WorldWideScience

Sample records for alveolate perkinsus marinus

  1. The Alveolate Perkinsus marinus: Biological Insights from EST Gene Discovery

    Directory of Open Access Journals (Sweden)

    El-Sayed Najib M

    2010-04-01

    Full Text Available Abstract Background Perkinsus marinus, a protozoan parasite of the eastern oyster Crassostrea virginica, has devastated natural and farmed oyster populations along the Atlantic and Gulf coasts of the United States. It is classified as a member of the Perkinsozoa, a recently established phylum considered close to the ancestor of ciliates, dinoflagellates, and apicomplexans, and a key taxon for understanding unique adaptations (e.g. parasitism within the Alveolata. Despite intense parasite pressure, no disease-resistant oysters have been identified and no effective therapies have been developed to date. Results To gain insight into the biological basis of the parasite's virulence and pathogenesis mechanisms, and to identify genes encoding potential targets for intervention, we generated >31,000 5' expressed sequence tags (ESTs derived from four trophozoite libraries generated from two P. marinus strains. Trimming and clustering of the sequence tags yielded 7,863 unique sequences, some of which carry a spliced leader. Similarity searches revealed that 55% of these had hits in protein sequence databases, of which 1,729 had their best hit with proteins from the chromalveolates (E-value ≤ 1e-5. Some sequences are similar to those proven to be targets for effective intervention in other protozoan parasites, and include not only proteases, antioxidant enzymes, and heat shock proteins, but also those associated with relict plastids, such as acetyl-CoA carboxylase and methyl erythrithol phosphate pathway components, and those involved in glycan assembly, protein folding/secretion, and parasite-host interactions. Conclusions Our transcriptome analysis of P. marinus, the first for any member of the Perkinsozoa, contributes new insight into its biology and taxonomic position. It provides a very informative, albeit preliminary, glimpse into the expression of genes encoding functionally relevant proteins as potential targets for chemotherapy, and evidence

  2. Numerical Quantification of Perkinsus Marinus in the American Oyster Crassostrea virginicata (Gmelin 1791) (Mollusca: Bivalvia) by Modern Stereology

    Science.gov (United States)

    Species of Perkinsus are responsible for high mortalities of bivalve molluscs world-wide. Techniques to accurately estimate parasites in tissues are required to improve understanding of perkinsosis. This study quantifies the number and tissue distribution of Perkinsus marinus in ...

  3. ANTIOXIDANT ENZYMES, POTENTIAL VIRULENT FACTORS, IN DIFFERENT STRAINS OF THE OYSTER PROTOZOAN PARASITE, PERKINSUS MARINUS

    Science.gov (United States)

    The oyster protozoan parasite, Perkinsus marinus, is one of the two important parasites causing severe mortality in the eastern oysters (Crassostrea virginica) on the US east coast. Our recent study suggests that P. marinus cells and its extracellular products (ECP) could scaveng...

  4. Clonal population structures are derived from various population processes in the protistan oyster parasite Perkinsus marinus

    Science.gov (United States)

    Population genetic analysis of genotypes comprised of seven microsatellite loci revealed clonal genetic patterns in each of four populations of the protistan estuarine parasite Perkinsus marinus. Each locus was amplified directly from DNA extracted from infected oysters collected from four geographi...

  5. Partial inhibition of hemocyte agglutination by Lathyrus odoratus lectin in Crassotrea virginica infected with Perkinsus marinus

    Directory of Open Access Journals (Sweden)

    Thomas C. Cheng

    1995-06-01

    Full Text Available Quantitative determinations of agglutination of hemocytes from oysters, Crassostrea virginica, by the Lathyrus odoratus lectin at five concentrations revealed that clumping of hemocytes from oysters infected with Perkinsus marinus is partially inhibited. Although the nature of the hemocyte surface saccharide, which is not D(+-glucose, D(+mannose, or alpha-methyl-D-mannoside, remains to be determined, it may be concluded that this molecule also occurs on the surface of P. marinus. It has been demonstrated that the panning technique (Ford et al. 1990 is qualitatively as effective for determining the presence of P. marinus in C. virginica as the hemolymph assay method (Gauthier & Fisher 1990.

  6. Suppression of chemiluminescence of eastern oyster (Crassostrea virginica) hemocytes by the protozoan parasite Perkinsus marinus.

    Science.gov (United States)

    Volety, A K; Chu, F L

    1995-01-01

    Experiments were conducted to determine the ability of the protistan parasite, Perkinsus marinus, to inhibit chemiluminescence of hemocytes from the eastern oyster, Crassostrea virginica. Luminol-enhanced chemiluminescence (CL) was used to measure the production of reactive oxygen intermediates (ROI) generated by oyster hemocytes using zymosan as a stimulant. To determine whether P. marinus suppresses ROI evoked from zymosan-stimulated hemocytes, live or heat killed P. marinus in filtered estuarine water (YRW) (salinity = 20 ppt) were added to (1) zymosan-stimulated hemocytes after CL reached its peak, or (2) hemocytes at the same time as zymosan, and reduction of CL responses were recorded. In both tests, controls received only estuarine water. Live P. marinus meronts significantly suppressed ROI production by zymosan-stimulated hemocytes. The suppression of ROI production was dose dependent. Suppression of ROI production from zymosan-stimulated hemocytes by heat killed P. marinus was significantly less than by live P. marinus. Similarly, CL of hemocytes was reduced, though not significantly when hemocytes were exposed to YRW preincubated with P. marinus. When P. marinus meronts were used as a stimulant, no CL response was elicited. Results of this study suggest that P. marinus cells are able to suppress ROI release from oyster hemocytes, thus evading this component of the host's defense. PMID:7556800

  7. Perkinsus marinus superoxide dismutase 2 (PmSOD2) localizes to single-membrane subcellular compartments

    International Nuclear Information System (INIS)

    Perkinsus marinus (Phylum Perkinsozoa), a protozoan parasite of oysters, is considered one of the earliest diverging groups of the lineage leading to dinoflagellates. Perkinsus trophozoites are phagocytosed by oyster hemocytes, where they are likely exposed to reactive oxygen species. As part of its reactive oxygen detoxifying pathway, P. marinus possesses two iron-cofactored SOD (PmSOD1 and PmSOD2). Immunoflourescence analysis of P. marinus trophozoites and gene complementation in yeast revealed that PmSOD1 is targeted to the mitochondria. Surprisingly, although PmSOD2 is characterized by a bipartite N-terminus extension typical of plastid targeting, in preliminary immunofluorescence studies it was visualized as punctuate regions in the cytoplasm that could not be assigned to any organelle. Here, we used immunogold electron microscopy to examine the subcellular localization PmSOD2 in P. marinus trophozoites. Gold grains were mostly associated with single-membrane vesicle-like structures, and eventually, localized to electron-dense, apparently amorphous material present in the lumen of a larger, unique compartment. The images suggested that PmSOD2 is targeted to small vesicles that fuse and/or discharge their content into a larger compartment, possibly the large vacuole typical of the mature trophozoites. In light of the in silico targeting prediction, the association of PmSOD2 with single-membrane compartments raises interesting questions regarding its organellar targeting, and the nature of a putative relic plastid in Perkinsus species

  8. Flow cytometric analysis of lectin binding to in vitro-cultured Perkinsus marinus surface carbohydrates

    Science.gov (United States)

    Gauthier, J.D.; Jenkins, J.A.; La Peyre, Jerome F.

    2004-01-01

    Parasite surface glycoconjugates are frequently involved in cellular recognition and colonization of the host. This study reports on the identification of Perkinsus marinus surface carbohydrates by flow cytometric analyses of fluorescein isothiocyanate-conjugated lectin binding. Lectin-binding specificity was confirmed by sugar inhibition and Kolmogorov-Smirnov statistics. Clear, measurable fluorescence peaks were discriminated, and no parasite autofluorescence was observed. Parasites (GTLA-5 and Perkinsus-1 strains) harvested during log and stationary phases of growth in a protein-free medium reacted strongly with concanavalin A and wheat germ agglutinin, which bind to glucose-mannose and N-acetyl-D-glucosamine (GlcNAc) moieties, respectively. Both P. marinus strains bound with lower intensity to Maclura pomifera agglutinin, Bauhinia purpurea agglutinin, soybean agglutinin (N-acetyl-D-galactosamine-specific lectins), peanut agglutinin (PNA) (terminal galactose specific), and Griffonia simplicifolia II (GlcNAc specific). Only background fluorescence levels were detected with Ulex europaeus agglutinin I (L-fucose specific) and Limulus polyphemus agglutinin (sialic acid specific). The lectin-binding profiles were similar for the 2 strains except for a greater relative binding intensity of PNA for Perkinsus-1 and an overall greater lectin-binding capacity of Perkinsus-1 compared with GTLA-5. Growth stage comparisons revealed increased lectin-binding intensities during stationary phase compared with log phase of growth. This is the first report of the identification of surface glycoconjugates on a Perkinsus spp. by flow cytometry and the first to demonstrate that differential surface sugar expression is growth phase and strain dependent. ?? American Society of Parasitologists 2004.

  9. Fast detection of a protozoan pathogen, Perkinsus marinus, using AlGaN/GaN high electron mobility transistors

    Science.gov (United States)

    Wang, Yu-Lin; Chu, B. H.; Chen, K. H.; Chang, C. Y.; Lele, T. P.; Papadi, G.; Coleman, J. K.; Sheppard, B. J.; Dungen, C. F.; Pearton, S. J.; Johnson, J. W.; Rajagopal, P.; Roberts, J. C.; Piner, E. L.; Linthicum, K. J.; Ren, F.

    2009-06-01

    Antibody-functionalized, Au-gated AlGaN/GaN high electron mobility transistors (HEMTs) were used to detect Perkinsus marinus. The antibody was anchored to the gate area through immobilized thioglycolic acid. The AlGaN/GaN HEMT drain-source current showed a rapid response of less than 5 s when the infected solution was added to the antibody-immobilized surface. The sensor can be recycled with a phosphate buffered saline wash. These results clearly demonstrate the promise of field-deployable electronic biological sensors based on AlGaN/GaN HEMTs for Perkinsus marinus detection.

  10. An evolutionary legacy of sex and clonal reproduction in the protistan oyster parasite Perkinsus marinus.

    Science.gov (United States)

    Thompson, Peter C; Rosenthal, Benjamin M; Hare, Matthew P

    2011-04-01

    Perkinsus marinus, a protozoan parasite of the eastern oyster Crassostrea virginica, causes Dermo disease which limits fecundity and causes high mortality in host populations. The long-term efficacy of management strategies for suppressing this disease in both aquaculture and restoration settings depends on the potential rate of evolutionary response by P. marinus. Sexual reproduction has never been demonstrated in vitro or in previous population genetic studies. We developed high resolution microsatellite markers and amplified alleles directly from infected oyster genomic DNA. Of 336 infected oysters from four populations between Massachusetts and Florida, 129 (48%) appeared to be infected with a single parasite genotype and were subjected to population genetic analyses assuming diploidy. The great diversity of multilocus genotypes observed is incompatible with strictly clonal reproduction. Substantial heterozygote deficits in three populations suggest that sexual reproduction often involves inbreeding. At the same time, significant multilocus linkage disequilibrium occurred in most sampled populations, and several genotypes were sampled repeatedly in each of two populations, indicating that asexual reproduction also occurs in P. marinus populations. Interestingly, where this parasite has recently expanded its range, lower strain diversity, significant heterozygote excess, and highly heterozygous multilocus genotypes suggests clonal propagation of recent recombinants. Taken together, these data suggest that P. marinus employs multiple reproductive modes, and that over the short term, selection acts upon independent parasite lineages rather than upon individual loci in a cohesive, interbreeding population. Nevertheless, high genotypic diversity is the evolutionary legacy of sex in P. marinus. Anthropogenic movement of infected oysters may increase outcrossing opportunities, potentially facilitating rapid evolution of this parasite. PMID:21256249

  11. Effects of salinity and temperature on in vitro cell cycle and proliferation of Perkinsus marinus from Brazil.

    Science.gov (United States)

    Queiroga, Fernando Ramos; Marques-Santos, Luis Fernando; DE Medeiros, Isac Almeida; DA Silva, Patrícia Mirella

    2016-04-01

    Field and in vitro studies have shown that high salinities and temperatures promote the proliferation and dissemination of Perkinsus marinus in several environments. In Brazil, the parasite infects native oysters Crassostrea gasar and Crassostrea rhizophorae in the Northeast (NE), where the temperature is high throughout the year. Despite the high prevalence of Perkinsus spp. infection in oysters from the NE of Brazil, no mortality events were reported by oyster farmers to date. The present study evaluated the effects of salinity (5, 20 and 35 psu) and temperature (15, 25 and 35 °C) on in vitro proliferation of P. marinus isolated from a host (C. rhizophorae) in Brazil, for a period of up to 15 days and after the return to the control conditions (22 days; recovery). Different cellular parameters (changes of cell phase's composition, cell density, viability and production of reactive oxygen species) were analysed using flow cytometry. The results indicate that the P. marinus isolate was sensitive to the extreme salinities and temperatures analysed. Only the highest temperature caused lasting cell damage under prolonged exposure, impairing P. marinus recovery, which is likely to be associated with oxidative stress. These findings will contribute to the understanding of the dynamics of perkinsiosis in tropical regions. PMID:26888407

  12. Associations between land use and Perkinsus marinus infection of eastern oysters in a high salinity, partially urbanized estuary

    Science.gov (United States)

    Gray, Brian R.; Bushek, David; Drane, J. Wanzer; Porter, Dwayne

    2009-01-01

    Infection levels of eastern oysters by the unicellular pathogen Perkinsus marinus have been associated with anthropogenic influences in laboratory studies. However, these relationships have been difficult to investigate in the field because anthropogenic inputs are often associated with natural influences such as freshwater inflow, which can also affect infection levels. We addressed P. marinus-land use associations using field-collected data from Murrells Inlet, South Carolina, USA, a developed, coastal estuary with relatively minor freshwater inputs. Ten oysters from each of 30 reefs were sampled quarterly in each of 2 years. Distances to nearest urbanized land class and to nearest stormwater outfall were measured via both tidal creeks and an elaboration of Euclidean distance. As the forms of any associations between oyster infection and distance to urbanization were unknown a priori, we used data from the first and second years of the study as exploratory and confirmatory datasets, respectively. With one exception, quarterly land use associations identified using the exploratory dataset were not confirmed using the confirmatory dataset. The exception was an association between the prevalence of moderate to high infection levels in winter and decreasing distance to nearest urban land use. Given that the study design appeared adequate to detect effects inferred from the exploratory dataset, these results suggest that effects of land use gradients were largely insubstantial or were ephemeral with duration less than 3 months.

  13. MODULATION OF EASTERN OYSTER HEMOCYTE ACTIVITIES BY PERKINSUS MARINUS EXTRACELLULAR PROTEINS

    Science.gov (United States)

    The oyster pathogen Perkinsus marinusproduces many extracellular proteins (ECP) in vitro. Analysis of this ECP revealed a battery of hydrolytic enzymes. Some of these enzymes are known to modulate the activity of host defense cells. Although information on the effects of P. marin...

  14. Effects of air-exposure gradients on spatial infection patterns of Perkinsus marinus in the eastern oyster Crassostrea virginica.

    Science.gov (United States)

    Malek, Jennafer C; Breitburg, Denise L

    2016-02-25

    Spatial distributions of species can be shaped by factors such as parasites, mortality, and reproduction, all of which may be influenced by differences in physical factors along environmental gradients. In nearshore tidal waters, an elevational gradient in aerial exposure during low tide can shape the spatial distributions of benthic marine organisms. The eastern oyster Crassostrea virginica is an ecologically and economically important species that can dominate both subtidal and intertidal habitats along the east coast of the USA. Our goal was to determine whether prevalence and intensity of Perkinsus marinus (the causative agent of Dermo disease) infections vary along intertidal to subtidal gradients during summer. We used (1) field experiments conducted at 4 sites in the Chesapeake Bay and a Virginia coastal bay, (2) a controlled air-exposure experiment, and (3) field surveys from 7 sites ranging from Maine to North Carolina to test for effects of tidal exposure on infection. Results from our field surveys suggested that high intertidal oysters tend to have higher infection prevalence than subtidal oysters, but there was no effect on infection intensity. Field experiments rarely yielded significant effects of tidal exposure on infection prevalence and intensity. Overall, our study shows that exposure to air may not be a strong driver of infection patterns in this host-parasite system. PMID:26912044

  15. Humanized HLA-DR4 mice fed with the protozoan pathogen of oysters Perkinsus marinus (Dermo do not develop noticeable pathology but elicit systemic immunity.

    Directory of Open Access Journals (Sweden)

    Wathsala Wijayalath

    Full Text Available Perkinsus marinus (Phylum Perkinsozoa is a marine protozoan parasite responsible for "Dermo" disease in oysters, which has caused extensive damage to the shellfish industry and estuarine environment. The infection prevalence has been estimated in some areas to be as high as 100%, often causing death of infected oysters within 1-2 years post-infection. Human consumption of the parasites via infected oysters is thus likely to occur, but to our knowledge the effect of oral consumption of P. marinus has not been investigated in humans or other mammals. To address the question we used humanized mice expressing HLA-DR4 molecules and lacking expression of mouse MHC-class II molecules (DR4.EA(0 in such a way that CD4 T cell responses are solely restricted by the human HLA-DR4 molecule. The DR4.EA(0 mice did not develop diarrhea or any detectable pathology in the gastrointestinal tract or lungs following single or repeated feedings with live P. marinus parasites. Furthermore, lymphocyte populations in the gut associated lymphoid tissue and spleen were unaltered in the parasite-fed mice ruling out local or systemic inflammation. Notably, naïve DR4.EA(0 mice had antibodies (IgM and IgG reacting against P. marinus parasites whereas parasite specific T cell responses were undetectable. Feeding with P. marinus boosted the antibody responses and stimulated specific cellular (IFNγ immunity to the oyster parasite. Our data indicate the ability of P. marinus parasites to induce systemic immunity in DR4.EA(0 mice without causing noticeable pathology, and support rationale grounds for using genetically engineered P. marinus as a new oral vaccine platform to induce systemic immunity against infectious agents.

  16. Diversity of extracellular proteins during the transition from the ‘proto-apicomplexan’ alveolates to the apicomplexan obligate parasites

    KAUST Repository

    Templeton, Thomas J.

    2015-11-20

    The recent completion of high-coverage draft genome sequences for several alveolate protozoans – namely, the chromerids, Chromera velia and Vitrella brassicaformis ; the perkinsid Perkinsus marinus ; the apicomplexan, Gregarina niphandrodes , as well as high coverage transcriptome sequence information for several colpodellids, allows for new genome-scale comparisons across a rich landscape of apicomplexans and other alveolates. Genome annotations can now be used to help interpret fine ultrastructure and cell biology, and guide new studies to describe a variety of alveolate life strategies, such as symbiosis or free living, predation, and obligate intracellular parasitism, as well to provide foundations to dissect the evolutionary transitions between these niches. This review focuses on the attempt to identify extracellular proteins which might mediate the physical interface of cell–cell interactions within the above life strategies, aided by annotation of the repertoires of predicted surface and secreted proteins encoded within alveolate genomes. In particular, we discuss what descriptions of the predicted extracellular proteomes reveal regarding a hypothetical last common ancestor of a pre-apicomplexan alveolate – guided by ultrastructure, life strategies and phylogenetic relationships – in an attempt to understand the evolution of obligate parasitism in apicomplexans.

  17. An Agar-Based Method for Plating Marine Protozoan Parasites of the Genus Perkinsus.

    Directory of Open Access Journals (Sweden)

    Emma R Cold

    Full Text Available The genus Perkinsus includes protozoan parasites of mollusks responsible for losses in the aquaculture industry and hampering the recovery of natural shellfish beds worldwide, and they are a key taxon for understanding intracellular parasitism adaptations. The ability to propagate the parasite in liquid media, in the absence of the host, has been crucial for improving understanding of its biology; however, alternative techniques to grow the parasite are needed to explore other basic aspects of the Perkinsus spp. biology. We optimized a DME: Ham's F12-5% FBS- containing solid agar medium for plating Perkinsus marinus. This solid medium supported trophozoite propagation both by binary fission and schizogony. Colonies were visible to the naked eye 17 days after plating. We tested the suitability of this method for several applications, including the following: 1 Subcloning P. marinus isolates: single discrete P. marinus colonies were obtained from DME: Ham's F12-5% FBS- 0.75% agar plates, which could be further propagated in liquid medium; 2 Subcloning engineered Perkinsus mediterraneus MOE[MOE]: GFP by streaking cultures on plates; 3 Chemical susceptibility: Infusing the DME: Ham's F12-5% FBS- 0.75% agar plates with triclosan resulted in inhibition of the parasite propagation in a dose-dependent manner. Altogether, our plating method has the potential for becoming a key tool for investigating diverse aspects of Perkinsus spp. biology, developing new molecular tools, and for biotechnological applications.

  18. An Agar-Based Method for Plating Marine Protozoan Parasites of the Genus Perkinsus.

    Science.gov (United States)

    Cold, Emma R; Freyria, Nastasia J; Martínez Martínez, Joaquín; Fernández Robledo, José A

    2016-01-01

    The genus Perkinsus includes protozoan parasites of mollusks responsible for losses in the aquaculture industry and hampering the recovery of natural shellfish beds worldwide, and they are a key taxon for understanding intracellular parasitism adaptations. The ability to propagate the parasite in liquid media, in the absence of the host, has been crucial for improving understanding of its biology; however, alternative techniques to grow the parasite are needed to explore other basic aspects of the Perkinsus spp. biology. We optimized a DME: Ham's F12-5% FBS- containing solid agar medium for plating Perkinsus marinus. This solid medium supported trophozoite propagation both by binary fission and schizogony. Colonies were visible to the naked eye 17 days after plating. We tested the suitability of this method for several applications, including the following: 1) Subcloning P. marinus isolates: single discrete P. marinus colonies were obtained from DME: Ham's F12-5% FBS- 0.75% agar plates, which could be further propagated in liquid medium; 2) Subcloning engineered Perkinsus mediterraneus MOE[MOE]: GFP by streaking cultures on plates; 3) Chemical susceptibility: Infusing the DME: Ham's F12-5% FBS- 0.75% agar plates with triclosan resulted in inhibition of the parasite propagation in a dose-dependent manner. Altogether, our plating method has the potential for becoming a key tool for investigating diverse aspects of Perkinsus spp. biology, developing new molecular tools, and for biotechnological applications. PMID:27149378

  19. Neutrophilic alveolitis in Sweet's syndrome.

    OpenAIRE

    Bourke, S J; Quinn, A. G.; Farr, P M; Ashcroft, T.; Gibson, G. J.

    1992-01-01

    In a case of Sweet's syndrome (acute febrile neutrophilic dermatosis) neutrophilic alveolitis was found by lung biopsy. Pulmonary disease in this condition may be underrecognised yet, like the dermatological features, it responds rapidly to corticosteroids.

  20. Autoantibodies in cryptogenic fibrosing alveolitis

    Directory of Open Access Journals (Sweden)

    du Bois Ron

    2001-02-01

    Full Text Available Abstract The pathogenesis of cryptogenic fibrosing alveolitis (CFA involves injury, an immune/inflammatory response and fibrosis. The cause of the injury is unknown, but the identification of serum autoantibodies makes an autoimmune aetiology attractive. The core study on which this commentary is based used novel cloning and serum screening technologies in order to identify new public and private autoantibodies in sera from 12 patients with CFA. Largely negative conclusions were drawn from that study. However, we suggest that the prevalence of autoantibodies may have been underestimated, that the study was timely and that this approach is worth pursuing further.

  1. Capsaicin induced cough in cryptogenic fibrosing alveolitis

    OpenAIRE

    Doherty, M.; Mister, R; Pearson, M.; Calverley, P.

    2000-01-01

    BACKGROUND—Cough is a common and troublesome symptom in cryptogenic fibrosing alveolitis (CFA) but the mechanisms responsible are not known. The cough threshold to inhaled capsaicin is increased in asthma and chronic obstructive pulmonary disease (COPD) where lung volumes are increased, but the relationship between cough response and symptom intensity has not been studied in CFA where lung volumes are reduced.
METHODS—Capsaicin challenge tests were performed on 15 subject...

  2. A follow up study on interstitial alveolitis

    Directory of Open Access Journals (Sweden)

    Kamat S

    2004-01-01

    Full Text Available Objective : To study the benefits of steroid therapy in interstitial alveolitis. Method and Materials : One hundred five adult clinic patients were studied with clinical evaluation, chest radiography, CT scan, bronchoscopic lavage, pulmonary function studies and a regular follow up. They were put on daily prednisolone (in 19 on intravenous methyl prednisolone, for several months. Results: Only a few had no cough or dypnoea; 91 cases had atleast gr. III exertional breathlessness; 61(58% had been given steroids earlier and 32(31% were on a prior antitubercular treatment. Only 16% had GERD symptoms. On radiography, interstitial deposits were seen in 102 cases. While 53 cases belonged to idiopathic variety, 41 were sarcoidosis. A majority had poor lung function with a restrictive disability; but 50% showed a significant response (10%+ to bronchodilators. On follow up in 92 cases, 14 died, 8 went in remission; 32 had a fluctuating course. At some stage 66 had showed improvement. Conclusion : A large majority of our interstitial alveolitis cases are very disabled. They show clinical, functional, and radiographic improvement to long term oral prednisolone. In nonresponsive cases, intravenous steroids show an objective response.

