensitization to fungi due to exposure to dust of biodegradable waste. Further studies are necessary to show if separate collection of biodegradable waste increases the health risks due to exposure to bacteria and fungi in comparison to waste collection without separation. Copyright 2000 Wiley-Liss, Inc.

  17. Chapter 17: Occupational immunologic lung disease.

    Science.gov (United States)

    Sabin, Bradley R; Grammer, Leslie C

    2012-01-01

    Occupational immunologic lung disease is characterized by an immunologic response in the lung to an airborne agent inhaled in the work environment and can be subdivided into immunologically mediated occupational asthma (OA) and hypersensitivity pneumonitis (HP). Irritant-induced OA, a separate nonimmunologic entity, can be caused by chronic exposure to inhaled irritants or reactive airways dysfunction syndrome, defined as an asthma-like syndrome that persists for >3 months and occurs abruptly after a single exposure to a high concentration of an irritating industrial agent. High-risk fields for OA include farmers, printers, woodworkers, painters, plastic workers, cleaners, spray painters, electrical workers, and health care workers. OA can be triggered by high molecular weight (HMW) proteins that act as complete allergens or low molecular weight (LMW) sensitizers that act as haptens. HMW proteins (>10 kDa) are generally derived from microorganisms (such as molds and bacteria, including thermophilic actinomycetes), plants (such as latex antigens and flour proteins), or animals (such as animal dander, avian proteins, and insect scales) and are not specifically regulated by the Occupational Safety and Health Administration (OSHA). LMW haptens that bind to proteins in the respiratory mucosa include some OSHA-regulated substances such as isocyanates, anhydrides, and platinum. HP can present in an acute, a chronic, or a subacute form. The acute, subacute, and early chronic form is characterized by a CD4(+) T(H)1 and CD8(+) lymphocyte alveolitis. Classically, the bronchoalveolar lavage will show a CD4/CD8 ratio of <1.

  18. Pulmonary histopathologic findings, acid-base status, and absorption of colostral immunoglobulins in newborn calves.

    Science.gov (United States)

    López, A; Löfstedt, J; Bildfell, R; Horney, B; Burton, S

    1994-09-01

    A study was conducted to investigate whether aspiration of amniotic fluid is associated with a deleterious effect on absorption of colostral immunoglobulins or on blood gas and acid-base values of healthy newborn calves. Fourteen calves purchased from commercial sources were transported to a research facility immediately after birth and fed colostrum with known concentrations of immunoglobulins. Blood samples for gas analyses were collected within 5 hours of birth, 24 hours later, and prior to euthanasia. Between 3 and 5 days of age, calves were euthanatized by an overdose of barbiturates. Eleven calves had evidence of bronchoaspiration of amniotic fluid, as determined by presence of meconium, squamous epithelium, or keratin in histologic sections of fixed lung or by cytologic analysis of bronchoalveolar lavage fluid. Blood gas tensions and pH were within reference ranges in 11 of 14 calves. Aspiration of amniotic fluid could not be linked to any specific changes in blood gas tensions, acid-base status, or absorption of colostral immunoglobulins. Presence of keratin and meconium in the lungs often was accompanied by mild exudative alveolitis and focal atelectasis. It was concluded that aspiration of small amounts of amniotic fluid with or without meconium is common in calves and is not associated with hypoxemia, respiratory acidosis, or failure of passive transfer.

  19. Calcium signaling in closely related protozoan groups (Alveolata): non-parasitic ciliates (Paramecium, Tetrahymena) vs. parasitic Apicomplexa (Plasmodium, Toxoplasma).

    Science.gov (United States)

    Plattner, H; Sehring, I M; Mohamed, I K; Miranda, K; De Souza, W; Billington, R; Genazzani, A; Ladenburger, E-M

    2012-05-01

    The importance of Ca2+-signaling for many subcellular processes is well established in higher eukaryotes, whereas information about protozoa is restricted. Recent genome analyses have stimulated such work also with Alveolates, such as ciliates (Paramecium, Tetrahymena) and their pathogenic close relatives, the Apicomplexa (Plasmodium, Toxoplasma). Here we compare Ca2+ signaling in the two closely related groups. Acidic Ca2+ stores have been characterized in detail in Apicomplexa, but hardly in ciliates. Two-pore channels engaged in Ca2+-release from acidic stores in higher eukaryotes have not been stingently characterized in either group. Both groups are endowed with plasma membrane- and endoplasmic reticulum-type Ca2+-ATPases (PMCA, SERCA), respectively. Only recently was it possible to identify in Paramecium a number of homologs of ryanodine and inositol 1,3,4-trisphosphate receptors (RyR, IP3R) and to localize them to widely different organelles participating in vesicle trafficking. For Apicomplexa, physiological experiments suggest the presence of related channels although their identity remains elusive. In Paramecium, IP3Rs are constitutively active in the contractile vacuole complex; RyR-related channels in alveolar sacs are activated during exocytosis stimulation, whereas in the parasites the homologous structure (inner membrane complex) may no longer function as a Ca2+ store. Scrutinized comparison of the two closely related protozoan phyla may stimulate further work and elucidate adaptation to parasitic life. See also "Conclusions" section. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Usual interstitial pneumonitis UIP presenting with Wells grade 3. Can imaging methods help predict further progression of disease?; Fibrosi polmanare idiopatica con grado 3 di Wells all'esordio: possono le metodiche di diagnostica per immagini aiutare a predire la progressione ulteriore della malattia?

    Energy Technology Data Exchange (ETDEWEB)

    Fasano, L.; Pacilli, A. M.G. [Bologna Policlinico, Bologna (Italy). Ist. di Fisiopatologia Respiratoria; Zompatori, M.; Monetti, N. [Bologna Policlinico, Bologna (Italy). Servizio di Medicina Nucleare; Battista, G. [Bologna Policlinico, Bologna (Italy). Ist. di Radiologia, Radiodiagnostica 1; Di Scioscio, V.; Sciascia, N.

    1999-10-01

    Three different grades of idiopathic pulmonary fibrosis can be identified by HRCT pattern. Patients with predominant ground-glass opacity (grade 1) usually improve after treatment and may have a better prognosis. The subjects with a predominant reticular pattern and honeycombing (grade 3.) have irreversible fibrosis and usually do not improve after immunosuppressive therapy. Nevertheless, these patients may worsen even in the absence of HRCT features of the so-called alveolitis. The aim of this report is to investigate the predictive role of some noninvasive imaging methods (HRCT with visual score of disease extent; Gallium scintigraphy; DTPA scintigraphy) in patients with idiopathic fibrosis and a prevalent macroscopic fibrosis at HRCT study. [Italian] La fibrosi polomare idiopatica viene distinta in 3 gradi con diversa prognosi in base alla predominanza di opacita' a vetro smerigliato da alveolite o di fibrosi irreversibile. La fibrosi irreversibile tuttavia non e' necessariamente una situazione stabile ma puo progredire ed evolvere ulteriormente. In particolare i pazienti che gia all'esordio presentano solo i segni della fibrosi possono peggiorare a distanza di tempo nonostante la terapia. Scopo del lavoro e' stato quello di individuare in un gruppo di pazienti con prevalente fibrosi macroscopica quale possa essere un parametro preditivo della successiva evoluzione della malattia.

  1. [Pulmonary crackles, what does the clinician hear?].

    Science.gov (United States)

    Postiaux, G; Vilaro, J; Charlier, J-L; Marchand, E; Lens, E

    2015-09-01

    The overall duration of a pulmonary crackle is usually less than 20-30 ms but psychoacoustics demonstrates that an acoustical event with a duration of less than 20-40 ms cannot be estimated in terms of pitch and duration. We pose the hypothesis that the main resonant information is contained into the breath sounds following the crackle. Eight patients with COPD, viral pneumonia, bronchiectasis, congestive heart failure, hypoproteinemia and fibrosing alveolitis were recruited for this study. Thirty-six crackles were analyzed in time and frequency domains; 12 in each category of low, medium and high frequencies. The acoustic features of the crackles, their segments (initial deflection width, first cycle duration, two cycles duration, decay segment) and the breath sounds following the crackles were compared. The study confirms the differences between the three crackles categories in time and frequency domains. No statistical differences were found between the decay segments and breath sounds in each category. Breath sounds modified by lung tissue density could be the main resonators determining the fundamental transmission frequencies of crackle signals. Combined acoustic analysis of crackles and breath sounds could replace single analysis of isolated crackles. Copyright © 2014 SPLF. Published by Elsevier Masson SAS. All rights reserved.

  2. Age and sex dimorphisms contribute to the severity of bleomycin-induced lung injury and fibrosis

    Science.gov (United States)

    Redente, Elizabeth F.; Jacobsen, Kristen M.; Solomon, Joshua J.; Lara, Abigail R.; Faubel, Sarah; Keith, Rebecca C.; Henson, Peter M.; Downey, Gregory P.

    2011-01-01

    Fibrotic interstitial pneumonias are more prevalent in males of advancing age, although little is known about the underlying mechanisms. To evaluate the contributions of age and sex to the development of pulmonary fibrosis, we intratracheally instilled young (8–12 wk) and aged (52–54 wk) male and female mice with bleomycin and assessed the development and severity of fibrotic lung disease by measurements of lung collagen levels, static compliance, leukocyte infiltration, and stereological quantification of fibrotic areas in histological sections. We also quantified proinflammatory and profibrotic chemokine and cytokine levels in the bronchoalveolar lavage fluid. Aged male mice developed more severe lung disease, indicated by increased mortality, increased collagen deposition, and neutrophilic alveolitis compared with aged female mice or young mice of either sex. Aged male mice also exhibited increased levels of transforming growth factor-β, IL-17A, and CXCL1 in their bronchoalveolar lavage fluid. Young male mice developed a more fibrotic disease after bleomycin instillation compared with female mice, regardless of age. There was no difference in fibrosis between young and aged female mice. Taken together, these findings suggest that the variables of advanced age and male sex contribute to the severity of pulmonary fibrosis in this model. Our findings also emphasize the importance of stratifying experimental groups on the basis of age and sex in experimental and epidemiological studies of this nature. PMID:21743030

  3. The Plasmodiophora brassicae genome reveals insights in its life cycle and ancestry of chitin synthases.

    Science.gov (United States)

    Schwelm, Arne; Fogelqvist, Johan; Knaust, Andrea; Jülke, Sabine; Lilja, Tua; Bonilla-Rosso, German; Karlsson, Magnus; Shevchenko, Andrej; Dhandapani, Vignesh; Choi, Su Ryun; Kim, Hong Gi; Park, Ju Young; Lim, Yong Pyo; Ludwig-Müller, Jutta; Dixelius, Christina

    2015-06-18

    Plasmodiophora brassicae causes clubroot, a major disease of Brassica oil and vegetable crops worldwide. P. brassicae is a Plasmodiophorid, obligate biotrophic protist in the eukaryotic kingdom of Rhizaria. Here we present the 25.5 Mb genome draft of P. brassicae, developmental stage-specific transcriptomes and a transcriptome of Spongospora subterranea, the Plasmodiophorid causing powdery scab on potato. Like other biotrophic pathogens both Plasmodiophorids are reduced in metabolic pathways. Phytohormones contribute to the gall phenotypes of infected roots. We report a protein (PbGH3) that can modify auxin and jasmonic acid. Plasmodiophorids contain chitin in cell walls of the resilient resting spores. If recognized, chitin can trigger defense responses in plants. Interestingly, chitin-related enzymes of Plasmodiophorids built specific families and the carbohydrate/chitin binding (CBM18) domain is enriched in the Plasmodiophorid secretome. Plasmodiophorids chitin synthases belong to two families, which were present before the split of the eukaryotic Stramenopiles/Alveolates/Rhizaria/Plantae and Metazoa/Fungi/Amoebozoa megagroups, suggesting chitin synthesis to be an ancient feature of eukaryotes. This exemplifies the importance of genomic data from unexplored eukaryotic groups, such as the Plasmodiophorids, to decipher evolutionary relationships and gene diversification of early eukaryotes.

  4. Subsurface ecosystem resilience: long-term attenuation of subsurface contaminants supports a dynamic microbial community

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, J.M.; Neuhauser, E.F.; Ripp, J.A.; Mauro, D.M.; Madsen, E.L. [Cornell University, Ithaca, NY (United States). Dept. of Microbiology

    2010-01-15

    The propensity for groundwater ecosystems to recover from contamination by organic chemicals (in this case, coal-tar waste) is of vital concern for scientists and engineers who manage polluted sites. The microbially mediated cleanup processes are also of interest to ecologists because they are an important mechanism for the resilience of ecosystems. In this study we establish the long-term dynamic nature of a coal-tar waste-contaminated site and its microbial community. We present 16 years of chemical monitoring data, tracking responses of a groundwater ecosystem to organic contamination (naphthalene, xylenes, toluene, 2-methyl naphthalene and acenaphthylene) associated with coal-tar waste. In addition, we analyzed small-subunit (SSU) ribosomal RNA (rRNA) genes from two contaminated wells at multiple time points over a 2-year period. Principle component analysis of community rRNA fingerprints (terminal-restriction fragment length polymorphism (T-RFLP)) showed that the composition of native microbial communities varied temporally, yet remained distinctive from well to well. After screening and analysis of 1178 cloned SSU rRNA genes from Bacteria, Archaea and Eukarya, we discovered that the site supports a robust variety of eukaryotes (for example, alveolates (especially anaerobic and predatory ciliates), stramenopiles, fungi, even the small metazoan flatworm, Suomina) that are absent from an uncontaminated control well. This study links the dynamic microbial composition of a contaminated site with the long-term attenuation of its subsurface contaminants.

  5. Smoking-related interstitial lung diseases: radiologic-pathologic correlation

    International Nuclear Information System (INIS)

    Hidalgo, Alberto; Franquet, Tomas; Gimenez, Ana; Pineda, Rosa; Madrid, Marta; Bordes, Ramon

    2006-01-01

    Smoking-related interstitial lung diseases (SRILD) are a heterogeneous group of entities of unknown cause. These diseases include desquamative interstitial pneumonia (DIP), respiratory-bronchiolitis-related interstitial lung disease (RB-ILD), pulmonary Langerhans' cell histiocytosis (LCH) and idiopathic pulmonary fibrosis (IPF). High-resolution CT is highly sensitive in the detection of abnormalities in the lung parenchyma and airways. Ground-glass attenuation can occur in DIP and RB-ILD. Whereas DIP is histologically characterized by intra-alveolar pigmented macrophages, RB-ILD shows alveolar macrophages in a patchy peribronchiolar distribution. LCH shows nodular infiltrates on histopathological examination containing varying amounts of characteristic Langerhans' histiocytes. The HRCT findings are characteristically bilateral, symmetrical and diffuse, involving the upper lobe zones with sparing of the costophrenic angles. The most prominent CT features are nodules (sometimes cavitary) measuring 1 to 10 mm in diameter, cysts and areas of ground-glass attenuation. Pathologically, IPF is characterized by its heterogeneity with areas of normal clung, alveolitis and end-stage fibrosis shown in the same biopsy specimen. High-resolution CT findings consist of honeycombing, traction bronchiectasis and intralobular interstitial thickening with subpleural and lower lung predominance. Since coexisting lesions in the same cases have been observed, a better understanding of the different smoking-related interstitial lung diseases (SRILD) allows a more confident and specific diagnosis. (orig.)

  6. Occurrence of the parasite genus Hematodinium (Alveolata: Syndinea) in the water column.

    Science.gov (United States)

    Hamilton, Kristina M; Tew, Ian F; Atkinson, R Jim A; Roberts, Emily C

    2011-01-01

    Crustaceans worldwide are infected with alveolate parasites of the genus Hematodinium, causing substantial losses to langoustine and crab fisheries. The distinct seasonality in Hematodinium occurrence in their decapod hosts, as well as unsuccessful attempts at transmission, suggest the existence of life stages outside their benthic crustacean hosts. We used a nested polymerase chain reaction method to detect Hematodinium rDNA in the environment and in potential alternative hosts. Environmental samples from the Clyde Sea, Scotland, were screened during the April release of dinospores and during June and August, when infection prevalence is rare in benthic crustaceans. Hematodinium rDNA was amplified in 15% (14/94) of isolated langoustine larvae, and in 12% (13/111) of crab larvae. In addition, Hematodinium rDNA was present in mixed plankton samples devoid of decapod larvae, but including the 2 μm-10 mm fraction of particulate organic matter in the water column, containing phytoplankton and other zooplankton. These results indicate that Hematodinium occurs in the water column and is harboured by planktonic organisms, including larval stages of the crustacean hosts, when infections are at their lowest in adult hosts. © 2011 The Author(s). Journal of Eukaryotic Microbiology © 2011 International Society of Protistologists.

  7. Pleural and pulmonary involvement in systemic lupus erythematosus.

    Science.gov (United States)

    Torre, Olga; Harari, Sergio

    2011-01-01

    Systemic lupus erythematosus (SLE) is a rare complex autoimmune disease with a multisystem involvement. The clinical manifestations of this disease include an erythematous rash, oral ulcers, polyarthralgia, nonerosive arthritis, polyserositis, hematologic, renal, neurologic, pulmonary and cardiac abnormalties. The involvement of the respiratory system is frequent. Pleuro-pulmonary manifestations are present in almost half of the patients during the disease course and may be the presenting symptoms in 4-5% of patients with SLE. Complications directly associated to the disease include pleuritis with or without pleural effusion, alveolitis, interstitial lung disease, lupus pneumonitis, pulmonary hemorrhage, pulmonary arterial hypertension, and pulmonary thromboembolic disease. Complications due to secondary causes include pleuro-pulmonary manifestations of cardiac and renal failure, atelectasis due to diaphragmatic dysfunction, opportunistic pneumonia, and drug toxicity. The prevalence, clinical presentation, prognosis and response to treatment vary, depending on the pattern of involvement. As with other connective tissue diseases, early and specific therapeutic intervention may be indicated for many of these pleuro-pulmonary manifestations. Copyright © 2010 Elsevier Masson SAS. All rights reserved.

  8. Evolution and architecture of the inner membrane complex in asexual and sexual stages of the malaria parasite.

    Science.gov (United States)

    Kono, Maya; Herrmann, Susann; Loughran, Noeleen B; Cabrera, Ana; Engelberg, Klemens; Lehmann, Christine; Sinha, Dipto; Prinz, Boris; Ruch, Ulrike; Heussler, Volker; Spielmann, Tobias; Parkinson, John; Gilberger, Tim W

    2012-09-01

    The inner membrane complex (IMC) is a unifying morphological feature of all alveolate organisms. It consists of flattened vesicles underlying the plasma membrane and is interconnected with the cytoskeleton. Depending on the ecological niche of the organisms, the function of the IMC ranges from a fundamental role as reinforcement system to more specialized roles in motility and cytokinesis. In this article, we present a comprehensive evolutionary analysis of IMC components, which exemplifies the adaptive nature of the IMCs' protein composition. Focusing on eight structurally distinct proteins in the most prominent "genus" of the Alveolata-the malaria parasite Plasmodium-we demonstrate that the level of conservation is reflected in phenotypic characteristics, accentuated in differential spatial-temporal patterns of these proteins in the motile stages of the parasite's life cycle. Colocalization studies with the centromere and the spindle apparatus reveal their discriminative biogenesis. We also reveal that the IMC is an essential structural compartment for the development of the sexual stages of Plasmodium, as it seems to drive the morphological changes of the parasite during the long and multistaged process of sexual differentiation. We further found a Plasmodium-specific IMC membrane matrix protein that highlights transversal structures in gametocytes, which could represent a genus-specific structural innovation required by Plasmodium. We conclude that the IMC has an additional role during sexual development supporting morphogenesis of the cell, which in addition to its functions in the asexual stages highlights the multifunctional nature of the IMC in the Plasmodium life cycle.

  9. Effect of environmental conditions on the decay of stone in archaeological site of Volubilis - Morocco

    Science.gov (United States)

    Aalil, Issam; Chaaba, Ali; Cherkaoui, Khalid; Brunetaud, Xavier; Beck, Kevin; Al-Mukhtar, Muzahim

    2015-04-01

    Volubilis is the most excavated and the best preserved archaeological site of Morocco. Located about thirty kilometres north of Meknes, it was a Mauritanian capital founded in the 3rd century B.C., and became an important outpost of the Roman Empire. Volubilis monuments are constructed with five regional lithotypes of limestone. A grey massive limestone and beige-yellowish calcarenite limestone are the two most largely used on Volubilis site, representing respectively about 30% and 60 % of the total volume of building stones. Field observations showed that the calcarenite limestone is more decayed than the massive limestone and is mainly affected by scaling, alveolization and sanding. This work aims to estimate the role of environmental conditions on the decay of the calcarenite stone through the effect of thermal stresses and freezing-thawing action. Air temperature data of Meknes station is analysed. Furthermore, mineralogical composition of the calcarenite limestone and its intrinsic properties required for stress calculation are determined. The results of this study show that the calcarenite limestone is a quite soft carbonate stone, contains about 71 % of calcite, 18 % of quartz and others accessory minerals. Besides, there is no risk of damage due to freezing-thawing processes. Nonetheless, thermal stresses may have an important role in the decay of calcarenite stones of the Volubilis site.

  10. Tropical pulmonary eosinophilia - A review

    Directory of Open Access Journals (Sweden)

    Jai B Mullerpattan

    2013-01-01

    Full Text Available Tropical pulmonary eosinophilia (TPE is a syndrome of wheezing, fever and eosiniphilia seen predominantly in the Indian subcontinent and other tropical areas. Its etiological link with Wuchereria bancrofti and Brugia malayi has been well established. The pathogenesis is due to an exaggerated immune response to the filarial antigens which includes type I, type III and type IV reactions with eosinophils playing a pivotal role. Peripheral blood eosinophilia is usually striking with levels over 3000/΅l being common. High serum levels of IgE and filarial-specific IgE and IgG are also found. The pathology may vary from an acute eosinophilic alveolitis to histiocytic infiltration depending on the stage of the disease. While earlier studies had suggested that the disease runs a benign course, more recent work has shown that untreated TPE could result in a fair degree of respiratory morbidity. Pulmonary function tests may show a mixed restrictive and obstructive abnormality with a reduction in diffusion capacity. The bronchoalveolar lavage (BAL eosinophil count has a negative correlation with the diffusion capacity. Treatment consists of diethylcarbamazine (DEC for at least three weeks. Despite treatment with DEC, about 20 per cent of patients may relapse. Steroids have shown to have a beneficial effect but the exact dose and duration is yet to be confirmed by randomized controlled trials. A specific and easily available marker is required for TPE in order to distinguish it from other parasitic and non-parasitic causes of pulmonary eosinophilia.

  11. Primary and secondary siRNA synthesis triggered by RNAs from food bacteria in the ciliate Paramecium tetraurelia

    Science.gov (United States)

    Carradec, Quentin; Götz, Ulrike; Arnaiz, Olivier; Pouch, Juliette; Simon, Martin; Meyer, Eric; Marker, Simone

    2015-01-01

    In various organisms, an efficient RNAi response can be triggered by feeding cells with bacteria producing double-stranded RNA (dsRNA) against an endogenous gene. However, the detailed mechanisms and natural functions of this pathway are not well understood in most cases. Here, we studied siRNA biogenesis from exogenous RNA and its genetic overlap with endogenous RNAi in the ciliate Paramecium tetraurelia by high-throughput sequencing. Using wild-type and mutant strains deficient for dsRNA feeding we found that high levels of primary siRNAs of both strands are processed from the ingested dsRNA trigger by the Dicer Dcr1, the RNA-dependent RNA polymerases Rdr1 and Rdr2 and other factors. We further show that this induces the synthesis of secondary siRNAs spreading along the entire endogenous mRNA, demonstrating the occurrence of both 3′-to-5′ and 5′-to-3′ transitivity for the first time in the SAR clade of eukaryotes (Stramenopiles, Alveolates, Rhizaria). Secondary siRNAs depend on Rdr2 and show a strong antisense bias; they are produced at much lower levels than primary siRNAs and hardly contribute to RNAi efficiency. We further provide evidence that the Paramecium RNAi machinery also processes single-stranded RNAs from its bacterial food, broadening the possible natural functions of exogenously induced RNAi in this organism. PMID:25593325

  12. Impact of agricultural practices on microbiology of hay, silage and flour on Finnish and French farms.

    Science.gov (United States)

    Reboux, Gabriel; Reiman, Marjut; Roussel, Sandrine; Taattola, Kirsti; Millon, Laurence; Dalphin, Jean-Charles; Piarroux, Renaud

    2006-01-01

    Exposure to microorganisms in farm environments may cause respiratory disorders, e.g. asthma, organic dust toxic syndrome and allergic alveolitis. By reducing microbiological deterioration of organic materials, some agricultural practices have a protective effect. Microbiological analyses were carried out on hay, silage and flour samples (n=107) from farms in Finland and France (n=23) that use different methods of haymaking. High concentrations of Absidia corymbifera were found in approximately 35 % of French hay samples and only 10 % of Finnish hay samples. Concentrations of Eurotium spp. were found in 20 % of hay samples from both regions. High concentrations of Wallemia sebi typified Finnish hay (38 %) more than French hay (8 %). Rhodotorula yeast was frequently and abundantly found in Finland, but never in France. The method used to make hay appeared to be the main factor affecting the microbiology of the hay. A. corymbifera and Eurotium spp. concentrations were smaller in low-density square bales than in others. In conclusion, our results emphasize the importance of good agricultural practice in the microbiological quality of fodder.