  3. The alveolitis of pulmonary sarcoidosis. Evaluation of natural history and alveolitis-dependent changes in lung function

    International Nuclear Information System (INIS)

    Current concepts of the pathogenesis of pulmonary sarcoidosis suggest that a mononuclear cell alveolitis, comprised of activated T-lymphocytes and activated alveolar macrophages, precedes and modulates the formation of granuloma and fibrosis. To evaluate the natural history of this alveolitis and determine the relationship it has to subsequent changes in lung function, 19 untreated patients with pulmonary sarcoidosis without extrapulmonary manifestations were studied with bronchoalveolar lavage, 67Ga scanning, and pulmonary function tests to evaluate lung T-cells, lung alveolar macrophages, and lung function, respectively. In patients with sarcoidosis, low intensity alveolitis (lung T-cells less than or equal to 28% of all lung effector cells and/or 67Ga scan negative) was much more common (80% of all observations) than high intensity alveolitis (lung T-cells greater than 28% and 67Ga scan positive, 20% of all observations). Conventional clinical, roentgenographic, or physiologic studies could not predict the alveolitis status. Interestingly, of the 51 alveolitis evaluations in the 19 patients, there were 24 occurrences (47%) where the alveolitis was ''split,'' i.e., 67Ga scans positive and T-cells low (39%) or 67Ga negative and T-cells high (8%). Most untreated patients with sarcoidosis without extrapulmonary symptoms may have some inflammatory processes ongoing in their alveolar structures. Overall, whenever a high intensity alveolitis episode occurred, it was followed by deterioration over the next 6 months in at least one lung function parameter. A low intensity alveolitis episode was followed by functional deterioration only 8% of the time. The alveolitis parameters (lavage and 67Ga scanning) clearly predicted prognosis. These observations should prove useful in understanding the natural history of pulmonary sarcoidosis, in staging patients with this disease, and in making rational therapy decisions

  4. Accuracy of the typical computed tomographic appearances of fibrosing alveolitis.

    OpenAIRE

    Tung, K. T.; Wells, A. U.; Rubens, M B; Kirk, J M; du Bois, R M; Hansell, D. M.

    1993-01-01

    BACKGROUND--Open lung biopsy is often performed to confirm the diagnosis in patients with suspected fibrosing alveolitis. The superior sensitivity and specificity of high resolution computed tomography (CT) over chest radiography in various diffuse lung diseases suggest that the characteristic appearance of fibrosing alveolitis on high resolution CT might render biopsy confirmation unnecessary. METHODS--The chest radiographs and high resolution CT scans of 86 patients (41 with fibrosing alveo...

  5. A photosynthetic alveolate closely related to apicomplexan parasites

    Czech Academy of Sciences Publication Activity Database

    Moore, R. B.; Oborník, Miroslav; Janouškovec, Jan; Chrudimský, Tomáš; Vancová, Marie; Green, D. H.; Wright, S. W.; Davies, N. W.; Bolch, Ch. J. S.; Heimann, K.; Šlapeta, J.; Hoegh-Guldberg, O.; Logsdon, J. M.; Carter, D. A.

    2008-01-01

    Roč. 451, 21-02-2008 (2008), s. 959-963. ISSN 0028-0836 R&D Projects: GA ČR GA206/06/1439 Institutional research plan: CEZ:AV0Z60220518 Keywords : alveolate * photosynthesis * Chromera velia * evolution * Apicomplexa Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.434, year: 2008

  6. Cryptogenic fibrosing alveolitis: clinical features and their influence on survival

    OpenAIRE

    Turner-Warwick, M.; Burrows, B; Johnson, A

    1980-01-01

    A retrospective analysis of 220 cases fulfilling criteria for cryptogenic fibrosing alveolitis (CFA) attending the Brompton Hospital between 1955 and 1973 has been carried out and patients have been followed for between four and 21 years. The frequency of various clinical features confirms previous reports. The 2: 1 male preponderance was similar in all age groups. The mean age at presentation was 54 years ± 12 SD; 202 (92%) of the patients presented with dyspnoea, the severity of which was r...

  7. Aerosolised ribavirin in patients with advanced cryptogenic fibrosing alveolitis: a pilot study.

    OpenAIRE

    Agustí, C.; Xaubet, A; Ballester, E.; Alarcón, A.; Picado, C

    1993-01-01

    BACKGROUND: A report has recently been published concerning a patient with a cryptogenic fibrosing alveolitis who showed a striking improvement after being treated with the antiviral drug ribavirin (tribavirin, Virazid). The objective of this study was to further evaluate, in an open trial, the efficacy of rivabirin in cryptogenic fibrosing alveolitis. METHODS: Ten patients (eight women) with advanced cryptogenic fibrosing alveolitis received aerosolised ribavirin (6 g/day for 15 days). Chest...

  8. Infliximab-associated alveolitis after treatment for severe left-sided ulcerative colitis.

    LENUS (Irish Health Repository)

    Veerappan, Sundaram G

    2012-02-01

    Here we describe a patient with ulcerative colitis who developed alveolitis after infliximab therapy. With earlier case reports of development of alveolitis in rheumatoid arthritis patients after infliximab infusion, the temporal relationship between the infliximab therapy and the development of alveolitis in this case, raises the possibility that the two might be causally related. With an increasing trend towards treating moderate to severely active ulcerative colitis patients with infliximab as a rescue therapy, clinicians should be aware of this potentially serious complication.

  9. One Perkinsus species may hide another: characterization of Perkinsus species present in clam production areas of France

    OpenAIRE

    ARZUL, Isabelle; Chollet, Bruno; Michel, J.; Robert Mill, Hugh; Garcia, Celine; Joly, Jean-pierre; Francois, Cyrille; Miossec, Laurence

    2012-01-01

    Although clam populations in France are known to be infected with protozoans of the genus Perkinsus, no molecular characterization was previously performed on these parasites. Considering that several members of this genus have been associated with mortalities of molluscs worldwide, a study was undertaken in order to characterize these parasites in France. For that purpose, clams, Ruditapes philippinarum and R. decussatus, collected from different production areas and found to be infected wit...

  10. Ventilation perfusion radionuclide imaging in cryptogenic fibrosing alveolitis.

    Science.gov (United States)

    Bourke, S J; Hawkins, T; Keavey, P M; Gascoigne, A D; Corris, P A

    1993-06-01

    There is increasing interest in ventilation perfusion (V/Q) imaging in cryptogenic fibrosing alveolitis because of the data these scans provide on the dynamic V/Q relationships in such patients undergoing single lung transplantation. However, the full spectrum of V/Q abnormalities in this disease is poorly defined. We therefore analysed the V/Q scans of 45 consecutive patients with advanced cryptogenic fibrosing alveolitis being considered for single lung transplantation. Scans were classified according to the presence, severity and degree of matching of defects in ventilation and perfusion images and the results were compared with the data obtained from lung function tests. Ventilation images showed defects in 13 (29%) and 'washout delay' in 15 (33%) patients; 10 (22%) patients had asymmetric distribution of ventilation with one lung receiving > 60% of total ventilation. Perfusion images showed normal perfusion in 8 (18%), mild defects in 18 (40%) and major defects in 19 (42%) patients. The distribution of perfusion between lungs was significantly asymmetric in 20 (45%) patients. V/Q images were matched in 15 (33%), mildly mismatched in 15 (33%) and severely mismatched in 15 (33%) patients, but the degree of V/Q mismatch did not show a relationship to KCO, PaO2 or A-aO2 gradient. The appearances were atypical of pulmonary embolism in eight patients. V/Q images in cryptogenic fibrosing alveolitis show a diverse range of appearances and may mimic pulmonary embolism. V/Q imaging complements the data obtained from lung function tests and is particularly useful in defining the differential function of each lung which is particularly important in the assessment of patients for single lung transplantation. PMID:8321484

  11. Ventilation perfusion radionuclide imaging in cryptogenic fibrosing alveolitis

    International Nuclear Information System (INIS)

    There is increasing interest in ventilation perfusion (V/Q) imaging in cryptogenic fibrosing alveolitis because of the data these scans provide on the dynamic V/Q relationships in such patients undergoing single lung transplantation. We analysed the V/Q scans of 45 consecutive patients with advanced cryptogenic fibrosing alveolitis being considered for single lung transplantation. Scans were classified according to the presence, severity and degree of matching of defects in ventilation and perfusion images and the results were compared with the data obtained from lung function tests. Ventilation images showed defects in 13 (29%) and ''washout delay'' in 15 (33%) patients; 10 (22%) patients had asymmetric distribution of ventilation with one lung receiving >60% of total ventilation. Perfusion images showed normal perfusion in 8 (18%), mild defects in 18 (40%) and major defects in 19 (42%) patients. The distribution of perfusion between lungs was significantly asymmetric in 20 (45%) patients. V/Q images were matched in 15 (33%), mildly mismatched in 15 (33%) and severely mismatched in 15 (33%) patients, but the degree of V/Q mismatch did not show a relationship to KCO, PaO2 or A-aO2 gradient. The appearances were atypical of pulmonary embolism in eight patients. (Author)

  12. Phylogenetic position of the genus Perkinsus (Protista, Apicomplexa) based on small subunit ribosomal RNA.

    Science.gov (United States)

    Goggin, C L; Barker, S C

    1993-07-01

    Parasites of the genus Perkinsus destroy marine molluscs worldwide. Their phylogenetic position within the kingdom Protista is controversial. Nucleotide sequence data (1792 bp) from the small subunit rRNA gene of Perkinsus sp. from Anadara trapezia (Mollusca: Bivalvia) from Moreton Bay, Queensland, was used to examine the phylogenetic affinities of this enigmatic genus. These data were aligned with nucleotide sequences from 6 apicomplexans, 3 ciliates, 3 flagellates, a dinoflagellate, 3 fungi, maize and human. Phylogenetic trees were constructed after analysis with maximum parsimony and distance matrix methods. Our analyses indicate that Perkinsus is phylogenetically closer to dinoflagellates and to coccidean and piroplasm apicomplexans than to fungi or flagellates. PMID:8366895

  13. Thyroid anatomy and topography of toad (Bufo marinus ictericus)

    International Nuclear Information System (INIS)

    The autoradiographic method is used for the study of the toad's thyroid of Bufo marinus ictericus by 131I. Histolological proceedings are done. Comparative evaluations with bibliographic informations are presented. (M.A.C.)

  14. Critical threshold size for overwintering sandeels (Ammodytes marinus)

    DEFF Research Database (Denmark)

    Deurs, Mikael van; Hartvig, Martin; Steffensen, John Fleng

    2011-01-01

    independent long-term overwintering experiments. Maximum attainable energy reserves were estimated from published data on A. marinus in the North Sea. The critical threshold size in terms of length (Lth) for A. marinus in the North Sea was estimated to be 9.5 cm. We then investigated two general predictions......: (1) Fish smaller than Lth display winter feeding activity, and (2) size at maturation of iteroparous species is larger than Lth to ensure sufficient energy reserves to accommodate both the metabolic cost of passive overwintering and reproductive investments. Both predictions were found to be...

  15. Radiosensitivity of the Philippine giant toad (Bufu marinus L.)

    International Nuclear Information System (INIS)

    The Philippine giant toad (Bufu marinus L.) were studied to establish their radiosensitivities and their possible use as a good biological indicator organism of radiation effects. Live male and female toads were exposed to ionizing doses of gamma irradiation. Chromosome analysis was done under the Carl Zeiss III photo microscope. Somatic and meiotic chromosome aberrations were induced in giant toad upon in vivo whole gamma irradiations. By cytogenetic analysis the aberrant chromosomes were observed and evaluated. In these studies, it was concluded that Bufo marinus L. is significantly radiosensitive and a good biological indicator organisms of radiation effects. (ISD). 2 figs.; 8 tabs

  16. Effectiveness of the aqueous extract of aloe in the treatment of oral alveolitis

    Directory of Open Access Journals (Sweden)

    Isidro de Jesús Nápoles González

    2015-07-01

    Full Text Available Background: alveolitis is a complication that may appear after the extraction of a tooth. It is considered a dental emergency due to the intense pain. Its prevalence is worrisome for the dental services for the complications and disability that it can provoke in patients.Objective: to evaluate the effectiveness of the aqueous extract of aloe with pharmaceutical use in the treatment of alveolitis.Method: an experimental study was carried out with 100 patients that visited the Provincial Teaching Dental Clinic, “La Vigía” Clinic, and “Julio Antonio Mella” Polycilinic of Camaguey in 2014, and that were diagnosed with alveolitis. The sample was made up of 50 patients in the control group treated with Alvogyl and 50 patients in the study group treated with aloe.Results: most of the patients belonged to the 26 to 45 age group. At 24 hours of treatment the results on pain relief were similar for both groups, with an 18 % for the study group and a 16 % for the control group. At 48 hours the best results were found in the control group, with 62 % of patients with no pain, and only a 30 % in the study group. At 72 hours this tendency was kept with 90 % in the control group and 72 % in the study group. In the study group an 84 % of the patients with wet alveolitis felt pain relief.Conclusions: the aqueous extract of aloe is a natural drug which is effective in the treatment of alveolitis, mainly in wet alveolitis and those affecting the maxillary bones. There were no adverse reactions with none of the used medications.

  17. Computer tomographic patterns in extrinsic allergic alveolitis - a comparison with conventional radiological findings

    International Nuclear Information System (INIS)

    Seventeen patients with extrinsic allergic alveolitis or bird-fancier's lung were examined by standard radiological techniques and classified after Hapke's classification. In addition, the patients were examined by CT. The CT patterns have been analysed and compared with standard radiological findings. The methodological advantages of CT are discussed. Radiological investigation is of limited value in the diagnosis of extrinsic allergic alveolitis. Conventional radiography remains the standard of initial X-ray examination. In early cases, however, CT may be a valuable addition within the diagnostic strategy of a diagnostic imaging department. (orig.)

  18. Dento-alveolær kirurgi på børn og unge

    DEFF Research Database (Denmark)

    Grønbæk, Anni Birgitte; Pedersen, Flemming; Haubek, Dorte; Poulsen, Sven

    Erfaringer med dento-alveolær kirurgi på børn og unge Dento-alveolær kirurgi på børn og unge forudsætter, at det samlede team besidder børnekompetence, dvs. den nødvendige odontologiske indsigt, høj kompetence indenfor kommunikation med børn og forældre samt en positiv holdning til børn og foræld...

  19. Treatment of small cell lung carcinoma in association with cryptogenic fibrosing alveolitis

    OpenAIRE

    Lipton, J. R.; Carroll, K; Mould, J. J.; Winstanley, J.; Thatcher, N

    1982-01-01

    Two patients with small cell bronchogenic carcinoma associated with cryptogenic fibrosing alveolitis are described. Both patients received radiotherapy and i.v. chemotherapy with moderate dose methotrexate (100 mg/m2) and escalating high dose cyclophosphamide (1·5 g, 2·5 g, 3·5 g/m2).

  20. A family with extrinsic allergic alveolitis caused by wild city pigeons: A case report

    NARCIS (Netherlands)

    G.J. du Marchie Sarvaas; P.J.F.M. Merkus (Peter); J.C. de Jongste (Johan)

    2000-01-01

    textabstractWe describe a family in which the mother died of unresolved lung disease and whose 5 children, some of whom had previous signs of asthma, were subsequently affected by extrinsic allergic alveolitis caused by contact with wild city pigeon antigens. The children received

  1. Gallium-67 scanning in the staging of cryptogenetic fibrosing alveolitis and hypersensitivity pneumonitis

    International Nuclear Information System (INIS)

    Gallium-67 citrate is known to localize within inflammatory sites. Gallium-67 scanning is used for the evaluation of lung inflammation (i.e. alveolitis) during interstitial lung diseases. We investigated 27 patients with cryptogenetic fibrosing alveolitis (n=17) and hypersensitivity pneumonitis (n=10) using gallium-67 lung scanning and lung function tests (forced vital capacity, diffusing capacity, resting and exercise blood gases). Investigations were performed before and after one year of methylprednisolone treatment. None of eight healthy volunteers had any abnormal gallium-67 uptake. In all patients with cryptogenetic fibrosing alveolitis and initial abnormal gallium-67 uptake was observed (mean fixation index: 163±18). In addition, analysis of lung function tests a year after initial evaluation showed that unchanged or improving patients presented initially with a lower gallium-67 index than patients with evidence of deterioration (163.9±23.7 vs 251.0±23.3.; p<0.01). Similarly, among patients with hypersensitivity pneumonitis the index was lower in unchanged or improving patients than in those with deterioration (74.0±22 vs 226.7±4.9; p<0.05). Thus gallium-67 scanning is useful in the management of cryptogenetic fibrosing alveolitis and hypersensitivity pneumonitis. (author)

  2. Population structure of Ammodytes marinus in the Northeast Atlantic

    OpenAIRE

    Nævdal, Gunnar; Lahn-Johannessen, John; Reinert, Jákup; Thorkildsen, Solveig

    1996-01-01

    Samples of the lesser sandeel species Ammodytes marinus Raitt were collected from Iceland, Denmark, Scotland, the Faeroe Islands and central and northern North Sea, and analysed for frequency distributions of genotypes of polymorphic enzymes. Main emphasize was laid on the enzymes IDHP, PGI and PGM, which were analysed by standard starch gel electrophoresis with two buffer systems. The chose of enzymes is based upon earlier studies in Scotland, Denmark as well as preliminar ana...

  3. Interrelationship between lung volume, expiratory flow, and lung transfer factor in fibrosing alveolitis.

    OpenAIRE

    Pande, J. N.

    1981-01-01

    Fifty patients with fibrosing alveolitis studied on 104 occasions exhibited significant direct correlations between vital capacity (VC), maximum mid-expiratory flow rate (MMFR), and transfer factor for carbon monoxide (TLCO). Forced expired volume in the first second (FEV1)/VC ratio bore a weak negative correlation with VC. Peak expiratory flow, MMFR, and maximum flow rates at 50% and 25% of VC were often reduced in patients with severe grades of pulmonary dysfunction. It appears that as the ...

  4. Decreased pulmonary distensibility in fibrosing alveolitis and its relation to decreased lung volume.

    OpenAIRE

    Thompson, M. J.; Colebatch, H J

    1989-01-01

    The relation between pulmonary distensibility, lung volume, and elastic recoil pressure was examined in 45 patients (38 men) with cryptogenic fibrosing alveolitis (mean age 61 (SD 14) years). Exponential analysis of static pressure-volume data obtained during deflation of the lungs gave the exponent K, an index of the distensibility of the remaining inflatable lung tissue. Total lung capacity (TLC) was measured in a body plethysmograph or by nitrogen washout. The results were compared with va...

  5. Cryptogenic fibrosing alveolitis: response to corticosteroid treatment and its effect on survival

    OpenAIRE

    Turner-Warwick, M.; Burrows, B; Johnson, A

    1980-01-01

    We have studied retrospectively 220 patients with cryptogenic fibrosing alveolitis (CFA) who were first seen between 1955-73 and had been followed up for at least four years until 1977. Seventy-seven patients had received no treatment and 143 had received corticosteroids. The only clinical difference between the groups was the age at presentation (untreated mean age 61 years±11 SD; treated mean age 56 years±11 SD p

  6. Vertical gradients of lung density in supine subjects with fibrosing alveolitis or pulmonary emphysema.

    OpenAIRE

    Millar, A B; Denison, D M

    1990-01-01

    Computed tomography was used to determine the vertical gradient of density in the peripheral lung tissue of 12 patients with histologically proved fibrosing alveolitis and 12 patients with chronic bronchitis and evidence of pulmonary emphysema on the computed tomograms. Measurements were made at total lung capacity and at residual volume and compared with similar measurements from 12 normal subjects reported in a previous study. At residual volume the mean peripheral tissue density in the emp...

  7. Increased lung epithelial permeability in HIV-infected patients with isolated cytotoxic T-lymphocytic alveolitis

    International Nuclear Information System (INIS)

    HIV-related lymphocytic alveolitis is common in HIV-seropositive patients without lung infection or tumor. In some of them a fraction of alveolar lymphocytes are HIV-specific cytotoxic T-lymphocytes (CTL) bearing the CD8 and D44 cell surface markers and capable of killing HIV-infected alveolar macrophages. In order to evaluate the in vivo effect of these CTL on lung function, we measured the pulmonary clearance of aerosolized 99mTc-diethylene triamine penta-acetate (DTPA-CI) on 24 occasions in 22 patients with lymphocytic alveolitis. DTPA-CI has been selected as a highly sensitive test to detect injury of the lung epithelium. In 13 of the patients, we found a high DTPA-CI of 4.56 +/- 2.54%.min-1 (mean +/- SD), suggesting an increase of the epithelial permeability. The lymphocytic alveolitis was then characterized by a high cellularity, a high proportion of lymphocytes (59 +/- 18%), mainly composed of CD8+D44+ T-lymphocytes (149 +/- 109 cells/mm3), which spontaneously exhibited a cytolytic activity against the autologous alveolar macrophages in a standard 51Cr release assay. In the remaining 11 patients, DTPA-CI was normal (less than 1.78%.min-1), lymphocytic alveolitis being characterized by a low number or an absence of CD8+D44+ alveolar lymphocytes (9 +/- 13 cells/mm3) with no significant cytolytic activity. In the whole group, a significant correlation (r = 0.74, p = 0.0004) was found between the DTPA-CI and the number of CD8+D44+ lymphocytes and their cytotoxic activity against alveolar macrophages. Altogether, these results suggest that an injury of the lung epithelium could result from a HIV-specific CTL-induced immunologic conflict

  8. An Agar-Based Method for Plating Marine Protozoan Parasites of the Genus Perkinsus

    OpenAIRE

    Cold, Emma R.; Freyria, Nastasia J.; Joaquín Martínez Martínez; Fernández Robledo, José A.

    2016-01-01

    The genus Perkinsus includes protozoan parasites of mollusks responsible for losses in the aquaculture industry and hampering the recovery of natural shellfish beds worldwide, and they are a key taxon for understanding intracellular parasitism adaptations. The ability to propagate the parasite in liquid media, in the absence of the host, has been crucial for improving understanding of its biology; however, alternative techniques to grow the parasite are needed to explore other basic aspects o...

  9. Zoosporulation of a new Perkinsus species isolated from the gills of the softshell clam Mya arenaria

    Directory of Open Access Journals (Sweden)

    Mclaughlin S.M.

    2000-06-01

    Full Text Available A gill-associated Perkinsus sp. isolated from the softshell clam (Mya arenaria is described as a new species, P. chesapeaki sp. nov. Examination of the parasite in seawater cultures revealed life cycle stages and zoosporulation processes similar to those described for other species of the genus Perkinsus. Prezoosporangia developed thickened cell walls upon contraction of the cytoplasm and development of a distinctive clear area between the cell wall and the protoplast. Successive bipartition of the protoplast led to the formation of hundred's of zoospores within mature sporangia. Zoospores were released into seawater through one or more discharge tubes. Ultrastructural studies revealed an oblong zoospore possessing two flagella that arose from a concave side located in the upper third of the zoospore body. The anterior flagellum possessed a unilateral array of hair-like structures. A large anterior vacuole and basolateral nucleus dominated the cytoplasm of the zoospore body. The presence of a rudimentary apical complex including on open-sided conoid, rhoptries, micronemes, and subpellicular microtubules were also discerned. Differences in zoospore morphology, and sequence analyses of two genes previously reported, support the designation of the gill-associated Perkinsus from the softshell clam as a new species

  10. Description of Colponema vietnamica sp.n. and Acavomonas peruviana n. gen. n. sp., two new alveolate phyla (Colponemidia nom. nov. and Acavomonidia nom. nov. and their contributions to reconstructing the ancestral state of alveolates and eukaryotes.

    Directory of Open Access Journals (Sweden)

    Denis V Tikhonenkov

    Full Text Available The evolutionary and ecological importance of predatory flagellates are too often overlooked. This is not only a gap in our understanding of microbial diversity, but also impacts how we interpret their better-studied relatives. A prime example of these problems is found in the alveolates. All well-studied species belong to three large clades (apicomplexans, dinoflagellates, and ciliates, but the predatory colponemid flagellates are also alveolates that are rare in nature and seldom cultured, but potentially important to our understanding of alveolate evolution. Recently we reported the first cultivation and molecular analysis of several colponemid-like organisms representing two novel clades in molecular trees. Here we provide ultrastructural analysis and formal species descriptions for both new species, Colponema vietnamica n. sp. and Acavomonas peruviana n. gen. n. sp. Morphological and feeding characteristics concur with molecular data that both species are distinct members of alveolates, with Acavomonas lacking the longitudinal phagocytotic groove, a defining feature of Colponema. Based on ultrastructure and molecular phylogenies, which both provide concrete rationale for a taxonomic reclassification of Alveolata, we establish the new phyla Colponemidia nom. nov. for the genus Colponema and its close relatives, and Acavomonidia nom. nov. for the genus Acavomonas and its close relatives. The morphological data presented here suggests that colponemids are central to our understanding of early alveolate evolution, and suggest they also retain features of the common ancestor of all eukaryotes.

  11. Update of information on perkinsosis in NW Mediterranean coast: Identification of Perkinsus spp. (Protista) in new locations and hosts.