  13. Smoking-related interstitial lung diseases: radiologic-pathologic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Hidalgo, Alberto [Universidad Autonoma de Barcelona, Department of Radiology, Hospital de Sant Pau, Barcelona (Spain); Hospital de la Santa Creu i Sant Pau, Thoracic Radiology, Department of Radiology, Barcelona (Spain); Franquet, Tomas; Gimenez, Ana; Pineda, Rosa; Madrid, Marta [Universidad Autonoma de Barcelona, Department of Radiology, Hospital de Sant Pau, Barcelona (Spain); Bordes, Ramon [Universidad Autonoma de Barcelona, Department of Pathology, Hospital de Sant Pau, Barcelona (Spain)

    2006-11-15

    Smoking-related interstitial lung diseases (SRILD) are a heterogeneous group of entities of unknown cause. These diseases include desquamative interstitial pneumonia (DIP), respiratory-bronchiolitis-related interstitial lung disease (RB-ILD), pulmonary Langerhans' cell histiocytosis (LCH) and idiopathic pulmonary fibrosis (IPF). High-resolution CT is highly sensitive in the detection of abnormalities in the lung parenchyma and airways. Ground-glass attenuation can occur in DIP and RB-ILD. Whereas DIP is histologically characterized by intra-alveolar pigmented macrophages, RB-ILD shows alveolar macrophages in a patchy peribronchiolar distribution. LCH shows nodular infiltrates on histopathological examination containing varying amounts of characteristic Langerhans' histiocytes. The HRCT findings are characteristically bilateral, symmetrical and diffuse, involving the upper lobe zones with sparing of the costophrenic angles. The most prominent CT features are nodules (sometimes cavitary) measuring 1 to 10 mm in diameter, cysts and areas of ground-glass attenuation. Pathologically, IPF is characterized by its heterogeneity with areas of normal clung, alveolitis and end-stage fibrosis shown in the same biopsy specimen. High-resolution CT findings consist of honeycombing, traction bronchiectasis and intralobular interstitial thickening with subpleural and lower lung predominance. Since coexisting lesions in the same cases have been observed, a better understanding of the different smoking-related interstitial lung diseases (SRILD) allows a more confident and specific diagnosis. (orig.)

  14. β-thymosins and interstitial lung disease: study of a scleroderma cohort with a one-year follow-up

    Directory of Open Access Journals (Sweden)

    Messana Irene

    2011-02-01

    Full Text Available Abstract Background β-thymosins play roles in cytoskeleton rearrangement, angiogenesis, fibrosis and reparative process, thus suggesting a possible involvement in the pathogenesis of systemic sclerosis. The aim of the study was to investigate the presence of thymosins β4, β4 sulfoxide, and β10 in bronchoalveolar lavage fluid of scleroderma patients with interstitial lung disease and the relation of these factors with pulmonary functional and radiological parameters. Methods β-thymosins concentrations were determined by Reverse Phase-High Performance Liquid Chromatography-Electrospray-Mass Spectrometry in the bronchoalveolar lavage fluid of 46 scleroderma patients with lung involvement and of 15 controls. Results Thymosin β4, β4 sulfoxide, and β10 were detectable in bronchoalveolar lavage fluid of patients and controls. Thymosin β4 levels were significantly higher in scleroderma patients than in controls. In addition, analyzing the progression of scleroderma lung disease at one-year follow-up, we have found that higher thymosin β4 levels seem to have a protective role against lung tissue damage. Thymosin β4 sulfoxide levels were higher in the smokers and in the scleroderma patients with alveolitis. Conclusions We describe for the first time β-thymosins in bronchoalveolar lavage fluid and their possible involvement in the pathogenesis of scleroderma lung disease. Thymosin β4 seems to have a protective role against lung tissue damage, while its oxidation product mirrors an alveolar inflammatory status.

  15. Streptococcus bovis/S. equinus complex septicemia in a group of calves following intramuscular vaccination.

    Science.gov (United States)

    Clarke, Lorelei L; Fathke, Robert L; Sanchez, Susan; Stanton, James B

    2016-07-01

    Organisms previously classified as Streptococcus bovis (i.e., the S. bovis/S. equinus complex) are common in cattle feces, but may also act as opportunistic pathogens. In the current work, Streptococcus infantarius subsp. coli, a member of this complex, was associated of a cluster of calves that died within hours of injection with a modified live viral vaccine. Within 12 h of vaccination of 46 calves at a cow/calf operation, 4 calves had died, 3 calves were ill, and 1 unvaccinated cow was dead. Autopsies were performed on the cow, 2 dead calves, and 1 affected surviving calf, which was euthanized ~24 h after vaccine administration. The animals had similar gross anatomic and microscopic lesions, including subcutaneous and intramuscular dark hemorrhage on the caudal neck, multiorgan ecchymosis and petechiation, and alveolitis to interstitial pneumonia. Gram-positive cocci were in the vasculature of the lung and skeletal muscle, and S. infantarius subsp. coli was cultured from tissues and from the vaccines used on affected animals, but not in vials used on unaffected animals. Together, these findings suggest death caused by streptococcal septicemia and toxemia as a result of contamination. © 2016 The Author(s).

  16. Monthly variation in the Bioaccumulation of heavy metals and other safety issues in some marine and fresh water fish species in Ghana

    International Nuclear Information System (INIS)

    Arthur, W.

    2014-07-01

    Fish is one of the major sources of animal protein in Ghana and the fisheries industry is vital to the economy of the country. Unfortunately, most of the aquatic systems in Ghana are being polluted with domestic and industrial wastes which results in bioaccumulation of heavy metals in fish species. The traditional method for preserving fish in the country is by hot smoking or smoke drying, through freezing may be preferred where facilities are available. The presence of high levels of heavy metals in both fresh and smoked fish as well as other fish products is a matter of public health concern in Ghana. Variations in the level of bioaccumulation of heavy metals in both fresh and smoked marine fish, Sebastes marinus (red fish) and fresh water fish, Oreochromis niloticus (tilapia) caught off the coast of James Town in Accra and from the Volta river at Kpong respectively were monitored monthly from September 2013 to March 2014. Extension of two shelf life of the smoked fish species by gamma irradiation was also studied during 4 weeks of low temperature (5± 1 C ) storage by refrigeration. The total concentration of Iron (Fe), Zinc (Zn), Copper (Cu), Magnesium (Mg), Manganese (Mn), Cobalt (Co), Cadmium (Cd), Chromium (Cr), Arsenic (As) and Mercury (Hg) in the fish species as well as in their muscles, gills and bones were determined by Flame or Hydride Generation Atomic Absorption Spectrophotometry. The moisture content, pH, sensory analysis and population of aerobic mesophiles (on PCA), yeast and moulds (on OGYE), Escherichia coli (on EMB), Staphylococcus aureus (on BPA) and Salmonella (on XLD) in fresh fish, and smoked fish after treatment with 1, 2 and 3kGy of gamma irradiation and during storage were determined. Four patterns in the bioaccumulation of heavy metals in both Sebastes marinus and Oreochromis niloticus were observed over the 6 months monitoring period. Fe, Cu, Co and Cr accumulated heavily in the fish species during September and October after which the

  17. Helminths parasites of freshwater fishes from Pirassununga, SP, Brazil

    Directory of Open Access Journals (Sweden)

    A. Kohn

    1985-09-01

    Full Text Available Twelve species of parasitic helminths, seven trematodes, four nematodes and one acanthocephalan are reported from various hosts. Creptotrema lynchi, a parasite from Bufo marinus in Colombia, is described for the first time in fish and from Brazil, parasitizing two different species. A list of the host species, measurements and figures of most parasites are included with particular reference to the tegument of Bellumcorpus major recovered from a new host. The genus Zonocotyloides Padilha, 1978 is considered a synonym of Zonocotyle and the new combination: Zonocotyle haroltravassosi is proposed to the species Zonocotyloides haroltravassosi Padilha, 1978. The nematodes Cucullanus pinnai and Procamallanus (Spirocamallanus inopinatus and the trematode Pararhipidocotyle jeffersoni are reported in new hosts. The description of the acanthocephalan Neoechinorhynchus curemais (new locality record is supplemented. Other parasites recovered include the nematodes Travnema travnema (new locality record, Rondonia rondoni and the digenetic trematodes Cladocystis intestinalis, Pseudosellacotyla lutzi (new locality record, Teratotrema sp. and Zonocotyle bicaecata.No presente trabalho são apresentados sete trematódeos, quatro nematóides e um acantocéfalo parasitas de diferentes espécies de peixes do rio Mogi-Guassu. Creptotrema lynchi, tramatódeo descrito originalmente de anfíblio (Bufo marinus na Colômbia, é referido pela primeira vez em peixes e no Brasil. Bellumcorpus major é assinalado em um novo hospedeiro e são apresentados novos dados morfológicos referentes ao tegumento. O gênero Zonocotyloides Padilha, 1978 é considerado sinônimo de Zonocotyle Travassos, 1948 e é proposta uma nova combinação para a espécieZonocotyloides haroltravassosi Padilha, 1978. Os nematóides Cucullanus pinnai e Procamallanus (Spirocamallanus inopinatus e o trematódeo Pararhipidocotyle jeffersoni são assinalados em novos hospedeiros. O acantoc

  18. Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP)

    KAUST Repository

    Agusti, Susana

    2017-04-26

    Transparent exopolymer particles (TEP), usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1) than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1). Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean ± SE) observed at

  19. Excitabilidad iterativa y actividad rítmica de los músculos estriados: contracción prosténica

    Directory of Open Access Journals (Sweden)

    Hernando Ordoñez

    1957-04-01

    Full Text Available Se hace un estudio sobre la historia de la excitabilidad iterativa. Se relaciona la excitabilidad iterativa con la contracción prosténica. Se describen los caracteres de esta variedad de contracción muscular, a saber: contracción rítmica que aparece en el músculo gastrocnemio de varias clases de ranas, hyla labialis, rana esculenta, bufo marinus; excitación directa; la excitación repetida puede ser choques de inducción, descargas de condensadores, estimulación electrónica; la frecuencia de los estímulos usada ha estado entre 50 y 500 por segundo; la duración de los estímulos debe estar por debajo del valor de la cronaxia; con intensidad reobase no aparece la contracción prosténica; los electrodos pueden ser o no impolarizables. Hay dos clases de contracción prosténica una caracterizada por ondas rítmicas solas, y otra en que hay un tétanos y a éste se le agregan las sacudidas rítmicas; la variedad rítmica pura aparece con menor intensidad de los estímulos; con excitación ascendente aparece mejor la variedad rítmica. La frecuencia de las sacudidas está entre unas 6 y unas 150 por minuto. The history of the hiterative excitability is reported. It is pointed out the possible relation between the iterative excitability and the prosthenic contraction. The history of the hiterative excitability is reported. Is a rhythmic contraction that appears in the muscle gastrocnemius of the frog, hyla labialis, rana esculenta, bufo marinus, with direct excitation; this repeated estimulation may be induction shocks, condenser discharges or electronic stimulators; the frequency of the stimulus may vary from 60 to 500 per second; the duration of the stimulus must be less than the chronaxie; with intensity of rheobase it does not appear the prosthenic contraction; the electrodes may or may not be impolarizables; there are two kinds of prosthenic contraction: one characterized by rhytmic contractions only, and another one characterized by

  20. Rapid evolution meets invasive species control: The potential for pesticide resistance in sea lamprey

    Science.gov (United States)

    Dunlop, Erin S.; McLaughlin, Robert L.; Adams, Jean V.; Jones, Michael L.; Birceanu, Oana; Christie, Mark R.; Criger, Lori A.; Hinderer, Julia L.M.; Hollingworth, Robert M.; Johnson, Nicholas; Lantz, Stephen R.; Li, Weiming; Miller, James R.; Morrison, Bruce J.; Mota-Sanchez, David; Muir, Andrew M.; Sepulveda, Maria S.; Steeves, Todd B.; Walter, Lisa; Westman, Erin; Wirgin, Isaac; Wilkie, Michael P.

    2018-01-01

    Rapid evolution of pest, pathogen and wildlife populations can have undesirable effects; for example, when insects evolve resistance to pesticides or fishes evolve smaller body size in response to harvest. A destructive invasive species in the Laurentian Great Lakes, the sea lamprey (Petromyzon marinus) has been controlled with the pesticide 3-trifluoromethyl-4-nitrophenol (TFM) since the 1950s. We evaluated the likelihood of sea lamprey evolving resistance to TFM by (1) reviewing sea lamprey life history and control; (2) identifying physiological and behavioural resistance strategies; (3) estimating the strength of selection from TFM; (4) assessing the timeline for evolution; and (5) analyzing historical toxicity data for evidence of resistance. The number of sea lamprey generations exposed to TFM was within the range observed for fish populations where rapid evolution has occurred. Mortality from TFM was estimated as 82-90%, suggesting significant selective pressure. However, 57 years of toxicity data revealed no increase in lethal concentrations of TFM. Vigilance and the development of alternative controls are required to prevent this aquatic invasive species from evolving strategies to evade control.

  1. Determination of intracellular pH and PCO2 after metabolic inhibition by fluoride and nitrilotriacetic acid.

    Science.gov (United States)

    Pörtner, H O; Boutilier, R G; Tang, Y; Toews, D P

    1990-08-01

    Mean intracellular pH (pHi) and PCO2 (PiCO2) have been analysed based on pH and total CO2 measurements in tissue homogenates. Tissues were sampled from undisturbed worms (Sipunculus nudus), squid (Illex illecebrosus), trout (Salmo gairdneri), toads (Bufo marinus), and rats. Homogenate metabolism was inhibited by the addition of potassium fluoride and nitrilotriacetic acid (NTA). Model calculations revealed that the influence of dilution, medium buffers, and contamination by extracellular fluids was negligible. In white muscle tissue the resulting pHi values were virtually the same as found in studies using DMO (dimethyloxazolidinedione). If large fractions of mitochondria were present (e.g. in heart muscle), DMO derived pHi values were considerably higher, probably representing overestimates. Homogenate derived pHi values are concluded to represent the effective mean pHi by taking into account pH gradients, and the volumes and buffering of cellular compartments. High time resolution and small variability make this method especially useful to assess rapid changes in pHi, e.g. in exercising animals.

  2. Plastic and Non-plastic Debris Ingestion in Three Gull Species Feeding in an Urban Landfill Environment.

    Science.gov (United States)

    Seif, S; Provencher, J F; Avery-Gomm, S; Daoust, P-Y; Mallory, M L; Smith, P A

    2017-12-27

    Plastic debris is recognized as a widespread, common and problematic environmental pollutant. An important consequence of this pollution is the ingestion of plastic debris by wildlife. Assessing the degree to which different species ingest plastics, and the potential effects of these plastics on their health are important research needs for understanding the impacts of plastic pollution. We examined debris (plastic and other types) ingestion in three sympatric overwintering gull species (Herring gulls Larus smithsonianus, Great Black-backed Gulls Larus marinus, and Iceland Gulls Larus glaucoides) to understand how debris ingestion differs among species, age classes and sexes in gulls. We also assessed how plastic burdens were associated with body condition to investigate how gulls may be affected by debris ingestion. There were no differences among the species, age classes or sexes in the incidence of debris ingestion (plastic or otherwise), the mass or number of debris pieces ingested. We found no correlation between ingested plastics burdens and individual condition. Gulls ingested plastic debris, but also showed high levels of other debris types as well, including metal, glass and building materials, including a metal piece of debris found within an abscess in the stomach. Thus, when the health effects of debris ingestion on gulls, and other species that ingest debris, is of interest, either from a physical or chemical perspective, it may be necessary to consider all debris types and not just plastic burdens as is often currently done for seabirds.

  3. Methanol Production by a Broad Phylogenetic Array of Marine Phytoplankton.

    Directory of Open Access Journals (Sweden)

    Tracy J Mincer

    Full Text Available Methanol is a major volatile organic compound on Earth and serves as an important carbon and energy substrate for abundant methylotrophic microbes. Previous geochemical surveys coupled with predictive models suggest that the marine contributions are exceedingly large, rivaling terrestrial sources. Although well studied in terrestrial ecosystems, methanol sources are poorly understood in the marine environment and warrant further investigation. To this end, we adapted a Purge and Trap Gas Chromatography/Mass Spectrometry (P&T-GC/MS method which allowed reliable measurements of methanol in seawater and marine phytoplankton cultures with a method detection limit of 120 nanomolar. All phytoplankton tested (cyanobacteria: Synechococcus spp. 8102 and 8103, Trichodesmium erythraeum, and Prochlorococcus marinus, and Eukarya (heterokont diatom: Phaeodactylum tricornutum, coccolithophore: Emiliania huxleyi, cryptophyte: Rhodomonas salina, and non-diatom heterokont: Nannochloropsis oculata produced methanol, ranging from 0.8-13.7 micromolar in culture and methanol per total cellular carbon were measured in the ranges of 0.09-0.3%. Phytoplankton culture time-course measurements displayed a punctuated production pattern with maxima near early stationary phase. Stabile isotope labeled bicarbonate incorporation experiments confirmed that methanol was produced from phytoplankton biomass. Overall, our findings suggest that phytoplankton are a major source of methanol in the upper water column of the world's oceans.

  4. Effects of sea lamprey substrate modification and carcass nutrients on macroinvertebrate assemblages in a small Atlantic coastal stream

    Science.gov (United States)

    Weaver, Daniel M.; Coghlan, Stephen M.; Zydlewski, Joseph D.

    2018-01-01

    Aquatic macroinvertebrates respond to patch dynamics arising from interactions of physical and chemical disturbances across space and time. Anadromous fish, such as sea lamprey, Petromyzon marinus, migrate from the ocean and alter physical and chemical properties of recipient spawning streams. Sea lamprey disturb stream benthos physically through nest construction and spawning, and enrich food webs through nutrient deposition from decomposing carcasses. Sea lamprey spawning nests support greater macroinvertebrate abundance than adjacent reference areas, but concurrent effects of stream bed modification and nutrient supplementation have not been examined sequentially. We added carcasses and cleared substrate experimentally to mimic the physical disturbance and nutrient enrichment associated with lamprey spawning, and characterized effects on macroinvertebrate assemblage structure. We found that areas receiving cleared substrate and carcass nutrients were colonized largely by Simuliidae compared to upstream and downstream control areas that were colonized largely by Hydropsychidae, Philopotamidae, and Chironomidae. Environmental factors such as stream flow likely shape assemblages by physically constraining macroinvertebrate establishment and feeding. Our results indicate potential changes in macroinvertebrate assemblages from the physical and chemical changes to streams brought by spawning populations of sea lamprey.

  5. Phycobilisomes from blue-green and red algae: isolation criteria and dissociation characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Gantt, E.; Lipschultz, C.A.; Grabowski, J.; Zimmerman, B.K.

    1979-04-01

    A general procedure for the isolation of functionally intact phycobilisomes was devised, based on modifications of previously used procedures. It has been successful with numerous species of red and blue-green algae (Anabaena variabilis, Anacystis nidulans, Agmenellum quadruplicatum, Fremyella diplosiphon, Glaucosphaera vacuolata, Griffithsia pacifica, Nemalion multifidum, Nostoc sp., Phormidium persicinum, Porphyridium cruentum, P. sordidum, P. aerugineum, Rhodosorus marinus). Isolation was carried out in 0.75 molar K-phosphate (pH 6.8 to 7.0) at 20 to 23 C on sucrose step gradients. Lower temperature (4 to 10 C) was usually unfavorable resulting in uncoupling of energy transfer and partial dissociation of the phycobilisomes, sometimes with complete loss of allophycocyanin. Intact phycobilisomes were characterized by fluorescence emission peaks of 670 to 675 nanometers at room temperature, and 678 to 685 nanometers at liquid nitrogen temperature. Uncoupling and subsequent dissociation of phycobilisomes, in lowered ionic conditions, varied with the species and the degree of dissociation but occurred preferentially between phycocyanin and allophycocyanin, or between phycocyanin and phycoerythrin.

  6. Mixtures of Two Bile Alcohol Sulfates Function as a Proximity Pheromone in Sea Lamprey.

    Directory of Open Access Journals (Sweden)

    Cory O Brant

    Full Text Available Unique mixtures of pheromone components are commonly identified in insects, and have been shown to increase attractiveness towards conspecifics when reconstructed at the natural ratio released by the signaler. In previous field studies of pheromones that attract female sea lamprey (Petromyzon marinus, L., putative components of the male-released mating pheromone included the newly described bile alcohol 3,12-diketo-4,6-petromyzonene-24-sulfate (DkPES and the well characterized 3-keto petromyzonol sulfate (3kPZS. Here, we show chemical evidence that unequivocally confirms the elucidated structure of DkPES, electrophysiological evidence that each component is independently detected by the olfactory epithelium, and behavioral evidence that mature female sea lamprey prefer artificial nests activated with a mixture that reconstructs the male-released component ratio of 30:1 (3kPZS:DkPES, molar:molar. In addition, we characterize search behavior (sinuosity of swim paths of females approaching ratio treatment sources. These results suggest unique pheromone ratios may underlie reproductive isolating mechanisms in vertebrates, as well as provide utility in pheromone-integrated control of invasive sea lamprey in the Great Lakes.

  7. A thermogenic secondary sexual character in male sea lamprey

    Science.gov (United States)

    Chung-Davidson, Yu-Wen; Priess, M. Cody; Yeh, Chu-Yin; Brant, Cory O.; Johnson, Nicholas S.; Li, Ke; Nanlohy, Kaben G.; Bryan, Mara B.; Brown, C. Titus; Choi, Jongeun; Li, Weiming

    2013-01-01

    Secondary sexual characters in animals are exaggerated ornaments or weapons for intrasexual competition. Unexpectedly, we found that a male secondary sexual character in sea lamprey (Petromyzon marinus ) is a thermogenic adipose tissue that instantly increases its heat production during sexual encounters. This secondary sexual character, developed in front of the anterior dorsal fin of mature males, is a swollen dorsal ridge known as the ‘rope’ tissue. It contains nerve bundles, multivacuolar adipocytes and interstitial cells packed with small lipid droplets and mitochondria with dense and highly organized cristae. The fatty acid composition of the rope tissue is rich in unsaturated fatty acids. The cytochrome c oxidase activity is high but the ATP concentration is very low in the mitochondria of the rope tissue compared with those of the gill and muscle tissues. The rope tissue temperature immediately rose up to 0.3°C when the male encountered a conspecific. Mature males generated more heat in the rope and muscle tissues when presented with a mature female than when presented with a male (paired t-test, P-3 more heat than the muscle in 10 min. Transcriptome analyses revealed that genes involved in fat cell differentiation are upregulated whereas those involved in oxidative-phosphorylation-coupled ATP synthesis are downregulated in the rope tissue compared with the gill and muscle tissues. Sexually mature male sea lamprey possess the only known thermogenic secondary sexual character that shows differential heat generation toward individual conspecifics.