    Science.gov (United States)

    Ramilo, Andrea; Carrasco, Noelia; Reece, Kimberly S; Valencia, José M; Grau, Amalia; Aceituno, Patricia; Rojas, Mauricio; Gairin, Ignasi; Furones, M Dolores; Abollo, Elvira; Villalba, Antonio

    2015-02-01

    This study addressed perkinsosis in commercially important mollusc species in the western Mediterranean area. Perkinsus olseni was found in Santa Gilla Lagoon (Sardinia) infecting Ruditapes decussatus, Cerastoderma glaucum and Venerupis aurea, in Balearic Islands infecting Venus verrucosa and in Delta de l'Ebre (NE Spain) parasitising Ruditapes philippinarum and R. decussatus. Perkinsus mediterraneus was detected infecting Ostrea edulis from the Gulf of Manfredonia (SE Italy) and Alacant (E Spain), V. verrucosa and Arca noae from Balearic Islands and Chlamys varia from Balearic Islands, Alacant and Delta de l'Ebre. PMID:25553580

  12. Acute toxicity, uptake and accumulation kinetics of nickel in an invasive copepod species: Pseudodiaptomus marinus.

    Science.gov (United States)

    Tlili, Sofiène; Ovaert, Julien; Souissi, Anissa; Ouddane, Baghdad; Souissi, Sami

    2016-02-01

    Pseudodiaptomus marinus is a marine calanoid copepod originating of the Indo-Pacific region, who has successfully colonized new areas and it was recently observed in the European side of the Mediterranean Sea as well as in the North Sea. Actually, many questions were posed about the invasive capacity of this copepod in several non-native ecosystems. In this context, the main aim of this study was to investigate the tolerance and the bioaccumulation of metallic stress in the invasive copepod P. marinus successfully maintained in mass culture at laboratory conditions since 2 years. In order to study the metallic tolerance levels of P. marinus, an emergent trace metal, the nickel, was chosen. First, lethal concentrations determination experiments were done for 24, 48, 72 and 96 h in order to calculated LC50% but also to select a relevant ecological value for the suite of experiments. Then, three types of experiments, using a single concentration of nickel (correspond the 1/3 of 96 h-LC50%) was carried in order to study the toxico-kinetics of nickel in P. marinus. Concerning lethal concentrations, we observed that P. marinus was in the same range of sensitivity compared to other calanoid copepods exposed to nickel in the same standardized experimental conditions. Results showed that the uptake of nickel in P. marinus depends from the pathways of entrance (water of food), but also that Isochrysis galbana, used as a food source, has an important bioaccumulation capacity and a rapid uptake of nickel. PMID:26519805

  13. Evaluating potential artefacts of photo-reversal on behavioral studies with nocturnal invasive sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Barnett, Matthew; Imre, Istvan; Wagner, Michael C.; Di Rocco, Richard T.; Johnson, Nicholas; Brown, Grant E

    2016-01-01

    Sea lampreys (Petromyzon marinus L., 1758) are nocturnal, so experiments evaluating their behaviour to chemosensory cues have typically been conducted at night. However, given the brief timeframe each year that adult P. marinus are available for experimentation, we investigated whether P. marinus exposed to a 12 h shifted diurnal cycle (reversed photoperiod) could be tested in a darkened arena during the day and show the same response to chemosensory cues as natural photoperiod P. marinus that were tested during the night. Ten replicates of 10 P. marinus, from each photoperiod, were exposed to deionized water (negative control), 2-phenylethylamine hydrochloride (PEA HCl, putative predator cue), or P. marinus whole-body extract (conspecific alarm cue). All P. marinus demonstrated a significant avoidance response to both cues. No significant differences were found in avoidance to PEA HCl between photoperiods. Avoidance of P. marinus whole-body extract was significantly stronger in natural compared with reversed photoperiod P. marinus. The use of reversed photoperiod subjects is suitable for examining the presence or absence of avoidance in response to novel chemosensory alarm cues, or the change in the magnitude of antipredator response. Studies investigating the natural magnitude of antipredator response should use natural photoperiod experimental subjects.

  14. Hypersensitivity pneumonitis (extrinsic allergic alveolitis): high-resolution computed tomography findings

    International Nuclear Information System (INIS)

    Hypersensitivity pneumonitis, or extrinsic allergic alveolitis, is an immunologic disease of the lungs caused by inhaled chemicals or organics allergens. A lymphocytic inflammatory response in the peripheral airways and surrounding interstitial tissue occurs. In this study the high-resolution computed tomography findings of 13 patients with hypersensitivity pneumonitis were analyzed and discussed. The most frequent high-resolution computed tomography findings were: ground-glass opacities (92.3%), centrilobular nodules (38.4%) and air trapping (38.4%). Other findings included bronchiectasis (23.1%), consolidation (23.1%), crazy paving (7.7%), parenchymal bands (15.4%), linear opacities (7.7%), architectural distortion (7.7%), tracheal dilatation (7.7%), intralobular reticulate (7.7%), honeycombing (7.7%), emphysema (7.7%) and atelectasis (7.7%). In two of the 13 patients there was fibrosis (architectural distortion and honeycombing), which represents the chronic phase of the disease. (author)

  15. Functional, radiological and biological markers of alveolitis and infections of the lower respiratory tract in patients with systemic sclerosis

    Directory of Open Access Journals (Sweden)

    Danza Francesco

    2005-08-01

    Full Text Available Abstract Background A progressive lung disease and a worse survival have been observed in patients with systemic sclerosis and alveolitis. The objective of this study was to define the functional, radiological and biological markers of alveolitis in SSc patients. Methods 100 SSc patients (76 with limited and 24 with diffuse disease underwent a multistep assessment of cardiopulmonary system: pulmonary function tests (PFTs every 6–12 months, echocardiography, high resolution computed tomography (HRCT and bronchoalveolar lavage (BAL, if clinically advisable. Alveolar and interstitial scores on HRCT and IL-6 plasma levels were also assessed as lung disease activity indices. Results 90 SSc patients with abnormal PFTs and 3 with signs and/or symptoms of lung involvement and normal PFTs underwent HRCT and echocardiography. HRCT revealed evidence of fibrosis in 87 (93.5% patients, with 55 (59.1% showing both ground glass attenuation and fibrosis. In 42 patients who had exhibited ground glass on HRCT and consented to undergo BAL, 16 (38.1% revealed alveolitis. 12 (75% of these patients had restrictive lung disease (p 14 (OR(95%CIs:7.03(1.40–34.33. The alveolar score showed a significant correlation with IL-6 plasma levels (r = 0.36, p = 0.001 and with the skin score (r = 0.33, p = 0.001. Cultures of BAL fluid resulted positive in 10 (23.8% of the 42 patients that underwent BAL and after one year a deterioration in PFTs occurred in 8 (80% of these patients (p = 0.01. Pulmonary artery systolic pressure ≥ 40 mmHg was found in 6 (37.5% patients with alveolitis. Conclusion We found alveolitis only in 38.1% of the patients who had exhibited ground glass on HRCT and then underwent BAL, probably because the concomitant fibrosis influenced results. A diffuse skin involvement and a restrictive pattern on PFTs together with ground glass on HRCT were judged possible markers of alveolitis, a BAL examination being indicated as the next step. Nevertheless BAL

  16. The influence of sediment type on the distribution of the lesser sandeel, Ammodytes marinus

    DEFF Research Database (Denmark)

    Wright, P.J.; Jensen, Henrik; Tuck, I.

    programmes around the Shetland Isles. These data were used in a general additive model framework (GAM) to examine the relative significance of physical factors in influencing distribution. This analysis found that A. marinus were absent from sediments with a silt/clay content of >10% and densities declined......The lesser sandeel Ammodytes marinus (Raitt, 1934) is an important component of the North Sea ecosystem and the subject of the largest single species fishery in this region. However, little is known about the distribution of this species outside the areas where they are fished. This study examines...... the physical characteristics of the habitat of A. marinus in an attempt to predict the distribution of this species. The characteristics and topography of sandeel habitat were described from video observations. Data on abundance, sediment characteristics and depth were collected from benthic sampling...

  17. Semi-quantitative gallium-67 lung scanning as a measure of the intensity of alveolitis in pulmonary sarcoidosis

    International Nuclear Information System (INIS)

    Gallium-67 (67Ga) lung scanning has been applied for some years in pulmonary sarcoidosis to assess the activity of the alveolitis. Interpreting the scans, however, is difficult due to the low uptake of 67Ga in the disease process relative to background activity. In this study we have measured the mean parenchymal lung activity of 67Ga and have compared the lung activity to that at three remote sites, the liver, the abdomen and the high. The results obtained were compared with the percentage of lymphocytes in broncho-alveolar lavage fluid. There was a very good correlation with the lung-to-thigh uptake measurements and a much poorer correlation with the lung-to-liver and the lung-to-abdomen measurements. It was observed that steroid therapy reduced dramatically the correlation between the broncho-alveolar lavage findings and the 67Ga scan measurements. The results suggest that in patients not on steroid therapy, the 67Ga lung-to-thigh measurements may be used, similarly to the broncho-alveolar lavage lymphocyte counts, to identify those with high-intensity alveolitis from those with low-intensity alveolitis. (orig.)

  18. CFD Simulation and Experimental Validation of Fluid Flow and Particle Transport in a Model of Alveolated Airways.

    Science.gov (United States)

    Ma, Baoshun; Ruwet, Vincent; Corieri, Patricia; Theunissen, Raf; Riethmuller, Michel; Darquenne, Chantal

    2009-05-01

    Accurate modeling of air flow and aerosol transport in the alveolated airways is essential for quantitative predictions of pulmonary aerosol deposition. However, experimental validation of such modeling studies has been scarce. The objective of this study is to validate CFD predictions of flow field and particle trajectory with experiments within a scaled-up model of alveolated airways. Steady flow (Re = 0.13) of silicone oil was captured by particle image velocimetry (PIV), and the trajectories of 0.5 mm and 1.2 mm spherical iron beads (representing 0.7 to 14.6 mum aerosol in vivo) were obtained by particle tracking velocimetry (PTV). At twelve selected cross sections, the velocity profiles obtained by CFD matched well with those by PIV (within 1.7% on average). The CFD predicted trajectories also matched well with PTV experiments. These results showed that air flow and aerosol transport in models of human alveolated airways can be simulated by CFD techniques with reasonable accuracy. PMID:20161301

  19. Connecting alveolate cell biology with trophic ecology in the marine plankton using the ciliate Favella as a model.

    Science.gov (United States)

    Echevarria, Michael L; Wolfe, Gordon V; Strom, Suzanne L; Taylor, Alison R

    2014-10-01

    Planktonic alveolates (ciliates and dinoflagellates), key trophic links in marine planktonic communities, exhibit complex behaviors that are underappreciated by microbiologists and ecologists. Furthermore, the physiological mechanisms underlying these behaviors are still poorly understood except in a few freshwater model ciliates, which are significantly different in cell structure and behavior than marine planktonic species. Here, we argue for an interdisciplinary research approach to connect physiological mechanisms with population-level outcomes of behaviors. Presenting the tintinnid ciliate Favella as a model alveolate, we review its population ecology, behavior, and cellular/molecular biology in the context of sensory biology and synthesize past research and current findings to construct a conceptual model describing the sensory biology of Favella. We discuss how emerging genomic information and new technical methods for integrating research across different levels of biological organization are paving the way for rapid advance. These research approaches will yield a deeper understanding of the role that planktonic alveolates may play in biogeochemical cycles, and how they may respond to future ocean conditions. PMID:25039294

  20. The complete genome sequence of Staphylothermus marinus reveals differences in sulfur metabolism among heterotrophic Crenarchaeota

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, iain J.; Dharmarajan, Lakshmi; Rodriguez, Jason; Hooper, Sean; Porat, Iris; Ulrich, Luke E.; Elkins, James G.; Mavromatis, Kostas; Sun, Hui; Land, Miriam; Lapidus, Alla; Lucas, Susan; Barry, Kerrie; Huber, Harald; Zhulin, Igor B.; Whitman, William B.; Mukhopadhyay, Biswarup; Woese, Carl; Bristow, James; Kyrpides, Nikos

    2008-09-05

    Staphylothermus marinus is an anaerobic, sulfur-reducing peptide fermenter of the archaeal phylum Crenarchaeota. It is the third heterotrophic, obligate sulfur reducing crenarchaeote to be sequenced and provides an opportunity for comparative analysis of the three genomes. The 1.57 Mbp genome of the hyperthermophilic crenarchaeote Staphylothermus marinus has been completely sequenced. The main energy generating pathways likely involve 2-oxoacid:ferredoxin oxidoreductases and ADP-forming acetyl-CoA synthases. S. marinus possesses several enzymes not present in other crenarchaeotes including a sodium ion-translocating decarboxylase likely to be involved in amino acid degradation. S. marinus lacks sulfur-reducing enzymes present in the other two sulfur-reducing crenarchaeotes that have been sequenced - Thermofilum pendens and Hyperthermus butylicus. Instead it has three operons similar to the mbh and mbx operons of Pyrococcus furiosus, which may play a role in sulfur reduction and/or hydrogen production. The two marine organisms, S. marinus and H. butylicus, possess more sodium-dependent transporters than T. pendens and use symporters for potassium uptake while T. pendens uses an ATP-dependent potassium transporter. T. pendens has adapted to a nutrient-rich environment while H. butylicus is adapted to a nutrient-poor environment, and S. marinus lies between these two extremes. The three heterotrophic sulfur-reducing crenarchaeotes have adapted to their habitats, terrestrial vs. marine, via their transporter content, and they have also adapted to environments with differing levels of nutrients. Despite the fact that they all use sulfur as an electron acceptor, they are likely to have different pathways for sulfur reduction.

  1. [Allergic alveolitis in agricultural workers, caused by thermophilic bacteria or fungi].

    Science.gov (United States)

    Barzó, P; Molnár, L; Csokonay, L

    1989-01-01

    Between 1976-1986 fifty-seven patients with farmer's lung have been diagnosed in Hungary on the basis of data obtained from public institutes for tuberculosis. That are 0.08% of the 744,300 manual workers employed in agriculture and forestry. In the counties of Borsod and Szolnok the rate was 0.5% (referred to 62,900 and 36,000 individuals, respectively). Regional accumulation of the different provoking agent's and variation of disease prevalence seem to be in correlation with geographical, climatic, meteorological, economical and occupational factors, showing a declining tendency in recent years. Antibodies of the Thermoactinomyces vulgaris antigen could be detected most frequently. In the biopsy material of 17 patients obtained by Klassen biopsy were fibrosing and not fibrosing desquamative alveolitis, granulomas similar to sarcoidosis, bronchiolitis with peribronchial fibrosis observed. Mostly focal, rarely subpleural deficiencies were detected by lung-scintigraphy, their dimension in acute cases being greater than the extent of radiological lesions. On the basis of 5 Coombs positive cases authors consider conceivable that sometimes cytotoxic allergic reaction type II participates in the pathogenesis of farmer's lung. PMID:2686222

  2. Feast or flee: bioelectrical regulation of feeding and predator evasion behaviors in the planktonic alveolate Favella sp. (Spirotrichia).

    Science.gov (United States)

    Echevarria, Michael L; Wolfe, Gordon V; Taylor, Alison R

    2016-02-01

    Alveolate (ciliates and dinoflagellates) grazers are integral components of the marine food web and must therefore be able to sense a range of mechanical and chemical signals produced by prey and predators, integrating them via signal transduction mechanisms to respond with effective prey capture and predator evasion behaviors. However, the sensory biology of alveolate grazers is poorly understood. Using novel techniques that combine electrophysiological measurements and high-speed videomicroscopy, we investigated the sensory biology of Favella sp., a model alveolate grazer, in the context of its trophic ecology. Favella sp. produced frequent rhythmic depolarizations (∼500 ms long) that caused backward swimming and are responsible for endogenous swimming patterns relevant to foraging. Contact of both prey cells and non-prey polystyrene microspheres at the cilia produced immediate mechanostimulated depolarizations (∼500 ms long) that caused backward swimming, and likely underlie aggregative swimming patterns of Favella sp. in response to patches of prey. Contact of particles at the peristomal cavity that were not suitable for ingestion resulted in depolarizations after a lag of ∼600 ms, allowing time for particles to be processed before rejection. Ingestion of preferred prey particles was accompanied by transient hyperpolarizations (∼1 s) that likely regulate this step of the feeding process. Predation attempts by the copepod Acartia tonsa elicited fast (∼20 ms) animal-like action potentials accompanied by rapid contraction of the cell to avoid predation. We have shown that the sensory mechanisms of Favella sp. are finely tuned to the type, location, and intensity of stimuli from prey and predators. PMID:26567352

  3. [Pathogenetic and clinical significance of the adhesion molecule expression on T cells of the lung in sarcoid alveolitis].

    Science.gov (United States)

    Gerli, R; Galandrini, R; Agea, E; Bini, P; Tognellini, R

    1990-01-01

    A double immunofluorescence analysis of CD4+ cell population from bronchoalveolar lavage (BAL) fluid samples of patients with active pulmonary sarcoidosis was carried out. The results showed that, unlike BAL and peripheral blood CD4+ cells of healthy subjects, almost all BAL CD4+ cells of the patients highly express, besides CDw29 antigen, LFA-1 and ICAM-1 adhesion molecules. The co-expression of these molecules on BAL CD4+ cells during high intensity sarcoid alveolitis could represent a marker of immunological memory. The relevant pathogenetic and clinical implications of this observation are discussed. PMID:2199744

  4. De novo assembly of Manila clam (Ruditapes philippinarum and protozoan parasite (Perkinsus olseni transcriptome from RNA-Seq data

    Directory of Open Access Journals (Sweden)

    Abul Farah Md. Hasanuzzaman

    2014-06-01

    Full Text Available Manila clam (Ruditapes philippinarum with its high commercial value has become a major contributor to the world´s clam production from both bivalve fishery and aquaculture ventures. But, the production of manila clam is at greater risk from diseases, especially caused by Perkinsus olseni. Considering the limited genomic resources of R. philippinarum and P. olseni as well as the increasing interest in immune-genes response in the host, the present work was conducted to analyze the transcriptome profile of R. philippinarum and of P. olseni using RNA-Seq technology. Data obtained will be used to construct transcriptome databases and to design oligo-microarrays both in the host and the parasite for understanding their transcriptional expressions through host-pathogen interactions. cDNA libraries were synthesized using RNA aliquots of clam haemocytes and perkinsus trophozoites collected from different experimental conditions (in vitro, in vivo and natural environment for further sequencing carried out on Illumina HiSeq 2000 (Oxford Genomics Center, UK. A total of 131,037,742 pair-end reads for R. philippinarum and 67,840,472 for P. olseni were produced. De novo assembly was evaluated using different parameters of Trinity and Abyss assembler programs. De novo transcriptome of clam was further undergone through filtering steps by expression (> 5 FPKM, and length (500 bp for improving transcriptome quality. CAP3 software was executed to cluster final de novo transcriptomes. Trinity+CAP3 assembly was the best approach after manual evaluation of 30 annotated contigs randomly sampled from each strategy and was chosen finally to assemble transcriptomes. 33,182 unique transcripts (3,031 contigs and 30,151 singletons from de novo clam transcriptome, and 47,590 unique transcripts (7,251 contigs and 40,339 singletons from perkinsus transcriptome were obtained. Among them; 3,031 (9.13% unigenes of R. philippinarum, and 7,251 (15.24% of P. olseni were annotated

  5. Diet composition of the invasive cane toad (Chaunus marinus) on Rota, Northern Mariana Islands

    Science.gov (United States)

    Reed, R.N.; Bakkegard, K.A.; Desy, G.E.; Plentovich, S.M.

    2007-01-01

    The cane or marine toad (Chaunus marinus, formerly Bufo marinus) was introduced to the Northern Mariana Islands starting in the 1930s. The effects of this exotic predator on native vertebrates (especially lizards) are largely unknown. We analysed the stomach contents of 336 cane toads collected from the island of Rota, with the goal of estimating the level of toad predation on native vertebrates. Beetles, ants, millipedes, and grasshoppers/crickets comprised the majority of prey classes consumed by toads. The introduced Brahminy blindsnake (Ramphotyphlops braminus; N = 6) and conspecific cane toads (N = 4) were the vertebrates most commonly found in toad stomachs. Skinks (Emoia; N = 2) were the only native vertebrates represented in our sample. The small numbers of nocturnal terrestrial vertebrates native to Rota likely translates to relatively low rates of predation by cane toads on native vertebrates.

  6. Prevalencia del protozoario Perkinsus sp. en un cultivo de ostión japonés Crassostrea gigas en Sinaloa, México

    Directory of Open Access Journals (Sweden)

    Lizeth Carolina Villanueva-Fonseca

    2013-11-01

    Full Text Available Crassostrea gigas es un molusco bivalvo de gran importancia comercial. En el noroeste de México su producción es afectada por mortalidades cuyo origen infeccioso no ha sido determinado claramente. En este trabajo se determinó la prevalencia e intensidad de la infección por Perkinsus sp. en un cultivo de C. gigas en el ciclo 2011-2012. El cultivo se hizo en un sistema de línea suspendida con densidades de 28 y 42 ostiones/canasta y se determinó un tamaño de muestra de 30 ostiones por mes. La detección de Perkinsus sp. se hizo de acuerdo a los protocolos de la Organización Mundial de Sanidad Animal (OIE para Medio Fluido de Tioglicolato y PCR. Con ambos métodos se determinó la prevalencia de Perkinsus sp., que varió entre 3,3 y 40%. La intensidad de la infección estuvo en niveles 1 y 2, de acuerdo a la escala de Mackin. La mortalidad acumulativa en las densidades de 28 y 42 ostiones por canasta fue del 4 y 6%, respectivamente. Las mayores mortalidades del ostión y las mayores prevalencias de Perkinsus sp. ocurrieron en septiembre (2,7 y 16,6% y octubre (1,5 y 23,3%, respectivamente, cuando la temperatura fue alta. En conclusión, Perkinsus sp. fue detectado en un cultivo de C. gigas en el estero La Pitahaya con prevalencia moderada, baja intensidad de infección y mayor presencia en los meses más calurosos del ciclo de cultivo.

  7. Genetic compatibility and hatching success in the sea lamprey (Petromyzon marinus)

    OpenAIRE

    Rodríguez-Muñoz, Rolando; Tregenza, Tom

    2008-01-01

    Recent discussion of genetic benefits of polyandry and female mate choice has distinguished between two potential factors influencing offspring quality: (i) some males carry higher quality genes and (ii) males and females differ in their degree of genetic compatibility. We examined evidence for effects of good genes and genetic compatibility on embryonic survival of sea lamprey (Petromyzon marinus), a fish species with external fertilization that spawns in North Atlantic rivers. Using in vitr...

  8. Measurements of Lesser sandeel schools (Ammodytes marinus) using omnidirectional fisheries sonar

    OpenAIRE

    Vartdal, Didrik

    2012-01-01

    The coverage of this master thesis is 58 pages, with 25 Figures and 9 Tables. The Simrad SH90 high frequency omidirectional sonar was used in a field experiment in 2011 to acoustically investigate the distribution of Lesser sandeel (Ammodytes marinus) during the North Sea sandeel survey by the Norwegian research vessel Johan Hjort". The sonar was applied together with conventional echo sounder survey, with trawl and dredge sample stations at various point. During the survey, sonar screenshots...

  9. Diversity of Aplochiton fishes (Galaxiidea and the taxonomic resurrection of A. marinus.

    Directory of Open Access Journals (Sweden)

    Dominique Alò

    Full Text Available Aplochiton is a small genus of galaxiid fishes endemic to Patagonia and the Falkland Islands whose taxonomy is insufficiently resolved. Recent genetic analyses confirmed the existence of only two closely related species, Aplochiton taeniatus and Aplochiton zebra, while a third controversial species, Aplochiton marinus, remained lost to synonymy with A. taeniatus. Using an integrative taxonomy framework, we studied original samples and published sequences from a broad range in western Patagonia and the Falkland Islands, and generated robust species hypotheses based on single-locus (Cytochrome Oxidase subunit I; COI species-delineation methods and known diagnostic morphological characters analyzed in a multivariate context. Results revealed three distinct evolutionary lineages that morphologically resemble, in important respects, existing nominal species descriptions. Interestingly, the lineage associated with A. marinus was unambiguously identifiable (100% accuracy both from the genetic and morphological viewpoints. In contrast, the morphology of A. taeniatus and A. zebra overlapped substantially, mainly due to the high variability of A. taeniatus. Discriminant function analysis aided the identification of these species with 83.9% accuracy. Hence, for their unambiguous identification, genetic screening is needed. A. marinus has seldom been documented, and when recorded, it has always been found in sites with clear marine influence. It is possible that only A. marinus preserves a life cycle related to the sea akin to the hypothesized ancestral galaxiid. We did not find evidence of claimed diadromy in A. taeniatus or A. zebra, and, therefore, these should be regarded as freshwater species. Finally, a lack of phylogeographic patterns and overrepresentation of uncommon haplotypes suggested demographic expansions in recent evolutionary time, especially of A. zebra, in line with the hypothesis of large-scale range expansion and lineage spread in

  10. PAR-2, IL-4R, TGF-beta and TNF-alpha in bronchoalveolar lavage distinguishes extrinsic allergic alveolitis from sarcoidosis

    Czech Academy of Sciences Publication Activity Database

    Matěj, R.; Smětáková, M.; Vašáková, M.; Nováková, J.; Šterclová, M.; Kukal, J.; Olejár, Tomáš

    2014-01-01

    Roč. 8, č. 2 (2014), s. 533-538. ISSN 1792-0981 Institutional support: RVO:67985823 Keywords : sarcoidosis * extrinsic allergic alveolitis * interleukin 4 receptor * transforming growth factor beta * tumor necrosis factor alpha * proteinase activated receptor 2 Subject RIV: EC - Immunology Impact factor: 1.269, year: 2014

  11. Thyroid hormone and retinoid X receptor function and expression during sea lamprey (Petromyzon marinus) metamorphosis.