  8. Ecosystem transformations of the Laurentian Great Lake Michigan by nonindigenous biological invaders.

    Science.gov (United States)

    Cuhel, Russell L; Aguilar, Carmen

    2013-01-01

    Lake Michigan, a 58,000-km(2) freshwater inland sea, is large enough to have persistent basin-scale circulation yet small enough to enable development of approximately balanced budgets for water, energy, and elements including carbon and silicon. Introduction of nonindigenous species-whether through invasion, intentional stocking, or accidental transplantation-has transformed the lake's ecosystem function and habitat structure. Of the 79 nonindigenous species known to have established reproductive populations in the lake, only a few have brought considerable ecological pressure to bear. Four of these were chosen for this review to exemplify top-down (sea lamprey, Petromyzon marinus), middle-out (alewife, Alosa pseudoharengus), and bottom-up (the dreissenid zebra and quagga mussels, Dreissena polymorpha and Dreissena rostriformis bugensis, respectively) transformations of Lake Michigan ecology, habitability, and ultimately physical environment. Lampreys attacked and extirpated indigenous lake trout, the top predator. Alewives outcompeted native planktivorous fish and curtailed invertebrate populations. Dreissenid mussels-especially quagga mussels, which have had a much greater impact than the preceding zebra mussels-moved ecosystem metabolism basin-wide from water column to bottom dominance and engineered structures throughout the lake. Each of these non indigenous species exerted devastating effects on commercial and sport fisheries through ecosystem structure modification.

  9. The control of the upstream movement of fish with pulsated direct current

    Science.gov (United States)

    McLain, Alberton L.

    1957-01-01

    Alternating-current electromechanical devices installed in the mouths of streams have proved effective in stopping the spawning migrations of the parasitic sea lamprey (Petromyzon marinus) which has seriously damaged Great Lakes fisheries. In a few streams, excessive mortality has occurred to other fish at the alternating-current barriers. A direct-current unit was developed in an attempt to reduce this mortality. This direct-current “diversion device” consists of a row of suspended negative electrodes which begins at the end of a trap wing and extends across the river at a downstream angle of 45° and a series of pipes (positive electrodes) driven into the stream bank. A second array, consisting of horizontal pipes installed downstream and parallel to the suspended electrodes and connected to a series of rods driven into the bank near the positive electrodes, controls the electrical field and dissipates the collecting influence of the positive side of the circuit. The electrical field is established from the end of the trap wing to the opposite bank. Fish are diverted away from the negative electrodes and toward the bank near which the trap is located. The array is activiated by pulsated direct current of essentially square wave shape with pulses at a duty cycle of 0.66 and a repetition rate of 3 per second. Direct-current diversion devices were operated in conjunction with alternating-current barriers during 1956 in the Chocolay River, Marquette County, and the Silver River, Baraga County, Michigan.

  10. Spatial mismatch between sea lamprey behaviour and trap location explains low success at trapping for control

    Science.gov (United States)

    Rous, Andrew M.; McLean, Adrienne R.; Barber, Jessica; Bravener, Gale; Castro-Santos, Theodore; Holbrook, Christopher M.; Imre, Istvan; Pratt, Thomas C.; McLaughlin, Robert L.

    2017-01-01

    Crucial to the management of invasive species is understanding space use and the environmental features affecting space use. Improved understanding of space use by invasive sea lamprey (Petromyzon marinus) could help researchers discern why trap success in large rivers is lower than needed for effective control. We tested whether manipulating discharge nightly could increase trap success at a hydroelectric generating station on the St. Marys River. We quantified numbers of acoustically tagged sea lampreys migrating up to, and their space use at, the hydroelectric generating station. In 2011 and 2012, 78% and 68%, respectively, of tagged sea lampreys reached the generating station. Sea lampreys were active along the face, but more likely to occur at the bottom and away from the traps near the surface, especially when discharge was high. Our findings suggest that a low probability of encountering traps was due to spatial (vertical) mismatch between space use by sea lamprey and trap locations and that increasing discharge did not alter space use in ways that increased trap encounter. Understanding space use by invasive species can help managers assess the efficacy of trapping and ways of improving trapping success.

  11. Methanol Production by a Broad Phylogenetic Array of Marine Phytoplankton.

    Science.gov (United States)

    Mincer, Tracy J; Aicher, Athena C

    2016-01-01

    Methanol is a major volatile organic compound on Earth and serves as an important carbon and energy substrate for abundant methylotrophic microbes. Previous geochemical surveys coupled with predictive models suggest that the marine contributions are exceedingly large, rivaling terrestrial sources. Although well studied in terrestrial ecosystems, methanol sources are poorly understood in the marine environment and warrant further investigation. To this end, we adapted a Purge and Trap Gas Chromatography/Mass Spectrometry (P&T-GC/MS) method which allowed reliable measurements of methanol in seawater and marine phytoplankton cultures with a method detection limit of 120 nanomolar. All phytoplankton tested (cyanobacteria: Synechococcus spp. 8102 and 8103, Trichodesmium erythraeum, and Prochlorococcus marinus), and Eukarya (heterokont diatom: Phaeodactylum tricornutum, coccolithophore: Emiliania huxleyi, cryptophyte: Rhodomonas salina, and non-diatom heterokont: Nannochloropsis oculata) produced methanol, ranging from 0.8-13.7 micromolar in culture and methanol per total cellular carbon were measured in the ranges of 0.09-0.3%. Phytoplankton culture time-course measurements displayed a punctuated production pattern with maxima near early stationary phase. Stabile isotope labeled bicarbonate incorporation experiments confirmed that methanol was produced from phytoplankton biomass. Overall, our findings suggest that phytoplankton are a major source of methanol in the upper water column of the world's oceans.

  12. Indirect evidence for elastic energy playing a role in limb recovery during toad hopping.

    Science.gov (United States)

    Schnyer, Ariela; Gallardo, Mirialys; Cox, Suzanne; Gillis, Gary

    2014-07-01

    Elastic energy is critical for amplifying muscle power during the propulsive phase of anuran jumping. In this study, we use toads (Bufo marinus) to address whether elastic recoil is also involved after take-off to help flex the limbs before landing. The potential for such spring-like behaviour stems from the unusually flexed configuration of a toad's hindlimbs in a relaxed state. Manual extension of the knee beyond approximately 90° leads to the rapid development of passive tension in the limb as underlying elastic tissues become stretched. We hypothesized that during take-off, the knee regularly extends beyond this, allowing passive recoil to help drive limb flexion in mid-air. To test this, we used high-speed video and electromyography to record hindlimb kinematics and electrical activity in a hindlimb extensor (semimembranosus) and flexor (iliofibularis). We predicted that hops in which the knees extended further during take-off would require less knee flexor recruitment during recovery. Knees extended beyond 90° in over 80% of hops, and longer hops involved greater degrees of knee extension during take-off and more intense semimembranosus activity. However, knee flexion velocities during recovery were maintained despite a significant decrease in iliofibularis intensity in longer hops, results consistent with elastic recoil playing a role. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

  13. Sea lamprey carcasses exert local and variable food web effects in a nutrient-limited Atlantic coastal stream

    Science.gov (United States)

    Weaver, Daniel M.; Coghlan, Stephen M.; Zydlewski, Joseph D.

    2016-01-01

    Resource flows from adjacent ecosystems are critical in maintaining structure and function of freshwater food webs. Migrating sea lamprey (Petromyzon marinus) deliver a pulsed marine-derived nutrient subsidy to rivers in spring when the metabolic demand of producers and consumers are increasing. However, the spatial and temporal dynamics of these nutrient subsidies are not well characterized. We used sea lamprey carcass additions in a small stream to examine changes in nutrients, primary productivity, and nutrient assimilation among consumers. Algal biomass increased 57%–71% immediately adjacent to carcasses; however, broader spatial changes from multiple-site carcass addition may have been influenced by canopy cover. We detected assimilation of nutrients (via δ13C and δ15N) among several macroinvertebrate families including Heptageniidae, Hydropsychidae, and Perlidae. Our research suggests that subsidies may evoke localized patch-scale effects on food webs, and the pathways of assimilation in streams are likely coupled to adjacent terrestrial systems. This research underscores the importance of connectivity in streams, which may influence sea lamprey spawning and elicit varying food web responses from carcass subsidies due to fine-scale habitat variables.

  14. Tradeoff between assessment and control of aquatic invasive species: A case study of sea lamprey management in the St. Marys River

    Science.gov (United States)

    Robinson, Jason M.; Wilberg, Michael J.; Adams, Jean V.; Jones, Michael L.

    2016-01-01

    Allocating resources between the gathering of information to guide management actions and implementing those actions presents an inherent tradeoff. This tradeoff is evident for control of the Sea Lamprey Petromyzon marinus in the St. Marys River, connecting Lakes Huron and Superior and a major source of parasitic Sea Lampreys to Lake Huron and northern Lake Michigan. Larval Sea Lampreys in the St. Marys River are controlled through the application of Bayluscide, which is applied to areas of high larval density. Bayluscide applications are guided with an annual deepwater electrofishing survey to estimate larval Sea Lamprey density at relatively fine spatial scales. We took a resampling approach to describe the effect of sampling intensity on the success of the larval Sea Lamprey management program and explicitly incorporated the economic tradeoff between assessment and control efforts to maximize numbers of larvae killed in the St. Marys River. When no tradeoff between assessment and control was incorporated, increasing assessment always led to more larvae killed for the same treatment budget. When the tradeoff was incorporated, the sampling intensity that maximized the number of larvae killed depended on the overall budget available. Increased sampling intensities maximized effectiveness under medium to large budgets (US \\$0.4 to \\$2.0 million), and intermediate sampling intensities maximized effectiveness under low budgets. Sea Lamprey control actions based on assessment information outperformed those that were implemented with no assessment under all budget scenarios.

  15. Impacts of aquatic nonindigenous invasive species on the Lake Erie ecosystem

    Science.gov (United States)

    Austen, Madeline J.W.; Ciborowski, Jan J.H.; Corkum, Lynda D.; Johnson, Tim B.; MacIsaac, Hugh J.; Metcalfe-Smith, Janice L.; Schloesser, Donald W.; George, Sandra E.

    2002-01-01

    Lake Erie is particularly vulnerable to the introduction and establishment of aquatic nonindigenous invasive species (NIS) populations. A minimum of 144 aquatic NIS have been recorded in the Lake Erie basin including several species [e.g., Eurasian watermilfoil (Myriophyllum spicatum); zebra mussel (Dreissena polymorpha); quagga mussel (Dreissena bugensis); an amphipod (Echinogammarus ischnus); round goby (Neogobius melanostomus); and sea lamprey (Petromyzon marinus)] that have had discernible impacts on the lake's ecology. NIS pose threats to the Lake Erie ecosystem for a variety of reasons including their ability to proliferate quickly, compete with native species, and transfer contaminants (e.g., PCBs) and disease through the food web. Six of the 14 beneficial use impairments listed in Annex 2 of the Great Lakes Water Quality Agreement are impaired in Lake Erie, in part as a result of the introduction of NIS. The Lake Erie Lakewide Management Plan (LaMP) has adopted an ecosystem approach to restore beneficial use impairments in the lake. Furthermore, a research consortium, known as the Lake Erie Millennium Network, is working alongside the LaMP, to address research problems regarding NIS, the loss of habitat, and the role of contaminants in the Lake Erie ecosystem.

  16. Excluding access to invasion hubs can contain the spread of an invasive vertebrate.

    Science.gov (United States)

    Florance, Daniel; Webb, Jonathan K; Dempster, Tim; Kearney, Michael R; Worthing, Alex; Letnic, Mike

    2011-10-07

    Many biological invasions do not occur as a gradual expansion along a continuous front, but result from the expansion of satellite populations that become established at 'invasion hubs'. Although theoretical studies indicate that targeting control efforts at invasion hubs can effectively contain the spread of invasions, few studies have demonstrated this in practice. In arid landscapes worldwide, humans have increased the availability of surface water by creating artificial water points (AWPs) such as troughs and dams for livestock. By experimentally excluding invasive cane toads (Bufo marinus) from AWP, we show that AWP provide a resource subsidy for non-arid-adapted toads and serve as dry season refuges and thus invasion hubs for cane toads in arid Australia. Using data on the distribution of permanent water in arid Australia and the dispersal potential of toads, we predict that systematically excluding toads from AWP would reduce the area of arid Australia across which toads are predicted to disperse and colonize under average climatic conditions by 38 per cent from 2,242,000 to 1,385,000 km(2). Our study shows how human modification of hydrological regimes can create a network of invasion hubs that facilitates a biological invasion, and confirms that targeted control at invasion hubs can reduce landscape connectivity to contain the spread of an invasive vertebrate.

  17. A thermogenic secondary sexual character in male sea lamprey.

    Science.gov (United States)

    Chung-Davidson, Yu-Wen; Priess, M Cody; Yeh, Chu-Yin; Brant, Cory O; Johnson, Nicholas S; Li, Ke; Nanlohy, Kaben G; Bryan, Mara B; Brown, C Titus; Choi, Jongeun; Li, Weiming

    2013-07-15

    Secondary sexual characters in animals are exaggerated ornaments or weapons for intrasexual competition. Unexpectedly, we found that a male secondary sexual character in sea lamprey (Petromyzon marinus) is a thermogenic adipose tissue that instantly increases its heat production during sexual encounters. This secondary sexual character, developed in front of the anterior dorsal fin of mature males, is a swollen dorsal ridge known as the 'rope' tissue. It contains nerve bundles, multivacuolar adipocytes and interstitial cells packed with small lipid droplets and mitochondria with dense and highly organized cristae. The fatty acid composition of the rope tissue is rich in unsaturated fatty acids. The cytochrome c oxidase activity is high but the ATP concentration is very low in the mitochondria of the rope tissue compared with those of the gill and muscle tissues. The rope tissue temperature immediately rose up to 0.3°C when the male encountered a conspecific. Mature males generated more heat in the rope and muscle tissues when presented with a mature female than when presented with a male (paired t-test, PSexually mature male sea lamprey possess the only known thermogenic secondary sexual character that shows differential heat generation toward individual conspecifics.

  18. Monitoring sea lamprey pheromones and their degradation using rapid stream-side extraction coupled with UPLC-MS/MS

    Science.gov (United States)

    Wang, Huiyong; Johnson, Nicholas; Bernardy, Jeffrey; Hubert, Terry; Li, Weiming

    2013-01-01

    Pheromones guide adult sea lamprey (Petromyzon marinus) to suitable spawning streams and mates, and therefore, when quantified, can be used to assess population size and guide management. Here, we present an efficient sample preparation method where 100 mL of river water was spiked with deuterated pheromone as an internal standard and underwent rapid field-based SPE and elution in the field. The combination of field extraction with laboratory UPLC-MS/MS reduced the sample consumption from 1 to 0.1 L, decreased the sample process time from more than 1 h to 10 min, and increased the precision and accuracy. The sensitivity was improved more than one order of magnitude compared with the previous method. The influences of experimental conditions were assessed to optimize the separation and peak shapes. The analytical method has been validated by studies of stability, selectivity, precision, and linearity and by the determination of the limits of detection and quantification. The method was used to quantify pheromone concentration from five streams tributary to Lake Ontario and to estimate that the environmental half-life of 3kPZS is about 26 h.

  19. Archaea S-layer nanotube from a "black smoker" in complex with cyclo-octasulfur (S8) rings.

    Science.gov (United States)

    McDougall, Matthew; Francisco, Olga; Harder-Viddal, Candice; Roshko, Roy; Meier, Markus; Stetefeld, Jörg

    2017-12-01

    Elemental sulfur exists primarily as an S80 ring and serves as terminal electron acceptor for a variety of sulfur-fermenting bacteria. Hyperthermophilic archaea from black smoker vents are an exciting research tool to advance our knowledge of sulfur respiration under extreme conditions. Here, we use a hybrid method approach to demonstrate that the proteinaceous cavities of the S-layer nanotube of the hyperthermophilic archaeon Staphylothermus marinus act as a storage reservoir for cyclo-octasulfur S8. Fully atomistic molecular dynamics (MD) simulations were performed and the method of multiconfigurational thermodynamic integration was employed to compute the absolute free energy for transferring a ring of elemental sulfur S8 from an aqueous bath into the largest hydrophobic cavity of a fragment of archaeal tetrabrachion. Comparisons with earlier MD studies of the free energy of hydration as a function of water occupancy in the same cavity of archaeal tetrabrachion show that the sulfur ring is energetically favored over water. © 2017 Wiley Periodicals, Inc.

  20. Blocking and guiding adult sea lamprey with pulsed direct current from vertical electrodes

    Science.gov (United States)

    Johnson, Nicholas S.; Thompson, Henry T.; Holbrook, Christopher M.; Tix, John A.

    2014-01-01

    Controlling the invasion front of aquatic nuisance species is of high importance to resource managers. We tested the hypothesis that adult sea lamprey (Petromyzon marinus), a destructive invasive species in the Laurentian Great Lakes, would exhibit behavioral avoidance to dual-frequency pulsed direct current generated by vertical electrodes and that the electric field would not injure or kill sea lamprey or non-target fish. Laboratory and in-stream experiments demonstrated that the electric field blocked sea lamprey migration and directed sea lamprey into traps. Rainbow trout (Oncorhynchus mykiss) and white sucker (Catostomus commersoni), species that migrate sympatrically with sea lamprey, avoided the electric field and had minimal injuries when subjected to it. Vertical electrodes are advantageous for fish guidance because (1) the electric field produced varies minimally with depth, (2) the electric field is not grounded, reducing power consumption to where portable and remote deployments powered by solar, wind, hydro, or a small generator are feasible, and (3) vertical electrodes can be quickly deployed without significant stream modification allowing rapid responses to new invasions. Similar dual-frequency pulsed direct current fields produced from vertical electrodes may be advantageous for blocking or trapping other invasive fish or for guiding valued fish around dams.

  1. Increasing temperature decreases the predatory effect of the intertidal shanny Lipophrys pholis on an amphipod prey

    KAUST Repository

    South, J.

    2017-11-15

    Interactions between Lipophrys pholis and its amphipod prey Echinogammarus marinus were used to investigate the effect of changing water temperatures, comparing current and predicted mean summer temperatures. Contrary to expectations, predator attack rates significantly decreased with increasing temperature. Handling times were significantly longer at 19° C than at 17 and 15° C and the maximum feeding estimate was significantly lower at 19° C than at 17° C. Functional-response type changed from a destabilizing type II to the more stabilizing type III with a temperature increase to 19° C. This suggests that a temperature increase can mediate refuge for prey at low densities. Predatory pressure by teleosts may be dampened by a large increase in temperature (here from 15 to 19° C), but a short-term and smaller temperature increase (to 17° C) may increase destabilizing resource consumption due to high maximum feeding rates; this has implications for the stability of important intertidal ecosystems during warming events.

  2. Feeding strategy assessment through fatty acid profiles in muscles of adult sea lampreys from the western Iberian coast

    Directory of Open Access Journals (Sweden)

    Maria João Lança

    2013-06-01

    Full Text Available The fatty acid signature of sea lamprey Petromyzon marinus (L. muscle was used as a tool to detect feeding strategies used during the parasitic marine trophic phase of the species. Adult sea lampreys were collected near the mouth of six Portuguese rivers (Minho, Lima, Douro, Vouga, Mondego and Tagus and muscle fatty acid profile was characterized. The analysis of fatty acid composition of muscle neutral lipids showed the formation of two groups, indicating that two feeding strategies may have been used by sea lampreys during the parasitic phase, based on the availability of ω-3 and ω-6 PUFA and on evidence of phytoplankton/zooplankton and bacterial detritus contribution in the sea lamprey host preferences. Two distinct lipid profiles were observed, probably related to two different trophic approaches, one typical of a top predator of a marine food web with a planktonic support, and the other much more diverse, including the same planktonic markers, together with biochemical clues that probably resulted from a parasitic phase that directly targeted fish that consumed detritus and benthic algae and/or fish from a food web with a detritivorous base.

  3. CYANOBACTERIA OF THE GENUS PROCHLOROTHRIX

    Directory of Open Access Journals (Sweden)

    Alexander Vasilievich Pinevich

    2012-05-01

    Full Text Available Green cyanobacteria are distinguished from blue-green ones by the possession of a chlorophyll-containing light harvesting antenna. Three genera of green cyanobacteria, namely Acaryochloris, Prochlorococcus and Prochloron, are unicellular and of marine habitat; Prochlorococcus marinus attracts most attention due to its outstanding role in prime productivity. The fourth genus, Prochlorothrix, is represented by filamentous freshwater strains. Unlike the rest of green cyanobacteria, Prochlorothrix is paradoxically rare: it has been isolated from two European locations only. Taking into account fluctuating blooms, morphological resemblance with Planktothrix and Pseudanabaena, and unsuccessful enrichment of Prochlorothrix, the preferred strategy of search for this cyanobacterium is based on PCR with natural DNA and specific primers. This approach already demonstrates a broader distribution of Prochlorothrix: marker genes have been found in at least two additional locations. Despite the growing evidence for naturally occurring Prochlorothrix, there are only a few cultivated strains, and only one of them (PCC 9006 is claimed to be axenic. In multixenic cultures, Prochlorothrix is accompanied by heterotrophic bacteria, indicating a consortium-type association. The genus Prochlorothrix includes two species: P. hollandica and P. scandica based on distinctions in genomic DNA, cell size, temperature optimum, and fatty acid composition of membrane lipids. In this short review, the properties of cyanobacteria of the genus Prochlorothrix are described, and the evolutionary scenario of green cyanobacteria, especially taking into account their role in the origin of simple chloroplast is given.

  4. The Structure of a BamA-BamD Fusion Illuminates the Architecture of the β-Barrel Assembly Machine Core.

    Science.gov (United States)

    Bergal, Hans Thor; Hopkins, Alex Hunt; Metzner, Sandra Ines; Sousa, Marcelo Carlos

    2016-02-02

    The β-barrel assembly machine (BAM) mediates folding and insertion of integral β-barrel outer membrane proteins (OMPs) in Gram-negative bacteria. Of the five BAM subunits, only BamA and BamD are essential for cell viability. Here we present the crystal structure of a fusion between BamA POTRA4-5 and BamD from Rhodothermus marinus. The POTRA5 domain binds BamD between its tetratricopeptide repeats 3 and 4. The interface structural elements are conserved in the Escherichia coli proteins, which allowed structure validation by mutagenesis and disulfide crosslinking in E. coli. Furthermore, the interface is consistent with previously reported mutations that impair BamA-BamD binding. The structure serves as a linchpin to generate a BAM model where POTRA domains and BamD form an elongated periplasmic ring adjacent to the membrane with a central cavity approximately 30 × 60 Å wide. We propose that nascent OMPs bind this periplasmic ring prior to insertion and folding by BAM. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Microbial analyses of traditional Italian salami reveal microorganisms transfer from the natural casing to the meat matrix.

    Science.gov (United States)

    Pisacane, Vincenza; Callegari, Maria Luisa; Puglisi, Edoardo; Dallolio, Giuliano; Rebecchi, Annalisa

    2015-08-17

    In this study the bacterial biodiversity, during the maturation process of traditional sausages (Salame Mantovano), produced with two different kinds of casing (hog middle or "Crespone" and hog bung or "Gentile"), was investigated by means of culture-dependent and -independent methods. In order to assess the natural variability linked to the type of casing used in production, the ingredients, as well as ripening conditions, were identical in both productions. The aim of the study was to understand the contribution of casing microflora during sausage ripening by identifying the dominant species and strains. The bacterial ecology of casings and salami at different ripening stages, as determined by plating, revealed higher staphylococci and enterococci counts for Gentile casing and for the entire ripening period of the salami studied. After molecular identification of 219 Lactobacilli and 225 cocci gram positive catalase positive (GPCP) isolates, the species most frequently isolated were Lactobacillus sakei, Lactobacillus curvatus, Staphylococcus xylosus, and Staphylococcus saprophyticus. Some L. sakei and S. saprophyticus strains, coming from casing, were also found in the salami at different times of ripening. A richer biodiversity was only detected at the beginning of maturation. We also report the first detection, by PCR-DGGE method, of Arcobacter marinus and Brochothrix thermosphacta species in casings and Kokuria salsicia in fresh sausage. Results suggesting that casing can be an important source of bacteria during natural fermentation when starter cultures are not used. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Biological indicators of environmental quality in the Elbe-, Weser- and Ems-estuary. Pt. 1. Distribution and life-cycle of euryhaline gammarid species (Amphipoda, Crustacea). Untersuchungen zur Verwendung von Bioindikatoren fuer die Umweltueberwachung im Aestuarbereich der Elbe, Weser und Ems. T. 1. Zum Vorkommen und Lebenszyklus euryhaliner Gammariden im Elbe-, Weser- und Ems-Astuar

    Energy Technology Data Exchange (ETDEWEB)

    Meurs, H.G.; Todeskino, D.; Baeumer, H.P.; Butte, W.; Zauke, G.P.

    1986-01-01

    Euryhaline gammarids from the Elbe-, Weser- and Ems-estuary are biologically characterised as a basis for the valuation of their heavy metal body burden. Subjects of this investigation are: 1) Species distribution within estuaries in relation to the salinity regime, 2) seasonal changes in species composition within specific habitats of the mixo-mesohaline region and 3) analysis of the life-cycle of the dominant species on the basis of monthly taken samples. With increasing salinity the following species have been found: Gammarus duebeni, G. tigrinus, G. zaddachi, G. salinus and Chaetogammarus marinus. G. salinus is in reproduction from March until November with a maximum in May/June. After an estimated life-span of approximately 9-12 months, the G. salinus specimen from the previous reproduction phase are supposed to die in the following July. Regarding specific habitats within the mixo-mesohaline region, G. salinus is displaced by immigrating G. zaddachi during the winter. The immigration is discussed in relation to the evolution of reproductive strategies. (orig.) With 10 tabs., 23 figs., 188 refs.

  7. Jeotgalibacillus soli sp. nov., a Gram-stain-positive bacterium isolated from soil.

    Science.gov (United States)

    Cunha, Sofia; Tiago, Igor; Paiva, Gabriel; Nobre, Fernanda; da Costa, Milton S; Veríssimo, António

    2012-03-01

    A Gram-staining-positive, motile, rod-shaped, spore-forming bacterium, designated P9(T), was isolated from soil in Portugal. This organism was aerobic and catalase- and oxidase-positive. It had an optimum growth temperature of about 35 °C and an optimum growth pH of about 8.0-8.5, and grew in medium with 0-9% (w/v) NaCl. The cell-wall peptidoglycan was of the A1α type, with L-lysine as the diagnostic diamino acid. The major respiratory quinone was menaquinone 7 (MK-7) and the major fatty acids were anteiso-C(15:0) (45.4%), iso-C(15:0) (22.0%) and anteiso-C(17:0) (11.2%). The genomic DNA G+C content was about 39.4 mol%. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain P9(T) was most closely related to Jeotgalibacillus campisalis DSM 18983(T) (96.8%) and Jeotgalibacillus marinus DSM 1297(T) (96.5%). These two recognized species formed a coherent cluster with strain P9(T) that was supported by a bootstrap value of 99%. On the basis of the phylogenetic analysis and physiological and biochemical characteristics, strain P9(T) (=DSM 23228(T)=LMG 25523(T)) represents a novel species of the genus Jeotgalibacillus, for which the name Jeotgalibacillus soli sp. nov. is proposed.

  8. Xylo- and arabinoxylooligosaccharides from wheat bran by endoxylanases, utilisation by probiotic bacteria, and structural studies of the enzymes.

    Science.gov (United States)

    Mathew, Sindhu; Aronsson, Anna; Karlsson, Eva Nordberg; Adlercreutz, Patrick

    2018-04-01

    Xylooligosaccharides (XOS) and arabinoxylooligosaccharides (AXOS) were produced from the insoluble arabinoxylan fraction of pretreated wheat bran by endoxylanases. The glycoside hydrolase (GH) family 10 xylanases GsXyn10A from Geobacillus stearothermophilus and RmXyn10A-CM from Rhodothermus marinus produced the AXOS A 3 X, A 2 XX and A 2 + 3 XX in addition to XOS. RmXyn10A-CM also produced XA 2 + 3 XX due to its non-conserved aglycone region accommodating additional arabinose substitutions in subsite +2. The GH11 enzymes, Pentopan from Thermomyces lanuginosus and NpXyn11A from Neocallimastix patriciarum had minor structural differences affecting hydrogen bonds in subsites -3 and +3, with similar hydrolysis profiles producing XA 3 XX as major AXOS and minor amounts of XA 2 XX but different ratios of X 3 /X 2 . In vitro analysis of the prebiotic properties of (A)XOS produced by Pentopan revealed nearly complete uptake of X 2 and X 3 by the probiotic bacteria Lactobacillus brevis and Bifidobacterium adolescentis. In contrast to previous reports, the GH43 arabinofuranosidase BaAXHd-3 from B. adolescentis cleaved α-1,3-linked arabinose on some single substituted AXOS.

  9. Relative contributions of sampling effort, measuring, and weighing to precision of larval sea lamprey biomass estimates

    Science.gov (United States)

    Slade, Jeffrey W.; Adams, Jean V.; Cuddy, Douglas W.; Neave, Fraser B.; Sullivan, W. Paul; Young, Robert J.; Fodale, Michael F.; Jones, Michael L.

    2003-01-01

    We developed two weight-length models from 231 populations of larval sea lampreys (Petromyzon marinus) collected from tributaries of the Great Lakes: Lake Ontario (21), Lake Erie (6), Lake Huron (67), Lake Michigan (76), and Lake Superior (61). Both models were mixed models, which used population as a random effect and additional environmental factors as fixed effects. We resampled weights and lengths 1,000 times from data collected in each of 14 other populations not used to develop the models, obtaining a weight and length distribution from reach resampling. To test model performance, we applied the two weight-length models to the resampled length distributions and calculated the predicted mean weights. We also calculated the observed mean weight for each resampling and for each of the original 14 data sets. When the average of predicted means was compared to means from the original data in each stream, inclusion of environmental factors did not consistently improve the performance of the weight-length model. We estimated the variance associated with measures of abundance and mean weight for each of the 14 selected populations and determined that a conservative estimate of the proportional contribution to variance associated with estimating abundance accounted for 32% to 95% of the variance (mean = 66%). Variability in the biomass estimate appears more affected by variability in estimating abundance than in converting length to weight. Hence, efforts to improve the precision of biomass estimates would be aided most by reducing the variability associated with estimating abundance.

  10. Characterization and Extracellular Enzyme Activity of Predominant Marine Bacillus spp. Isolated From Sea Water of Orissa Coast, India

    Directory of Open Access Journals (Sweden)

    Bal, S.

    2009-01-01

    Full Text Available Bacillus species are ubiquitous and diverse both in the terrestrial and marine ecosystems. In this investigation, predominant Bacillus species from sea water of three different sites of Orissa Coast were isolated and identified. In total, 16 Bacillus species were identified using morpho-physiological and biochemical characterisation. These identified bacterial strains include B. fastidiosus (CMB1, B. alvei (CMB2, B. coagulans (CMB3, B. marinus (CMB5, B. mycoides (CMB8, B. coagulans (PMB1, B. circulans (PMB2, B. cereus (PMB3, B. subtilis (PMB4, B. alcalophilus (GMB1, B. licheniformics (GMB2, B. polymyxa (GMB3 and B. pumilus (GMB4. The isolates CMB4, CMB6 and CMB7 were identified only up to genus level. These isolates were further screened for their salt tolerance and growth under varied temperature and pH conditions. Ability of these strains to produce extracellular enzymes such as protease, amylase, lipase, gelatinase, casein hydrolase, lecithinase, chitinase and pectinase were also screened and found that most of the Bacillus spp. possess extracellular enzymes.

  11. Characterisation of a New Family of Carboxyl Esterases with an OsmC Domain.

    Directory of Open Access Journals (Sweden)

    Mai-Britt V Jensen

    Full Text Available Proteins in the serine esterase family are widely distributed in bacterial phyla and display activity against a range of biologically produced and chemically synthesized esters. A serine esterase from the psychrophilic bacterium Pseudoalteromonas arctica with a C-terminal OsmC-like domain was recently characterized; here we report on the identification and characterization of further putative esterases with OsmC-like domains constituting a new esterase family that is found in a variety of bacterial species from different environmental niches. All of these proteins contained the Ser-Asp-His motif common to serine esterases and a highly conserved pentapeptide nucleophilic elbow motif. We produced these proteins heterologously in Escherichia coli and demonstrated their activity against a range of esterase substrates. Two of the esterases characterized have activity of over two orders of magnitude higher than other members of the family, and are active over a wide temperature range. We determined the crystal structure of the esterase domain of the protein from Rhodothermus marinus and show that it conforms to the classical α/β hydrolase fold with an extended 'lid' region, which occludes the active site of the protein in the crystal. The expansion of characterized members of the esterase family and demonstration of activity over a wide-range of temperatures could be of use in biotechnological applications such as the pharmaceutical, detergent, bioremediation and dairy industries.

  12. Ancient evolutionary origin of vertebrate enteric neurons from trunk-derived neural crest.

    Science.gov (United States)

    Green, Stephen A; Uy, Benjamin R; Bronner, Marianne E

    2017-04-06

    The enteric nervous system of jawed vertebrates arises primarily from vagal neural crest cells that migrate to the foregut and subsequently colonize and innervate the entire gastrointestinal tract. Here we examine development of the enteric nervous system in the basal jawless vertebrate the sea lamprey (Petromyzon marinus) to gain insight into its evolutionary origin. Surprisingly, we find no evidence for the existence of a vagally derived enteric neural crest population in the lamprey. Rather, labelling with the lipophilic dye DiI shows that late-migrating cells, originating from the trunk neural tube and associated with nerve fibres, differentiate into neurons within the gut wall and typhlosole. We propose that these trunk-derived neural crest cells may be homologous to Schwann cell precursors, recently shown in mammalian embryos to populate post-embryonic parasympathetic ganglia, including enteric ganglia. Our results suggest that neural-crest-derived Schwann cell precursors made an important contribution to the ancient enteric nervous system of early jawless vertebrates, a role that was largely subsumed by vagal neural crest cells in early gnathostomes.

  13. Lankesterella poeppigii n. sp. (Apicomplexa, Lankesterellidae from Bufo poeppigii (Tschudi, 1845 from Peru

    Directory of Open Access Journals (Sweden)

    Ilan Paperna

    2011-07-01

    Full Text Available Lankesterella poeppigii n. sp. is described from Bufo poeppigii (Tschudi, 1845 from Peru. Merogony and oogony occur in the capillary endothelium and the macrophages in the liver, spleen and kidneys. Meronts are oval, 25,2–29,4 x 15,7–16,8 μm in size and yield 35–46 merozoites. Oocysts are 26,3–29,4 x 15,1–17,6 μm in size; sporozoites 9,2-9,8 x 4,2–5,0 μm in size, assemble in macrophages. Released 8,7–9,8 x 2,8–3,1 μm sporozoites enter erythrocytes. L. poeppigii is compared with Lankesterella petiti Lainson & Paperna, 1995 infecting Bufo marinus (Linnaeus, 1758 in Brazil. The above mentioned specific characters, added to differences in hosts and geographical location warrant the description of Lankesterella poeppigii from B. poeppigii as a new species.

  14. Test of a non-physical barrier consisting of light, sound, and bubble screen to block upstream movement of sea lamprey in an experimental raceway

    Science.gov (United States)

    Miehls, Scott M.; Johnson, Nicholas S.; Hrodey, Pete J.

    2017-01-01

    Control of the invasive Sea Lamprey Petromyzon marinus is critical for management of commercial and recreational fisheries in the Laurentian Great Lakes. Use of physical barriers to block Sea Lampreys from spawning habitat is a major component of the control program. However, the resulting interruption of natural streamflow and blockage of nontarget species present substantial challenges. Development of an effective nonphysical barrier would aid the control of Sea Lampreys by eliminating their access to spawning locations while maintaining natural streamflow. We tested the effect of a nonphysical barrier consisting of strobe lights, low-frequency sound, and a bubble screen on the movement of Sea Lampreys in an experimental raceway designed as a two-choice maze with a single main channel fed by two identical inflow channels (one control and one blocked). Sea Lampreys were more likely to move upstream during trials when the strobe light and low-frequency sound were active compared with control trials and trials using the bubble screen alone. For those Sea Lampreys that did move upstream to the confluence of inflow channels, no combination of stimuli or any individual stimulus significantly influenced the likelihood that Sea Lampreys would enter the blocked inflow channel, enter the control channel, or return downstream.

  15. Predator interference effects on biological control: The "paradox" of the generalist predator revisited

    Science.gov (United States)

    Parshad, Rana D.; Bhowmick, Suman; Quansah, Emmanuel; Basheer, Aladeen; Upadhyay, Ranjit Kumar

    2016-10-01

    An interesting conundrum in biological control questions the efficiency of generalist predators as biological control agents. Theory suggests, generalist predators are poor agents for biological control, primarily due to mutual interference. However field evidence shows they are actually quite effective in regulating pest densities. In this work we provide a plausible answer to this paradox. We analyze a three species model, where a generalist top predator is introduced into an ecosystem as a biological control, to check the population of a middle predator, that in turn is depredating on a prey species. We show that the inclusion of predator interference alone, can cause the solution of the top predator equation to blow-up in finite time, while there is global existence in the no interference case. This result shows that interference could actually cause a population explosion of the top predator, enabling it to control the target species, thus corroborating recent field evidence. Our results might also partially explain the population explosion of certain species, introduced originally for biological control purposes, such as the cane toad (Bufo marinus) in Australia, which now functions as a generalist top predator. We also show both Turing instability and spatio-temporal chaos in the model. Lastly we investigate time delay effects.

  16. Community dynamics and glycoside hydrolase activities of thermophilic bacterial consortia adapted to switchgrass

    Energy Technology Data Exchange (ETDEWEB)

    Gladden, J.M.; Allgaier, M.; Miller, C.S.; Hazen, T.C.; VanderGheynst, J.S.; Hugenholtz, P.; Simmons, B.A.; Singer, S.W.

    2011-05-01

    Industrial-scale biofuel production requires robust enzymatic cocktails to produce fermentable sugars from lignocellulosic biomass. Thermophilic bacterial consortia are a potential source of cellulases and hemicellulases adapted to harsher reaction conditions than commercial fungal enzymes. Compost-derived microbial consortia were adapted to switchgrass at 60 C to develop thermophilic biomass-degrading consortia for detailed studies. Microbial community analysis using small-subunit rRNA gene amplicon pyrosequencing and short-read metagenomic sequencing demonstrated that thermophilic adaptation to switchgrass resulted in low-diversity bacterial consortia with a high abundance of bacteria related to thermophilic paenibacilli, Rhodothermus marinus, and Thermus thermophilus. At lower abundance, thermophilic Chloroflexi and an uncultivated lineage of the Gemmatimonadetes phylum were observed. Supernatants isolated from these consortia had high levels of xylanase and endoglucanase activities. Compared to commercial enzyme preparations, the endoglucanase enzymes had a higher thermotolerance and were more stable in the presence of 1-ethyl-3-methylimidazolium acetate ([C2mim][OAc]), an ionic liquid used for biomass pretreatment. The supernatants were used to saccharify [C2mim][OAc]-pretreated switchgrass at elevated temperatures (up to 80 C), demonstrating that these consortia are an excellent source of enzymes for the development of enzymatic cocktails tailored to more extreme reaction conditions.

  17. Sandeels and clams (Spisula sp.) in the wind turbine park at Horns Reef. Preliminary report

    International Nuclear Information System (INIS)

    Jensen, Henrik; Sand Kristensen, P.; Hoffmann, E.

    2003-04-01

    Sandeels were found in the sediment at all of the sample locations in the area of the wind turbine park and in the control area. The mean density of sandeels in the sediment was 0.0102 m -2 (10,200 km -2 ) in the control area and 0.0096 m -2 (9,600 km -2 ) in the impact area. The most abundant species of sandeel in both the impact and the control area was H. lanceolatus followed by A. marinus and A. tobianus. No G. semisquamatus was caught during the surveys. The construction of the wind turbine park is not supposed to effect the sandeel population in the Horns Reef area because the impact area seems to constitute a small fraction of a larger area with sandeel habitat. However, within the area of the wind turbine park sandeel abundance might be affected if the surface sediment changes due to the construction of the wind turbine park or if the abundance of sandeel predators increases in the impact area after the wind turbine park has been build (the so called artificial reef effect). To investigate if these effects will occur the field programmethat was carried out in February/march 2002 (the subject of this report) will have to be repeated after the wind turbine park has been constructed. (au)

  18. Environmental pollutants in endangered vs. increasing subspecies of the lesser black-backed gull on the Norwegian Coast

    Energy Technology Data Exchange (ETDEWEB)

    Bustnes, Jan Ove [Norwegian Institute for Nature Research, Division of Arctic Ecology, Polar Environmental Centre, N-9296 Tromso (Norway)]. E-mail: jan.o.bustnes@nina.no; Helberg, Morten [Norwegian Institute for Nature Research, Division of Arctic Ecology, Polar Environmental Centre, N-9296 Tromso (Norway); Strann, Karl-Birger [Norwegian Institute for Nature Research, Division of Arctic Ecology, Polar Environmental Centre, N-9296 Tromso (Norway); Skaare, Janneche Utne [National Veterinary Institute/Norwegian School of Veterinary Science, P.O. Box 8156 Dep., N-0033 Oslo (Norway)

    2006-12-15

    Organochlorine (OC) residues were measured in eggs and blood of different subspecies of the lesser black-backed gull, Larus fuscus, on the Norwegian coast: a) increasing L. f. intermedius in the North Sea; b) endangered L. f. fuscus near the Arctic Circle; c) L. f. fuscus and greyish-mantled gulls, with a L. f. intermedius appearance, in the Barents Sea region. The dominating OCs in lesser black-backed gulls were polychlorinated biphenyls (PCB) and p,p'-dichlorodiphenyldichloroethylene (DDE). DDE and {beta}-hexachlorocyclohexane ({beta}-HCH) residues were higher in L. f. fuscus compared to L. f. intermedius and greyish-mantled birds in the Barents Sea region. In the latter area, blood residues of PCB and DDE in lesser black-backed gulls were as high as in great black-backed gulls, Larus marinus, while in the other regions they were lower. The higher DDE residues in endangered L. f. fuscus compared to increasing L. f. intermedius and greyish-mantled birds, which are invading northern Norway, suggest that OCs may have played a role in the population decline of L. f. fuscus, possibly in combination with nutrient stress. - DDE and {beta}-HCH residues were higher in an endangered compared to an increasing subspecies of lesser black-backed gulls in Norway.

  19. Methanol Production by a Broad Phylogenetic Array of Marine Phytoplankton

    Science.gov (United States)

    Mincer, Tracy J.; Aicher, Athena C.

    2016-01-01

    Methanol is a major volatile organic compound on Earth and serves as an important carbon and energy substrate for abundant methylotrophic microbes. Previous geochemical surveys coupled with predictive models suggest that the marine contributions are exceedingly large, rivaling terrestrial sources. Although well studied in terrestrial ecosystems, methanol sources are poorly understood in the marine environment and warrant further investigation. To this end, we adapted a Purge and Trap Gas Chromatography/Mass Spectrometry (P&T-GC/MS) method which allowed reliable measurements of methanol in seawater and marine phytoplankton cultures with a method detection limit of 120 nanomolar. All phytoplankton tested (cyanobacteria: Synechococcus spp. 8102 and 8103, Trichodesmium erythraeum, and Prochlorococcus marinus), and Eukarya (heterokont diatom: Phaeodactylum tricornutum, coccolithophore: Emiliania huxleyi, cryptophyte: Rhodomonas salina, and non-diatom heterokont: Nannochloropsis oculata) produced methanol, ranging from 0.8–13.7 micromolar in culture and methanol per total cellular carbon were measured in the ranges of 0.09–0.3%. Phytoplankton culture time-course measurements displayed a punctuated production pattern with maxima near early stationary phase. Stabile isotope labeled bicarbonate incorporation experiments confirmed that methanol was produced from phytoplankton biomass. Overall, our findings suggest that phytoplankton are a major source of methanol in the upper water column of the world’s oceans. PMID:26963515

  20. Isolation breeds naivety: island living robs Australian varanid lizards of toad-toxin immunity via four-base-pair mutation.

    Science.gov (United States)

    Ujvari, Beata; Mun, Hee-chang; Conigrave, Arthur D; Bray, Alessandra; Osterkamp, Jens; Halling, Petter; Madsen, Thomas

    2013-01-01

    Since their introduction to the toad-free Australian continent cane toads (Bufo marinus) have caused a dramatic increase in naïve varanid mortality when these large lizards attempt to feed on this toxic amphibian. In contrast Asian-African varanids, which have coevolved with toads, are resistant to toad toxin. Toad toxins, such as Bufalin target the H1-H2 domain of the α(1) subunit of the sodium-potassium-ATPase enzyme. Sequencing of this domain revealed identical nucleotide sequences in four Asian as well as in three African varanids, and identical sequences in all 11 Australian varanids. However, compared to the Asian-African varanids, the Australian varanids showed four-base-pair substitutions, resulting in the alteration in three of the 12 amino acids representing the H1-H2 domain. The phenotypic effect of the substitutions was investigated in human embryonic kidney (HEK) 293 cells stably transfected with the Australian and the Asian-African H1-H2 domains. The transfections resulted in an approximate 3000-fold reduction in resistance to Bufalin in the Australian HEK293 cells compared to the Asian-African HEK293 cells, demonstrating the critical role of this minor mutation in providing Bufalin resistance. Our study hence presents a clear link between genotype and phenotype, a critical step in understanding the evolution of phenotypic diversity. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

  1. Quantitative and functional characterization of the hyper-conserved protein of Prochlorococcus and marine Synechococcus.

    Directory of Open Access Journals (Sweden)

    Caroline E Whidden

    Full Text Available A large fraction of any bacterial genome consists of hypothetical protein-coding open reading frames (ORFs. While most of these ORFs are present only in one or a few sequenced genomes, a few are conserved, often across large phylogenetic distances. Such conservation provides clues to likely uncharacterized cellular functions that need to be elucidated. Marine cyanobacteria from the Prochlorococcus/marine Synechococcus clade are dominant bacteria in oceanic waters and are significant contributors to global primary production. A Hyper Conserved Protein (PSHCP of unknown function is 100% conserved at the amino acid level in genomes of Prochlorococcus/marine Synechococcus, but lacks homologs outside of this clade. In this study we investigated Prochlorococcus marinus strains MED4 and MIT 9313 and Synechococcus sp. strain WH 8102 for the transcription of the PSHCP gene using RT-Q-PCR, for the presence of the protein product through quantitative immunoblotting, and for the protein's binding partners in a pull down assay. Significant transcription of the gene was detected in all strains. The PSHCP protein content varied between 8±1 fmol and 26±9 fmol per ug total protein, depending on the strain. The 50 S ribosomal protein L2, the Photosystem I protein PsaD and the Ycf48-like protein were found associated with the PSHCP protein in all strains and not appreciably or at all in control experiments. We hypothesize that PSHCP is a protein associated with the ribosome, and is possibly involved in photosystem assembly.

  2. Using experimental de-worming to measure the immunological and pathological impacts of lungworm infection in cane toads

    Directory of Open Access Journals (Sweden)

    Patrick B. Finnerty

    2017-12-01

    Full Text Available The immunological and pathological consequences of parasite infection can be more rigorously assessed from experimental manipulation than from correlational studies of natural infections. We used anthelmintic treatment to experimentally decrease intensities of lungworm infection in captive and free-ranging wild cane toads to assess parasite impacts on host immune responses. First, we administered the anthelmintic drug Ivermectin to both infected and uninfected toads, to distinguish drug effects per se from the impacts of killing lungworms. Worms began dying and decomposing <48 h after injection. The only immunological variables that were affected by anthelmintic treatment were bactericidal capacity of the blood which increased in parasitized toads (presumably triggered by decomposing worms in the lungs, and the phagocytic capacity of blood (which increased in both infected and uninfected toads; the latter effect presumably was caused by the injection of Ivermectin per se rather than removal of parasites. Second, we looked at correlates of variation in the infection intensity induced by de-worming (in both captive and free-ranging toads over an eight-week period. Heavier lungworm infection was associated with increased phagocytic ability of the host's blood, and a reduction in the host's liver mass (and hence, energy stores. Experimental de-worming thus revealed pathological and immunological costs of the presence of lungworms, and of their removal by anthelmintic injection. Keywords: Rhinella marina, Bufo marinus, Host, Parasite, Nematode

  3. Crystallization, neutron data collection, initial structure refinement and analysis of a xyloglucan heptamer bound to an engineered carbohydrate-binding module from xylanase.