    Science.gov (United States)

    Manzon, Lori A; Youson, John H; Holzer, Guillaume; Staiano, Leopoldo; Laudet, Vincent; Manzon, Richard G

    2014-08-01

    Sea lampreys (Petromyzon marinus) are members of the ancient class Agnatha and undergo a metamorphosis that transforms blind, sedentary, filter-feeding larvae into free-swimming, parasitic juveniles. Thyroid hormones (THs) appear to be important for lamprey metamorphosis, however, serum TH concentrations are elevated in the larval phase, decline rapidly during early metamorphosis and remain low until metamorphosis is complete; these TH fluctuations are contrary to those of other metamorphosing vertebrates. Moreover, thyroid hormone synthesis inhibitors (goitrogens) induce precocious metamorphosis and exogenous TH treatments disrupt natural metamorphosis in P. marinus. Given that THs exert their effects by binding to TH nuclear receptors (TRs) that often act as heterodimers with retinoid X receptors (RXRs), we cloned and characterized these receptors from P. marinus and examined their expression during metamorphosis. Two TRs (PmTR1 and PmTR2) and three RXRs (PmRXRs) were isolated from P. marinus cDNA. Phylogenetic analyses group the PmTRs together on a branch prior to the gnathostome TRα/β split. The three RXRs also group together, but our data indicated that these transcripts are most likely either allelic variants of the same gene locus, or the products of a lamprey-specific duplication event. Importantly, these P. marinus receptors more closely resemble vertebrate as opposed to invertebrate chordate receptors. Functional analysis revealed that PmTR1 and PmTR2 can activate transcription of TH-responsive genes when treated with nanomolar concentrations of TH and they have distinct pharmacological profiles reminiscent of vertebrate TRβ and TRα, respectively. Also similar to other metamorphosing vertebrates, expression patterns of the PmTRs during lamprey metamorphosis suggest that PmTR1 has a dynamic, tissue-specific expression pattern that correlates with tissue morphogenesis and biochemical changes and PmTR2 has a more uniform expression pattern. This TR

  12. The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243) on Bufo marinus Larvae

    Science.gov (United States)

    Daniels, Olivia; Fabbro, Larelle; Makiela, Sandrine

    2014-01-01

    Limnothrix (strain AC0243) is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243) live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-l-alanine are discussed. PMID:24662524

  13. The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243 on Bufo marinus Larvae

    Directory of Open Access Journals (Sweden)

    Olivia Daniels

    2014-03-01

    Full Text Available Limnothrix (strain AC0243 is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243 live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-L-alanine are discussed.

  14. Detection of anti-cytokeratin 8 antibody in the serum of patients with cryptogenic fibrosing alveolitis and pulmonary fibrosis associated with collagen vascular disorders

    OpenAIRE

    Dobashi, N.; Fujita, J; Ohtsuki, Y; Yamadori, I; Yoshinouchi, T; Kamei, T.; Tokuda, M.; Hojo, S; Okada, H.; Takahara, J.

    1998-01-01

    BACKGROUND—It has been suggested that the humoral immune system plays a role in the pathogenesis of cryptogenic fibrosing alveolitis (CFA). Although circulating autoantibodies to lung protein(s) have been suggested, none of the lung proteins have been characterised. The purpose of this study was to determine the antigen to which the serum from patients with pulmonary fibrosis reacted.
METHODS—The anti-A549 cell antibody was characterised in a patient with CFA using Western i...

  15. Characterization of a thermophilic 4-O-β-D-mannosyl-D-glucose phosphorylase from Rhodothermus marinus.

    Science.gov (United States)

    Jaito, Nongluck; Saburi, Wataru; Odaka, Rei; Kido, Yusuke; Hamura, Ken; Nishimoto, Mamoru; Kitaoka, Motomitsu; Matsui, Hirokazu; Mori, Haruhide

    2014-01-01

    4-O-β-D-Mannosyl-D-glucose phosphorylase (MGP), found in anaerobes, converts 4-O-β-D-mannosyl-D-glucose (Man-Glc) to α-D-mannosyl phosphate and D-glucose. It participates in mannan metabolism with cellobiose 2-epimerase (CE), which converts β-1,4-mannobiose to Man-Glc. A putative MGP gene is present in the genome of the thermophilic aerobe Rhodothermus marinus (Rm) upstream of the gene encoding CE. Konjac glucomannan enhanced production by R. marinus of MGP, CE, and extracellular mannan endo-1,4-β-mannosidase. Recombinant RmMGP catalyzed the phosphorolysis of Man-Glc through a sequential bi-bi mechanism involving ternary complex formation. Its molecular masses were 45 and 222 kDa under denaturing and nondenaturing conditions, respectively. Its pH and temperature optima were 6.5 and 75 °C, and it was stable between pH 5.5-8.3 and below 80 °C. In the reverse reaction, RmMGP had higher acceptor preferences for 6-deoxy-D-glucose and D-xylose than R. albus NE1 MGP. In contrast to R. albus NE1 MGP, RmMGP utilized methyl β-D-glucoside and 1,5-anhydro-D-glucitol as acceptor substrates. PMID:25036679

  16. Sequential change of fibrosing alveolitis on high-resolution CT: correlation with finding at pulmonary function test and bronchoalveolar lavage

    International Nuclear Information System (INIS)

    To evaluate prospectively relationship between the extent of abnormalities of fibrosing alveolotro on high resolution CT and these of pulmonary function test, and bronchoalveolar lavage. This study included 27 patients with pathologically proved UIP. We prospectively analyzed correlation of the extent of ground glass opacity, consolidation, irregular lines with honeycombing on initial CT scan and quantitative change of ground glass opacity on follow up CT scans with pulmonary function test(PFT) and bronchoalveolar lavage(BAL). On initial CT scan, score of extent of disease significantly correlated with FEV1(r = -0.5148, ρ = 0.0310) and DLco(r -0.7102, ρ = 0.0001). Proportion of individual cell in BAL was not correlated with ground glass opacity or extent of disease; lymphocyte(ρ -0.0165, r = 0.9616), eosinophil (ρ = -0.0077, r = 0.9832), neutrophil (ρ = -0.1732, r = 0.5903). On follow up CT scan, quantitative change of ground glass opacity correlated with DLco/VA(r = -0.6825, ρ = 0.0025) and TLC (r = 0.5248, ρ = 0.0429). The quantitative analysis of extent of disease on HRCT in useful for evaluation of clinical status. Also change of ground glass opacity on follow-up HRCT significantly correlated with improvement of diffusing capacity in fibrosing alveolitis

  17. First record of Renibacterium salmoninarum in the sea lamprey (Petromyzon marinus).

    Science.gov (United States)

    Eissa, A E; Elsayed, E E; McDonald, R; Faisal, M

    2006-07-01

    Bacterial kidney disease (BKD), caused by Renibacterium salmoninarum, is a widespread problem with major implications for salmonid fish species. The mechanisms by which the bacterium has reached high levels of infection previously unrecorded in the Laurentian Great Lakes are presently unknown. Research involving reservoirs and mechanisms of R. salmoninarum transmission in fish is lacking because of the ecologic complexity of heterogeneous habitats and the lack of adequate funding. Herein, we report on the isolation of R. salmoninarum from the kidneys of the sea lamprey (Petromyzon marinus). The bacterium was cultured from kidneys of 16% and 4% of lampreys collected from two locations within the Lake Ontario watershed in 2003 and 2004, respectively. The identity of bacterial colonies was verified with the nested polymerase chain reaction and quantitative enzyme-linked immunosorbent assay. PMID:17092886

  18. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.

    Directory of Open Access Journals (Sweden)

    Toews Daniel P

    2001-10-01

    Full Text Available Abstract Background Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Results Venous return from the posterior region of Bufo marinus was measured under resting conditions and in response to a systemic hypervolemia. Doppler flow probes were positioned on the renal portal and ventral abdominal veins, and flow was recorded as injections of artificial plasma equaling 100% of the animal's plasma volume were administered through the sciatic artery. Resting flow was found to be 5.54 ± 2.03 ml min-1 kg-1 in the paired renal portal veins, and 7.31 ± 0.89 ml min-1 kg-1 in the ventral abdominal vein. While renal portal flow was found to increase by a factor of 2.4 times during the first 10 min of hypervolemia, ventral abdominal flow only increased by a factor of 1.3. Conclusions Our results quantify the contribution to circulation from posterior venous return in the toad Bufo marinus. A preferential movement of excess fluid through the renal portal pathway was also demonstrated, supporting the possibility of water elimination via the renal portal circulation, especially during periods of high water influx into the animals.

  19. Dyes Extracted from Safflower, Medicago Sativa, and Ros Marinus Oficinalis as Photosensitizers for Dye-sensitized Solar Cells

    Directory of Open Access Journals (Sweden)

    Sofyan A. Taya

    2016-03-01

    Full Text Available In this work, three extracts of plant leaves were used as sensitizers for dye-sensitized solar cells (DSSCs. These plants are Safflower, Medicago sativa and Ros marinus oficinalis. The natural dyes were extracted before and after grinding the plant leaves. The UV-VIS absorption spectra of the three extracts in ethyl alcohol solution were measured. The DSSCs were assembled using TiO2 films on Fluorine-doped tin oxide (FTO coated glass. The DSSCs sensitized with the extracts of grinded leaves showed a better performance compared to those sensitized with un-grinded leaves with the highest efficiency of 0.115 % was obtained for the DSSC sensitized with Medicago sativa. The performance of the DSSCs sensitized with Safflower and Ros marinus oficinalis was significantly improved by acid treatment of the FTO substrates. Impedance spectroscopy of the fabricated cells was also carried out.

  20. Sterility method of pest control and its potential role in an integrated sea lamprey (Petromyzon marinus) control program

    Science.gov (United States)

    Hanson, Lee H.; Manion, Patrick J.

    1980-01-01

    The sterility method of pest control could be an effective tool in the sea lamprey (Petromyzon marinus) control program in the Great Lakes. Some of the requirements for its successful application have been met. A field study demonstrated that the release of male sea lampreys, sterilized by the injection of 100 mg/kg of P,P-bis(1-aziridinyl)-N-methylphosphinothioic amide (bisazir), will reduce the number of viable larvae produced. The actual reduction in reproductive success that occurred was directly related to the ratio of sterile to normal males in the population. The technique can be used in many ways in an integrated control program and has considerable potential for the more effective control of the sea lamprey. Eradication is a distinct possibility.Key words: sea lamprey, Petromyzon marinus; pest control, fish control, sterile-male technique, sterilization, chemosterilants, bisazir, Great Lakes

  1. Weight-Length Relationships in Gafftopsail Catfish (Bagre marinus) and Hardhead Catfish (Ariopsis felis) in Louisiana Waters

    OpenAIRE

    Courtney, Joshua; Klinkmann, Taylor; Torano, Joseph; 2; Courtney, Michael

    2012-01-01

    In spite of the abundance and commercial importance of these two species, there is little published weight-length data for the gafftopsail catfish (Bagre marinus) and hardhead catfish (Ariopsis felis). For this study 84 catfish were caught (hook and line) from the Calcasieu Estuary in Southwest Louisiana near the Gulf of Mexico and estuaries and near shore waters close to bayou Lafourche. Using least squares regression, best fit curves were determined for weight (W) vs. total length (L) relat...

  2. Upstream migration, reproduction and fishery of sea lamprey (Petromyzon marinus Linnaeus, 1758) in the River Ulla (NW Spain)

    OpenAIRE

    Sergio Silva; Sandra Barca; María José Servia

    2015-01-01

    After a juvenile haematophagous stage developed mainly at sea, the sea lamprey Petromyzon marinus Linnaeus, 1758 stop feeding and return to the river to spawn. One of the main pressures in this stage is the presence of obstacles that reduce the accessible habitat, the mobility of individuals within this section and the energy resources available for gonad development and spawning. In addition, in the River Ulla, adults are targeted in a commercial fishery, using fyke-nets in the upper estuary...

  3. Estudio de la efectividad del gel bioadhesivo de clorhexidina en la prevención de la alveolitis y su valor coadyuvante en el postoperatorio tras la extracción de terceros molares inferiores retenidos

    OpenAIRE

    Torres-Lagares, Daniel

    2003-01-01

    La alveolitis es una complicación bastante frecuente tras la extracción, más aún cuando hablamos de la extracción de los terceros molares retenidos. En estos casos la osteítis alveolar es una patología de alto coste social, en forma de días de trabajo perdidos, baja de productividad, consultas de revisión por parte del cirujano y visitas al hospital. El 45% de los pacientes que desarrollan una alveolitis necesitan un mínimo de 4 visitas postoperatorias para diagnosticarla, tratarla y recupera...

  4. De novo transcriptome assembly of Perkinsus olseni trophozoite stimulated in vitro with Manila clam (Ruditapes philippinarum) plasma.

    Science.gov (United States)

    Hasanuzzaman, Abul Farah Md; Robledo, Diego; Gómez-Tato, Antonio; Alvarez-Dios, Jose A; Harrison, Peter W; Cao, Asunción; Fernández-Boo, Sergio; Villalba, Antonio; Pardo, Belén G; Martínez, Paulino

    2016-03-01

    The protistan parasite Perkinsus olseni is a deadly causative agent of perkinsosis, a molluscan disease affecting Manila clam (Ruditapes philippinarum), having a significant impact on world mollusc production. Deciphering the underlying molecular mechanisms in R. philippinarum-P. olseni interaction is crucial for controlling this parasitosis. The present study investigated the transcriptional expression in the parasite trophozoite using RNA-seq. Control and treatment (in vitro challenged with Manila clam-plasma) P. olseni trophozoite RNA were extracted and sequenced on the Illumina HiSeq 2000 instrument using a 100-bp paired-end sequencing strategy. Paired reads (64.7 million) were de novo assembled using Trinity, and the resultant transcripts were further clustered using CAP3. The re-constructed P. olseni transcriptome contains 47,590 unique transcripts of which 23,505 were annotated to 9764 unique proteins. A large number of genes were associated with Gene Ontology terms such as stress and immune-response, cell homeostasis, antioxidation, cell communication, signal transduction, signalling and proteolysis. Among annotated transcripts, a preliminary gene expression analysis detected 679 up-regulated and 478 down-regulated genes, linked to virulence factors, anti-oxidants, adhesion and immune-response molecules. Genes of several metabolic pathways such as DOXP/MEP, FAS II or folate biosynthesis, which are potential therapeutic targets, were identified. This study is the first description of the P. olseni transcriptome, and provides a substantial genomic resource for studying the molecular mechanisms of the host-parasite interaction in perkinsosis. In this sense, it is also the first evaluation of the parasite gene expression after challenge with clam extracellular products. PMID:26820448

  5. Stone-dwelling actinobacteria Blastococcus saxobsidens, Modestobacter marinus and Geodermatophilus obscurus proteogenomes

    KAUST Repository

    Sghaier, Haïtham

    2015-06-30

    The Geodermatophilaceae are unique model systems to study the ability to thrive on or within stones and their proteogenomes (referring to the whole protein arsenal encoded by the genome) could provide important insight into their adaptation mechanisms. Here we report the detailed comparative genome analysis of Blastococcus saxobsidens (Bs), Modestobacter marinus (Mm) and Geodermatophilus obscurus (Go) isolated respectively from the interior and the surface of calcarenite stones and from desert sandy soils. The genome-scale analysis of Bs, Mm and Go illustrates how adaptation to these niches can be achieved through various strategies including ‘molecular tinkering/opportunism’ as shown by the high proportion of lost, duplicated or horizontally transferred genes and ORFans. Using high-throughput discovery proteomics, the three proteomes under unstressed conditions were analyzed, highlighting the most abundant biomarkers and the main protein factors. Proteomic data corroborated previously demonstrated stone-related ecological distribution. For instance, these data showed starvation-inducible, biofilm-related and DNA-protection proteins as signatures of the microbes associated with the interior, surface and outside of stones, respectively.

  6. A new clarification method to visualize biliary degeneration during liver metamorphosis in sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Chung-Davidson, Yu-Wen; Davidson, Peter J.; Scott, Anne M.; Walaszczyk, Erin J.; Brant, Cory O.; Buchinger, Tyler; Johnson, Nicholas S.; Li, Weiming

    2014-01-01

    Biliary atresia is a rare disease of infancy, with an estimated 1 in 15,000 frequency in the southeast United States, but more common in East Asian countries, with a reported frequency of 1 in 5,000 in Taiwan. Although much is known about the management of biliary atresia, its pathogenesis is still elusive. The sea lamprey (Petromyzon marinus) provides a unique opportunity to examine the mechanism and progression of biliary degeneration. Sea lamprey develop through three distinct life stages: larval, parasitic, and adult. During the transition from larvae to parasitic juvenile, sea lamprey undergo metamorphosis with dramatic reorganization and remodeling in external morphology and internal organs. In the liver, the entire biliary system is lost, including the gall bladder and the biliary tree. A newly-developed method called “CLARITY” was modified to clarify the entire liver and the junction with the intestine in metamorphic sea lamprey. The process of biliary degeneration was visualized and discerned during sea lamprey metamorphosis by using laser scanning confocal microscopy. This method provides a powerful tool to study biliary atresia in a unique animal model.

  7. Stone-dwelling actinobacteria Blastococcus saxobsidens, Modestobacter marinus and Geodermatophilus obscurus proteogenomes.

    Science.gov (United States)

    Sghaier, Haïtham; Hezbri, Karima; Ghodhbane-Gtari, Faten; Pujic, Petar; Sen, Arnab; Daffonchio, Daniele; Boudabous, Abdellatif; Tisa, Louis S; Klenk, Hans-Peter; Armengaud, Jean; Normand, Philippe; Gtari, Maher

    2016-01-01

    The Geodermatophilaceae are unique model systems to study the ability to thrive on or within stones and their proteogenomes (referring to the whole protein arsenal encoded by the genome) could provide important insight into their adaptation mechanisms. Here we report the detailed comparative genome analysis of Blastococcus saxobsidens (Bs), Modestobacter marinus (Mm) and Geodermatophilus obscurus (Go) isolated respectively from the interior and the surface of calcarenite stones and from desert sandy soils. The genome-scale analysis of Bs, Mm and Go illustrates how adaptation to these niches can be achieved through various strategies including 'molecular tinkering/opportunism' as shown by the high proportion of lost, duplicated or horizontally transferred genes and ORFans. Using high-throughput discovery proteomics, the three proteomes under unstressed conditions were analyzed, highlighting the most abundant biomarkers and the main protein factors. Proteomic data corroborated previously demonstrated stone-related ecological distribution. For instance, these data showed starvation-inducible, biofilm-related and DNA-protection proteins as signatures of the microbes associated with the interior, surface and outside of stones, respectively. PMID:26125681

  8. A spatial age-structured model for describing sea lamprey (Petromyzon marinus) population dynamics

    Science.gov (United States)

    Robinson, Jason M.; Wilberg, Michael J.; Adams, Jean V.; Jones, Michael L.

    2013-01-01

    The control of invasive sea lampreys (Petromyzon marinus) presents large scale management challenges in the Laurentian Great Lakes. No modeling approach has been developed that describes spatial dynamics of lamprey populations. We developed and validated a spatial and age-structured model and applied it to a sea lamprey population in a large river in the Great Lakes basin. We considered 75 discrete spatial areas, included a stock-recruitment function, spatial recruitment patterns, natural mortality, chemical treatment mortality, and larval metamorphosis. Recruitment was variable, and an upstream shift in recruitment location was observed over time. From 1993–2011 recruitment, larval abundance, and the abundance of metamorphosing individuals decreased by 80, 84, and 86%, respectively. The model successfully identified areas of high larval abundance and showed that areas of low larval density contribute significantly to the population. Estimated treatment mortality was less than expected but had a large population-level impact. The results and general approach of this work have applications for sea lamprey control throughout the Great Lakes and for the restoration and conservation of native lamprey species globally.

  9. Effects of sex pheromones and sexual maturation on locomotor activity in female sea lamprey (Petromyzon marinus)

    Science.gov (United States)

    Walaszczyk, Erin J.; Johnson, Nicholas S.; Steibel, Juan Pedro; Li, Weiming

    2013-01-01

    Synchronization of male and female locomotor rhythmicity can play a vital role in ensuring reproductive success. Several physiological and environmental factors alter these locomotor rhythms. As sea lamprey, Petromyzon marinus, progress through their life cycle, their locomotor activity rhythm changes multiple times. The goal of this study was to elucidate the activity patterns of adult female sea lamprey during the sexual maturation process and discern the interactions of these patterns with exposure to male pheromones. During these stages, preovulated and ovulated adult females are exposed to sex pheromone compounds, which are released by spermiated males and attract ovulated females to the nest for spawning. The locomotor behavior of adult females was monitored in a natural stream with a passive integrated tag responder system as they matured, and they were exposed to a sex pheromone treatment (spermiated male washings) or a control (prespermiated male washings). Results showed that, dependent on the hour of day, male sex pheromone compounds reduce total activity (p sex pheromones modulate a locomotor rhythm in a vertebrate, and they suggest that the interaction between maturity stage and sex pheromone exposure contributes to the differential locomotor rhythms found in adult female sea lamprey. This phenomenon may contribute to the reproductive synchrony of mature adults, thus increasing reproductive success in this species.

  10. PCB concentrations and activity of sea lamprey Petromyzon marinus vary by sex

    Science.gov (United States)

    Madenjian, Charles P.; Johnson, Nicholas S.; Binder, Thomas R.; Rediske, Richard R.; O'Keefe, James P.

    2013-01-01

    We determined the polychlorinated biphenyl (PCB) concentrations of 40 male and 40 female adult sea lampreys Petromyzon marinus captured in the Cheboygan River, a tributary to Lake Huron, during May 2011. In addition, we performed a laboratory experiment using passive integrated transponder tags to determine whether male adult sea lampreys were more active than female adult sea lampreys. Sex had a significant effect on PCB concentration, and PCB concentration at a given level of sea lamprey condition was approximately 25 % greater in males than in females. Adjusting for the difference in condition between the sexes, males averaged a 17 % greater PCB concentration compared with females. Results from the laboratory experiment indicated that males were significantly more active than females. The observed sex difference in PCB concentrations was not due to female sea lampreys releasing eggs at spawning because the sea lamprey is semelparous, and we caught the sea lampreys before spawning. Rather, we attributed the sex difference in PCB concentrations to a greater rate of energy expenditure in males compared with females. We proposed that this greater rate of energy expenditure was likely due to greater activity. Our laboratory experiment results supported this hypothesis. A greater resting metabolic rate may also have contributed to a greater rate of energy expenditure. Our findings should eventually be applicable toward improving control of sea lamprey, a pest responsible for considerable damage to fisheries in lakes where it is not native.

  11. Larval mortality rates and population dynamics of Lesser Sandeel ( Ammodytes marinus) in the northwestern North Sea

    Science.gov (United States)

    Heath, Michael R.; Rasmussen, Jens; Bailey, Martin C.; Dunn, John; Fraser, John; Gallego, Alejandro; Hay, Stephen J.; Inglis, Michelle; Robinson, Susan

    2012-05-01

    Intense fishing of a stock of sandeels ( Ammodytes marinus) on the sand banks off the Firth of Forth, northeast Scotland, during the 1990s led to a decline in catch per unit effort to uneconomic levels and collateral failures of piscivorous seabird breeding success at nearby colonies. A prohibition on fishing in 1999 was followed by a short-term recovery of stock biomass, but then a sustained decline to very low levels of abundance. Demographic survey data show that despite the decline in stock, recruit abundance was maintained implying an increasing larval survival rate, and that the stock decline was not due to recruitment failure. To verify this hypothesis we analysed a 10-year long data set of weekly catches of sandeel larvae at a nearby plankton monitoring site to determine the patterns of larval mortality and dispersal. We found that the loss rate of larvae up to 20 d age decreased over time, corresponding with the trend in survival rate implied by the stock demography data. The pattern of loss rate in relation to hatchling abundance implied that mortality may have been density dependent. Our study rules out increased larval mortality as the primary cause of decline in the sandeel stock.

  12. Separation and identification of cathepsin of non irradiated and irradiated red-fish (Sebates marinus)

    International Nuclear Information System (INIS)

    Cathepsin originated from Sebates marinus muscle hydrolyzed denatured hemoglobin optimally at pH 5. At pH 3 this phenomenon was also detected eventhough with lower intensity. Partial purification by ammonium sulfate fractionation technique was not suitable for the separation of protein contaminants from the active enzyme. By column gel filtration through Sephadex G-75 superfine, fractions with high cathepsin specific activity were recovered i.e. fractions with molecular weights between 15,000-20,000 Daltons. These fractions showed isoelectric components in the pH range of 4.5 - 8 with the predominant protein zones at pH 4.5 - 5. In fish irradiated at a dose of 0.3 Mrad, the gel filtration pattern was not essentially changed. However on focusing the 15,000 - 20,000 Dalton fraction, the isoelectric pattern showed some minor changes, especially the accumulation of protein in the range of pH 4.5 - 5. (author)

  13. Hypersensitivity pneumonitis (extrinsic allergic alveolitis): high-resolution computed tomography findings; Pneumonite por hipersensibilidade (alveolite alergica extrinseca): achados na tomografia computadorizada de alta resolucao

    Energy Technology Data Exchange (ETDEWEB)

    Almeida Junior, Jose Guiomar de; Marchiori, Edson [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Faculdade de Ciencias Medicas. Dept. de Radiologia]. E-mail: edmarchiori@zipmail.com.br; Escuissato, Dante L. [Parana Univ., Curitiba, PR (Brazil). Dept. de Radiologia; Souza Junior, Arthur Soares [Faculdade de Medicina de Sao Jose do Rio Preto (FAMERP), SP (Brazil). Dept. de Radiologia; Gasparetto, Emerson L. [Parana Univ., Curitiba, PR (Brazil). Hospital de Clinicas; Nobre, Luiz Felipe [Santa Catarina Univ., Florianopolis, SC (Brazil); Irion, Klaus L. [Santa Casa de Misericordia de Porto Alegre, RS (Brazil). Pavilhao Pereira Filho. Servico de Radiologia

    2003-12-01

    Hypersensitivity pneumonitis, or extrinsic allergic alveolitis, is an immunologic disease of the lungs caused by inhaled chemicals or organics allergens. A lymphocytic inflammatory response in the peripheral airways and surrounding interstitial tissue occurs. In this study the high-resolution computed tomography findings of 13 patients with hypersensitivity pneumonitis were analyzed and discussed. The most frequent high-resolution computed tomography findings were: ground-glass opacities (92.3%), centrilobular nodules (38.4%) and air trapping (38.4%). Other findings included bronchiectasis (23.1%), consolidation (23.1%), crazy paving (7.7%), parenchymal bands (15.4%), linear opacities (7.7%), architectural distortion (7.7%), tracheal dilatation (7.7%), intralobular reticulate (7.7%), honeycombing (7.7%), emphysema (7.7%) and atelectasis (7.7%). In two of the 13 patients there was fibrosis (architectural distortion and honeycombing), which represents the chronic phase of the disease. (author)

  14. Dyes Extracted from Safflower, Medicago Sativa, and Ros Marinus Oficinalis as Photosensitizers for Dye-sensitized Solar Cells

    OpenAIRE

    Sofyan A. Taya; Taher M. El-Agez; Monzir S. Abdel-Latif; Hatem Ghamri; Amal Batniji; Wael A. Tabaza

    2016-01-01

    In this work, three extracts of plant leaves were used as sensitizers for dye-sensitized solar cells (DSSCs). These plants are Safflower, Medicago sativa and Ros marinus oficinalis. The natural dyes were extracted before and after grinding the plant leaves. The UV-VIS absorption spectra of the three extracts in ethyl alcohol solution were measured. The DSSCs were assembled using TiO2 films on Fluorine-doped tin oxide (FTO) coated glass. The DSSCs sensitized with the extracts of grinded leaves...

  15. Ionoregulatory changes during metamorphosis and salinity exposure of juvenile sea lamprey (Petromyzon marinus L.)

    Science.gov (United States)

    Reis-Santos, P.; McCormick, S.D.; Wilson, J.M.

    2008-01-01

    Ammocoetes of the anadromous sea lamprey Petromyzon marinus L. spend many years in freshwater before metamorphosing and migrating to sea. Metamorphosis involves the radical transformation from a substrate-dwelling, filter feeder into a free-swimming, parasitic feeder. In the present work we examined osmoregulatory differences between ammocoetes and transformers (metamorphic juveniles), and the effects of salinity acclimation. We measured the expression of key ion-transporting proteins [Na+/K+-ATPase, vacuolar (V)-type H+-ATPase and carbonic anhydrase (CA)] as well as a number of relevant blood parameters (hematocrit, [Na+] and [Cl -]). In addition, immunofluorescence microscopy was used to identify and characterize the distributions of Na+/K+-ATPase, V-type H+-ATPase and CA immunoreactive cells in the gill. Ammocoetes did not survive in the experiments with salinities greater than 10???, whereas survival in high salinity (???25-35???) increased with increased degree of metamorphosis in transformers. Plasma [Na+] and [Cl -] of ammocoetes in freshwater was lower than transformers and increased markedly at 10???. In transformers, plasma ions increased only at high salinity (>25???). Branchial Na+/K+-ATPase levels were ??? tenfold higher in transformers compared to ammocoetes and salinity did not affect expression in either group. However, branchial H +-ATPase expression showed a negative correlation with salinity in both groups. Na+/K+-ATPase immunoreactivity was strongest in transformers and associated with clusters of cells in the interlamellar spaces. H+-ATPase (B subunit) immunoreactivity was localized to epithelial cells not expressing high Na+/K+-ATPase immunoreactivity and having a similar tissue distribution as carbonic anhydrase. The results indicate that branchial Na+/K+-ATPase and salinity tolerance increase in metamorphosing lampreys, and that branchial H+-ATPase is downregulated by salinity.

  16. Moonlight receptor of the "1-h-midge" Clunio marinus studied by micro-XRF

    Science.gov (United States)

    Falkenberg, G.; Fleissner, Ge; Neumann, D.; Wellenreuther, G.; Alraun, P.; Fleissner, Gue

    2013-10-01

    Melanin is a pigment widely occurring in animals, plants, fungi and algae. It does not only colour skin, hair and eyes but serves mainly as photoprotectant and prevents overload with minerals induced by inflammations, infections and degenerative diseases. Therefore, the mechanisms underlying melanisation gained increasing interest in the field of biomedical research and clinic. So far, the processes of melanogenesis are only partly analysed, nearly nothing is known on a putative switch between melanins of different types. Here we offer a model organism to study these mechanisms as part of a naturally cycling change of transparency of the retinal shielding pigment. A marine midge, Clunio marinus, living in coastal regions, underlies a complex timing of its development by solar and lunar climatic periodicities, which synchronise biological clocks. The question was how the animals can discriminate changing sunlight from moonlight intensities. For the first time, we could show a "moonlight window" in the larval ocelli of this midge, and propose a hypothesis on the underlying mechanisms. Driven by a lunar clock the image forming ocelli become transparent and convert during moonlit nights to a sensitive photometer, which can record the dynamics of environmental light. High resolution X-ray fluorescence (XRF) measurements of the distribution of trace minerals in single melanosomes combined with their fine structural details in various states of the lunar cycle provide a first insight into the enzymatic pathways for the generation of a dark melanin (like eumelanin) and a light coloured melanin (like phaeomelanin). Essential advantage of this approach is the spatial and temporal resolution of the metals associated with melanisation processes, which could never before be demonstrated in these details. The data may stimulate further research projects in biomedicine.

  17. Host selection and lethality of attacks by sea lampreys (Petromyzon marinus) in laboratory studies

    Science.gov (United States)

    Swink, William D.

    2003-01-01

    Parasitic-phase sea lampreys (Petromyzon marinus) are difficult to study in the wild. A series of laboratory studies (1984-1995) of single attacks on lake trout (Salvelinus namaycush), rainbow trout (Oncorhynchus mykiss), and burbot (Lota lota) examined host size selection; determined the effects of host size, host species, host strain, and temperature on host mortality; and estimated the weight of hosts killed per lamprey. Rainbow trout were more able and burbot less able to survive attacks than lake trout. Small sea lampreys actively selected the larger of two small hosts; larger sea lampreys attacked larger hosts in proportion to the hosts' body sizes, but actively avoided shorter hosts (a?? 600 mm) when larger were available. Host mortality was significantly less for larger (43-44%) than for smaller hosts (64%). However, the yearly loss of hosts per sea lamprey was less for small hosts (range, 6.8-14.2 kg per sea lamprey) than larger hosts (range, 11.4-19.3 kg per sea lamprey). Attacks at the lower of two temperature ranges (6.1-11.8A?C and 11.1-15.0A?C) did not significantly reduce the percentage of hosts killed (54% vs. 69%, p > 0.21), but longer attachment times at lower temperatures reduced the number of hosts attacked (33 vs. 45), and produced the lowest loss of hosts (6.6 kg per sea lamprey). Low temperature appeared to offset other factors that increase host mortality. Reanalysis of 789 attacks pooled from these studies, using forward stepwise logistic regression, also identified mean daily temperature as the dominant factor affecting host mortality. Observations in Lakes Superior, Huron, and Ontario support most laboratory results.

  18. Characterization of Somatically-Eliminated Genes During Development of the Sea Lamprey (Petromyzon marinus).

    Science.gov (United States)

    Bryant, Stephanie A; Herdy, Joseph R; Amemiya, Chris T; Smith, Jeramiah J

    2016-09-01

    The sea lamprey (Petromyzon marinus) is a basal vertebrate that undergoes developmentally programmed genome rearrangements (PGRs) during early development. These events facilitate the elimination of ∼20% of the genome from the somatic cell lineage, resulting in distinct somatic and germline genomes. Thus far only a handful of germline-specific genes have been definitively identified within the estimated 500 Mb of DNA that is deleted during PGR, although a few thousand germline-specific genes are thought to exist. To improve our understanding of the evolutionary/developmental logic of PGR, we generated computational predictions to identify candidate germline-specific genes within a new transcriptomic dataset derived from adult germline and the early embryonic stages during which PGR occurs. Follow-up validation studies identified 44 germline-specific genes and further characterized patterns of transcription and DNA loss during early embryogenesis. Expression analyses reveal that many of these genes are differentially expressed during early embryogenesis and presumably function in the early development of the germline. Ontology analyses indicate that many of these germline-specific genes play known roles in germline development, pluripotency, and oncogenesis (when misexpressed). These studies provide support for the theory that PGR serves to segregate molecular functions related to germline development/pluripotency in order to prevent their potential misexpression in somatic cells. This larger set of eliminated genes also allows us to extend the evolutionary/developmental breadth of this theory, as some deleted genes (or their gnathostome homologs) appear to be associated with the early development of somatic lineages, perhaps through the evolution of novel functions within gnathostome lineages. PMID:27288344

  19. Moonlight receptor of the '1-h-midge' Clunio marinus studied by micro-XRF

    International Nuclear Information System (INIS)

    Melanin is a pigment widely occurring in animals, plants, fungi and algae. It does not only colour skin, hair and eyes but serves mainly as photoprotectant and prevents overload with minerals induced by inflammations, infections and degenerative diseases. Therefore, the mechanisms underlying melanisation gained increasing interest in the field of biomedical research and clinic. So far, the processes of melanogenesis are only partly analysed, nearly nothing is known on a putative switch between melanins of different types. Here we offer a model organism to study these mechanisms as part of a naturally cycling change of transparency of the retinal shielding pigment. A marine midge, Clunio marinus, living in coastal regions, underlies a complex timing of its development by solar and lunar climatic periodicities, which synchronise biological clocks. The question was how the animals can discriminate changing sunlight from moonlight intensities. For the first time, we could show a 'moonlight window' in the larval ocelli of this midge, and propose a hypothesis on the underlying mechanisms. Driven by a lunar clock the image forming ocelli become transparent and convert during moonlit nights to a sensitive photometer, which can record the dynamics of environmental light. High resolution X-ray fluorescence (XRF) measurements of the distribution of trace minerals in single melanosomes combined with their fine structural details in various states of the lunar cycle provide a first insight into the enzymatic pathways for the generation of a dark melanin (like eumelanin) and a light coloured melanin (like phaeomelanin). Essential advantage of this approach is the spatial and temporal resolution of the metals associated with melanisation processes, which could never before be demonstrated in these details. The data may stimulate further research projects in biomedicine

  20. Serum and hepatic vitamin A levels in captive and wild marine toads (Bufo marinus).

    Science.gov (United States)

    Berkvens, Charlene N; Lentini, Andrew; Dutton, Christopher J; Pearl, David L; Barker, Ian K; Crawshaw, Graham J

    2014-01-01

    The captive breeding program for the endangered Puerto Rican crested toad (Peltophryne [Bufo] lemur) has been hampered by an undiagnosed condition called "Brown Skin Disease" (BSD). Toads develop widespread skin darkening, skin thickening and abnormal shedding and eventually succumb to a chronic loss of viability. This project evaluated the marine toad (Bufo marinus) as a model for the PRCT, examining vitamin A deficiency as a potential cause of BSD. Wild caught marine toads had significantly higher liver vitamin A concentrations (61.89 ± 63.49 µg/g) than captive born marine toads (0.58 ± 0.59 µg/g); P<0.001). A significant difference in serum vitamin A concentration was found between the captive and wild caught toads (P=0.013) and between the low vitamin A-fed and wild caught toads (P=0.004), when controlling for liver vitamin A concentrations. After captive toads were treated with topical and/or oral vitamin A, their hepatic vitamin A concentrations were similar to those of the wild toads, averaging 48.41 ± 37.03 µg/g. However, plasma vitamin A concentrations pre- and post-vitamin A supplementation did not differ statistically. We concluded that plasma vitamin A concentrations do not provide a linear indication of liver/body vitamin A status, and that both topical and oral supplementation with an oil-based vitamin A formulation can increase liver stores in amphibians. No evidence of BSD or other signs of deficiency were noted in the marine toads, although this feeding trial was relatively short (127 days). To date, clinical, pathological and research findings do not support vitamin A deficiency as a primary factor underlying BSD. PMID:25230391

  1. Differential Effects of Sex Pheromone Compounds on Adult Female Sea Lamprey (Petromyzon marinus) Locomotor Patterns.

    Science.gov (United States)

    Walaszczyk, Erin J; Goheen, Benjamin B; Steibel, Juan Pedro; Li, Weiming

    2016-06-01

    Synchronization of male and female locomotor activity plays a critical role in ensuring reproductive success, especially in semelparous species. The goal of this study was to elucidate the effects of individual chemical signals, or pheromones, on the locomotor activity in the sea lamprey (Petromyzon marinus). In their native habitat, adult preovulated females (POF) and ovulated females (OF) are exposed to sex pheromone compounds that are released from spermiated males and attract females to nests during their migration and spawning periods. In this study, locomotor activity of individual POF and OF was measured hourly in controlled laboratory conditions using an automated video-tracking system. Differences in the activity between a baseline day (no treatment exposure) and a treatment day (sex pheromone compound or control exposure) were examined for daytime and nighttime periods. Results showed that different pheromone compound treatments affected both POF and OF sea lamprey (p < 0.05) but in different ways. Spermiated male washings (SMW) and one of its main components, 7α,12α,24-trihydroxy-5α-cholan-3-one 24 sulfate (3kPZS), decreased activity of POF during the nighttime. SMW also reduced activity in POF during the daytime. In contrast, SMW increased activity of OF during the daytime, and an additional compound found in SMW, petromyzonol sulfate (PZS), decreased the activity during the nighttime. In addition, we examined factors that allowed us to infer the overall locomotor patterns. SMW increased the maximum hourly activity during the daytime, decreased the maximum hourly activity during the nighttime, and reduced the percentage of nocturnal activity in OF. Our findings suggest that adult females have evolved to respond to different male compounds in regards to their locomotor activity before and after final maturation. This is a rare example of how species-wide chemosensory stimuli can affect not only the amounts of activity but also the overall locomotor

  2. Anadromous sea lampreys (Petromyzon marinus) are ecosystem engineers in a spawning tributary

    Science.gov (United States)

    Hogg, Robert S.; Coghlan Jr., Stephen M.; Zydlewski, Joseph; Simon, Kevin S.

    2014-01-01

    Sea lampreys (Petromyzon marinus) disturb the substratum during nest construction and alter the physical habitat, potentially affecting other stream organisms. We quantified differences in depth, velocity, fine-sediment coverage, embeddedness, intragravel permeability and benthic invertebrate assemblages (density and diversity) among nest mounds, nest pits and undisturbed reference locations over a 4-month period after June spawning. In 2010 and 2011, immediate and persistent effects of nest construction were assessed in summer (July) and in autumn (late September to early October), respectively. Randomly selected nests were sampled annually (25 each in summer and autumn). Nest construction increased stream-bed complexity by creating and juxtaposing shallow, swift, rocky habitat patches with deep, slow, sandy habitat patches. Mounds had a 50–143% less cover of fine sediment, and a 30–62% reduction in embeddedness, compared to pits and reference locations. These physical changes persisted into the autumn (almost 4 months). Five insect families contributed 74% of the benthic invertebrate abundance: Chironomidae (27%), Hydropsychidae (26%), Heptageniidae (8%), Philopotamidae (7%) and Ephemerellidae (6%). Densities of Hydropsychidae, Philopotamidae and Heptageniidae were up to 10 times greater in mounds than in pits and adjacent reference habitat. In summer, mounds had twice the density of Chironomidae than did pits, and 1.5 times more than reference habitats, but densities were similar among the habitats in autumn. These results suggest that spawning sea lampreys are ecosystem engineers. The physical disturbance caused by nest-building activity was significant and persistent, increasing habitat heterogeneity and favouring pollution-sensitive benthic invertebrates and, possibly, drift-feeding fish.

  3. An extremely thermostable amylopullulanase from Staphylothermus marinus displays both pullulan- and cyclodextrin-degrading activities.

    Science.gov (United States)

    Li, Xiaolei; Li, Dan; Park, Kwan-Hwa

    2013-06-01

    A gene encoding an amylopullulanase of the glycosyl hydrolase (GH) family 57 from Staphylothermus marinus (SMApu) was heterologously expressed in Escherichia coli. SMApu consisted of 639 amino acids with a molecular mass of 75.3 kDa. It only showed maximal amino acid identity of 17.1 % with that of Pyrococcus furiosus amylopullulanase in all identified amylases. Not like previously reported amylopullulanases, SMApu has no signal peptide but contains a continuous GH57N_Apu domain. It had the highest catalytic efficiency toward pullulan (k cat/K m , 342.34 s(-1) mL mg(-1)) and was extremely thermostable with maximal pullulan-degrading activity (42.1 U/mg) at 105 °C and pH 5.0 and a half-life of 50 min at 100 °C. Its activity increased to 116 % in the presence of 5 mM CaCl2. SMApu could also degrade cyclodextrins, which are resistant to the other amylopullulanases. The initial hydrolytic products from pullulan, γ-CD, and 6-O-maltooligosyl-β-CD were [6)-α-D-Glcp-(1 → 4)-α-D-Glcp-(1 → 4)-α-D-Glcp-(1→]n, maltooctaose, and single maltooligosaccharide plus β-CD, respectively. The final hydrolytic products from above-mentioned substrates were maltose and glucose. These results confirm that SMApu is a novel amylopullulanase of the family GH57 possessing the cyclodextrin-degrading activity of cyclomaltodextrinase. PMID:23001056

  4. Effects of salinity on upstream-migrating, spawning sea lamprey, Petromyzon marinus

    Science.gov (United States)

    Ferreira-Martins, D.; Coimbra, J.; Antunes, C.; Wilson, J. M.

    2016-01-01

    The sea lamprey, Petromyzon marinus, is an anadromous, semelparous species that is vulnerable to endangered in parts of its native range due in part to loss of spawning habitat because of man-made barriers. The ability of lampreys to return to the ocean or estuary and search out alternative spawning river systems would be limited by their osmoregulatory ability in seawater. A reduction in tolerance to salinity has been documented in migrants, although the underlying mechanisms have not been characterized. We examined the capacity for marine osmoregulation in upstream spawning migrants by characterizing the physiological effects of salinity challenge from a molecular perspective. Estuarine-captured migrants held in freshwater (FW) for ∼1 week (short-term acclimation) or 2 months (long-term acclimation) underwent an incremental salinity challenge until loss of equilibrium occurred and upper thresholds of 25 and 17.5, respectively, occurred. Regardless of salinity tolerance, all lamprey downregulated FW ion-uptake mechanisms [gill transcripts of Na+:Cl− cotransporter (NCC/slc12a3) and epithelial Na+ channel (ENaC/scnn1) and kidney Na+/K+-ATPase (NKA) protein and activity but not transcript]. At their respective salinity limits, lamprey displayed a clear osmoregulatory failure and were unable to regulate [Na+] and [Cl−] in plasma and intestinal fluid within physiological limits, becoming osmocompromised. A >90% drop in haematocrit indicated haemolysis, and higher plasma concentrations of the cytosolic enzymes alanine aminotransferase, aspartate aminotransferase and lactate dehydrogenase indicated damage to other tissues, including liver. However, >80% of short-term FW-acclimated fish were able to osmoregulate efficiently, with less haemolysis and tissue damage. This osmoregulatory ability was correlated with significant upregulation of the secretory form of Na+:K+:2Cl− cotransporter (NKCC1/slc12a2) transcript levels and the re-emergence of seawater

  5. Upstream migration, reproduction and fishery of sea lamprey (Petromyzon marinus Linnaeus, 1758 in the River Ulla (NW Spain

    Directory of Open Access Journals (Sweden)

    Sergio Silva

    2015-11-01

    Full Text Available After a juvenile haematophagous stage developed mainly at sea, the sea lamprey Petromyzon marinus Linnaeus, 1758 stop feeding and return to the river to spawn. One of the main pressures in this stage is the presence of obstacles that reduce the accessible habitat, the mobility of individuals within this section and the energy resources available for gonad development and spawning. In addition, in the River Ulla, adults are targeted in a commercial fishery, using fyke-nets in the upper estuary and fishing in pesqueiras, which are stone constructions placed on the river bed, in the low section of the river. This study advances in the knowledge of the upstream migration (and related impact of barriers, reproduction and fishery of P. marinus in the River Ulla. The study combined fieldwork (radiotelemetry tracking of 19 adults in years 2012 and 2013 and inventory and characterization of obstacles, with information on the capture of lampreys (years 2000 to 2010 by commercial fishing and by a fixed trap located in the middle section of the river. The migration period in this river runs from January, or even December, until June, followed by reproduction in May and June. A total of 48 anthropogenic obstacles (all small-medium sized barriers except the last three, which are impassable, including 20 pesqueiras, were identified as a relevant obstacle for sea lamprey migration (which joins the impact of fishing performed in these sites. Hence, still more attention must be paid to "small" barriers, as pesqueiras, and to fisheries to properly conserve and manage populations of this and other anadromous lamprey species.

  6. Subcellular localization of the magnetosome protein MamC in the marine magnetotactic bacterium Magnetococcus marinus strain MC-1 using immunoelectron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Valverde-Tercedor, C [Universidad de Granada; Abada-Molina, F [Universidad de Granada; Martinez-Bueno, M [Universidad de Granada; Pineda-Molina, Estela [Laboratorio de Estudios Cristalograficos; Chen, Lijun [Ohio State University; Oestreicher, Zachery [Ohio State University; Lower, Brian H [Ohio State University; Lower, Steven K [Ohio State University; Bazylinski, Dennis A [Ames Laboratory; Jimenez-Lopez, C [Universidad de Granada

    2014-04-24

    Magnetotactic bacteria are a diverse group of prokaryotes that biomineralize intracellular magnetosomes, composed of magnetic (Fe3O4) crystals each enveloped by a lipid bilayer membrane that contains proteins not found in other parts of the cell. Although partial roles of some of these magnetosome proteins have been determined, the roles of most have not been completely elucidated, particularly in how they regulate the biomineralization process. While studies on the localization of these proteins have been focused solely on Magnetospirillum species, the goal of the present study was to determine, for the first time, the localization of the most abundant putative magnetosome membrane protein, MamC, in Magnetococcus marinus strain MC-1. MamC was expressed in Escherichia coli and purified. Monoclonal antibodies were produced against MamC and immunogold labeling TEM was used to localize MamC in thin sections of cells of M. marinus. Results show that MamC is located only in the magnetosome membrane of Mc. marinus. Based on our findings and the abundance of this protein, it seems likely that it is important in magnetosome biomineralization and might be used in controlling the characteristics of synthetic nanomagnetite.

  7. Ultraviolet stress delays chromosome replication in light/dark synchronized cells of the marine cyanobacterium Prochlorococcus marinus PCC9511

    Directory of Open Access Journals (Sweden)

    Blot Nicolas

    2010-07-01

    Full Text Available Abstract Background The marine cyanobacterium Prochlorococcus is very abundant in warm, nutrient-poor oceanic areas. The upper mixed layer of oceans is populated by high light-adapted Prochlorococcus ecotypes, which despite their tiny genome (~1.7 Mb seem to have developed efficient strategies to cope with stressful levels of photosynthetically active and ultraviolet (UV radiation. At a molecular level, little is known yet about how such minimalist microorganisms manage to sustain high growth rates and avoid potentially detrimental, UV-induced mutations to their DNA. To address this question, we studied the cell cycle dynamics of P. marinus PCC9511 cells grown under high fluxes of visible light in the presence or absence of UV radiation. Near natural light-dark cycles of both light sources were obtained using a custom-designed illumination system (cyclostat. Expression patterns of key DNA synthesis and repair, cell division, and clock genes were analyzed in order to decipher molecular mechanisms of adaptation to UV radiation. Results The cell cycle of P. marinus PCC9511 was strongly synchronized by the day-night cycle. The most conspicuous response of cells to UV radiation was a delay in chromosome replication, with a peak of DNA synthesis shifted about 2 h into the dark period. This delay was seemingly linked to a strong downregulation of genes governing DNA replication (dnaA and cell division (ftsZ, sepF, whereas most genes involved in DNA repair (such as recA, phrA, uvrA, ruvC, umuC were already activated under high visible light and their expression levels were only slightly affected by additional UV exposure. Conclusions Prochlorococcus cells modified the timing of the S phase in response to UV exposure, therefore reducing the risk that mutations would occur during this particularly sensitive stage of the cell cycle. We identified several possible explanations for the observed timeshift. Among these, the sharp decrease in transcript levels

  8. Cribrihabitans marinus gen. nov., sp. nov., isolated from a biological filter in a marine recirculating aquaculture system.