    Science.gov (United States)

    Ohlin, Mats; von Schantz, Laura; Schrader, Tobias E; Ostermann, Andreas; Logan, Derek T; Fisher, S Zoë

    2015-08-01

    Carbohydrate-binding modules (CBMs) are discrete parts of carbohydrate-hydrolyzing enzymes that bind specific types of carbohydrates. Ultra high-resolution X-ray crystallographic studies of CBMs have helped to decipher the basis for specificity in carbohydrate-protein interactions. However, additional studies are needed to better understand which structural determinants confer which carbohydrate-binding properties. To address these issues, neutron crystallographic studies were initiated on one experimentally engineered CBM derived from a xylanase, X-2 L110F, a protein that is able to bind several different plant carbohydrates such as xylan, β-glucan and xyloglucan. This protein evolved from a CBM present in xylanase Xyn10A of Rhodothermus marinus. The protein was complexed with a branched xyloglucan heptasaccharide. Large single crystals of hydrogenous protein (∼1.6 mm(3)) were grown at room temperature and subjected to H/D exchange. Both neutron and X-ray diffraction data sets were collected to 1.6 Å resolution. Joint neutron and X-ray refinement using phenix.refine showed significant density for residues involved in carbohydrate binding and revealed the details of a hydrogen-bonded water network around the binding site. This is the first report of a neutron structure of a CBM and will add to the understanding of protein-carbohydrate binding interactions.

  4. Locomotor performance in an invasive species: cane toads from the invasion front have greater endurance, but not speed, compared to conspecifics from a long-colonised area.

    Science.gov (United States)

    Llewelyn, John; Phillips, Benjamin L; Alford, Ross A; Schwarzkopf, Lin; Shine, Richard

    2010-02-01

    Cane toads (Bufo marinus) are now moving about 5 times faster through tropical Australia than they did a half-century ago, during the early phases of toad invasion. Radio-tracking has revealed higher daily rates of displacement by toads at the invasion front compared to those from long-colonised areas: toads from frontal populations follow straighter paths, move more often, and move further per displacement than do toads from older (long-established) populations. Are these higher movement rates of invasion-front toads associated with modified locomotor performance (e.g. speed, endurance)? In an outdoor raceway, toads collected from the invasion front had similar speeds, but threefold greater endurance, compared to conspecifics collected from a long-established population. Thus, increased daily displacement in invasion-front toads does not appear to be driven by changes in locomotor speed. Instead, increased dispersal is associated with higher endurance, suggesting that invasion-front toads tend to spend more time moving than do their less dispersive conspecifics. Whether this increased endurance is a cause or consequence of behavioural shifts associated with rapid dispersal is unclear. Nonetheless, shifts in endurance between frontal and core populations of this invasive species point to the complex panoply of traits affected by selection for increased dispersal ability on expanding population fronts.

  5. Comparative embryology of five species of lampreys of the upper Great Lakes

    Science.gov (United States)

    Smith, Allen J.; Howell, John H.; Piavis, George W.

    1968-01-01

    The four species of lampreys native to the upper Great Lakes (American brook lamprey, Lampetra lamotteni; chestnut lamprey, Ichthyomyzon castaneus; northern brook lamprey, I. fossor; and silver lamprey, I. unicuspis) were collected in various stages of their life cycle and maintained in the laboratory until sexually mature. Secondary sex characters of the four native species are compared. Several batches of eggs of each species were reared at 18.4A?C and their development was compared to that of the exotic sea lamprey, Petromyzon marinus. The temperature of 18.4A?C was previously determined to be optimum for development of the sea lamprey. The high percentage survival of many batches of eggs of native species to prolarvae indicated that 18.4A?C was near the optimum for them. Survival to the burrowing stage varied considerably among different batches of eggs from the same species; some batches failed to produce prolarvae. The staging characteristics used for the sea lamprey were applicable to the native species, except for the end point of the burrowing stage. Embryos of the native species in each stage of development appeared according to the time sequence established for the sea lamprey.

  6. Eleutherodactylus frog introductions to Hawaii

    Science.gov (United States)

    Kraus, Fred; Campbell, Earl W.; Allison, Allen; Pratt, Thane K.

    1999-01-01

    As an oceanic archipelago isolated from continental source areas, Hawaii lacks native terrestrial reptiles and amphibians, Polynesians apparently introduced seven gecko and skink species after discovering the islands approximately 1500 years ago, and another 15 reptiles and five frogs have been introduced in the last century and a half (McKeown 1996). The Polynesian introductions are probably inadvertent because the species involved are known stowaway dispersers (Gibbons 1985; Dye and Steadman 1990), In contrast, most of the herpetological introductions since European contact with Hawaii have been intentional. Several frog species were released for biocontrol of insects (e.g., Dendrobates auratus, Bufo marinus, Rana rugosa, Bryan 1932; Oliver and Shaw 1953), and most of the remaining species are released or escaped pets (e.g., Phelsuma spp., Chamaeleo jacksonii, Iguana iguana, McKeown 1996), Government-approved releases have not occurred for many years, but the rate of establishment of new species has increased in the past few decades because of the importation and subsequent release of pets.

  7. Anselm Citron (1923 - 2014)

    CERN Multimedia

    2015-01-01

    Anselm Citron, one of CERN’s pioneers, an enthusiastic scholar and internationally renowned researcher, passed away on 8 December at the age of 91.   Anselm Citron, front, looks at a quadrupole for the muon beam at the SC with, left to right, Bengt Hedin, Marinus van Gulik and Pierre Lapostolle. Born in Germany, Citron went to high school in the Netherlands, where he had been sent to escape the persecution of people with Jewish roots. After abitur and a short period at a technical high school, he took part in the last stages of the Second World War before returning to Freiburg in 1945. There, he studied physics under Wolfgang Gentner, and obtained his PhD. Citron then joined the Cavendish Laboratory, Cambridge, in 1952, to take part in research on accelerator physics. A year later, he came to the newly founded CERN as one of its first 12 staff physicists and contributed to the construction of the Proton Synchrotron, for which he was responsible for the high-frequency powe...

  8. HPLC and ELISA analyses of larval bile acids from Pacific and western brook lampreys

    Science.gov (United States)

    Yun, S.-S.; Scott, A.P.; Bayer, J.M.; Seelye, J.G.; Close, D.A.; Li, W.

    2003-01-01

    Comparative studies were performed on two native lamprey species, Pacific lamprey (Lampetra tridentata) and western brook lamprey (Lampetra richardsoni) from the Pacific coast along with sea lamprey (Petromyzon marinus) from the Great Lakes, to investigate their bile acid production and release. HPLC and ELISA analyses of the gall bladders and liver extract revealed that the major bile acid compound from Pacific and western brook larval lampreys was petromyzonol sulfate (PZS), previously identified as a migratory pheromone in larval sea lamprey. An ELISA for PZS has been developed in a working range of 20pg-10ng per well. The tissue concentrations of PZS in gall bladder were 127.40, 145.86, and 276.96??g/g body mass in sea lamprey, Pacific lamprey, and western brook lamprey, respectively. Releasing rates for PZS in the three species were measured using ELISA to find that western brook and sea lamprey released PZS 20 times higher than Pacific lamprey did. Further studies are required to determine whether PZS is a chemical cue in Pacific and western brook lampreys. ?? 2003 Elsevier Inc. All rights reserved.

  9. Effects of temperature, pH-values and sodium chloride concentrations on the glucose-6-phosphate dehydrogenase activity by thermotolerant Bacillus strains

    Directory of Open Access Journals (Sweden)

    HAZEM AQEL

    2012-01-01

    Full Text Available Thirteen new isolated thermotolerant Bacillus strains and four known Bacillus species were used to evaluate the effect of growth temperature, pH-values and NaCl concentrations on the intracellular glucose-6-phosphate dehydrogenase (G6PDH activity. Results had shown a significant difference in G6PDH production among all species at all used temperatures (p<0.05. The response of individual new isolates and controls for production of G6PDH under growth conditions was variable. The optimal growth conditions did not correspond to the optimal cultivation conditions for maximum G6PDH production. The growth temperature showed the most significant effect on G6PDH activity. The combined effect of temperature and NaCl on the G6PDH activity was strongly pronounced in comparison with the combined effect of temperature and pH or pH and NaCl. Thermal stability at 53ºC and electrophoretic mobility were also investigated. G6PDH from HUTB41 was the most thermostable G6PDH enzyme with T50% of more than 360 minutes. Electrophoretic study demonstrated that G6PDH was composed of two isoenzymes for all strains except B. marinus and B. schlegelii that had three isoenzymes.

  10. Seasonal patterns in growth, blood consumption, and effects on hosts by parasitic-phase sea lampreys in the Great Lakes: an individual-based model approach

    Science.gov (United States)

    Madenjian, Charles P.; Cochran, Philip A.; Bergstedt, Roger A.

    2003-01-01

    An individual-based model (IBM) was developed for sea lamprey (Petromyzon marinus) populations in the Laurentian Great Lakes. The IBM was then calibrated to observed growth, by season, for sea lampreys in northern Lake Huron under two different water temperature regimes: a regime experienced by Seneca-strain lake trout (Salvelinus namaycush) and a regime experienced by Marquettestrain lake trout. Modeling results indicated that seasonal blood consumption under the Seneca regime was very similar to that under the Marquette regime. Simulated mortality of lake trout directly due to blood removal by sea lampreys occurred at nearly twice the rate during August and September under the Marquette regime than under the Seneca regime. However, cumulative sea lamprey-induced mortality on lake trout over the entire duration of the sea lamprey's parasitic phase was only 7% higher for the Marquette regime compared with the Seneca regime. Thus, these modeling results indicated that the strain composition of the host (lake trout) population was not important in determining total number of lake trout deaths or total blood consumption attributable to the sea lamprey population, given the sea lamprey growth pattern. Regardless of water temperature regime, both blood consumption rate by sea lampreys and rate of sea lamprey-induced mortality on lake trout peaked in late October. Elevated blood consumption in late October appeared to be unrelated to changes in water temperature. The IBM approach should prove useful in optimizing control of sea lampreys in the Laurentian Great Lakes.

  11. Corresponding long-term shifts in stream temperature and invasive fish migration

    Science.gov (United States)

    McCann, Erin L.; Johnson, Nicholas; Pangle, Kevin

    2018-01-01

    By investigating historic trapping records of invasive sea lamprey (Petromyzon marinus) throughout tributaries to the Laurentian Great Lakes, we found that upstream spawning migration timing was highly correlated with stream temperatures over large spatial and temporal scales. Furthermore, several streams in our study exceeded a critical spring thermal threshold (i.e., 15°C) and experienced peak spawning migration up to 30 days earlier since the 1980s, whereas others were relatively unchanged. Streams exhibiting warming trends and earlier migration were spatially clustered and generally found on the leeward side of the Great Lakes where the lakes most affect local climate. These findings highlight that all streams are not equally impacted by climate change and represent, to our knowledge, the first observation linking long-term changes in stream temperatures to shifts in migration timing of an invasive fish. Earlier sea lamprey migration in Great Lakes tributaries may improve young of the year growth and survival, but not limit their spatial distribution, making sea lamprey control more challenging.

  12. Investigations of novel unsaturated bile salts of male sea lamprey as potential chemical cues

    Science.gov (United States)

    Johnson, Nicholas S.; Yun, Sang-Seon; Li, Weiming

    2014-01-01

    Sulfated bile salts function as chemical cues that coordinate reproduction in sea lamprey, Petromyzon marinus. 7α, 12α, 24-trihydroxy-5α-cholan-3-one 24-sulfate (3kPZS) is the most abundant known bile salt released by sexually mature male sea lampreys and attracts ovulated females. However, previous studies showed that the male-produced pheromone consists of unidentified components in addition to 3kPZS. Here, analysis of water conditioned with mature male sea lampreys indicated the presence of 4 oxidized, unsaturated compounds with molecular weights of 466 Da, 468 Da, and 2 of 470 Da. These compounds were not detectable in water conditioned with immature male sea lampreys. By using mass spectrometry, 4 A-ring unsaturated sulfated bile salts were tentatively identified from male washings as 2 4-ene, a 1-ene, and a 1,4-diene analogs. These were synthesized to determine if they attracted ovulated female sea lampreys to spawning nests in natural streams. One of the novel synthetic bile salts, 3 keto-1-ene PZS, attracted ovulated females to the point of application at a concentration of 10-12 M. This study reveals the structural diversity of bile salts in sea lamprey, some of which have been demonstrated to be pheromonal cues.

  13. Galen. On my own books

    Directory of Open Access Journals (Sweden)

    Irina Prolygina

    2017-07-01

    Full Text Available In the treatise On my own books (De libris propriis Galen explains why there have been circulating many forgeries, entitled by his name, in the book market of Roman Empire, and gives a list of his authentic works with a short description of each of them. In his notes to his books Galen discusses the content of each book, and describes historical circumstances of its appearance, specificity of its genre and its addressee. This work contains a unique historical information on Galen’s childhood, on the two periods of his life in Rome, on the fire which took place in the Temple of Peace in Rome in 192 A.D., on the plague which burst out during the reign of Antonius Pius, and on the agonistic nature of the medical profession in Rome in the 2nd–3rd cent. C.E. Moreover this work is an important source for the history of ancient philosophy and medicine, because Galen mentions the titles and even summaries of many lost works of his own as well as of his famous predecessors and contemporaries — philosophers and physicians. In particular, he mentions two great anatomists of antiquity — Marinus and Likus. The treatise «On my own books» is one of the most frequently cited works of Galen and may serve as an introduction to his thought. The first Russian translation of this work is provided with a short introduction and detailed commentary.

  14. Effects of coded-wire-tagging on stream-dwelling Sea Lamprey larvae

    Science.gov (United States)

    Johnson, Nicholas; Swink, William D.; Dawson, Heather A.; Jones, Michael L.

    2016-01-01

    The effects of coded wire tagging Sea Lamprey Petromyzon marinus larvae from a known-aged stream-dwelling population were assessed. Tagged larvae were significantly shorter on average than untagged larvae from 3 to 18 months after tagging. However, 30 months after tagging, the length distribution of tagged and untagged larvae did not differ and tagged Sea Lampreys were in better condition (i.e., higher condition factor) and more likely to have undergone metamorphosis than the untagged population. The reason why tagged larvae were more likely to metamorphose is not clear, but the increased likelihood of metamorphosis could have been a compensatory response to the period of slower growth after tagging. Slower growth after tagging was consistent across larval size-classes, so handling and displacement from quality habitat during the early part of the growing season was likely the cause rather than the tag burden. The tag effects observed in this study, if caused by displacement and handling, may be minimized in future studies if tagging is conducted during autumn after growth has concluded for the year.

  15. Crystalline ligand transitions in lamprey hemoglobin. Structural evidence for the regulation of oxygen affinity.

    Science.gov (United States)

    Heaslet, H A; Royer, W E

    2001-07-13

    The hemoglobins of the Sea Lamprey (Petromyzon marinus) exist in an equilibrium between low affinity oligomers, stabilized by proton binding, and higher affinity monomers, stabilized by oxygen binding. Recent crystallographic analysis revealed that dimerization is coupled with key changes at the ligand binding site with the distal histidine sterically restricting ligand binding in the deoxy dimer but with no significant structural rearrangements on the proximal side. These structural insights led to the hypothesis that oxygen affinity of lamprey hemoglobin is distally regulated. Here we present the 2.9-A crystal structure of deoxygenated lamprey hemoglobin in an orthorhombic crystal form along with the structure of these crystals exposed to carbon monoxide. The hexameric assemblage in this crystal form is very similar to those observed in the previous deoxy structure. Whereas the hydrogen bonding network and packing contacts formed in the dimeric interface of lamprey hemoglobin are largely unaffected by ligand binding, the binding of carbon monoxide induces the distal histidine to swing to positions that would preclude the formation of a stabilizing hydrogen bond with the bound ligand. These results suggest a dual role for the distal histidine and strongly support the hypothesis that ligand affinity in lamprey hemoglobin is distally regulated.

  16. Electrical guidance efficiency of downstream-migrating juvenile Sea Lamprey decreases with increasing water velocity

    Science.gov (United States)

    Miehls, Scott M.; Johnson, Nicholas; Haro, Alexander

    2017-01-01

    We tested the efficacy of a vertically oriented field of pulsed direct current (VEPDC) created by an array of vertical electrodes for guiding downstream-moving juvenile Sea Lampreys Petromyzon marinus to a bypass channel in an artificial flume at water velocities of 10–50 cm/s. Sea Lampreys were more likely to be captured in the bypass channel than in other sections of the flume regardless of electric field status (on or off) or water velocity. Additionally, Sea Lampreys were more likely to be captured in the bypass channel when the VEPDC was active; however, an interaction between the effects of VEPDC and water velocity was observed, as the likelihood of capture decreased with increases in water velocity. The distribution of Sea Lampreys shifted from right to left across the width of the flume toward the bypass channel when the VEPDC was active at water velocities less than 25 cm/s. The VEPDC appeared to have no effect on Sea Lamprey distribution in the flume at water velocities greater than 25 cm/s. We also conducted separate tests to determine the threshold at which Sea Lampreys would become paralyzed. Individuals were paralyzed at a mean power density of 37.0 µW/cm3. Future research should investigate the ability of juvenile Sea Lampreys to detect electric fields and their specific behavioral responses to electric field characteristics so as to optimize the use of this technology as a nonphysical guidance tool across variable water velocities.

  17. Characteristics physicist-chemistries of honeys produced in combs different of the age / Características físico-químicas de méis produzidos em favos de diferentes idades

    Directory of Open Access Journals (Sweden)

    Alisson Becker Pacheco

    2010-09-01

    Full Text Available Honey color is a characteristic related to the flower source and plays a major role on consumers buying preference. When finished, honey is placed in wax honeycombs that are composed mainly by hydrocarbons, esters and a small percentage of fatty acids and alcohols that give to wax the plasticity and ability to absorb several kinds of elements. The consecutive comb reutilization might transfer pigments to honey that, in turn, can alter honey final characteristics. In the present study the objective was to evaluate the influence of comb reutilization on honey physico-chemical and color characteristics. The experiment was carried out using randomized blocks with four treatments and six repetitions. Each hive was considered a block. The treatments consisted of boxes with sheet of alveolated wax and honeycomb with one, two or three years of usage, totaling 24 boxes. Honey samples were analyzed by diffuse reflectance spectrophotometry and the physico-chemical properties were analyzed by laboratory standard tests. The diffuse reflectance, total sugar, pH, acidity and ash did not varied significantly among treatments (p > 0.05. Honey color produced in honeycomb with different years of use was similar amongst treatment; however, the honey produced in sheets of alveolated wax had clearer color and less sugar content. A cor do mel é uma característica relacionada à fonte floral e que mais interfere na preferência de compra do consumidor. Ao ser elaborado, o mel é depositado em favos de cera, a qual é composta de hidrocarbonetos, ésteres e uma pequena percentagem de ácidos graxos e alcoóis, que propiciam a cera a plasticidade e a capacidade de absorver diversos elementos. A reutilização consecutiva de favos pode transferir pigmentos ao mel, alterando as características do produto final. O presente estudo teve por objetivo avaliar a influência da reutilização de favos da melgueira sobre a coloração e as variáveis físico-químicas do mel. O

  18. Paracoccidioidomicose: estudo radiológico e pulmonar de 58 casos Pulmonary and radiological studies in 58 paracoccidioidomycosis patients

    Directory of Open Access Journals (Sweden)

    E.P. Campos

    1991-08-01

    in 18 patients. The pulmonary function revealed: normal spyrographic findings in 17, pure obstructive type in 32 and mixed form in 9 of them. Hyperventilation was described in 54 individues and all of them showed an increasing of the alveole-arterial difference. Pa02 less than 80 mm/Hg observed in 36 of them. Statistical analysis demonstrated significative association between clinical evolution and radiological interpretation. Similar data were obtained in radiology evaluations, clinical evolutive studies and pulmonary functions described in these patients. The granulomatous reaction due to Paracoccidioidomycosis, in heavy smokers patients, gave origin to the alterations in small airways predisposing the interalveolar dissemination an impaired alveole-arterial diffusion.

  19. Effect of mangosteen peel extract combined with demineralized freezed-dried bovine bone xenograft on osteoblast and osteoclast formation in post tooth extraction socket

    Directory of Open Access Journals (Sweden)

    Utari Kresnoadi

    2016-12-01

    Full Text Available Background: Tooth extraction, a common procedure in dentistry, can cause bone resorption during socket healing. Therefore, it is important to perform socket preservation procedure to maintain alveolar bone. Providing a combination of mangosteen peel extract with demineralized freezed-dried bovine bone xenograft (DFDBBX in tooth extraction socket was expected to accelerate alveol bone formation. Purpose: This study aims to determine the effect of mangosteen peel extract combined with DFDBBX introduced into the socket of post tooth extraction on the formation of osteoblasts and osteoclasts. Method: Twenty-eight (28 Cavia cobayas were divided into four groups. Extraction to the lower left incisor of Cavia cobaya was performed. The extraction socket was filled with 25 gram of PEG (group I as a control, active materials consisted of mangosteen peel extract and DFDBBX 0.5% (group II, active materials consisted of mangosteen peel extract and DFDBBX 1% (group III, and active materials consisted of mangosteen peel extract and DFDBBX 2% (group IV. After thirty days, those Cavia cobayas were sacrificed. By using HE on Histopatological examination, the number of osteoblasts and osteoclasts were measured by light microscope with 400 times of magnification. The statistical analysis was then performed using oneway Anova & TukeyHSD test. Result: The component active materials consisted of mangosteen peel extract and DFDBBX 2% had the most significant results related to the formation of osteoblasts and osteoclasts. Conclusion: Mangosteen peel extract combined with DFDBBX can increase osteoblasts and decrease osteoclasts in the socket of tooth extraction in Cavia cobaya. The combination of mangosteen peel extract and DFDBBX 2% is the most effective material in increasing osteoblast and decreasing osteoclast.

  20. Advice of the French institute of radiation protection and nuclear safety about the 'Clay 2005' file

    International Nuclear Information System (INIS)

    2005-01-01

    The French institute of radiation protection and nuclear safety (IRSN) presents in this document its evaluation of the 'Clay 2005' file made by the ANDRA and which aims at demonstrating the feasibility of a disposal facility for high level and long living rad-wastes in the argillite formation of the Bure site. The critical points of the safety have been considered more thoroughly, together with the uncertainties concerning some important data and phenomena in relation with the confining properties of such a disposal facility. The basic geologic data gathered by the ANDRA about the Callovo-Oxfordian clay formation of the Bure site are sufficient to confirm the favorable intrinsic properties of this formation with respect to the confinement of wastes. The main possible disturbances of internal and external origin (thermal, hydrological, mechanical, chemical, climatic change, earthquakes, erosion..) would have no redhibitory impact on the overall confining capacity of the facility. The design safety principles retained for the exploitation of the facility and the post-closure safety aspects are globally satisfactory. Therefore, the IRSN considers the disposal of rad-wastes in the Callovo-Oxfordian argilite formation as feasible but in the case of a continuation of this project, several complementary informations would have to be supplied in particular concerning: the possible fracturing of the host and surrounding formations, the possibility of localized inhomogeneous fluid flows inside the surrounding formations, the improvement of our knowledge about the changes of the mechanical, physical and chemical properties of the site rocks and of concretes with time, the dimensioning of the metallic components of the facility (shafts, containers..), and the efficiency of the ventilation system with respect to the explosion risks inside B-type waste alveoles. (J.S.)