    Science.gov (United States)

    Chen, Zhu; Liu, Ying; Liu, Liang-Zi; Zhong, Zhi-Ping; Liu, Zhi-Pei; Liu, Ying

    2014-04-01

    A Gram-negative bacterium, strain CZ-AM5(T), was isolated from an aerated biological filter in a marine recirculating aquaculture system in Tianjin, China. Its taxonomic position was investigated by using a polyphasic approach. Cells of strain CZ-AM5(T) were non-spore-forming rods, 0.5-0.8 µm wide and 1.2-2.0 µm long, and motile by means of one or two polar or lateral flagella. Strain CZ-AM5(T) was strictly aerobic, heterotrophic, oxidase-negative and catalase-positive. Growth occurred at 15-40 °C (optimum, 30-35 °C), at pH 6.5-10.5 (optimum, pH 7.0-7.5) and in the presence of 0-12.0 % (w/v) NaCl (optimum, 4.0 %). The predominant fatty acid was C18 : 1ω7c (80.3 %). Ubiquinone 10 (Q-10) was the sole respiratory quinone. The polar lipids were phosphatidylcholine, phosphatidylglycerol, phosphatidylethanolamine, diphosphatidylglycerol, an unknown aminolipid, an unknown phospholipid and three unknown lipids. The DNA G+C content was 60.4 mol%. Strain CZ-AM5(T) showed the highest 16S rRNA gene sequence similarity (96.5 %) to Phaeobacter caeruleus LMG 24369(T); it exhibited 16S rRNA gene sequence similarity of 95.0-96.5, 95.2-96.3, 96.2, 94.6-95.7 and 94.8-95.8 % to members of the genera Phaeobacter, Ruegeria, Citreimonas, Leisingera and Donghicola, respectively. However, phylogenetic trees based on 16S rRNA gene sequences showed that strain CZ-AM5(T) did not join any of the above genera, but formed a distinct lineage in the trees. On the basis of phenotypic, chemotaxonomic and phylogenetic analyses, strain CZ-AM5(T) is considered to represent a novel genus and species of the family Rhodobacteraceae, for which the name Cribrihabitans marinus gen. nov., sp. nov. is proposed. The type strain of Cribrihabitans marinus is CZ-AM5(T) ( = CGMCC 1.13219(T) = JCM 19401(T)). PMID:24425741

  9. Structural Mechanism for Light-driven Transport by a New Type of Chloride Ion Pump, Nonlabens marinus Rhodopsin-3.

    Science.gov (United States)

    Hosaka, Toshiaki; Yoshizawa, Susumu; Nakajima, Yu; Ohsawa, Noboru; Hato, Masakatsu; DeLong, Edward F; Kogure, Kazuhiro; Yokoyama, Shigeyuki; Kimura-Someya, Tomomi; Iwasaki, Wataru; Shirouzu, Mikako

    2016-08-19

    The light-driven inward chloride ion-pumping rhodopsin Nonlabens marinus rhodopsin-3 (NM-R3), from a marine flavobacterium, belongs to a phylogenetic lineage distinct from the halorhodopsins known as archaeal inward chloride ion-pumping rhodopsins. NM-R3 and halorhodopsin have distinct motif sequences that are important for chloride ion binding and transport. In this study, we present the crystal structure of a new type of light-driven chloride ion pump, NM-R3, at 1.58 Å resolution. The structure revealed the chloride ion translocation pathway and showed that a single chloride ion resides near the Schiff base. The overall structure, chloride ion-binding site, and translocation pathway of NM-R3 are different from those of halorhodopsin. Unexpectedly, this NM-R3 structure is similar to the crystal structure of the light-driven outward sodium ion pump, Krokinobacter eikastus rhodopsin 2. Structural and mutational analyses of NM-R3 revealed that most of the important amino acid residues for chloride ion pumping exist in the ion influx region, located on the extracellular side of NM-R3. In contrast, on the opposite side, the cytoplasmic regions of K. eikastus rhodopsin 2 were reportedly important for sodium ion pumping. These results provide new insight into ion selection mechanisms in ion pumping rhodopsins, in which the ion influx regions of both the inward and outward pumps are important for their ion selectivities. PMID:27365396

  10. Identification of squalamine in the plasma membrane of white blood cells in the sea lamprey, Petromyzon marinus.

    Science.gov (United States)

    Yun, Sang-Seon; Li, Weiming

    2007-12-01

    It is well established that innate mechanisms play an important role in the immunity of fish. Antimicrobial peptides have been isolated and characterized from several species of teleosts. Here, we report the isolation of an antimicrobial compound from the blood of bacterially challenged sea lamprey, Petromyzon marinus. An acetic acid extract from the blood cells of challenged fish was subjected to solid-phase extraction, cation-exchange chromatography, gel-filtration chromatography, and reverse-phase high-performance liquid chromatography, with the purified fractions assayed for antimicrobial activity. Surprisingly, antimicrobial activity in these fractions originated from squalamine, an aminosterol previously identified in the dogfish shark, Squalus acanthias. Further chromatographic and mass spectrometric analyses confirmed the identity of squalamine, an antimicrobial and antiangiogenic agent, in the active fraction from the sea lamprey blood cells. Immunocytochemical analysis localized squalamine to the plasma membrane of white blood cells. Therefore, we postulate that squalamine has an important role in the innate immunity that defends the lamprey against microbial invasion. The full biochemical and immunological roles of squalamine in the white blood cell membrane remain to be investigated. PMID:17726196

  11. Survival and metamorphosis of low-density populations of larval sea lampreys (Petromyzon marinus) in streams following lampricide treatment

    Science.gov (United States)

    Johnson, Nicholas S.; Swink, William D.; Brenden, Travis O.; Slade, Jeffrey W.; Steeves, Todd B.; Fodale, Michael F.; Jones, Michael L.

    2014-01-01

    Sea lamprey Petromyzon marinus control in the Great Lakes primarily involves application of lampricides to streams where larval production occurs to kill larvae prior to their metamorphosing and entering the lakes as parasites (juveniles). Because lampricides are not 100% effective, larvae that survive treatment maymetamorphose before streams are again treated. Larvae that survive treatment have not beenwidely studied, so their dynamics are notwell understood.Wetagged and released larvae in six Great Lake tributaries following lampricide treatment and estimated vital demographic rates using multistate tag-recovery models. Model-averaged larval survivals ranged from 56.8 to 57.6%. Model-averaged adult recovery rates, which were the product of juvenile survivals and adult capture probabilities, ranged from 6.8 to 9.3%. Using stochastic simulations, we estimated production of juvenile sea lampreys from a hypothetical population of treatment survivors under different growth conditions based on parameter estimates from this research. For fast-growing populations, juvenile production peaked 2 years after treatment. For slow-growing populations, juvenile production was approximately one-third that of fast-growing populations,with production not peaking until 4 years after treatment. Our results suggest that dynamics (i.e., survival, metamorphosis) of residual larval populations are very similar to those of untreated larval populations. Consequently, residual populations do not necessarily warrant special consideration for the purpose of sea lamprey control and can be ranked for treatment along with other populations. Consecutive lampricide treatments, which are under evaluation by the sea lamprey control program, would bemost effective for reducing juvenile production in large, fast-growing populations.

  12. A sea lamprey (Petromyzon marinus) sex pheromone mixture increases trap catch relative to a single synthesized component in specific environments

    Science.gov (United States)

    Johnson, Nicholas S.; Tix, John A.; Hlina, Benjamin L.; Wagner, C. Michael; Siefkes, Michael J.; Wang, Huiyong; Li, Weiming

    2015-01-01

    Spermiating male sea lamprey (Petromyzon marinus) release a sex pheromone, of which a component, 7α, 12α, 24-trihydoxy-3-one-5α-cholan-24-sulfate (3kPZS), has been identified and shown to induce long distance preference responses in ovulated females. However, other pheromone components exist, and when 3kPZS alone was used to control invasive sea lamprey populations in the Laurentian Great Lakes, trap catch increase was significant, but gains were generally marginal. We hypothesized that free-ranging sea lamprey populations discriminate between a partial and complete pheromone while migrating to spawning grounds and searching for mates at spawning grounds. As a means to test our hypothesis, and to test two possible uses of sex pheromones for sea lamprey control, we asked whether the full sex pheromone mixture released by males (spermiating male washings; SMW) is more effective than 3kPZS in capturing animals in traditional traps (1) en route to spawning grounds and (2) at spawning grounds. At locations where traps target sea lampreys en route to spawning grounds, SMW-baited traps captured significantly more sea lampreys than paired 3kPZS-baited traps (~10 % increase). At spawning grounds, no difference in trap catch was observed between 3kPZS and SMW-baited traps. The lack of an observed difference at spawning grounds may be attributed to increased pheromone competition and possible involvement of other sensory modalities to locate mates. Because fishes often rely on multiple and sometimes redundant sensory modalities for critical life history events, the addition of sex pheromones to traditionally used traps is not likely to work in all circumstances. In the case of the sea lamprey, sex pheromone application may increase catch when applied to specifically designed traps deployed in streams with low adult density and limited spawning habitat.

  13. Size control of in vitro synthesized magnetite crystals by the MamC protein of Magnetococcus marinus strain MC-1.

    Science.gov (United States)

    Valverde-Tercedor, C; Montalbán-López, M; Perez-Gonzalez, T; Sanchez-Quesada, M S; Prozorov, T; Pineda-Molina, E; Fernandez-Vivas, M A; Rodriguez-Navarro, A B; Trubitsyn, D; Bazylinski, Dennis A; Jimenez-Lopez, C

    2015-06-01

    Magnetotactic bacteria are a diverse group of prokaryotes that share the unique ability of biomineralizing magnetosomes, which are intracellular, membrane-bounded crystals of either magnetite (Fe3O4) or greigite (Fe3S4). Magnetosome biomineralization is mediated by a number of specific proteins, many of which are localized in the magnetosome membrane, and thus is under strict genetic control. Several studies have partially elucidated the effects of a number of these magnetosome-associated proteins in the control of the size of magnetosome magnetite crystals. However, the effect of MamC, one of the most abundant proteins in the magnetosome membrane, remains unclear. In this present study, magnetite nanoparticles were synthesized inorganically in free-drift experiments at 25 °C in the presence of different concentrations of the iron-binding recombinant proteins MamC and MamCnts (MamC without its first transmembrane segment) from the marine, magnetotactic bacterium Magnetococcus marinus strain MC-1 and three commercial proteins [α-lactalbumin (α-Lac), myoglobin (Myo), and lysozyme (Lyz)]. While no effect was observed on the size of magnetite crystals formed in the presence of the commercial proteins, biomimetic synthesis in the presence of MamC and MamCnts at concentrations of 10-60 μg/mL resulted in the production of larger and more well-developed magnetite crystals (~30-40 nm) compared to those of the control (~20-30 nm; magnetite crystals grown protein-free). Our results demonstrate that MamC plays an important role in the control of the size of magnetite crystals and could be utilized in biomimetic synthesis of magnetite nanocrystals. PMID:25874532

  14. Population ecology of the sea lamprey (Petromyzon marinus) as an invasive species in the Laurentian Great Lakes and an imperiled species in Europe

    Science.gov (United States)

    Hansen, Michael J.; Madenjian, Charles P.; Slade, Jeffrey W.; Steeves, Todd B.; Almeida, Pedro R.; Quintella, Bernardo R.

    2016-01-01

    The sea lamprey Petromyzon marinus (Linnaeus) is both an invasive non-native species in the Laurentian Great Lakes of North America and an imperiled species in much of its native range in North America and Europe. To compare and contrast how understanding of population ecology is useful for control programs in the Great Lakes and restoration programs in Europe, we review current understanding of the population ecology of the sea lamprey in its native and introduced range. Some attributes of sea lamprey population ecology are particularly useful for both control programs in the Great Lakes and restoration programs in the native range. First, traps within fish ladders are beneficial for removing sea lampreys in Great Lakes streams and passing sea lampreys in the native range. Second, attractants and repellants are suitable for luring sea lampreys into traps for control in the Great Lakes and guiding sea lamprey passage for conservation in the native range. Third, assessment methods used for targeting sea lamprey control in the Great Lakes are useful for targeting habitat protection in the native range. Last, assessment methods used to quantify numbers of all life stages of sea lampreys would be appropriate for measuring success of control in the Great Lakes and success of conservation in the native range.

  15. NORTHWARD EXPANSION OF A MARINE PARASITE: TESTING THE ROLE OF TEMPERATURE ADAPTATION

    Science.gov (United States)

    The known range of the eastern oyster (Crassostrea virginica) parasite, Perkinsus marinus, expanded into the northeastern United States in the early 1990s. We used both in vitro and in vivo data to test the hypothesis that the northward expansion was associated with a low-tempera...

  16. The emergence of the vasopressin and oxytocin hormone receptor gene family lineage: Clues from the characterization of vasotocin receptors in the sea lamprey (Petromyzon marinus).

    Science.gov (United States)

    Mayasich, Sally A; Clarke, Benjamin L

    2016-01-15

    The sea lamprey (Petromyzon marinus) is a jawless vertebrate at an evolutionary nexus between invertebrates and jawed vertebrates. Lampreys are known to possess the arginine vasotocin (AVT) hormone utilized by all non-mammalian vertebrates. We postulated that the lamprey would possess AVT receptor orthologs of predecessors to the arginine vasopressin (AVP)/oxytocin (OXT) family of G protein-coupled receptors found in mammals, providing insights into the origins of the mammalian V1A, V1B, V2 and OXT receptors. Among the earliest animals to diverge from the vertebrate lineage in which these receptors are characterized is the jawed, cartilaginous elephant shark, which has genes orthologous to all four mammalian receptor types. Therefore, our work was aimed at helping resolve the critical gap concerning the outcomes of hypothesized large-scale (whole-genome) duplication events. We sequenced one partial and four full-length putative lamprey AVT receptor genes and determined their mRNA expression patterns in 15 distinct tissues. Phylogenetically, three of the full-coding genes possess structural characteristics of the V1 clade containing the V1A, V1B and OXT receptors. Another full-length coding gene and the partial sequence are part of the V2 clade and appear to be most closely related to the newly established V2B and V2C receptor subtypes. Our synteny analysis also utilizing the Japanese lamprey (Lethenteron japonicum) genome supports the recent proposal that jawless and jawed vertebrates shared one-round (1R) of WGD as the most likely scenario. PMID:26764211

  17. Comparison of isometric contractile properties in hindlimb extensor muscles of the frogs Rana pipiens and Bufo marinus: functional correlations with differences in hopping performance.

    Science.gov (United States)

    Chadwell, Brad A; Hartwell, Hadley J; Peters, Susan E

    2002-03-01

    The leopard frog (Rana pipiens) is an excellent jumper that can reach high take-off velocities and accelerations. It is diurnal, using long, explosive jumps to capture prey and escape predators. The marine toad (Bufo marinus) is a cryptic, nocturnal toad, typically using short, slow hops, or sometimes walking, to patrol its feeding area. Typical of frogs with these different locomotor styles, Rana has relatively long hindlimbs and large (by mass) hindlimb extensor muscles compared to Bufo. We studied the isometric contractile properties of their extensor muscles and found differences that correlate with their different hopping performances. At the hip (semimembranosus, SM), knee (peroneus, Per) and ankle (plantaris longus, PL), we found that Rana's muscles tended to produce greater maximum isometric force relative to body mass, although the difference was significant only for PL. This suggests that differences in force capability at the ankle may be more important than at other joints to produce divergent hopping performances. Maximum isometric force scaled with body mass so that the smaller Rana has relatively larger muscles and force differences between species may reflect size differences only. In addition, Rana's muscles exhibited greater passive resistance to elongation, implying more elastic tissue is present, which may amplify force at take-off due to elastic recoil. Rana's muscles also achieved a higher percentage of maximum force at lower stimulus inputs (frequencies and durations) than in Bufo, perhaps amplifying the differences in force available for limb extension during natural stimulation. Twitch contraction and relaxation times tended to be faster in Rana, although variation was great, so that differences were significant only for Per. Fatigability also tended to be greater in Rana muscles, although, again, values reached significance in only one muscle (PL). Thus, in addition to biomechanical effects, differences in hopping performance may also be

  18. Structure and stability of metagenome-derived glycoside hydrolase family 12 cellulase (LC-CelA a homolog of Cel12A from Rhodothermus marinus

    Directory of Open Access Journals (Sweden)

    Hiroyuki Okano

    2014-01-01

    Full Text Available Ten genes encoding novel cellulases with putative signal peptides at the N-terminus, termed pre-LC-CelA–J, were isolated from a fosmid library of a leaf–branch compost metagenome by functional screening using agar plates containing carboxymethyl cellulose and trypan blue. All the cellulases except pre-LC-CelG have a 14–29 residue long flexible linker (FL between the signal peptide and the catalytic domain. LC-CelA without a signal peptide (residues 20–261, which shows 76% amino acid sequence identity to Cel12A from Rhodothermus marinus (RmCel12A, was overproduced in Escherichia coli, purified and characterized. LC-CelA exhibited its highest activity across a broad pH range (pH 5–9 and at 90 °C, indicating that LC-CelA is a highly thermostable cellulase, like RmCel12A. The crystal structure of LC-CelA was determined at 1.85 Å resolution and is nearly identical to that of RmCel12A determined in a form without the FL. Both proteins contain two disulfide bonds. LC-CelA has a 16-residue FL (residues 20–35, most of which is not visible in the electron density map, probably due to structural disorder. However, Glu34 and Pro35 form hydrogen bonds with the central region of the protein. ΔFL-LC-CelA (residues 36–261 and E34A-LC-CelA with a single Glu34 → Ala mutation were therefore constructed and characterized. ΔFL-LC-CelA and E34A-LC-CelA had lower melting temperatures (Tm than LC-CelA by 14.7 and 12.0 °C respectively. The Tm of LC-CelA was also decreased by 28.0 °C in the presence of dithiothreitol. These results suggest that Glu34-mediated hydrogen bonds and the two disulfide bonds contribute to the stabilization of LC-CelA.

  19. Richness and distribution of tropical oyster parasites in two oceans.

    Science.gov (United States)

    Pagenkopp Lohan, Katrina M; Hill-Spanik, Kristina M; Torchin, Mark E; Aguirre-Macedo, Leopoldina; Fleischer, Robert C; Ruiz, Gregory M

    2016-08-01

    Parasites can exert strong effects on population to ecosystem level processes, but data on parasites are limited for many global regions, especially tropical marine systems. Characterizing parasite diversity and distributions are the first steps towards understanding the potential impacts of parasites. The Panama Canal serves as an interesting location to examine tropical parasite diversity and distribution, as it is a conduit between two oceans and a hub for international trade. We examined metazoan and protistan parasites associated with ten oyster species collected from both Panamanian coasts, including the Panama Canal and Bocas del Toro. We found multiple metazoan taxa (pea crabs, Stylochus spp., Urastoma cyrinae). Our molecular screening for protistan parasites detected four species of Perkinsus (Perkinsus marinus, Perkinsus chesapeaki, Perkinsus olseni, Perkinsus beihaiensis) and several haplosporidians, including two genera (Minchinia, Haplosporidium). Species richness was higher for the protistan parasites than for the metazoans, with haplosporidian richness being higher than Perkinsus richness. Perkinsus species were the most frequently detected and most geographically widespread among parasite groups. Parasite richness and overlap differed between regions, locations and oyster hosts. These results have important implications for tropical parasite richness and the dispersal of parasites due to shipping associated with the Panama Canal. PMID:27263626

  20. Geometric hysteresis of alveolated ductal architecture.

    Science.gov (United States)

    Kojic, M; Butler, J P; Vlastelica, I; Stojanovic, B; Rankovic, V; Tsuda, A

    2011-11-01

    Low Reynolds number airflow in the pulmonary acinus and aerosol particle kinetics therein are significantly conditioned by the nature of the tidal motion of alveolar duct geometry. At least two components of the ductal structure are known to exhibit stress-strain hysteresis: smooth muscle within the alveolar entrance rings, and surfactant at the air-tissue interface. We hypothesize that the geometric hysteresis of the alveolar duct is largely determined by the interaction of the amount of smooth muscle and connective tissue in ductal rings, septal tissue properties, and surface tension-surface area characteristics of surfactant. To test this hypothesis, we have extended the well-known structural model of the alveolar duct by Wilson and Bachofen (1982, "A Model for Mechanical Structure of the Alveolar Duct," J. Appl. Physiol. 52(4), pp. 1064-1070) by adding realistic elastic and hysteretic properties of (1) the alveolar entrance ring, (2) septal tissue, and (3) surfactant. With realistic values for tissue and surface properties, we conclude that: (1) there is a significant, and underappreciated, amount of geometric hysteresis in alveolar ductal architecture; and (2) the contribution of smooth muscle and surfactant to geometric hysteresis are of opposite senses, tending toward cancellation. Quantitatively, the geometric hysteresis found experimentally by Miki et al. (1993, "Geometric Hysteresis in Pulmonary Surface-to-Volume Ratio during Tidal Breathing," J. Appl. Physiol. 75(4), pp. 1630-1636) is consistent with little or no smooth muscle tone in anesthetized rabbits in control conditions, and with substantial smooth muscle activation following methacholine challenge. The observed local hysteretic boundary motion of the acinar duct would result in irreversible acinar flow fields, which might be important mechanistic contributors to aerosol mixing and deposition deep in the lung. PMID:22168737

  1. Geometric Hysteresis of Alveolated Ductal Architecture

    OpenAIRE

    Kojic, M.; Butler, J. P.; Vlastelica, I.; B. Stojanovic; Rankovic, V.; Tsuda, A.

    2011-01-01

    Low Reynolds number airflow in the pulmonary acinus and aerosol particle kinetics therein are significantly conditioned by the nature of the tidal motion of alveolar duct geometry. At least two components of the ductal structure are known to exhibit stress-strain hysteresis: smooth muscle within the alveolar entrance rings, and surfactant at the air-tissue interface. We hypothesize that the geometric hysteresis of the alveolar duct is largely determined by the interaction of th...

  2. Mitochondrial genomes of photosynthetic euglenids and alveolates

    Czech Academy of Sciences Publication Activity Database

    Flegontov, Pavel; Lukeš, Julius

    Vol. 63. 24-28 OVAL ROAD, LONDON NW1 7DX: ACADEMIC PRESS LTD-ELSEVIER SCIENCE LTD, 2012 - (MarechalDrouard, L), s. 127-153 ISBN 978-0-12-394279-1 R&D Projects: GA ČR GA204/09/1667; GA ČR(CZ) GAP305/11/2179 Institutional support: RVO:60077344 Keywords : Dinoflagellate Alexandrium-Catenella * cytochrome-oxidase SUBUNIT-1 * transfer-RNA import * open reading frames * ribosomal-RNA * Plasmodium falciparum * messenger-RNAs * complete sequence * OXYRRHIS-MARINA * TETRAHYMENA-THERMOPHILA Subject RIV: EB - Genetics ; Molecular Biology

  3. Enhanced recovery of Arcobacter spp. using NaCl in culture media and re-assessment of the traits of Arcobacter marinus and Arcobacter halophilus isolated from marine water and shellfish.

    Science.gov (United States)

    Salas-Massó, Nuria; Andree, Karl B; Furones, M Dolors; Figueras, M José

    2016-10-01

    The genus Arcobacter is a relatively poorly known group of bacteria, and the number of new species and sequences from non-culturable strains has increased considerably in recent years. This study investigates whether using media that contain NaCl might help to improve the recovery of Arcobacter spp. from marine environments. To this aim, 62 water and shellfish samples were analysed in parallel, with both a commonly used culture method (enrichment in Arcobacter-CAT broth followed by culture on Blood Agar) and a new one that supplements the Arcobacter-CAT enrichment broth with 2.5% NaCl (w/v) followed by culturing on Marine Agar. The new method yielded ca. 40% more positive samples and provided a higher diversity of known (11 vs. 7) and unknown (7 vs. 2) Arcobacter species. Among the 11 known species recovered, Arcobacter marinus and Arcobacter halophilus were isolated only by this new method. No more strains of these species have been isolated since their original descriptions, both of which were based only on a single strain. In view of that, the phenotypic characteristics of these species are re-evaluated in the present study, using the new strains. Strains of A. halophilus had the same phenotypic profile as the type strain. However, some strains of A. marinus differed from the type strain in that they did not hydrolyse indoxyl-acetate, becoming, therefore, the first Arcobacter species to show a varying ability to hydrolyse indoxyl-acetate. This study shows to what extent a simple variation to the culture media can have a big influence on positive samples and on the community of species recovered. PMID:27282494

  4. Longitudinal course of extrinsic allergic alveolitis in pigeon breeders.

    OpenAIRE

    Bourke, S. J.; Banham, S W; Carter, R; P. Lynch; Boyd, G.