  1. Efficacy of immunosoppressive therapy and steroid sparing effect in interstitial lung disease associated to antisynthetase syndrome

    Directory of Open Access Journals (Sweden)

    G. De Marchi

    2011-09-01

    Full Text Available Objective: To evaluate the role of bronchoalveolar lavage (BAL in patients with interstitial lung disease associated to antisynthetase syndrome. Methods: We describe 5 patients, anti-Jo1 positive, with interstitial lung disease (lung fibrosis and/or diffusion capacity of CO <80%. Patients were monitored with lung function tests every 6 months, with high-resolution computed tomography (HRCT every 12 months, and with bronchoalveolar lavage (BAL at baseline and in the subsequent follow-up. Patients were treated as follows: a azathioprine with colchicine, or cyclosporine alone b cyclophosphamide when high neutrophil or eosinophil count on BAL was observed. Only low-dose steroids were used for mild muscular or articular involvement. Results: Pulmonary involvement remained stable in all patients at months +24. Lung function remained unchanged compared to the baseline evaluation; HRCT was stable in patients with fibrosis and no progression into fibrosis was observed in patients with ground glass areas at baseline. Bacterial pneumonia occurred in one patient treated with cyclophosphamide and resolved after antibiotic therapy. Conclusions: Clinical manifestations, instrumental tests and BAL may be of value to choice the best immunosuppressive therapy in the single case. An early less aggressive approach (azathioprine with colchicine, or cyclosporine alone may be useful. BAL could be performed when a progression of the lung involvement is demonstrated in the subsequent follow-up. Cyclophosphamide may be a valid alternative treatment in the presence of a neutrophilic or eosinophilic alveolitis. Efficacy and safety of the aforementioned immunosuppressive approach were observed in our series, avoiding prolonged high-dose steroid administration.

  2. Evaluating the Ribosomal Internal Transcribed Spacer (ITS) as a Candidate Dinoflagellate Barcode Marker

    Science.gov (United States)

    Stern, Rowena F.; Andersen, Robert A.; Jameson, Ian; Küpper, Frithjof C.; Coffroth, Mary-Alice; Vaulot, Daniel; Le Gall, Florence; Véron, Benoît; Brand, Jerry J.; Skelton, Hayley; Kasai, Fumai; Lilly, Emily L.; Keeling, Patrick J.

    2012-01-01

    Background DNA barcoding offers an efficient way to determine species identification and to measure biodiversity. For dinoflagellates, an ancient alveolate group of about 2000 described extant species, DNA barcoding studies have revealed large amounts of unrecognized species diversity, most of which is not represented in culture collections. To date, two mitochondrial gene markers, Cytochrome Oxidase I (COI) and Cytochrome b oxidase (COB), have been used to assess DNA barcoding in dinoflagellates, and both failed to amplify all taxa and suffered from low resolution. Nevertheless, both genes yielded many examples of morphospecies showing cryptic speciation and morphologically distinct named species being genetically similar, highlighting the need for a common marker. For example, a large number of cultured Symbiodinium strains have neither taxonomic identification, nor a common measure of diversity that can be used to compare this genus to other dinoflagellates. Methodology/Principal Findings The purpose of this study was to evaluate the Internal Transcribed Spacer units 1 and 2 (ITS) of the rDNA operon, as a high resolution marker for distinguishing species dinoflagellates in culture. In our study, from 78 different species, the ITS barcode clearly differentiated species from genera and could identify 96% of strains to a known species or sub-genus grouping. 8.3% showed evidence of being cryptic species. A quarter of strains identified had no previous species identification. The greatest levels of hidden biodiversity came from Scrippsiella and the Pfiesteriaceae family, whilst Heterocapsa strains showed a high level of mismatch to their given species name. Conclusions/Significance The ITS marker was successful in confirming species, revealing hidden diversity in culture collections. This marker, however, may have limited use for environmental barcoding due to paralogues, the potential for unidentifiable chimaeras and priming across taxa. In these cases ITS would

  3. Marine bacterial, archaeal and protistan association networks reveal ecological linkages.

    Science.gov (United States)

    Steele, Joshua A; Countway, Peter D; Xia, Li; Vigil, Patrick D; Beman, J Michael; Kim, Diane Y; Chow, Cheryl-Emiliane T; Sachdeva, Rohan; Jones, Adriane C; Schwalbach, Michael S; Rose, Julie M; Hewson, Ian; Patel, Anand; Sun, Fengzhu; Caron, David A; Fuhrman, Jed A

    2011-09-01

    Microbes have central roles in ocean food webs and global biogeochemical processes, yet specific ecological relationships among these taxa are largely unknown. This is in part due to the dilute, microscopic nature of the planktonic microbial community, which prevents direct observation of their interactions. Here, we use a holistic (that is, microbial system-wide) approach to investigate time-dependent variations among taxa from all three domains of life in a marine microbial community. We investigated the community composition of bacteria, archaea and protists through cultivation-independent methods, along with total bacterial and viral abundance, and physico-chemical observations. Samples and observations were collected monthly over 3 years at a well-described ocean time-series site of southern California. To find associations among these organisms, we calculated time-dependent rank correlations (that is, local similarity correlations) among relative abundances of bacteria, archaea, protists, total abundance of bacteria and viruses and physico-chemical parameters. We used a network generated from these statistical correlations to visualize and identify time-dependent associations among ecologically important taxa, for example, the SAR11 cluster, stramenopiles, alveolates, cyanobacteria and ammonia-oxidizing archaea. Negative correlations, perhaps suggesting competition or predation, were also common. The analysis revealed a progression of microbial communities through time, and also a group of unknown eukaryotes that were highly correlated with dinoflagellates, indicating possible symbioses or parasitism. Possible 'keystone' species were evident. The network has statistical features similar to previously described ecological networks, and in network parlance has non-random, small world properties (that is, highly interconnected nodes). This approach provides new insights into the natural history of microbes.

  4. Assessment of marine and urban-industrial environments influence on built heritage sandstone using X-ray fluorescence spectroscopy and complementary techniques

    Science.gov (United States)

    Morillas, Héctor; García-Galan, Javier; Maguregui, Maite; Marcaida, Iker; García-Florentino, Cristina; Carrero, Jose Antonio; Madariaga, Juan Manuel

    2016-09-01

    The sandstone used in the construction of the tower of La Galea Fortress (Getxo, north of Spain) shows a very bad conservation state and a high percentage of sandstone has been lost. The fortress is located just on a cliff and close to the sea, and it experiments the direct influence of marine aerosol and also the impact of acid gases (SOx and NOx) coming from the surrounding industry and maritime traffic. This environment seems to be very harmful for the preservation of the sandstone used in it, promoting different pathologies (disintegration, alveolization, cracking or erosion blistering, salts crystallization on the pores, efflorescences etc.). In this work, a multianalytical methodology based on a preliminary in-situ screening of the affected sandstone using a handheld energy dispersive X-ray fluorescence spectrometer (HH-ED-XRF) and a subsequent characterization of extracted sample in the laboratory using elemental (μ-ED-XRF, Scanning Electron Microscope coupled to an X-Max Energy-Dispersive (SEM-EDS) and Inductively coupled plasma mass spectrometry (ICP-MS)) and molecular techniques (micro-Raman spectroscopy (μ-RS) and X-ray Diffraction (XRD)) was applied in order to characterize the original composition of this kind of stone and related deterioration products. With the whole methodology, it was possible to assess that the sandstone contain a notable percentage of calcite. The sulfation and nitration of this carbonate detected in the stone led to the dissolution process of the sandstone, promoting the observed material loss. Additionally, the presence of salts related with the influence of marine aerosol confirms that this kind of environment have influence on the conservation state of the sandstone building.

  5. The diagnostic value of the bronchoalveolar lavage in interstitial lung diseases.

    Science.gov (United States)

    Efared, Boubacar; Ebang-Atsame, G; Rabiou, Sani; Diarra, Abdoulsalam S; Tahiri, Layla; Hammas, Nawal; Smahi, Mohamed; Amara, Bouchra; Benjelloun, Mohamed C; Serraj, Mounia; Chbani, Laila; El Fatemi, Hinde

    2017-03-01

    Bronchoalveolar lavage (BAL) is a diagnostic tool often used during the management of interstitial lung diseases (ILD). However, its diagnostic value in discrimination between entities comprising the very heterogenous group of ILD, is still a controversial issue. The objective of our study is to assess the diagnostic value of BAL in the management of ILD, by comparing the cytological findings in BAL fluid among the different diseases of this group. It was a retrospective, observational study of 151 patients between January 2012 and December 2015. BAL fluid cytology was performed to analyse the distribution of leucocytes population subsets in patients with ILD. The mean age was 52.78 years; 74.83% were women. The analysis of the following main groups of diseases was performed : sarcoïdosis (n = 30), idiopathic pulmonary fibrosis (IPF; n = 22), other idiopathic interstitial pneumonia (non specific interstitial pneumonia, cryptogenic organising pneumonia and respiratory bronchiolitis interstitial lung disease; n = 20) and connective tissue disease (n = 14). Overall, out of 141 patients, 22% had sarcoïdosis, 15.6% had idiopathic pulmonary fibrosis (IPF), 14.18% had other idiopathic interstitial pneumonia (IIP) and 9.9% had connective tissue disease (CTD). Mixed alveolitis was common in the 4 groups, sarcoïdosis had higher proportion of lymphocytes and IPF had higher neutrophils count. However, there was no significant statistical difference of BAL cellular count among these diseases (p > 0.05). Also, the prevalence of studied diseases did not change with variation of BAL cellular count (p > 0.05). Alone, the BAL cytological analysis has a limited value to provide substantial information that could lead to discriminate between diseases that form ILD. Thus, it must be always associated with other diagnostic methods.

  6. Mashhad University of Medical Sciences

    Directory of Open Access Journals (Sweden)

    Ali Shoeibi

    2013-03-01

    Full Text Available     Human T-cell lymphotropic virus (HTLV types 1 and 2 belong to the Oncorna group of retroviridae, a large family of viruses, grouped initially by pathogenic features, but later revised on the basis of genome structure and nucleotide sequence. HTLV-I was the first discovered human retrovirus to be associated with a malignancy in 1980. The malignancy, first described by Uchiyama and co-workers in southwestern Japan, was named Adult T-cell Leukemia/Lymphoma (ATL and characterized with cutaneous and respiratory involvement, hepatosplenomegaly, lymphadenopathy and various metabolic abnormalities such as hypercalcemia. The HTLV-I has been known to be endemic to certain parts of Iran like the province of Khorasan in the northeast since 1990, with a 2.3% prevalence rate of infection. The main manifestations of HTLV-I infection are neurologic and hematologic (such as ATL disorders, but it has also other manifestations such as uveitis, arthritis, dermatitis, vitiligo and lymphocytic alveolitis. Its main neurologic manifestation is a chronic progressive myelopathy that is referred to HTLV-I Associated Myelopathy (HAM in Japan and Tropical Spastic Paraparesis (TSP in Caribbean. But other disorders such as peripheral neuropathy, polyradiculoneuropathy, myopathy, peripheral facial paresis, and so on have been reported too. In this review we wish to give some brief information on the different aspects (including epidemiology, pathogenesis and pathology, clinical findings, and treatment of HTLV-I infection according to our twenty-year researches. The department of neurology of Mashhad University of Medical Sciences has been a pioneer in researches on HTLV-I in the last twenty years.  

  7. Organ burden and pulmonary toxicity of nano-sized copper (II) oxide particles after short-term inhalation exposure.

    Science.gov (United States)

    Gosens, Ilse; Cassee, Flemming R; Zanella, Michela; Manodori, Laura; Brunelli, Andrea; Costa, Anna Luisa; Bokkers, Bas G H; de Jong, Wim H; Brown, David; Hristozov, Danail; Stone, Vicki

    2016-10-01

    Increased use of nanomaterials has raised concerns about the potential for undesirable human health and environmental effects. Releases into the air may occur and, therefore, the inhalation route is of specific interest. Here we tested copper oxide nanoparticles (CuO NPs) after repeated inhalation as hazard data for this material and exposure route is currently lacking for risk assessment. Rats were exposed nose-only to a single exposure concentration and by varying the exposure time, different dose levels were obtained (C × T protocol). The dose is expressed as 6 h-concentration equivalents of 0, 0.6, 2.4, 3.3, 6.3, and 13.2 mg/m(3) CuO NPs, with a primary particle size of 10 9.2-14 nm and an MMAD of 1.5 μm. Twenty-four hours after a 5-d exposure, dose-dependent lung inflammation and cytotoxicity were observed. Histopathological examinations indicated alveolitis, bronchiolitis, vacuolation of the respiratory epithelium, and emphysema in the lung starting at 2.4 mg/m(3). After a recovery period of 22 d, limited inflammation was still observed, but only at the highest dose of 13.2 mg/m(3). The olfactory epithelium in the nose degenerated 24 h after exposure to 6.3 and 13.2 mg/m(3), but this was restored after 22 d. No histopathological changes were detected in the brain, olfactory bulb, spleen, kidney and liver. A 5-d, 6-h/day exposure equivalent to an aerosol of agglomerated CuO NPs resulted in a dose-dependent toxicity in rats, which almost completely resolved during a 3-week post-exposure period.

  8. Does laterally rotated flap design influence the short-term periodontal status of second molars and postoperative discomfort after partially impacted third molar surgery?

    Science.gov (United States)

    Korkmaz, Yavuz Tolga; Mollaoglu, Nur; Ozmeriç, Nurdan

    2015-06-01

    To assess the influence of the surgical removal of partially impacted third molars (3Ms) and compare the effects of a 3-cornered laterally rotated flap (LRF) with primary closure (flap 1) and an envelope flap with secondary closure (flap 2) on the short-term periodontal status of the adjacent second molars (2Ms). We also assessed the postoperative complications after removal of the partially impacted 3M. A split mouth, randomized clinical study was designed. The study sample included patients with bilateral partially impacted 3Ms. The primary predictor variable was the type of flap design (flaps 1 and 2). The primary outcome variable was periodontal status (gingival recession [GR], probing depth [PD], plaque index [PI], and gingival index) of the 2Ms measured preoperatively and 90 days postoperatively. The secondary outcome variables were postoperative complications, including pain, facial swelling, alveolitis, and local wound infection. The other variables included gender, position of the 3Ms, and surgical difficulty. We performed descriptive, comparative, correlation, and multivariate analyses. The sample included 28 patients aged 18 to 28 years. The GR, PD, and PI values with the flap 2 design were greater than those with the flap 1 design (P surgery considerably influences the early periodontal health of the 2Ms and postoperative discomfort. However, although the 3-cornered LRF design might cause more pain and swelling, it could be the method of choice for partially impacted 3M surgery because of the early periodontal healing. Copyright © 2015 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.

  9. A quantitative TaqMan PCR assay for the detection of Ureaplasma diversum.

    Science.gov (United States)

    Marques, Lucas M; Amorim, Aline T; Martins, Hellen Braga; Rezende, Izadora Souza; Barbosa, Maysa Santos; Lobão, Tassia Neves; Campos, Guilherme B; Timenetsky, Jorge

    2013-12-27

    Ureaplasma diversum in veterinary studies is an undesirable microbe, which may cause infection in bulls and may result in seminal vesiculitis, balanopostitis, and alterations in spermatozoids, whereas in cows, it may cause placentitis, fetal alveolitis, abortion, and birth of weak calves. U. diversum is released through organic secretions, especially semen, preputial and vaginal mucus, conjunctival secretion, and milk. The aim of the present study was to develop a TaqMan probe, highly sensitive and specific quantitative PCR (qPCR) assay for the detection and quantification of U. diversum from genital swabs of bovines. Primers and probes specific to U. diversum 16S rRNA gene were designed. The specificity, detection limit, intra- and inter-assay variability of qPCR to detect this ureaplasma was compared with the results of the conventional PCR assay (cPCR). Swabs of vaginal mucus from 169 cows were tested. The qPCR assay detected as few as 10 copies of U. diversum and was 100-fold more sensitive than the cPCR. No cross-reactivity with other Mollicutes or eubacteria was observed. U. diversum was detected in 79 swabs (46.42%) by qPCR, while using cPCR it was detected in 42 (25%) samples. The difference in cPCR and qPCR ureaplasma detection between healthy and sick animals was not statistically significant. But the U. diversum load in samples from animals with genital disorders was higher than in healthy animals. The qPCR assay developed herein is highly sensitive and specific for the detection and quantification of U. diversum in vaginal bovine samples. Copyright © 2013. Published by Elsevier B.V.

  10. Particle-size dependent effects in the Balb/c murine model of inhalational melioidosis

    Directory of Open Access Journals (Sweden)

    Richard eThomas

    2012-07-01

    Full Text Available Deposition of Burkholderia pseudomallei within either the lungs or nasal passages of the Balb/c murine model resulted in different infection kinetics. The infection resulting from the inhalation of B. pseudomallei within a 12 um particle aerosol was prolonged compared to a 1 um particle aerosol with a mean time-to-death (MTD of 73.8 ± 11.3 h and 174.7 ± 14.9 h respectively. Inhalation of B. pseudomallei within 1 um or 12 um particle aerosols resulted in a median lethal dose (MLD of 4 and 12 cfu respectively. The 12 mm particle inhalational infection was characterised by involvement of the respiratory epithelium and inflammation of the neurological path leading from the olfactory epithelium to the olfactory bulb (100%, culminating in abscessation of the brain (33%. Initial involvement of the upper respiratory tract lymphoid tissues (nasal-associated lymphoid tissue and cervical lymph nodes was observed in both the 1 and 12 um particle inhalational infections (80-85%. Necrotising alveolitis and bronchiolitis were evident in both inhalational infections however lung pathology was greater after inhalation of the 1 mm particle aerosol with pronounced involvement of the mediastinal lymph node (50%. Terminal disease was characterised by bacteraemia in both inhalational infections with dissemination to the spleen, liver, kidneys and thymus. Treatment with co-trimoxazole was more effective than treatment with doxycycline irrespective of the size of the particles inhaled. Doxycycline was more effective against the 12 um particle inhalational infection as evidenced by increased time to death. However, both treatment regimes exhibited significant relapse when therapy was discontinued with massive enlargement and abscessation of the lungs, spleen and cervical lymph nodes observed.

  11. Host Specificity for Bacterial, Archaeal and Fungal Communities Determined for High- and Low-Microbial Abundance Sponge Species in Two Genera

    Directory of Open Access Journals (Sweden)

    Maryam Chaib De Mares

    2017-12-01

    Full Text Available Sponges are engaged in intimate symbioses with a diversity of microorganisms from all three domains of life, namely Bacteria, Archaea and Eukarya. Sponges have been well studied and categorized for their bacterial communities, some displaying a high microbial abundance (HMA, while others show low microbial abundance (LMA. However, the associated Archaea and Eukarya have remained relatively understudied. We assessed the bacterial, archaeal and eukaryotic diversities in the LMA sponge species Dysidea avara and Dysidea etheria by deep amplicon sequencing, and compared the results to those in the HMA sponges Aplysina aerophoba and Aplysina cauliformis. D. avara and A. aerophoba are sympatric in the Mediterranean Sea, while D. etheria and A. cauliformis are sympatric in the Caribbean Sea. The bacterial communities followed a host-specific pattern, with host species identity explaining most of the variation among samples. We identified OTUs shared by the Aplysina species that support a more ancient association of these microbes, before the split of the two species studied here. These shared OTUs are suitable targets for future studies of the microbial traits that mediate interactions with their hosts. Even though the archaeal communities were not as rich as the bacterial ones, we found a remarkable diversification and specificity of OTUs of the family Cenarchaeaceae and the genus Nitrosopumilus in all four sponge species studied. Similarly, the differences in fungal communities were driven by sponge identity. The structures of the communities of small eukaryotes such as dinophytes and ciliophores (alveolates, and stramenopiles, could not be explained by either sponge host, sponge genus or geographic location. Our analyses suggest that the host specificity that was previously described for sponge bacterial communities also extends to the archaeal and fungal communities, but not to other microbial eukaryotes.

  12. Distribution and host diversity of Amoebophryidae parasites across oligotrophic waters of the Mediterranean Sea

    Science.gov (United States)

    Siano, R.; Alves-de-Souza, C.; Foulon, E.; Bendif, El M.; Simon, N.; Guillou, L.; Not, F.

    2011-02-01

    Sequences affiliated to Syndiniales (Marine alveolate, MALV) regularly dominate 18S rDNA genetic libraries of nearly all marine ecosystems investigated so far. Among them, Amoebophryidae (MALV group II) is composed of numerous and genetically distant environmental sequences, where Amoebophrya is the only known and formally described genus. Amoebophrya species include virulent pathogens for a wide range of dinoflagellate species. Beside their regular occurrence in marine ecosystems, their quantitative distribution and the environmental factors triggering host infection have barely been studied in open oligotrophic waters. In order to understand the functional role of these parasites in natural environments, we studied the distribution and contribution to the eukaryotic community of the small free-living stage of Amoebophryidae (the dinospores) along a transect in the Mediterranean Sea, as well as their host diversity at three oligotrophic stations. Dinospores were more abundant at a coastal station (max. 1.5 × 103 cells ml-1) than in oligotrophic waters (max. 51 ± 16.3 cells ml-1), where they represented 10.3 to 34.9% of the total eukaryotic community at 40 and 30 m depth, respectively and 21.2% on average along the water column. Positive correlation was found between dinospore occurrence and higher concentration of NO3 + NO2 at the coastal station. At selected stations, out of 38 different dinoflagellates taxa identified, 15 were infected, among which a majority were not recognized as Amoebophryidae host so far. Prevalences (percentage of infected cells) generally varied between 1% and 10%, with a notable exception for Blepharocysta paulsenii for which 25% of cells were infected at the most oligotrophic station. The present study shows that dinospores are able to thrive and infect dinoflagellates both in coastal and ultra-oligotrophic open waters. Our results emphasize the role of parasitism in microbial food web dynamics and ultimately on biogeochemical cycles.

  13. Chapter 19: Hypersensitivity pneumonitis.

    Science.gov (United States)

    Blatman, Karen Hsu; Grammer, Leslie C

    2012-01-01

    Hypersensitivity pneumonitis (HP), also referred to as extrinsic allergic alveolitis, is characterized by non-IgE-mediated inflammation of the parenchyma, alveoli, and terminal airways of the lung initiated by inhaled antigens in a susceptible host. Etiologic agents of HP are either organic high molecular weight compounds such as bacteria, fungi, amoebae, plant, and animal proteins or inorganic low molecular weight haptens such as isocyanate and drugs including amiodarone, nitrofurantoin, and minocycline. Six significant predictors have been identified that provide ∼95% diagnostic accuracy. These six predictors are (1) exposure to a known offending allergen, (2) positive precipitating antibodies to the offending antigen, (3) recurrent episodes of symptoms, (4) inspiratory crackles on lung auscultation, (5) symptoms occurring 4-8 hours after exposure, and (6) weight loss. HP is staged into acute, subacute, and chronic. In the acute stage after direct exposure to the antigen, there is fever, chills, nonproductive cough, dyspnea, malaise, and myalgias, all resembling influenza. However, if obtained, a chest radiograph shows nodular infiltrates, and pulmonary function testing is restrictive (unless the cause is avian in which obstruction or obstruction with restriction is present). In the chronic stage, fever and chills are absent, but weight loss can occur. The immunologic response includes activated macrophages and CD8(+) cytotoxic lymphocytes, and bronchoalveolar lavage fluid reveals marked lymphocytosis with a ratio of CD4(+) cells to CD8(+) cells <1. Activated macrophages have increased expression of CD80/CD86, and T cells have increased expression of its counter-ligand CD28, evidence for heightened antigen presentation.

  14. Novel lineage patterns from an automated water sampler to probe marine microbial biodiversity with ships of opportunity

    Science.gov (United States)

    Stern, Rowena F.; Picard, Kathryn T.; Hamilton, Kristina M.; Walne, Antony; Tarran, Glen A.; Mills, David; McQuatters-Gollop, Abigail; Edwards, Martin

    2015-09-01

    There is a paucity of data on long-term, spatially resolved changes in microbial diversity and biogeography in marine systems, and yet these organisms underpin fundamental ecological processes in the oceans affecting socio-economic values of the marine environment. We report results from a new autonomous Water and Microplankton Sampler (WaMS) that is carried within the Continuous Plankton Recorder (CPR). Whilst the CPR with its larger mesh size (270 μm), is designed to capture larger plankton, the WaMS was designed as an additional device to capture plankton below 50 μm and delicate larger species, often destroyed by net sampling methods. A 454 pyrosequencing and flow cytometric investigation of eukaryotic microbes using the partial 18S rDNA from thirteen WaMS samples collected over three months in the English Channel revealed a wide diversity of organisms. Alveolates, Fungi, and picoplanktonic Chlorophytes were the most common lineages captured despite the small sample volumes (200-250 ml). The survey also identified Cercozoa and MAST heterotrophic Stramenopiles, normally missed in microscopic-based plankton surveys. The most common was the likely parasitic LKM11 Rozellomycota lineage which comprised 43.2% of all reads and are rarely observed in marine pelagic surveys. An additional 9.5% of reads belonged to other parasitic lineages including marine Syndiniales and Ichthyosporea. Sample variation was considerable, indicating that microbial diversity is spatially or temporally patchy. Our study has shown that the WaMS sampling system is autonomous, versatile and robust, and due to its deployment on the established CPR network, is a cost-effective monitoring tool for microbial diversity for the detection of smaller and delicate taxa.

  15. The molecular diversity of freshwater picoeukaryotes reveals high occurrence of putative parasitoids in the plankton.

    Directory of Open Access Journals (Sweden)

    Emilie Lefèvre

    Full Text Available Eukaryotic microorganisms have been undersampled in biodiversity studies in freshwater environments. We present an original 18S rDNA survey of freshwater picoeukaryotes sampled during spring/summer 2005, complementing an earlier study conducted in autumn 2004 in Lake Pavin (France. These studies were designed to detect the small unidentified heterotrophic flagellates (HF, 0.6-5 microm which are considered the main bacterivores in aquatic systems. Alveolates, Fungi and Stramenopiles represented 65% of the total diversity and differed from the dominant groups known from microscopic studies. Fungi and Telonemia taxa were restricted to the oxic zone which displayed two fold more operational taxonomic units (OTUs than the oxycline. Temporal forcing also appeared as a driving force in the diversification within targeted organisms. Several sequences were not similar to those in databases and were considered as new or unsampled taxa, some of which may be typical of freshwater environments. Two taxa known from marine systems, the genera Telonema and Amoebophrya, were retrieved for the first time in our freshwater study. The analysis of potential trophic strategies displayed among the targeted HF highlighted the dominance of parasites and saprotrophs, and provided indications that these organisms have probably been wrongfully regarded as bacterivores in previous studies. A theoretical exercise based on a new 'parasite/saprotroph-dominated HF hypothesis' demonstrates that the inclusion of parasites and saprotrophs may increase the functional role of the microbial loop as a link for carbon flows in pelagic ecosystems. New interesting perspectives in aquatic microbial ecology are thus opened.

  16. Detection of Saccharopolyspora rectivirgula by quantitative real-time PCR.

    Science.gov (United States)

    Schäfer, Jenny; Kämpfer, Peter; Jäckel, Udo

    2011-07-01

    The thermophilic actinomycete species Saccharopolyspora rectivirgula has been associated with the exogen allergic alveolitis (EAA). EAA is caused by the inhalation of high amounts of airborne spores that can be found for example in environments of agricultural production, compost facilities, mushroom cultivation rooms, or rooms with technical air moistening. Because of the medical relevance of S. rectivirgula, a reliable detection system is needed. Therefore, a quantitative real-time polymerase chain reaction (qPCR) primer system was designed, targeting the 16S rRNA gene of the type strain S. rectivirgula DSM 43747(T) and six other S. rectivirgula reference strains. Our investigation showed that S. rectivirgula presumably own four operons of the 16S rRNA gene, which has to be considered for estimation of cell equivalents. Furthermore, the DNA recovery efficiency from these strains was tested in combination with bioaerosol or material sample as well as the influence of non-target DNA to the recovery rate. Results showed a recovery DNA efficiency of 7-55%. The recovery rate of DNA in a mixture with non-target DNA resulted in ∼87%. In summary, a high amplification efficiency using real-time PCR was found, for which estimated concentrations revealed cell numbers of 2.7 × 10(5) cells m(-3) in bioaerosol and 2.8 × 10(6) cells g(-1) fw(-1) in material samples from a duck house. The specificity of the new developed quantification system was shown by generation of two clone libraries from bioarosol samples, from a duck house, and from a composting plant. Totally, the results clearly show the specificity and practicability of the established qPCR assay for detection of S. rectivirgula.

  17. Efectividad de la homeopatía en el tratamiento de exodoncias traumáticas

    Directory of Open Access Journals (Sweden)

    Kenya Caridad Casanova Sales

    2014-11-01

    Full Text Available Se realizó un estudio de intervención en el período de enero hasta agosto del 2014, en el área de salud del Policlínico Docente “28 de Septiembre” de Vázquez, Puerto Padre, Las Tunas, para evaluar la efectividad de la homeopatía en el tratamiento de las exodoncias traumáticas. La muestra estuvo constituida por 48 pacientes, que en el proceso de la extracción dentaria presentaron complicaciones a causa de fractura del tabique interdentario, de las corticales, de las raíces, de la tuberosidad, comunicación bucosinusal y desgarro. Los pacientes fueron seleccionados por muestreo aleatorio simple y distribuidos en dos grupos: grupo I (estudio con 24 pacientes con complicaciones en el proceso de la exodoncia, a los que se les aplicó el remedio homeopático AlivioHo-trauma; y grupo II (control con 24 pacientes con complicaciones en el proceso de la exodoncia, a los que se les aplicó el tratamiento convencional. En ambos grupos se atendió previamente el área afectada, de acuerdo con la complicación. Se obtuvo que el tratamiento con el remedio homeopático AliviHo-trauma fue efectivo sobre los síntomas dolor e inflamación, al igual con referencia a la ausencia de alveolitis, de manera similar al grupo control. No se reportó ninguna reacción adversa

  18. Presence of multiple lesion types with vastly different microenvironments in C3HeB/FeJ mice following aerosol infection with Mycobacterium tuberculosis

    Directory of Open Access Journals (Sweden)

    Scott M. Irwin

    2015-06-01

    Full Text Available Cost-effective animal models that accurately reflect the pathological progression of pulmonary tuberculosis are needed to screen and evaluate novel tuberculosis drugs and drug regimens. Pulmonary disease in humans is characterized by a number of heterogeneous lesion types that reflect differences in cellular composition and organization, extent of encapsulation, and degree of caseous necrosis. C3HeB/FeJ mice have been increasingly used to model tuberculosis infection because they produce hypoxic, well-defined granulomas exhibiting caseous necrosis following aerosol infection with Mycobacterium tuberculosis. A comprehensive histopathological analysis revealed that C3HeB/FeJ mice develop three morphologically distinct lesion types in the lung that differ with respect to cellular composition, degree of immunopathology and control of bacterial replication. Mice displaying predominantly the fulminant necrotizing alveolitis lesion type had significantly higher pulmonary bacterial loads and displayed rapid and severe immunopathology characterized by increased mortality, highlighting the pathological role of an uncontrolled granulocytic response in the lung. Using a highly sensitive novel fluorescent acid-fast stain, we were able to visualize the spatial distribution and location of bacteria within each lesion type. Animal models that better reflect the heterogeneity of lesion types found in humans will permit more realistic modeling of drug penetration into solid caseous necrotic lesions and drug efficacy testing against metabolically distinct bacterial subpopulations. A more thorough understanding of the pathological progression of disease in C3HeB/FeJ mice could facilitate modulation of the immune response to produce the desired pathology, increasing the utility of this animal model.

  19. The domain architecture of large guanine nucleotide exchange factors for the small GTP-binding protein Arf

    Directory of Open Access Journals (Sweden)

    Geldner Niko

    2005-02-01

    Full Text Available Abstract Background Small G proteins, which are essential regulators of multiple cellular functions, are activated by guanine nucleotide exchange factors (GEFs that stimulate the exchange of the tightly bound GDP nucleotide by GTP. The catalytic domain responsible for nucleotide exchange is in general associated with non-catalytic domains that define the spatio-temporal conditions of activation. In the case of small G proteins of the Arf subfamily, which are major regulators of membrane trafficking, GEFs form a heterogeneous family whose only common characteristic is the well-characterized Sec7 catalytic domain. In contrast, the function of non-catalytic domains and how they regulate/cooperate with the catalytic domain is essentially unknown. Results Based on Sec7-containing sequences from fully-annotated eukaryotic genomes, including our annotation of these sequences from Paramecium, we have investigated the domain architecture of large ArfGEFs of the BIG and GBF subfamilies, which are involved in Golgi traffic. Multiple sequence alignments combined with the analysis of predicted secondary structures, non-structured regions and splicing patterns, identifies five novel non-catalytic structural domains which are common to both subfamilies, revealing that they share a conserved modular organization. We also report a novel ArfGEF subfamily with a domain organization so far unique to alveolates, which we name TBS (TBC-Sec7. Conclusion Our analysis unifies the BIG and GBF subfamilies into a higher order subfamily, which, together with their being the only subfamilies common to all eukaryotes, suggests that they descend from a common ancestor from which species-specific ArfGEFs have subsequently evolved. Our identification of a conserved modular architecture provides a background for future functional investigation of non-catalytic domains.

  20. Prospectively defined murine mesenchymal stem cells inhibit Klebsiella pneumoniae-induced acute lung injury and improve pneumonia survival.

    Science.gov (United States)

    Hackstein, Holger; Lippitsch, Anne; Krug, Philipp; Schevtschenko, Inna; Kranz, Sabine; Hecker, Matthias; Dietert, Kristina; Gruber, Achim D; Bein, Gregor; Brendel, Cornelia; Baal, Nelli

    2015-10-06

    Numerous studies have described the immunosuppressive capacity of mesenchymal stem cells (MSC) but these studies use mixtures of heterogeneous progenitor cells for in vitro expansion. Recently, multipotent MSC have been prospectively identified in murine bone marrow (BM) on the basis of PDFGRa(+) SCA1(+) CD45(-) TER119(-) (PαS) expression but the immunomodulatory capacity of these MSC is unknown. We isolated PαS MSC by high-purity FACS sorting of murine BM and after in vitro expansion we analyzed the in vivo immunomodulatory activity during acute pneumonia. PαS MSC (1 × 10(6)) were applied intratracheally 4 h after acute respiratory Klebsiella pneumoniae induced infection. PαS MSC treatment resulted in significantly reduced alveolitis and protein leakage in comparison to mock-treated controls. PαS MSC-treated mice exhibited significantly reduced alveolar TNF-α and IL-12p70 expression, while IL-10 expression was unaffected. Dissection of respiratory dendritic cell (DC) subsets by multiparameter flow cytometry revealed significantly reduced lung DC infiltration and significantly reduced CD86 costimulatory expression on lung CD103(+) DC in PαS MSC-treated mice. In the post-acute phase of pneumonia, PαS MSC-treated animals exhibited significantly reduced respiratory IL-17(+) CD4(+) T cells and IFN-γ(+) CD4(+) T cells. Moreover, PαS MSC treatment significantly improved overall pneumonia survival and did not increase bacterial load. In this study we demonstrated for the first time the feasibility and in vivo immunomodulatory capacity of prospectively defined MSC in pneumonia.

  1. The Glycoprofile Patterns of Endothelial Cells in Usual Interstitial Pneumonia

    Directory of Open Access Journals (Sweden)

    A Barkhordari

    2014-09-01

    Full Text Available [THIS ARTICLE HAS BEEN RETRACTED FOR DUPLICATE PUBLICATION] Background: The pathological classification of cryptogenic fibrosing alveolitis has been a matter of debate and controversy for histopathologists. Objective: To identify and specify the glycotypes of capillary endothelial cells in usual interstitial pneumonia (UIP compared to those found in normal tissue. Methods: Sections of formalin-fixed, paraffin-embedded blocks from 16 cases of UIP were studied by lectin histochemistry with a panel of 27 biotinylated lectins and an avidin-peroxidase revealing system. Results: High expression of several classes of glycan was seen de novo in capillary endothelial cells from patients with UIP including small complex and bi/tri-antennary bisected complex N-linked sequences bolund by Concanavalin A and erythro-phytohemagglutinin, respectively, GalNAca1 residues bound by Helix pomatia and Maclura pomifera agglutinins, and L-fucosylated derivatives of type II glycan chains recognized by Ulex europaeus agglutinin-I. Glycans bound by agglutinins from Lycopersicon esculentum (β1,4GlcNAc and Wisteria floribunda (GalNAc as well as GlcNAc oligomers bound by Phytolacca americana and succinylated Wheat Germ agglutinin were also seen in the capillary endothelial cells of UIP. In contrast, L-fucosylated derivatives of type I glycan chains were absent in cells from cases of UIP when Anguilla anguilla agglutinin was applied, unlike the situation in normal tissue. Conclusion: These results may indicate existence of two distinct populations of endothelial cell in UIP with markedly different patterns of glycosylation, reflecting a pattern of differentiation and angiogenesis, which is not detectable morphologically.

  2. Amelioration of bleomycin-induced pulmonary fibrosis in a mouse model by a combination therapy of bosentan and imatinib.

    Science.gov (United States)

    Chilakapati, Shanmuga Reddy; Serasanambati, Mamatha; Vissavajjhala, Prabhakar; Kanala, Jagadeeshwara Reddy; Chilakapati, Damodar Reddy

    2015-05-01

    Idiopathic pulmonary fibrosis (IPF) is characterized by alveolitis, progressing into fibrosis. Due to the involvement of both endothelin and platelet-derived growth factor signaling in IPF, combination effects of a bosentan and imatinib were studied in mouse model of bleomycin-induced pulmonary fibrosis. Mice subjected to bleomycin instillation (0.05 U) and were administered with either bosentan (100 mg/kg) and/or imatinib (50 mg/kg). Inflammatory cell count, total protein estimation in bronchoalveolar lavage fluid, lung edema, superoxide dismutase, catalase, myeloperoxidase activities, and Hematoxylin & Eosin staining were performed on day 7. Hydroxyproline content, α-smooth muscle actin (SMA), collagens I and III gene expression analysis, immunohistochemistry, matrix metalloproteinases-9 and -2 activities, trichrome and sirius red staining were performed on day 21. Combination treatment with bosentan and imatinib prevented bleomycin-induced mortality and loss of body weight more than the individual agents. On day 7, the combination therapy attenuated bleomycin-induced increase of total and differential inflammatory cell counts, total proteins, lung wet/dry weight ratio, myeloperoxidase activity, lung inflammatory cell infiltration more than individual agents alone. Bosentan but not imatinib ameliorated superoxide dismutase and catalase activities, which were lowered following bleomycin instillation. On day 21, combination therapy ameliorated bleomycin-induced increase of fibrosis score, collagen deposition, protein and gene expression of SMA, mRNA levels of collagens-I and -III, matrix metalloproteinase-9 and -2 activities more than monotherapy. Combination of bosentan and imatinib exerted more enhanced protection against bleomycin-induced inflammation and fibrosis than either of the agents alone.

  3. Protective Effect of Ginsenoside Rg1 on Bleomycin-Induced Pulmonary Fibrosis in Rats: Involvement of Caveolin-1 and TGF-β1 Signal Pathway.

    Science.gov (United States)

    Zhan, Heqin; Huang, Feng; Ma, Wenzhuo; Zhao, Zhenghang; Zhang, Haifang; Zhang, Chong

    2016-01-01

    Idiopathic pulmonary fibrosis (IPF) is a progressive disease with poor prognosis and high mortality rate. Panax Notoginseng Saponins (PNS), extracted from Panax Notoginseng as a traditional Asian medicine, displayed a significant anti-fibrosis effect in liver and lung. However, whether Ginsenoside Rg1 (Rg1), an important and active ingredient of PNS, exerts anti-fibrotic activity on IPF still remain unclear. In this study, we investigated the effect of Rg1 on bleomycin-induced pulmonary fibrosis in rats. Bleomycin (5 mg/kg body weight) was intratracheally administrated to male rats. Rg1 (18, 36 and 72 mg/kg) was orally administered on the next day after bleomycin. Lungs were harvested at day 7 and 28 for the further experiments. Histological analysis revealed that bleomycin successfully induced pulmonary fibrosis, and that Rg1 restored the histological alteration of bleomycin-induced pulmonary fibrosis (PF), significantly decreased lung coefficient, scores of alveolitis, scores of PF as well as contents of alpha smooth muscle actin (α-SMA) and hydroxyproline (Hyp) in a dose-dependent manner in PF rats. Moreover, Rg1 increased the expression levels of Caveolin-1 (Cav-1) mRNA and protein, lowered the expression of transforming growth factor-β1 (TGF-β1) mRNA and protein in the lung tissues of PF rats. These data suggest that Rg1 exhibits protective effect against bleomycin-induced PF in rats, which is potentially associated with the down-regulation of TGF-β1 and up-regulation of Cav-1.

  4. A selenocysteine derivative therapy affects radiation-induced pneumonitis in the mouse.

    Science.gov (United States)

    Kunwar, Amit; Jain, V K; Priyadarsini, K I; Haston, Christina K

    2013-10-01

    The mechanism leading to the radiation-induced lung response of pneumonitis is largely unknown. Here we investigated whether treatment with 3,3'-diselenodipropionic acid (DSePA), which reduces radiation-induced oxidative stress in acute response models, decreases the lung response to irradiation. Mice of the C3H/HeJ (alveolitis/pneumonitis-responding) strain received 18 Gy whole-thorax irradiation, and a subset of these mice was treated with DSePA (2 mg/kg) three times per week, beginning at 2 hours after radiation treatment, and continuing in the postirradiation period until death because of respiratory distress symptoms. DSePA treatment increased the postirradiation survival time of mice by an average of 32 days (P = 0.0002). Radiation-treated and DSePA-treated mice presented lower levels of lipid peroxidation and augmented glutathione peroxidase in the lungs, compared with those levels measured in mice receiving radiation only, when mice receiving radiation only were killed because of distress symptoms, whereas catalase and superoxide dismutase levels did not show consistent differences among treatment groups. DSePA treatment decreased pneumonitis and the numbers of mast cells, neutrophils, and lymphocytes in the lungs and bronchoalveolar lavage, respectively, of irradiated mice relative to mice exposed to radiation alone. DSePA treatment also decreased the radiation-induced increase in granulocyte colony-stimulating factor levels in the bronchoalveolar lavage and lung-tissue expression of intercellular adhesion molecule-1 and E-selectin, while increasing the expression of glutathione peroxidase-4. We conclude that DSePA treatment reduces radiation-induced pneumonitis in mice by delaying oxidative damage and the inflammatory cell influx.

  5. Granulocyte-colony stimulating factor levels in bronchoalveolar lavage fluid from patients with idiopathic pulmonary fibrosis

    Science.gov (United States)

    Ashitani, J.; Mukae, H.; Taniguchi, H.; Ihi, T.; Kadota, J.; Kohno, S.; Matsukura, S.

    1999-01-01

    BACKGROUND—Granulocyte-colony stimulating factor (G-CSF) is known as a potent neutrophil chemotactic glycoprotein in vitro but its contribution to chemotactic activity in neutrophil mediated lung diseases is not yet known. The aims of this study were to determine whether G-CSF is present in high concentrations in bronchoalveolar lavage (BAL) fluid of patients with idiopathic pulmonary fibrosis (IPF, also called cryptogenic fibrosing alveolitis), a neutrophil mediated lung disease, and to what extent G-CSF in BAL fluid contributes to neutrophil accumulation in the lung of patients with IPF.
METHODS—G-CSF concentrations in BAL fluid samples from 16 healthy volunteers, 24 patients with IPF, and 73 patients with non-IPF lung disease were measured by enzyme linked immunosorbent assay. The relationship between G-CSF concentrations and neutrophil count in BAL fluid was also examined. Neutrophil chemotactic activity (NCA) was measured in BAL fluid in healthy volunteers and patients with IPF. The contribution of G-CSF to overall NCA in lungs with IPF was assessed by repeating the measurement of NCA after a complete neutralisation of G-CSF bioactivity by anti-human G-CSF antiserum.
RESULTS—Detectable levels of G-CSF were found in BAL fluid of 83% of patients with IPF while the levels in all healthy volunteers were below the detection limit. In patients with IPF a significant correlation was observed between the BAL fluid neutrophil count and the concentration of G-CSF in the BAL fluid. The neutrophil count also correlated significantly with percentage forced vital capacity. In BAL fluid samples from patients with IPF the mean NCA value was reduced by 35% after neutralisation with an anti-human G-CSF antiserum.
CONCLUSIONS—G-CSF may be involved in enhancing neutrophil accumulation in the lungs of patients with IPF.

 PMID:10525561

  6. Clinical study of sarcoidosis with special reference to significance and diagnostic value of 201Tl scintigraphy and 99mTc perfusion lung scintigraphy

    International Nuclear Information System (INIS)

    Hirose, Yoshiki

    1987-01-01

    Both 201 Tl scintigraphy and 99m Tc-MAA perfusion lung scintigraphy were performed in 31 patients with sarcoidosis and the perfusion lung scintigraphy only was performed in additional 11 patients. In order to evaluate the diagnostic usefullness and the significance of these methods, the scintigraphic findings were compared with other clinical findings such as chest roentgenographic findings, pathological changes on the biopsy specimen, levels of serum angiotensin converting enzyme (ACE), pulmonary function data and so on. From the present study, the results were summarized as follow : 1) Diffuse 201 Tl lung uptake was observed in 23 cases (74.2 %), but its intensity was mild or moderate in most cases. 2) The intensity of 201 Tl lung uptake had a tendency to be related to the quantity of abnormal lung shadows on the chest x-ray film, the frequency of epithelioid granuloma on the biopsy specimen, levels of serum ACE and serum lysozyme. However, no good relationship was obtained between the intensity of 201 Tl lung uptake and pulmonary function data or the intensity of alveolitis on the biopsy specimen. 3) There was close relationship between 201 Tl uptake of hilar or mediastinal lymphnodes and chest roentgenographic findings of lymphadenopathy. In mediastinal lymphnodes, however, about half of roentgenographically negative cases showed 201 Tl uptake. 4) In the 201 Tl myocardial image, visualization of the right ventricle and the myocardial perfusion defect were revealed in 17 and 9 cases, respectively. 5) In the perfusion lung scintigraphy, perfusion abnormalities were observed in 41 of 42 cases. They were more frequently observed in the upper and/or middle fields and peripheral areas of the lung. (author)

  7. Specifics of stands formation at coalmine dumps in forest-steppe zone

    Directory of Open Access Journals (Sweden)

    R. T. Murzakmаtov

    2018-02-01

    Full Text Available Rock dumps of coalmines have high potential for forest regeneration and environmental capacity, which are dependent on the technology of reclamation and the properties of technogenic soils and grounds. Traditional forestry methods for obtaining the main criteria of biological indicators of woody vegetation were used in the study as follows: ground seed germination, seedling planting technology, composition and increment of tree stands, root structure, care harvesting of undergrowth, biotopic classification. Natural overgrowing of dumps is dependent on the availability of seeds and conditions for their germination and subsequent growth. Most of the zonal tree and shrub species are able to colonize and grow on the coalmine dumps. Mineralization of the dumps surfaces without rich soil stratum, porosity of the upper horizon of lithostratum, and low nutrient content (nitrogen give benefits in the growth and subsequent formation of birch, pine and sea-buckthorn stands. Afforestation is the cheapest and most effective method of biological reclamation. The analysis of artificial reforestation shows the probability of targeted plantation cultivation of various tree species. The use of a wide range of tree and shrub species make it possible to create biologically diverse intrazonal technogenic ecosystems with high recreational and economic productivity. Wildfires spreading out in spring season on herbaceous rags limit the overgrowth of the dumps by forest vegetation. Two-year cyclical increment decline of trees due to provocative spring warming takes place. The zoogenic factor, especially zoo chores distribution of berry plants, has essential value for forest forming process. By the results of forest formation analysis at rock dumps, alveolate-hilly technology of mine reclamation was developed, which allows to significantly improve dumps’ afforestation capacity, their biological posttechnogenic diversity and productivity.