    1989-01-01

    The purpose of this study was to assess the longitudinal course of pigeon breeders' disease by evaluating 24 patients with the acute form of the disease 10 years after their original diagnosis. Twenty one patients attended for clinical assessment, pulmonary function studies, chest radiography, and antibody measurement. Eighteen had continued to keep pigeons, emphasising their commitment to the hobby. Despite continued antigen exposure pigeon related symptoms had improved in most patients and ...

  5. Pulmoner Alveoler Mikrolitiazis: Altı Olgu Bildirisi

    OpenAIRE

    YALIN, T.; Arslan, A; SELÇUK, M.; TANIK, A.

    2010-01-01

    Pulmonary alveolar microlithiasis : Six Case Reports Pulmonary alveolar microlithiasis is a rare hereditary disease of unknown etiology, characterized by intraalveolar calcified microgranules. The roentgenographic differen-tial diagnosis should include miliary tuberculosis, sarcoidosis, pulmonary hemoside-rosis, histoplasmosis, pneumoconiosis, ornithosis and pulmonary adenomatosis. In this study, we report six cases of pulmonary alveolar microlithiasis, four of which are from the sam...

  6. Rearing of sea lamprey, Petromyzon marinus, embryos in distilled water

    Science.gov (United States)

    Piavis, George W.; Howell, John H.

    1969-01-01

    Most embryological studies of lampreys in the Great Lakes have been conducted with filtered water from Lake Huron. Although this water was entirely satisfactory for the earlier work, the present need for knowledge of the effects of various compounds on embryological development requires that the initial medium be sterile. The purpose of the present study was to determine whether sea lamprey embryos could be successfully reared in distilled water. Mature sea lampreys were collected from the Ocqueoc River, Presque Isle County, Michigan, and transferred to the Hammond Bay Biological Station where eggs were stripped and fertilized according to the method of Piavis. After activation was ascertained to be 90-100% complete, the embryos were washed 3-5 timesexperimentals with commercially obtained U.S.P. distilled water and controls with filtered Lake Huron water.

  7. Metamorphosis of the landlocked sea lamprey, Petromyzon marinus

    Science.gov (United States)

    Manion, Patrick J.; Stauffer, Thomas M.

    1970-01-01

    The external metamorphosis of the sea lamprey was divided into four stages, based primarily on the condition of the mouth: mouth reduced, mouth fused, mouth enclosed, and mouth elongated. During metamorphosis, the eye enlarged greatly, the snout and mouth region changed from a fleshy hood enclosing a sieve apparatus to a large sucking disc, the nasopore membrane and the branchial area shrank, the branchiopores changed in shape, the general color changed from dark brown and yellow to an intense blue-black dorsally and white ventrally, and the total length increased. Metamorphosis began in early to mid-July and did not take place after August. The duration of external metamorphosis was about 3 months for lampreys transforming under natural conditions. The mean lengths of metamorphosing lampreys from tributaries of lakes Superior and Michigan were 145 and 136 mm, respectively.

  8. Spatial and temporal distributions of contaminant body burden and disease in Gulf of Mexico oyster populations: The role of local and large-scale climatic controls

    Science.gov (United States)

    Wilson, E. A.; Powell, E. N.; Wade, T. L.; Taylor, R. J.; Presley, B. J.; Brooks, J. M.

    1992-06-01

    As part of NOAA's Status and Trends Program, oysters were sampled from 43 sites throughout the Gulf of Mexico from Brownsville, Texas, to the Florida Everglades from 1986 to 1989. Oysters were analysed for body burden of a suite of metals and petroleum aromatic hydrocarbons (PAHs), the prevalence and intensity of the oyster pathogen, Perkinsus marinus, and condition index. The contaminants fell into two groups based on the spatial distribution of body burden throughout the Gulf. Arsenic, selenium, mercury and cadmium were characterized by clinal reduction in similarity with distance reminiscent of that followed by mean monthly temperature and precipitation. Zinc, copper, PAHs and silver showed no consistent geographic trend. Within local regions, industrial and agricultural and use and P. marinus prevalence and infection intensity frequently correlated with body burden. Contaminants and biological attributes followed one of three temporal trends. Zinc, copper and PAHs showed concordant shifts over 4 years throughout the eastern and southern Gulf. Mercury and cadmium showed concordant shifts in the northwestern Gulf. Selenium, arsenic, length, condition index and P. marinus prevalence and infection intensity showed concordant shifts throughout most of the entire Gulf. Concordant shifts suggest that climatic factors, the El Niño/Southern Oscillation being one example, exert a strong influence on biological attributes and contaminant body burdens in the Gulf. Correlative factors are those that probably affect or indicate the rate of tissue turnover and the frequency of reproduction; namely, temperature, disease intensity, condition index and length.

  9. Incidence and prevalence of cryptogenic fibrosing alveolitis in a Norwegian community

    DEFF Research Database (Denmark)

    von Plessen, C; Grinde, O; Gulsvik, A

    2003-01-01

    of pulmonary fibrosis (ICD 8: 517 and ICD 9: 515 and 516). Cases with a history of exposure to fibrogenic agents or with collagen vascular disease were excluded and the remaining 158 cases were defined as CFA. The average annual incidence of hospitalised CFA was 4.3 per 100,000. No change was...

  10. Anti-cytokine therapy in fibrosing alveolitis: where are we now?

    Directory of Open Access Journals (Sweden)

    Millar Ann

    2000-06-01

    Full Text Available Abstract Idiopathic pulmonary fibrosis (IPF is a condition that has a poor prognosis, with a median survival of 4-5 years irrespective of treatment. Ziesche et al (N Engl J Med 1999, 341: 1264-1269 describe an open randomised trial of 18 patients with IPF, unresponsive to corticosteroid treatment at high dose. Nine patients were treated with continued corticosteroid and nine with prednisolone plus interferon-γ 1b (IFN-γ. Significant benefits in physiological parameters are reported in the IFN-γ-treated group. An analysis of lung tissue by reverse-transcriptase-mediated polymerase chain reaction showed corresponding decreases in the transcription of transforming growth factor-β1 and connective tissue growth factor. This is the first report of treatment showing efficacy in this disease, albeit in a very preliminary study, but the data should be viewed with caution. This study is discussed in the context of other published studies of treatment for IPF and the scientific rationale on which it was based.

  11. Incidence and prevalence of cryptogenic fibrosing alveolitis in a Norwegian community

    DEFF Research Database (Denmark)

    von Plessen, C; Grinde, O; Gulsvik, A

    2003-01-01

    observed in the annual incidence during the 15-year study period. The prevalence was 19.7 and 23.9 per 100,000 by 31.12. 1991 and by 31.12. 1998, respectively. The incidence increased considerably and significantly with age. No significant gender differences were observed. The lack of gender differences...

  12. Dicty_cDB: Contig-U11022-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35 5 ( EH079886 ) PMECF85TO Perkinsus marinus large insert cDNA lib... 42 0.048 2 ( ET095291 ) QM0AAA22BH01FM1 CCL1...gylocentrotus purpuratus clone R3-3085L11, W... 40 0.14 2 ( AC180454 ) Strongylocentrotus purpuratus clone R...022-1Q) /CSM_Contig/Contig-U11022-1Q.Seq.d CAAATACACTCAGACAGGGTTGCAAATGCGTTGAATTGGACGTTTGGGAT GGTAATGATGGTGATCC...DNA sequence from clone CH211-51L17 in ... 52 0.060 1 ( BX324154 ) Zebrafish DNA ... SP_1031_A2_E05_SP6E Strongylocentrotus purpuratus... 42 0.075 2 ( EL354039 ) CCEM10702.b4_L12.ab1 CC

  13. Infection of clams by Perkinsus olseni as an example of the new French Surveillance Programme

    OpenAIRE

    Miossec, Laurence; Garcia, Celine; ARZUL, Isabelle; Francois, Cyrille; Joly, Jean-pierre; Chollet, Bruno; Robert, Maeva; De Blas, Isabelle

    2006-01-01

    The French network for the surveillance and monitoring of mollusc health (REPAMO) was officially set up in 1992 to control the shellfish status along the French coasts according to the European directives 91/67/EEC and 95/70/EC. The objectives are 1) the surveillance of notifiable diseases present in France (Bonamiosis and Marteiliosis of flat oysters Ostrea edulis), 2) the surveillance of health status of cultured and wild populations of molluscs, 3) the study of abnormal mortality and 4) th...

  14. Updating algal evolutionary relationships through plastid genome sequencing: did alveolate plastids emerge through endosymbiosis of an ochrophyte?

    Czech Academy of Sciences Publication Activity Database

    Ševčíková, T.; Horák, Aleš; Klimeš, V.; Zbránková, V.; Demir-Hilton, E.; Sudek, S.; Jenkis, J.; Schmutz, J.; Přibyl, Pavel; Fousek, Jan; Vlček, Čestmír; Lang, B.F.; Oborník, Miroslav; Worden, A.Z.; Eliáš, M.

    2015-01-01

    Roč. 5, MAY 28 2015 (2015), s. 10134. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA13-33039S; GA ČR GPP506/12/P931 Grant ostatní: GA MŠk(CZ) LO1208; GA MŠk(CZ) ED2.1.00/03.0100 Institutional support: RVO:60077344 ; RVO:67985939 ; RVO:68378050 Keywords : phylogenetic position * Chromera velia * Dinoflagellate Subject RIV: EG - Zoology; EF - Botanics (UMG-J); EF - Botanics (BU-J) Impact factor: 5.578, year: 2014

  15. Protein (Cyanobacteria): 122791 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available EGLTSLGGGDIGLGPDGLKQIEGTFFLVLFSSLFGGTLGTVNGWLLANCRFKGRKYLRLAQLLPLATPAYLLSAILIDIGSIHGIRIHGMFWGILIMSLTTYPYVFLL... iron ABC transporter Prochlorococcus marinus subsp. marinus str. CCMP1375 MSKTFPQQRRIFLEIFSILLCVIFLLPIINLIR...FLSICSRWNKSKWMKSISFLSGLGYAIPGAVIALALLSFSGSVWNLPALILLLWGYSDRFLAVAKGGIDSAFERINPNIDEAAMSLGANWTGVLKTIHLPLLKGPLVVGSLLVFVDTIKELPLTFILRPFDFDTLSVRIFQYAGDERMGESIIPGLIVLLLGLLASIALMPSLDYKNKSI ... ...SAESFAKCGQRQLEACRSLGIGPWNSFRRIALPMATPAIGAGIALMGMEVINELGAVQLLNIPSLSAGIVENWIIKGNPSGAIALAFIA...LLVVLVLVAYEKWLRKRSRRWTEGITGAESPAWVLKGFRATIAQALSVMPPLFTLGVPFYWAIINSDQLLQGFDIELVQLTFRSLMLGLIASGLTVLGAI

  16. Protein (Cyanobacteria): 289805 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available IEKKNSNAYFLLGNAKLIQKNHTEALDAFTKATKVKPNFWQAINNKGLIYFELGNKKQAIQIWRKVLKIKSDPEPKLALAIALYSIEPANKESIKLAKEALQENPNYFSQAHQKEQLWGEKLQEAGKTLFKNPKLKAVINKASANSRFTN ... ...YSPNPKVLIDTSIGIGLTASEYIKYGQTKEAIGLAKLAISLNPKEIELWIILARAQLSNNKLEEALISIERAKNINPNIPILWFTKASIEMQMGEIQLAINSINKCLK...tical protein Pro0006 Prochlorococcus marinus subsp. marinus str. CCMP1375 MKNYKKIYWLICIILNTNLFVINKPSHAYIPNI

  17. Protein (Cyanobacteria): 410899 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available LFAIPIASFWGRYSQIWAISHYPYLNKEGSSKFLHKKNWRGFLIESIPSYAFLSFLIFILINIDISIISTPNLIIGIIVGFLPALIIPHLLARRLGGHSGDSYGASVVLVETCMLIIFSIILPAS ... ...GVLQVSVLILLLQLQWPNESMPFIAIALGLWITGGIHVDGLMDTADGIAAGPSRCIEAMKDSRIGASGIIALTINLLLQIAALFKLRLLI...1 cobalamin-5-phosphate synthase Prochlorococcus marinus subsp. marinus str. CCMP1375 MSSPNWLKDLTGAWLFYTVFPKLTRINPRFERIARFSPLIGVLI

  18. Downstream movement of recently transformed sea lampreys, Petromyzon marinus, in Carp Lake River, Michigan

    Science.gov (United States)

    Applegate, Vernon C.; Brynildson, Clifford L.

    1951-01-01

    In order to obtain more precise information concerning the downstream movement of recently transformed sea lampreys, a trapping device was operated in the Carp Lake River, Emmet County, Michigan, from October, 1948, to July, 1951.

  19. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.)

    OpenAIRE

    Killorn, Erin E; Toews, Daniel P

    2001-01-01

    Background Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Results Venous return from the poste...

  20. 'n Konseptuele model vir 'n bestuursinligtingstelsel vir 'n streekkantoor / Albertus Marinus Jan Brenkman

    OpenAIRE

    Brenkman, Albertus Marinus Jan

    1989-01-01

    In the research for this paper, which concerns a conceptual model for a management information system (MIS) for a regional office, it was found that the regional office could be seen as a typical mini organisation. The regional office as organisation needs educational leaders in order to function. This educational management can be embodied in a pyramid structure comprising top management, middle management and first-line management. Management information is therefore ...

  1. Prey or predator – expanding the food web role of sandeel (Ammodytes marinus)

    DEFF Research Database (Denmark)

    Eigaard, Ole Ritzau; Deurs, Mikael van; Behrens, Jane;

    2014-01-01

    marine food webs. In 2012 and 2013 the stomachs of 748 sandeels from 36 different commercial sandeel hauls in the central North Sea were opened. 9% of these stomachs contained late stage sandeel larvae. In order to better understand the cannibalistic nature of sandeels, we made a detailed analysis of...... North Sea sandeel stocks, but it may also add a new element to the complexity of energy flow in marine food chains...

  2. Phycobiliproteins in Prochlorococcus marinus: biosynthesis of pigments and their assembly into proteins.

    Science.gov (United States)

    Wiethaus, Jessica; Busch, Andrea W U; Dammeyer, Thorben; Frankenberg-Dinkel, Nicole

    2010-12-01

    Prochlorococcus sp. is a very unique and highly abundant class of organisms within the cyanobacteria. Found in the world's oceans Prochlorococcus is very small in size and possesses the smallest genome of a photosynthetic autotroph. Prochlorococcus is characterized by a special chlorophyll antenna for light harvesting and the absence of classical cyanobacterial phycobilisomes. Despite the lack of phycobilisomes Prochlorococcus possesses remnants thereof which is the phycobiliprotein phycoerythrin (PE) encoded in a PE operon as well as genes encoding enzymes of phycobilin biosynthesis. The size of this PE operon varies depending on the light-adapted ecotype. While high-light strains only possess a β-subunit of PE, low-light adapted strains possess both, an α- and a β-subunit. α-/β-subunits are also present in functional phycobilisomes. Consistent with the number of subunits is also the varying number of putative lyase genes, involved in the transfer and attachment of phycobilins (open-chain tetrapyrroles) to the PE subunits. This minireview summarizes the only sparely available data on the biosynthesis and assembly of Prochlorococcus PE. On one hand the quite well understood biosynthesis of pigments will be reviewed but also new data on the phycobiliprotein lyase-mediated transfer of the phycobilins to the PE subunits will be discussed. PMID:20724022

  3. fRNAdb Summary: FR189385 [

    Lifescience Database Archive (English)

    Full Text Available FR189385 AE017162,AF387607,AF397673,AF397674,AF397675,AF397676,AF397677,AF397678,AF397679,AF3976 ... s marinus str. NATL2A,Prochlorococcus marinus str. MIT ... 9107,Prochlorococcus marinus str. PAC1,Prochloroco ... occus marinus str. SB,Prochlorococcus marinus str. MIT ... 9302,Prochlorococcus marinus str. MIT ... 9312,Prochlo ...

  4. A comparison of two methods for colorimetric in situ hybridization using paraffin-embedded tissue sections and digoxigenin-labeled hybridization probes.

    Science.gov (United States)

    Marcino, Joe

    2013-06-01

    Two methods for colorimetric in situ DNA probe hybridization (CISH) assays on paraffin-embedded tissue sections were compared. The heated method used heat (90-100°C) to denature DNA in the sample prior to probe hybridization, while the unheated method used a standard hybridization temperature of 42°C. Both procedures were tested on tissue samples that harbored the mollusk protozoan pathogens Perkinsus marinus, P. chesapeaki, or Haplosporidium nelsoni, the protozoan and bacterial fish pathogens Myxobolus cerebralis (myxosporidean) or Renibacterium salmoninarum (bacterial), or the crab viral pathogen Callinectes sapidus reovirus. Samples were fixed in either formalin or Davidson's fixative and embedded in paraffin for histological examination. The heated method is labor intensive and highly prone to human error, while the unheated method is less labor intensive and can be completed in a shorter period of time. Both methods yielded similar hybridization results. The use of complex and expensive prehybridization buffers did not improve the performances of the tested CISH assays. Prehybridization heat denaturation of DNA in assayed samples increased both assay duration and loss of samples but did not improve hybridization signals. PMID:23697605

  5. fRNAdb Summary: FR288323 [

    Lifescience Database Archive (English)

    Full Text Available FR288323 AF317071,AF317072,AF317073,AF317074,AF317075,AF317076,AF317077,AF317078,AF317079,AF3302 ... s marinus str. NATL2A,Prochlorococcus marinus str. MIT ... 9107,Prochlorococcus marinus str. MIT ... 9303,Prochlo ... chococcus sp. WH 5701,Prochlorococcus marinus str. MIT ... 9302,Prochlorococcus marinus str. MIT ... 9312,Prochlo ...

  6. Expression of a tumor necrosis factor-alpha transgene in murine lung causes lymphocytic and fibrosing alveolitis. A mouse model of progressive pulmonary fibrosis.

    OpenAIRE

    Y. Miyazaki; Araki, K; Vesin, C; Garcia, I.; Kapanci, Y.; Whitsett, J A; Piguet, P F; Vassalli, P.

    1995-01-01

    The murine TNF-alpha gene was expressed under the control of the human surfactant protein SP-C promoter in transgenic mice. A number of the SP-C TNF-alpha mice died at birth or after a few weeks with very severe lung lesions. Surviving mice transmitted a pulmonary disease to their offspring, the severity and evolution of which was related to the level of TNF-alpha mRNA in the lung; TNF-alpha RNA was detected in alveolar epithelium, presumably in type II epithelial cells. In a longitudinal stu...

  7. Anatomy of the lamprey ear: morphological evidence for occurrence of horizontal semicircular ducts in the labyrinth of Petromyzon marinus

    Science.gov (United States)

    Maklad, Adel; Reed, Caitlyn; Johnson, Nicholas S.; Fritzsch, Bernd

    2014-01-01

    In jawed (gnathostome) vertebrates, the inner ears have three semicircular canals arranged orthogonally in the three Cartesian planes: one horizontal (lateral) and two vertical canals. They function as detectors for angular acceleration in their respective planes. Living jawless craniates, cyclostomes (hagfish and lamprey) and their fossil records seemingly lack a lateral horizontal canal. The jawless vertebrate hagfish inner ear is described as a torus or doughnut, having one vertical canal, and the jawless vertebrate lamprey having two. These observations on the anatomy of the cyclostome (jawless vertebrate) inner ear have been unchallenged for over a century, and the question of how these jawless vertebrates perceive angular acceleration in the yaw (horizontal) planes has remained open. To provide an answer to this open question we reevaluated the anatomy of the inner ear in the lamprey, using stereoscopic dissection and scanning electron microscopy. The present study reveals a novel observation: the lamprey has two horizontal semicircular ducts in each labyrinth. Furthermore, the horizontal ducts in the lamprey, in contrast to those of jawed vertebrates, are located on the medial surface in the labyrinth rather than on the lateral surface. Our data on the lamprey horizontal duct suggest that the appearance of the horizontal canal characteristic of gnathostomes (lateral) and lampreys (medial) are mutually exclusive and indicate a parallel evolution of both systems, one in cyclostomes and one in gnathostome ancestors.

  8. The dynamics of venous return and response to hypervolemia in the toad, Bufo marinus (L.)

    OpenAIRE

    Toews Daniel P; Killorn Erin E

    2001-01-01

    Abstract Background Venous return from the posterior region of amphibians travels by either two renal portal veins to the kidney or a central abdominal vein that drains into the hepatic portal system. The relative proportions of blood flow in these vessels has never been measured nor has a modification of flow been determined when venous return increases by changes in blood volume during hypervolemia or during increased volume input from the posterior lymph hearts. Results Venous return from ...

  9. Albirhodobacter marinus gen. nov., sp. nov., a member of the family Rhodobacteraceae isolated from sea shore water of Visakhapatnam, India

    Digital Repository Service at National Institute of Oceanography (India)

    Nupur; Bhumika, V.; Srinivas, T.N.R.; AnilKumar, P.

    , chemotaxonomy. Introduction The family Rhodobacteraceae was established by Garrity et al. (2005) within the α-3 Proteobacteria. Rhodobacteraceae is an ecologically, metabolically and phenotypically diverse group, including both chemotrophic...- arranged as chain, Te, arranged as tetrads; sh, short; Nm, non-motile, Mo, motile, Ma, marine; FW, fresh water; Ter, terrestrial; en, environments; hy-s, hypersaline; So, soil; sw, sewage; Ac-s, Activated sludge; Bl-Blood (Specimen); -, negative...

  10. The sea lamprey Petromyzon marinus genome reveals the early origin of several chemosensory receptor families in the vertebrate lineage

    Directory of Open Access Journals (Sweden)

    Zhang Ziping

    2009-07-01

    Full Text Available Abstract Background In gnathostomes, chemosensory receptors (CR expressed in olfactory epithelia are encoded by evolutionarily dynamic gene families encoding odorant receptors (OR, trace amine-associated receptors (TAAR, V1Rs and V2Rs. A limited number of OR-like sequences have been found in invertebrate chordate genomes. Whether these gene families arose in basal or advanced vertebrates has not been resolved because these families have not been examined systematically in agnathan genomes. Results Petromyzon is the only extant jawless vertebrate whose genome has been sequenced. Known to be exquisitely sensitive to several classes of odorants, lampreys detect fewer amino acids and steroids than teleosts. This reduced number of detectable odorants is indicative of reduced numbers of CR gene families or a reduced number of genes within CR families, or both, in the sea lamprey. In the lamprey genome we identified a repertoire of 59 intact single-exon CR genes, including 27 OR, 28 TAAR, and four V1R-like genes. These three CR families were expressed in the olfactory organ of both parasitic and adult life stages. Conclusion An extensive search in the lamprey genome failed to identify potential orthologs or pseudogenes of the multi-exon V2R family that is greatly expanded in teleost genomes, but did find intact calcium-sensing receptors (CASR and intact metabotropic glutamate receptors (MGR. We conclude that OR and V1R arose in chordates after the cephalochordate-urochordate split, but before the diversification of jawed and jawless vertebrates. The advent and diversification of V2R genes from glutamate receptor-family G protein-coupled receptors, most likely the CASR, occurred after the agnathan-gnathostome divergence.

  11. Evolution of retinoic acid receptors in chordates: insights from three lamprey species, Lampetra fluviatilis, Petromyzon marinus, and Lethenteron japonicum

    OpenAIRE

    Campo-Paysaa, Florent; Jandzik, David; Takio-Ogawa, Yoko; Cattell, Maria V; Neef, Haley C; Langeland, James A.; Kuratani, Shigeru; Medeiros, Daniel M.; Mazan, Sylvie; Kuraku, Shigehiro; Laudet, Vincent; Schubert, Michael

    2015-01-01

    Background Retinoic acid (RA) signaling controls many developmental processes in chordates, from early axis specification to late organogenesis. The functions of RA are chiefly mediated by a subfamily of nuclear hormone receptors, the retinoic acid receptors (RARs), that act as ligand-activated transcription factors. While RARs have been extensively studied in jawed vertebrates (that is, gnathostomes) and invertebrate chordates, very little is known about the repertoire and developmental role...