  8. Dynamics of phytomass of a tree stand of the deciduous-coniferous phytocenosis in middle taiga of Komi Republic

    Directory of Open Access Journals (Sweden)

    S. I. Tarasov

    2018-02-01

    Full Text Available Rock dumps of coalmines have high potential for forest regeneration and environmental capacity, which are dependent on the technology of reclamation and the properties of technogenic soils and grounds. Traditional forestry methods for obtaining the main criteria of biological indicators of woody vegetation were used in the study as follows: ground seed germination, seedling planting technology, composition and increment of tree stands, root structure, care harvesting of undergrowth, biotopic classification. Natural overgrowing of dumps is dependent on the availability of seeds and conditions for their germination and subsequent growth. Most of the zonal tree and shrub species are able to colonize and grow on the coalmine dumps. Mineralization of the dumps surfaces without rich soil stratum, porosity of the upper horizon of lithostratum, and low nutrient content (nitrogen give benefits in the growth and subsequent formation of birch, pine and sea-buckthorn stands. Afforestation is the cheapest and most effective method of biological reclamation. The analysis of artificial reforestation shows the probability of targeted plantation cultivation of various tree species. The use of a wide range of tree and shrub species make it possible to create biologically diverse intrazonal technogenic ecosystems with high recreational and economic productivity. Wildfires spreading out in spring season on herbaceous rags limit the overgrowth of the dumps by forest vegetation. Two-year cyclical increment decline of trees due to provocative spring warming takes place. The zoogenic factor, especially zoo chores distribution of berry plants, has essential value for forest forming process. By the results of forest formation analysis at rock dumps, alveolate-hilly technology of mine reclamation was developed, which allows to significantly improve dumps’ afforestation capacity, their biological posttechnogenic diversity and productivity.

  9. A Pilot Study on the Feasibility of Interventional Lung Volume Reduction

    International Nuclear Information System (INIS)

    Wang Wansheng; Dong Yonghua; Liu Bin; Zhu Chi; Yu Yongqiang

    2008-01-01

    The objective of this study was to evaluate the feasibility and safety of lung volume reduction by transbronchial alcohol and lipiodol suspension infusion with the aid of balloon-tipped catheter occlusion. Twenty-six healthy adult rabbits were divided into four treatment groups: alcohol and lipiodol suspension infusion (n = 8), lipiodol infusion (n = 8), alcohol infusion (n = 5), or bronchial lumen occlusion (n = 5). After selective lobar or segmental bronchial catheterization using a balloon-tipped occlusion catheter, the corresponding drug infusion was performed. Bone cement was used to occlude the bronchial lumen in the occlusion group. The animals were followed up for 10 weeks by chest X-ray and computed tomography (CT), and then the whole lungs were harvested for histological examination. Alcohol and lipiodol suspension or lipiodol could be stably retained in alveoli in the first two groups based on chest X-ray and CT, but obvious collapse only occurred in the group receiving alcohol and lipiodol suspension or the bronchial lumen occlusion group. Histological examination revealed damage and disruption of the alveolar epithelium and fibrosis in related lung tissue in the group receiving alcohol and lipiodol suspension. Similar changes were seen in the bronchial lumen occlusion group, apart from obvious marginal emphysema of the target areas in two animals. Interstitial pneumonia and dilated alveoli existed in some tissue in target areas in the lipiodol group, in which pulmonary fibrosis obliterating alveoli also occurred. Chronic alveolitis and pleural adhesion in target areas occurred in the group infused with alcohol alone, whereas visceral pleura of the other three groups was regular and no pleural effusion or adhesion was found. Alcohol and lipiodol suspension that is stably retained in alveoli can result in significant lung volume reduction. Through alcohol and lipiodol suspension infusion, obstructive emphysema or pneumonia arising from bronchial lumen

  10. [Pathomorphologic findings following intensive therapy].

    Science.gov (United States)

    Ruchti, C

    1986-05-24

    Based on autopsy findings in 301 adults who had died after intensive care, different patterns of single or multiple organ damage were identified. Signs of septicemia and/or exudative-to-fibrosing alveolitis (EFA) of the lungs, the prominent cause of the adult respiratory distress syndrome (ARDS), were recognized in 89 cases. Severe, progressive EFA, which appears to ensue mainly from continuing damage to alveolar walls, consequent fibroblast proliferation and so-called atelectatic induration (collapsed alveoli forming single thick septa), was registered only in individuals who had undergone long-term intensive care. The latter was necessitated in various severe conditions of which abdominal disease was the most important. Systemic disorders, such as hemorrhagic diathesis and multiple organ damage ("multiple organ failure"), showed a close correlation with septicemia. Infections with gram-negative bacteria appear to play a special role in such processes. Morphologically, these cases were characterized by multiple organ/system damage, e.g., in order of frequency, partial necrosis of renal proximal tubules, followed by signs of regeneration; jaundice; splenitis; lobular pneumonia; centrolobular-to-zonal liver necrosis, in part combined with cholestasis; petechial and/or extended hemorrhage; and others. This complex pattern contrasted strongly with findings in individuals who had been admitted to intensive care because of e.g. a cardiovascular incident: in this latter group (125 cases) intensive care was usually of short duration, progressive EFA was largely absent, signs of septicemia were exceptional, and multiple organ/system damage was rare. The group with polytraumatism (28 cases) exhibited a pattern of organ damage intermediate between (a) and (b).

  11. Evaluation of chronic infectious interstitial pulmonary disease in children by low-dose CT-guided transthoracic lung biopsy

    Energy Technology Data Exchange (ETDEWEB)

    Heyer, Christoph M.; Lemburg, Stefan P.; Kagel, Thomas; Nicolas, Volkmar [Ruhr-University of Bochum, Institute of Diagnostic Radiology, Interventional Radiology and Nuclear Medicine, BG Clinics Bergmannsheil, Bochum (Germany); Mueller, Klaus-Michael [Ruhr-University of Bochum, Institute of Pathology, BG Clinics Bergmannsheil, Bochum (Germany); Nuesslein, Thomas G.; Rieger, Christian H.L. [Ruhr-University of Bochum, Pediatric Hospital, Bochum (Germany)

    2005-07-01

    Children with chronic infectious interstitial lung disease often have to undergo open lung biopsy to establish a final diagnosis. Open lung biopsy is an invasive procedure with major potential complications. Transthoracic lung biopsy (TLB) guided by computed tomography (CT) is a less-invasive well-established procedure in adults. Detailing the role of low-dose CT-guided TLB in the enhanced diagnosis of chronic lung diseases related to infection in children. A group of 11 children (age 8 months to 16 years) underwent CT-guided TLB with a 20-gauge biopsy device. All investigations were done under general anaesthesia on a multidetector CT scanner (SOMATOM Volume Zoom, Siemens, Erlangen, Germany) using a low-dose protocol (single slices, 120 kV, 20 mAs). Specimens were processed by histopathological, bacteriological, and virological techniques. All biopsies were performed without major complications; one child developed a small pneumothorax that resolved spontaneously. A diagnosis could be obtained in 10 of the 11 patients. Biopsy specimens revealed chronic interstitial alveolitis in ten patients. In five patients Chlamydia pneumoniae PCR was positive, in three Mycoplasma pneumoniae PCR was positive, and in two Cytomegalovirus PCR was positive. The average effective dose was 0.83 mSv. Low-dose CT-guided TLB can be a helpful tool in investigating chronic infectious inflammatory processes in children with minimal radiation exposure. It should be considered prior to any open surgical procedure performed for biopsy alone. In our patient group no significant complication occurred. A disadvantage of the method is that it does not allow smaller airways and vessels to be assessed. (orig.)

  12. Occupational asthma and immunologic responses induced by inhaled carmine among employees at a factory making natural dyes.

    Science.gov (United States)

    Quirce, S; Cuevas, M; Olaguibel, J M; Tabar, A I

    1994-01-01

    Carmine is a natural red dye widely used as a food coloring agent and for cosmetic manufacture. It is extracted from the dried females of the insect Dactylopius coccus var. Costa (cochineal). Although it has been reported that inhalation of carmine may give rise to occupational asthma and extrinsic allergic alveolitis, there is little evidence of its immunogenic capacity. We studied nine current employees at a factory making natural dyes and one former employee who had left this plant after occupational asthma developed. A current employee had work-related symptoms of rhinitis and asthma that were confirmed by bronchial provocation tests, and another worker had rhinitis. Immunologic sensitization to carmine and cochineal was evaluated by means of skin testing and determination of serum-specific IgE and IgG subclass antibodies by RAST and ELISA, respectively. The specificity of the RAST assay was investigated by RAST inhibition with different fractions of carmine. The three workers with respiratory symptoms had positive skin prick test reactions to both carmine and cochineal. An immediate response to the bronchial provocation test with carmine and cochineal was observed in the current employee with asthma. Specific IgE antibodies against carmine and cochineal were found only in this worker. RAST inhibition studies indicated that the main allergen had a molecular weight between 10 and 30 kd. Specific IgG antibodies against carmine and cochineal, mainly the subclasses IgG1, IgG3, and IgG4, were found in the 10 subjects surveyed. These findings suggest that carmine may induce immunologic responses, most likely IgE mediated in workers with symptoms of occupational asthma.

  13. Treatment Algorithms in Systemic Lupus Erythematosus.

    Science.gov (United States)

    Muangchan, Chayawee; van Vollenhoven, Ronald F; Bernatsky, Sasha R; Smith, C Douglas; Hudson, Marie; Inanç, Murat; Rothfield, Naomi F; Nash, Peter T; Furie, Richard A; Senécal, Jean-Luc; Chandran, Vinod; Burgos-Vargas, Ruben; Ramsey-Goldman, Rosalind; Pope, Janet E

    2015-09-01

    To establish agreement on systemic lupus erythematosus (SLE) treatment. SLE experts (n = 69) were e-mailed scenarios and indicated preferred treatments. Algorithms were constructed and agreement determined (≥50% respondents indicating ≥70% agreement). Initially, 54% (n = 37) responded suggesting treatment for scenarios; 13 experts rated agreement with scenarios. Fourteen of 16 scenarios had agreement as follows: discoid lupus: first-line therapy was topical agents and hydroxychloroquine and/or glucocorticoids then azathioprine and subsequently mycophenolate (mofetil); uncomplicated cutaneous vasculitis: initial treatment was glucocorticoids ± hydroxychloroquine ± methotrexate, followed by azathioprine or mycophenolate and then cyclophosphamide; arthritis: initial therapy was hydroxychloroquine and/or glucocorticoids, then methotrexate and subsequently rituximab; pericarditis: first-line therapy was nonsteroidal antiinflammatory drugs, then glucocorticoids with/without hydroxychloroquine, then azathioprine, mycophenolate, or methotrexate and finally belimumab or rituximab, and/or a pericardial window; interstitial lung disease/alveolitis: induction was glucocorticoids and mycophenolate or cyclophosphamide, then rituximab or intravenous gamma globulin (IVIG), and maintenance followed with azathioprine or mycophenolate; pulmonary hypertension: glucocorticoids and mycophenolate or cyclophosphamide and an endothelin receptor antagonist were initial therapies, subsequent treatments were phosphodiesterase-5 inhibitors and then prostanoids and rituximab; antiphospholipid antibody syndrome: standard anticoagulation with/without hydroxychloroquine, then a thrombin inhibitor for venous thrombosis, versus adding aspirin or platelet inhibition drugs for arterial events; mononeuritis multiplex and central nervous system vasculitis: first-line therapy was glucocorticoids and cyclophosphamide followed by maintenance with azathioprine or mycophenolate, and

  14. Phylogenomic analysis supports the monophyly of cryptophytes and haptophytes and the association of rhizaria with chromalveolates.

    Science.gov (United States)

    Hackett, Jeremiah D; Yoon, Hwan Su; Li, Shenglan; Reyes-Prieto, Adrian; Rümmele, Susanne E; Bhattacharya, Debashish

    2007-08-01

    Here we use phylogenomics with expressed sequence tag (EST) data from the ecologically important coccolithophore-forming alga Emiliania huxleyi and the plastid-lacking cryptophyte Goniomonas cf. pacifica to establish their phylogenetic positions in the eukaryotic tree. Haptophytes and cryptophytes are members of the putative eukaryotic supergroup Chromalveolata (chromists [cryptophytes, haptophytes, stramenopiles] and alveolates [apicomplexans, ciliates, and dinoflagellates]). The chromalveolates are postulated to be monophyletic on the basis of plastid pigmentation in photosynthetic members, plastid gene and genome relationships, nuclear "host" phylogenies of some chromalveolate lineages, unique gene duplication and replacements shared by these taxa, and the evolutionary history of components of the plastid import and translocation systems. However the phylogenetic position of cryptophytes and haptophytes and the monophyly of chromalveolates as a whole remain to be substantiated. Here we assess chromalveolate monophyly using a multigene dataset of nuclear genes that includes members of all 6 eukaryotic supergroups. An automated phylogenomics pipeline followed by targeted database searches was used to assemble a 16-protein dataset (6,735 aa) from 46 taxa for tree inference. Maximum likelihood and Bayesian analyses of these data support the monophyly of haptophytes and cryptophytes. This relationship is consistent with a gene replacement via horizontal gene transfer of plastid-encoded rpl36 that is uniquely shared by these taxa. The haptophytes + cryptophytes are sister to a clade that includes all other chromalveolates and, surprisingly, two members of the Rhizaria, Reticulomyxa filosa and Bigelowiella natans. The association of the two Rhizaria with chromalveolates is supported by the approximately unbiased (AU)-test and when the fastest evolving amino acid sites are removed from the 16-protein alignment.

  15. Cobalt bioavailability from hard metal particles. Further evidence that cobalt alone is not responsible for the toxicity of hard metal particles.

    Science.gov (United States)

    Lison, D; Lauwerys, R

    1994-01-01

    Hard metal is an alloy of tungsten carbide (WC) in a matrix of cobalt metal (Co). The inhalation of hard metal dust can cause an alveolitis which may progress to interstitial fibrosis. This study was undertaken to compare, both in vivo and in vitro, the bioavailability of cobalt metal when mixed or not with WC and to assess whether this factor had any influence on the cellular toxicity of hard metal particles. In vivo, non-toxic doses of cobalt metal were administered intratracheally in the rat, alone (Co, 0.03 mg/100 g) or mixed with tungsten carbide (WC-Co, 0.5 mg/100 g containing 6.3% of cobalt metal particles). Sequential measurements of cobalt in the lung and in urine demonstrated that the retention time of the metal in the lung was longer in Co- than in WC-Co-treated animals. In vitro, the cellular cobalt uptake was higher when the metal was presented to the macrophages as WC-Co. However, there was no relationship between the cellular uptake of cobalt and the occurrence of toxicity, since the intracellular concentration of cobalt associated with the occurrence of a cytotoxic effect of WC-Co particles was insufficient to exert the same effect when resulting from exposure to Co alone. This clearly indicates that increased bioavailability of cobalt is not the mechanism by which hard metal particles exhibit their cellular toxicity. These observations confirm and extend our previous findings supporting the view that cobalt is not the only component responsible for the toxicity of hard metal particles which should be considered as a specific toxic entity.

  16. [Legionnaires disease : 3 cases from the northern suburbs of Paris (author's transl)].

    Science.gov (United States)

    Valeyre, D; Dournon, E; Jeantils, V; Kemeny, J L; Blin, F; Battesti, J P

    1981-01-01

    During the summer of 1980, 3 sporadic cases of Legionnaires disease (ML) were recognized in the northern suburbs of Paris. The clinical picture was characterized by an extensive pneumonia, high fever with repeated rigors (3 cases), a confusional state (2 cases), and transitory watery diarrhea (3 cases). Blood cultures, evidence of bacterial antigens in blood or urine, and serology notably for chlamydia and mycoplasma pneumoniae were all negative. The diagnosis of ML (serotype I) was confirmed by serology using indirect immunofluorescence against Legionella pneumophila (LP) with an antigen prepared by Taylor. In one patient treated early with erythromycin (4 g/day), there was a quick and favorable response. Two other patients died, and in their case erythromycin therapy was started late. At necropsy, the lesions were solely thoracic, and were characterized by an alveolitis with many macrophages, and intense leukocytosis, and rich in fibrin; in one case, extensive fibrosis was noted; in the other, LP was diagnosed by direct and indirect immunofluorescence on a lung specimen. In the pneumology department of Hôpital Avicenne, two other patients with acute pneumonias and similar clinical and radiological pictures had elevated titres to LP (1/64), but they did not rise or fall. The diagnosis of ML is probably nevertheless, particularly as the serology was negative for both Mycoplasma pneumoniae and the Chlamydias. Two of the three cases presented were among seventeen acute febrile pneumonias admitted to the pneumology department of Hôpital Avicenne between the 1st of July and the 1st of October 1980, showing the relative frequency of this infection.

  17. Notes on the Bull shark Carcharhinus leucas in the lagoon region of Cananéia, Brazil

    Directory of Open Access Journals (Sweden)

    V Sadowsky

    1971-12-01

    Full Text Available Ninety one young specimens and 3 adult females of BulI shark ("cação cabeça chata" caught in the lagoon region of Cananéia were examined, their tooth formula being 27/25 and the number of pre-caudal vertebrae ranging from 109 to 115. The proportion between the 1st and 2nd dorsal fins were found to be 2.3 and 2.8 for the young,and 2.9 to 3.1 for the adults. These data confirm that the studied form belongs to C. leuoas. Young occur regularly but in limited numbers.As regards the adults, however, females only appear during the short parturition period, i.e., from November to February. The number of embryos in the litters were from 7 to 9, their sizes ranging between 768-812 mm. The length of the smallest free young found was 697 mm, but young presumably 9 to 12 months old had 98 to 112 cm; between 21 and 24 months they were reaching 124 to 128 cm, that is, the same size they have when they start migrating to the open sea. The feeding inhibition phenomenon during the period of parturition was not observed in the female specimens caught in the lagoon. The more abundant species found in the stomach contents were: Arius spixii; Chloroscombrus chrysurus; A. grandicassus; A. barbus; Felichtys marinus; Genidens genidens; Chanophorus tajacica and Carcharhinus porosus.Noventa e um espécimes jovens e 3 fêmeas adultas de "cação cabeça chata" capturados na região lagunar de Cananeia foram examinados, constatando-se a fórmula dental 27/25 e número de vértebras pré-caudais entre 109 e 115.Verificouse que as proporções entre a la. nadadeira dorsal e a 2a. foram de 2.3 e 2.8 para os jovens e de 2.9 até 3.1 para os adultos.Ficou assim confirmado que a forma es tudada pertence a C. leuaas. É comum a ocorrência de jovens dentro da região estudada~ no entanto,quanto aos adultos,as fêmeas só são encontradas durante o período de parição, i.é, de novembro a fevereiro. Constatou-se que o número de embriões nas ninhadas foi de 7 a 9 e seus

  18. Genetically programmed chiral organoborane synthesis

    Science.gov (United States)

    Kan, S. B. Jennifer; Huang, Xiongyi; Gumulya, Yosephine; Chen, Kai; Arnold, Frances H.

    2017-12-01

    Recent advances in enzyme engineering and design have expanded nature’s catalytic repertoire to functions that are new to biology. However, only a subset of these engineered enzymes can function in living systems. Finding enzymatic pathways that form chemical bonds that are not found in biology is particularly difficult in the cellular environment, as this depends on the discovery not only of new enzyme activities, but also of reagents that are both sufficiently reactive for the desired transformation and stable in vivo. Here we report the discovery, evolution and generalization of a fully genetically encoded platform for producing chiral organoboranes in bacteria. Escherichia coli cells harbouring wild-type cytochrome c from Rhodothermus marinus (Rma cyt c) were found to form carbon-boron bonds in the presence of borane-Lewis base complexes, through carbene insertion into boron-hydrogen bonds. Directed evolution of Rma cyt c in the bacterial catalyst provided access to 16 novel chiral organoboranes. The catalyst is suitable for gram-scale biosynthesis, providing up to 15,300 turnovers, a turnover frequency of 6,100 h-1, a 99:1 enantiomeric ratio and 100% chemoselectivity. The enantiopreference of the biocatalyst could also be tuned to provide either enantiomer of the organoborane products. Evolved in the context of whole-cell catalysts, the proteins were more active in the whole-cell system than in purified forms. This study establishes a DNA-encoded and readily engineered bacterial platform for borylation; engineering can be accomplished at a pace that rivals the development of chemical synthetic methods, with the ability to achieve turnovers that are two orders of magnitude (over 400-fold) greater than those of known chiral catalysts for the same class of transformation. This tunable method for manipulating boron in cells could expand the scope of boron chemistry in living systems.

  19. Chemical Characterization of Lipophilic Constituents in the Skin of Migratory Adult Sea Lamprey from the Great Lakes Region.

    Directory of Open Access Journals (Sweden)

    Amila A Dissanayake

    Full Text Available The sea lamprey (Petromzons marinus is an invasive ectoparasite of large-bodied fishes that adversely affects the fishing industry and ecology of the Laurentian Great Lakes. Lipid content in the whole sea lamprey and muscles, liver and kidney of metamorphosing larval stages has been reported. Similarly, the fatty acid profile of the rope tissues of sexually-mature male sea lampreys has also been reported. The average body weight of a sub-adult migratory sea lamprey is 250 g, which includes 14.4% skin (36 g. Our preliminary extraction data of an adult sea lamprey skin revealed that it contained approximately 8.5% of lipophilic compounds. Lamprey skin is home to a naturally aversive compound (an alarm cue that is being developed into a repellent for use in pest management. As part of an ongoing investigation to identify the chemical structure of the sea lamprey alarm cue, we extracted the skin with water and methanol, respectively. The methanolic extract (1.55% contained exclusively lipophilic compounds and did not include the alarm cue. We chemically characterized all compounds present in the methanolic extract as cholesterol esters (CE, tri- and di-glycerides (TG and DG, cholesterol, free fatty acids (FFA and minor amounts of plasticizers. The free fatty acids fraction was composed of saturated (41.8%, monounsaturated (40.7% and polyunsaturated (17.4% fatty acids, respectively. The plasticizers characterized were phthalate and benzoate and found to be 0.95 mg and 2.54 mg, respectively, per adult sea lamprey skin. This is the first report of the chemical characterization of all the lipophilic constituents in the skin of sub-adult migratory sea lamprey. The CEs isolated and characterized from sea lamprey skin are also for the first time.

  20. Lake trout (Salvelinus namaycush) populations in Lake Superior and their restoration in 1959-1993

    Science.gov (United States)

    Hansen, Michael J.; Peck, James W.; Schorfhaar, Richard G.; Selgeby, James H.; Schreiner, Donald R.; Schram, Stephen T.; Swanson, Bruce L.; MacCallum, Wayne R.; Burnham-Curtis, Mary K.; Curtis, Gary L.; Heinrich, John W.; Young, Robert J.

    1995-01-01

    Naturally-reproducing populations of lake trout (Salvelinus namaycush) have been reestablished in most of Lake Superior, but have not been restored to 1929-1943 average abundance. Progress toward lake trout restoration in Lake Superior is described, management actions are reviewed, and the effectiveness of those actions is evaluated; especially stocking lake trout as a tool for building spawning stocks, and subsequently, populations of wild recruits. Widespread destruction of lake trout stocks in the 1950s due to an intense fishery and sea lamprey (Petromyzon marinus) predation resulted in lower overall phenotypic diversity than was previously present. Stocking of yearling lake trout, begun in the 1950s, produced high densities of spawners that reproduced wherever inshore spawning habitat was widespread. Sea lampreys were greatly reduced, beginning in 1961, using selective chemical toxicants and barrier dams, but continue to exert substantial mortality. Fishery regulation was least effective in Wisconsin, where excessive gillnet effort caused high by-catch of lake trout until 1991, and in eastern Michigan, where lake trout restoration was deferred in favor of a tribal fishery for lake whitefish (Coregonus clupeaformis) in 1985. Restoration of stocks was quicker in offshore areas where remnant wild lake trout survived and fishing intensity was low, and was slower in inshore areas where stocked lake trout reproduced successfully and fishing intensity was high. Inshore stocks of wild lake trout are currently about 61 % of historic abundance in Michigan and 53% in Wisconsin. Direct comparison of modern and historic abundances of inshore lake trout stocks in Minnesota and Ontario is impossible due to lack of historic stock assessment data. Stocks in Minnesota are less abundant at present than in Michigan or Wisconsin, and stocks in Ontario are similar to those in Michigan. Further progress in stock recovery can only be achieved if sea lampreys are depressed and if