  12. Size control of in vitro synthesized magnetite crystals by the MamC protein of Magnetococcus marinus strain MC-1

    NARCIS (Netherlands)

    Valverde-Tercedor, C; Montalbán-López, M; Perez-Gonzalez, T; Sanchez-Quesada, M S; Prozorov, T; Pineda-Molina, E; Fernandez-Vivas, M A; Rodriguez-Navarro, A B; Trubitsyn, D; Bazylinski, Dennis A; Jimenez-Lopez, C

    2015-01-01

    Magnetotactic bacteria are a diverse group of prokaryotes that share the unique ability of biomineralizing magnetosomes, which are intracellular, membrane-bounded crystals of either magnetite (Fe3O4) or greigite (Fe3S4). Magnetosome biomineralization is mediated by a number of specific proteins, man

  13. Analysis of DNA damage in sea lamprey (Petromyzon marinus) spermatozoa by UV, hydrogen peroxide, and the toxicant bisazir

    Energy Technology Data Exchange (ETDEWEB)

    Ciereszko, Andrzej [School of Natural Resources, Ohio State University, 210 Kottman Hall, 2021 Coffey Rd., Columbus, OH 434210 (United States); Semen Biology Group, Institute of Animal Reproduction and Food Research, Polish Academy of Sciences, 10-747 Olsztyn (Poland); Wolfe, Tobie D. [School of Natural Resources, Ohio State University, 210 Kottman Hall, 2021 Coffey Rd., Columbus, OH 434210 (United States); Dabrowski, Konrad [School of Natural Resources, Ohio State University, 210 Kottman Hall, 2021 Coffey Rd., Columbus, OH 434210 (United States)]. E-mail: dabrowski.1@osu.edu

    2005-06-15

    In this study we sought to demonstrate that Comet assay can be applied to sea lamprey sperm DNA fragmentation and used to describe the relationship between sperm DNA damage and sperm fertilizing ability. We show that the assay can be used reliably and accurately, and unlike in the case of mammals, there is no need for additional steps related to improvement of efficacy of lysis and DNA decondensation. This agrees with the presence of histone proteins in lamprey sperm. An increase in DNA fragmentation was noted during short-term storage of milt on ice (0-4 days). We demonstrated genotoxic effects of UV radiation and oxidative stress (exposure to hydrogen peroxide) and found that oxidative damage to sperm DNA was likely repaired after fertilization in the embryo. Repairing capacity of the oocyte toward sperm DNA lesions caused by UV was restricted. Toxic effect of p,p-bis-(1-aziridinyl)-N-methylphosphinothioic acid (p,p-bis(1-aziridinyl)-N-methylphosphinothioic amide), a sea lamprey chemosterilant, could not be linked to DNA fragmentation in the in vitro tests. Its genotoxicity in vivo may possibly be associated with other mechanisms of DNA degradation (oxidation or DNA-protein and DNA-DNA cross-linking). In conclusion, this study demonstrates that Comet assay can be successfully applied to monitor effects of environmental disturbances and imposed injuries in sea lamprey spermatozoa and possibly other species of ancient fish with acrosomal sperm.

  14. Structural, functional, and evolutionary aspects of galectins in aquatic mollusks: From a sweet tooth to the Trojan horse.

    Science.gov (United States)

    Vasta, G R; Feng, C; Bianchet, M A; Bachvaroff, T R; Tasumi, S

    2015-09-01

    Galectins constitute a conserved and widely distributed lectin family characterized by their binding affinity for β-galactosides and a unique binding site sequence motif in the carbohydrate recognition domain (CRD). In spite of their structural conservation, galectins display a remarkable functional diversity, by participating in developmental processes, cell adhesion and motility, regulation of immune homeostasis, and recognition of glycans on the surface of viruses, bacteria and protozoan parasites. In contrast with mammals, and other vertebrate and invertebrate taxa, the identification and characterization of bona fide galectins in aquatic mollusks has been relatively recent. Most of the studies have focused on the identification and domain organization of galectin-like transcripts or proteins in diverse tissues and cell types, including hemocytes, and their expression upon environmental or infectious challenge. Lectins from the eastern oyster Crassostrea virginica, however, have been characterized in their molecular, structural and functional aspects and some notable features have become apparent in the galectin repertoire of aquatic mollusks. These including less diversified galectin repertoires and different domain organizations relative to those observed in vertebrates, carbohydrate specificity for blood group oligosaccharides, and up regulation of galectin expression by infectious challenge, a feature that supports their proposed role(s) in innate immune responses. Although galectins from some aquatic mollusks have been shown to recognize microbial pathogens and parasites and promote their phagocytosis, they can also selectively bind to phytoplankton components, suggesting that they also participate in uptake and intracellular digestion of microalgae. In addition, the experimental evidence suggests that the protozoan parasite Perkinsus marinus has co-evolved with the oyster host to be selectively recognized by the oyster hemocyte galectins over algal food

  15. Comparative genomic analysis of multi-subunit tethering complexes demonstrates an ancient pan-eukaryotic complement and sculpting in Apicomplexa.

    Directory of Open Access Journals (Sweden)

    Christen M Klinger

    Full Text Available Apicomplexa are obligate intracellular parasites that cause tremendous disease burden world-wide. They utilize a set of specialized secretory organelles in their invasive process that require delivery of components for their biogenesis and function, yet the precise mechanisms underpinning such processes remain unclear. One set of potentially important components is the multi-subunit tethering complexes (MTCs, factors increasingly implicated in all aspects of vesicle-target interactions. Prompted by the results of previous studies indicating a loss of membrane trafficking factors in Apicomplexa, we undertook a bioinformatic analysis of MTC conservation. Building on knowledge of the ancient presence of most MTC proteins, we demonstrate the near complete retention of MTCs in the newly available genomes for Guillardiatheta and Bigelowiellanatans. The latter is a key taxonomic sampling point as a basal sister taxa to the group including Apicomplexa. We also demonstrate an ancient origin of the CORVET complex subunits Vps8 and Vps3, as well as the TRAPPII subunit Tca17. Having established that the lineage leading to Apicomplexa did at one point possess the complete eukaryotic complement of MTC components, we undertook a deeper taxonomic investigation in twelve apicomplexan genomes. We observed excellent conservation of the VpsC core of the HOPS and CORVET complexes, as well as the core TRAPP subunits, but sparse conservation of TRAPPII, COG, Dsl1, and HOPS/CORVET-specific subunits. However, those subunits that we did identify appear to be expressed with similar patterns to the fully conserved MTC proteins, suggesting that they may function as minimal complexes or with analogous partners. Strikingly, we failed to identify any subunits of the exocyst complex in all twelve apicomplexan genomes, as well as the dinoflagellate Perkinsus marinus. Overall, we demonstrate reduction of MTCs in Apicomplexa and their ancestors, consistent with modification during

  16. Protein (Cyanobacteria): 380452 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available protein PMT1441 Prochlorococcus marinus str. MIT 9313 MIQQEGPGWRLARDPARKAFPVLIGGEGWAIELTQDEWQCLQSLVVELTDQHQQLVDQLLAEESVCLEMERQPWWACLDGDRHSWSLQVILQGDGEKARGAEGCWSVPAAQAMATAMRTTWDFDQ ...

  17. Protein (Cyanobacteria): 341533 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available otein P9215_03981 Prochlorococcus marinus str. MIT 9215 MWSKIRLTIYGTTAIAGILWPFYFIIQFINLVRNGNIQGTFIDIGNAFFDDAWITPTSGFISADTAILLIAIFVFYAAEGKRLKLRFWGIYFPLTFIISLAFSFGAFMFIRELEINKELNETD ...

  18. fRNAdb Summary: FR276682 [

    Lifescience Database Archive (English)

    Full Text Available FR276682 AF397676,AF397677,AF397679,AF397680,AF397681,AF397682,AF397683,AF397684,AF397685,AF3976 ... RNA (rRNA) rRNA_5_8S Prochlorococcus marinus str. MIT ... 9107,Prochlorococcus marinus str. SB,Prochlorococc ... us marinus str. MIT ... 9302,Prochlorococcus marinus str. MIT ... 9312,Prochlo ...

  19. Protein (Cyanobacteria): 431667 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available idine synthase A Prochlorococcus marinus str. MIT 9312 MKRIALLVQYDGSNYSGWQRQKNATTVQETLERALFKITHQVVKTFAAGRTDAGVHASGQVVHFNIDCVIPANSYS...DILNGLLPSAIRILESVEVKDSWHSCYSAMYRHYRYVINNSKFPNLFINNWSWHRYQKILDEVLMSNASKLMEGEHDFFAFQKSGSQRKNS

  20. Protein (Cyanobacteria): 122792 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GTSLLGGLLGTANGWLLANCRFPGRRALRVAQLLPLATPAYLLSAILIDLGSRNAIRIHGMGWGILIMALTTYPYVFLLSTESFSICGRRQLEACRSLGVGPWNSFRRIA... transporter Prochlorococcus marinus str. MIT 9303 MTQDAVPSSYGSNRLRKRHWQPDRLLLNSMAILLAVLALWPLIGLIREALQGFINGSASLGVDGPQQIQGTLTLLI...IVMSLVGYERRLRRRSRRWTEGVAGGDSPAWQLHGVRALCAQCLALIPPTITLGVPLLWAILNLDQLEQGIDPDLIPLTERSLGLGLAAASLAVVAGLILAIAKRWSS...TRWMGNLSFMAGIGYAIPGAVMAIALMPFNGAPWNLAWILLLLWGYSDRFLAVAKGGLDAAFERLSPSLDEAATGLGCQWQEVLRRVHLPLLKGPLAVGALLVFVDTVKELPLTFVLRPFDFDTLSVRLYQYAADERMAESILPALIIIALGLIASLALVPGLDQGERKKPPLSKEPLT ... ...LPMALPAIGAGIALMGMEVVNELGAVALLAIPSLSAGIVETWQMEGNPAGAIGLAMIALI

  1. Protein (Cyanobacteria): 373618 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available SGSLSCVYAIIYSLGRVWIEGLRTDPLCLGGVPPFCIGGIRIAQLISTILFGLGLLGLFWIYQRKKKLPSLGIIGRKHQ ... ...NDLLPILVISSIIGARAYYVIFEWRNYSGSNFWSSIQAFGLTISIPTFIKVWQGGIAIHGALLAGTIAILIFCRLKQEDFWDVLDVLI...PSVALGQAIGRWGNFFNNEAFGLPTDLPWKLFIPYPYRPEFFLDNNYFHPTFLYESIWNILLFLCLISLIRLSIKGKLKLP...protein diacylglyceryl transferase Prochlorococcus marinus str. MIT 9211 MEAYFATFRSPGPELLKVGFFTLRWYGLLIAFAVLIGLNLSNKLASIKGLSKNLI

  2. Protein (Cyanobacteria): 23619 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available DSNIDVIVEVMGGTDMAKDIILKSLKARKSVVTANKAVIARYGSEIYATAAKYGVYVLTEAAVCGGIPIIEPLKRSLKSNQINKIVGIINGTTNFILSKMTNEKA...drogenase Prochlorococcus marinus str. MIT 9515 MGKCKIGIIGFGTVGTGIYRILKSRNDVHPILKDIEIVGIAVKNINKNRNIELENNLLIDDPNKLIN...LRIICLDSPGVIGKIGDLFGKNDVSIESIVQLDASENKAEIVVITHEVSNGNFEKSKEGIRALPEVELIASQLSCI ... ...DYEETLKLAQKLGFAEFDPTADVEGHDAADKISILSELAFGGRINRDSISTEGINQINIKDIEYANKLGFEIKLLAFSERNTINNK

  3. Protein (Cyanobacteria): 344777 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available KDKYCTYRNLRRLRCIALFICELNATQDEAALLMHSGISTIEALTNLNPQEIITKTGRFERMLDTDREPVLNLRKAKKLINKAKEKLE ... ...tical protein P9211_10641 Prochlorococcus marinus str. MIT 9211 MKLLINKKKIAQNFRKEEQVLSSIGIDNWEAIMNLTDEYISCLV

  4. Protein (Cyanobacteria): 233771 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GLSRLGLALLTSEKLPSEAPVSPKLINKAINAHKRPYPALKALKALKACKPQSTSWRAAGTDSSDGLIESIRGICQASNCQ...ophosphate kinase Prochlorococcus marinus str. NATL1A MTTTIQDLGEIELLNRLKKFMRCGQIDDDVAEINKINKSLLINTDLLVEKIHFS...AILSKTSILKHPDWPEDDIWDEWILNGGEDYELILSLPKDWAKSLSNKLKSAKIIGFIKEGKPNIFWDNLEQTRIDQSSLFRHFKL ...

  5. Protein (Cyanobacteria): 424832 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available binamide kinase Prochlorococcus marinus str. NATL2A MITPLEKNYKGLISITGPTRSGKSQLAEFLIKKQQSVTYIATSKPRPNDPDWQQRIDLHKKRRPDRWKLIE...HPKDICKAIESISKNGSILIDSIGGLVEHHLGDDDTQWEIFQDKLLNCFTDDNLLIVFVSEEVGWGIVPATPIGHLFRERHSTLTSLLSCRSKKRLLAINGIAIDLDQIGDLIP ...

  6. Protein (Cyanobacteria): 468586 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available KRPSMGISFDIPLDILEGIFDFWLDIYKNQEAWETCIGLLKVRKRISLTNLIESEGLKGNSKKWAIKVETLHTYVPTVPRIEKLNEPMWK ... ...ike Prochlorococcus marinus str. MIT 9312 MENSSQYLFLASGAKNGEGFWIVGVKSCDETILEDKNLLDCHRKELIGNESAKDILFAINLNINNLFNELKNKNFLI

  7. Protein (Cyanobacteria): 424833 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available mide kinase Prochlorococcus marinus str. NATL1A MITPLEKNYKGLISITGPTRSGKSQLAEFLIKKQQSVTYIATSKPRPNDPDWQQRIDLHRKRRPDRWKLIEHPKDICKAIES...ISENGSILIDSIGGLVEHHLEDDDTQWEIFQDKLLNCFTDDNLLIVFVSEEVGWGIVPATPIGHLFRERHSTLTSLLSCRSKKRLLAINGIAIDLDQIGELIP ...

  8. Protein (Cyanobacteria): 470825 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YGHEIYFGERGYKNSGGHLQPCPEWLIKNYAERLKLKFHYTFIPLIESIRIITFLKSIFPFLIAKKNHRKGLNAAINIWLIYK ... ...ical protein P9202_263 Prochlorococcus marinus str. MIT 9202 MALEIIEHLDYGYNLFKIFNNTLSNDGFALLSSPNNNSALDRYNFIR

  9. Protein (Cyanobacteria): 383158 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available EEGSWHGMFAGFCIGMLVDATHLEGASQIPALIILGFWWGRLGRQSQLIESSFNLGLLAWIGAFLIGLTIWVQKIYLLENKTISFFHAFSLHSLLAETIITALLAPIICSLLLLYFFRYKT ... ...al protein P9211_17461 Prochlorococcus marinus str. MIT 9211 MKKLSKRSLYLLIGFAVPFLNLLNPAWISIKGVGPSWAVLWLLPWAL

  10. Protein (Cyanobacteria): 308061 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available IVMEIGTTRAIAAQILRHRSFSFQEFSQRYADVSTMAFAKPPSLRRQDIKNRQSSIDDLDQETVSKLSSKANLLFEQSRDLYQEMLAAGVAKECAREVLPLATPTKIYMAGSVRSWLHYIDLRSAHGTQKEHQDVAIKCREILTQEMPCVCNAMWP ... ...t thymidylate synthase Prochlorococcus marinus str. MIT 9303 MNTVSLISVTPKAEEIIAYCARVSNPQNQDNPDSERLIRYLIKHRHWSPFEMAH

  11. Protein (Cyanobacteria): 343580 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Prochlorococcus marinus str. MIT 9313 MSDGSVNSDSPLPSPSSYLSKDINAVMAQSDALVGIDDVQKSLNRSRASVYRYTNTDPRNLNPSFNPRKLNPEYRSDQ...KDPLLFHPNEVARFAKDVLRIKEVTVEVLNSPSTATQQVLGSILEELRAIRSQLDGLNDAPSDLAAHRERQDRPAA ...

  12. Protein (Cyanobacteria): 343581 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se Prochlorococcus marinus str. MIT 9303 MSDGSVNSDSPLPSPSSDLSKDINAVMAQSDALVGIDDVQKSLNRSRASVYRYTNTDPRNLNPSFNPRKLNPEYRSDQ...KDPLLFHPNEVARFAKDVLRIKEVTVEVLNSPSTATQQVLGSILEELRAIRSQLDGLNDAPSDLAAHRERQDRPAA ...

  13. Protein (Cyanobacteria): 318827 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available l protein PMT0264 Prochlorococcus marinus str. MIT 9313 MPAFSLGLPVVGMIWALNALMLIKADLVRGYGWLADPPISNLWPCSLAGRQP...VLAIATAQDDREARRRAIIYSVGSAPSPIWCSQVLMRCGPAFDINGEPNLAGGFQNRVLIYGLPASLSHGEPGFVARPDPLLPVLRLELEENFKAPNGKMQRIRSAASA ...

  14. Correlation among the cytokines levels in the bronco-alveolar lavage in a cohort of patient of the Central Military Hospital, with systemic sclerosis (SS), with and without alveolitis

    International Nuclear Information System (INIS)

    Systemic sclerosis (SS) is a generalized connective tissue disorder characterized clinically by thickening and fibrosis of the skin and by distinctive forms of involvement of internal organs, notably the heart, lungs, kidneys and gastrointestinal tract. We analyzed nineteen patients with SS 9 with SSI, 10 with SSd and two healthy controls. All patients were evaluated by comprise of skin, heart, lungs, and kidneys. Pulmonary assessments were performed with chest radiography, high-resolution computerized tomography, vital capacity, forced expiratory volume and bronchoalveolar lavage (cellular counts and measured interleukin). The interleukin's levels of IL 6, IL 1 β IL 8, and TNFα were found increased in all patients with SS, but not in healthy controls. The interleukin's level in SSd patients tended to be higher than in SSI patients, but this difference only reach statistical significance with interleukins 6. Lung involvement in SS is associated with an increase in interleukin's levels in BAL fluids, but this difference only reach statistical significance with the interleukins 6 lL 1β and TNFα

  15. Structural lipid changes and NKA activity of gill cells´ basolateral membranes as response to increasing salinity and atrazine stressors in sea lamprey (Petromyzon marinus, L. juveniles

    Directory of Open Access Journals (Sweden)

    Maria João Lança

    2015-12-01

    Modulation of BLM lipids associated with NKA activity seems to be the strategy adopted by gill cells of juveniles to compensate for osmotic and ionic stressors and for contact/resistance to ATZ exposure.

  16. Details of the structure determination of the sulfated steroids PSDS and PADS: new components of the sea lamprey (petromyzon marinus) migratory pheromone.

    Science.gov (United States)

    Hoye, Thomas R; Dvornikovs, Vadims; Fine, Jared M; Anderson, Kari R; Jeffrey, Christopher S; Muddiman, David C; Shao, Feng; Sorensen, Peter W; Wang, Jizhou

    2007-09-28

    The discovery of two new components of the migratory pheromone used by sea lamprey to guide adults to spawning grounds was recently reported. These hold promise for use in a pheromone-based control program for this species, an invasive pest in the Great Lakes. Details of the structure determination of these steroidal bis-sulfates [petromyzosterol disulfate (PSDS, 2) and petromyzonamine disulfate (PADS, 3)] are described here. Pattern matching of 1H NMR data was particularly valuable. This involved comparison of spectra of the natural samples of 2 and 3 with those of appropriate steroidal analogues [e.g., petromyzonol sulfate (PS, 1, a previously known sea lamprey bile acid derivative that is a third component of the migratory pheromone), cholesterol sulfate (6), and squalamine (8)] and model compounds containing the unprecedented aminolactam substructure present in 3. The logic underlying the iterative analyses used is presented. PMID:17718505

  17. NCBI nr-aa BLAST: CBRC-VPAC-01-1290 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1290 ref|YP_001011324.1| permease [Prochlorococcus marinus str. MIT ... 9515] gb|ABM722 ... | Predicted permease [Prochlorococcus marinus str. MIT ... 9515] YP_001011324.1 1.2 26% ...

  18. NCBI nr-aa BLAST: CBRC-ETEL-01-0712 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0712 ref|YP_396762.1| ammonium transporter [Prochlorococcus marinus str. MIT ... 9312] ... ammonium transporter [Prochlorococcus marinus str. MIT ... 9312] YP_396762.1 0.39 29% ...

  19. NCBI nr-aa BLAST: CBRC-VPAC-01-1063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1063 ref|YP_001011324.1| permease [Prochlorococcus marinus str. MIT ... 9515] gb|ABM722 ... | Predicted permease [Prochlorococcus marinus str. MIT ... 9515] YP_001011324.1 1.8 25% ...

  20. NCBI nr-aa BLAST: CBRC-ETEL-01-0189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0189 ref|YP_396602.1| Thioredoxin domain 2 [Prochlorococcus marinus str. MIT ... 9312] ... Thioredoxin domain 2 [Prochlorococcus marinus str. MIT ... 9312] YP_396602.1 9.6 31% ...

  1. NCBI nr-aa BLAST: CBRC-VPAC-01-1582 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1582 ref|YP_001011324.1| permease [Prochlorococcus marinus str. MIT ... 9515] gb|ABM722 ... | Predicted permease [Prochlorococcus marinus str. MIT ... 9515] YP_001011324.1 0.088 26% ...

  2. NCBI nr-aa BLAST: CBRC-OPRI-01-0594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0594 ref|NP_895536.1| hypothetical protein PMT1709 [Prochlorococcus marinus str. MIT ... hypothetical protein [Prochlorococcus marinus str. MIT ... 9313] NP_895536.1 3.2 32% ...

  3. Protein (Cyanobacteria): 470883 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available etical protein P9211_14491 Prochlorococcus marinus str. MIT 9211 MAAAAFLSAAAFLSAAAFLSAAAFLAAAACLSAAAFLSAAAFLSAAAFLAAAACL...SAAAFLSAAAFLAAAAFLSAAACLSAAAFLSAAAFLAAAACLSAAAFLAAAACLSAAAFLSAAAFLAAAACLSAAAFLSAAAFLAAAACLSAAAFLSAAAFLAAAACLSAAAFLAAAACL...SAAAFLAAAAFLAAAACLSAAAFLSAAAFLAAAAFLSAAACLSAAAFLSAAAFLAAAACLSAAAFLAAAACL...SAAAFLSAAAFLAAAACLSAAAFLSAAAFLAAAACLSAAAFLAAAACLSAAAFLAAAACLSTPCLLAATCKSILYVLIYSSTLIVSKRPSLLKVNQLH ...

  4. Protein (Cyanobacteria): 186351 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available TIDYVVTKIPRFAFEKFKGSPAVLSTAMKSVGEAMAIGRCFEESFQKAMRSLEIGRAGWGCDRQEPEFTPTEIERLLRTPSPERIMAVRTAMLAGRSDHDIYALSKIDIWFLAKLRHMINIE...PLYRLDSDDQLYKLEPESEVVTDNRAKVMILGGGPNRIGQGIEFDYCCCHASFASQDKGFVTVMVNSNPETVSTDYDTSDRLYFEPLTLEDVLNVIEAER...hate synthase large subunit Prochlorococcus marinus str. MIT 9313 MPRRSDLRRILLLGSGPIVIGQACEFDYSGTQACKALRDEGFEVVLVNSNPASIMTDPE...MRSTGEVMGSASSFGMAFAKSEIAAGDSLPIRGTVFLSTHDRDKPALILVAERLIELGFDLTATSGTAQALNRAGLNVQPVLKVHEGRPNIEDLIRSGQIQLVINTPIGRQAAHDDKYLRRAALDYSVPTLTTIAGARAAVEGITALQQQSLSVAALQDIHV ... ...MADRTYIEPLTPEVVTRVIELERPDALLPTMGGQTALNLAVELAENHTLERFGVELIGADLAAIRKAEDRQLFKQAMERIGVNVCPSGIAS

  5. Protein (Cyanobacteria): 28175 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available EAQVKITINREKNTLTISDNGIGMNDEEIKKYINQVAFSSAEEFLTKYKKDNDEFIGHFGLGFYSSFMVADKVDILTKSAIGESKAFKWSCDGSPNFTLEESERETIGTDVILHLLEEEKEFIEPER...DEKFAELVNNSIIFETIINSEKNVTKNIENKSLIKSNDKYFTTLANYKERNKLTDSKKIIYCSDLIAQSSALKICLSDNKEVIKSDPLIDAQFLPWLESKNEDFQFQRVDSEINEIE...NTDYPYDIQGILYFPKLSGRADWEKGEIKLFCNQVFVSDSIKEIVPKYLLPLRGVIDSTDIPLNVSRSALQTDRKVRSISSFISKKIANKLKDLIKNSPEFYAEIWDSISAFIKIGAIE...ck protein 90 Prochlorococcus marinus str. MIT 9301 MEKGEIRINTENIFPIIKKAVYSDHEIFLRELVSNGVDAISKRRMASMAGDCENTE...IKSLIKKYCDFMPIDVLLEGETINKKNPPWRKQPSELKDEDYIELYKYLYPFQGDPLLWIHL

  6. Protein (Cyanobacteria): 436078 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available photosystem I PsaK protein (subunit X) Prochlorococcus marinus subsp. pastoris str. CCMP1986 MLTTLFAAAAAPATFEWSPKCAIVMIACNVFAYAIARATIRKPNEGFEIPNSQFFGGLSHASVVGANCLGHIFGIGAILGLASRGVL ...

  7. Protein (Cyanobacteria): 244240 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available etical protein P9301_14351 Prochlorococcus marinus str. MIT 9301 MSSFGVMFHHFHGDYHKPSQGSINKNDFERIIDYLQSKYLIINANSY...DKWFRYLRDVVLKEYNYDQIMLKIMNKCNFDKSSASKKLWIKTSQLKEMHQEGHIIGLHSYSHPTKIDNLPYQQ...LKKIINKSLKPNEICLTFDDALRSQYDIAIPILRQRNISAFFFIYSSVFSNNPSKLEIYRYFRSNYFQSIDQFYSQFFDIVKTNFRDKYNSELEQYKSLNYLSHFPFYTNS...QNEEYQKNLYHLKKVLNVEKIESMSHPCGRYNGDTLDILKDIGIKVGFRSNMSIKETKNSLEIPREDHSNILSRIK ...

  8. Protein (Cyanobacteria): 39401 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available HLLDGDAASNTLSWRWVAGMHTNKKPYLASKENINKYTVNRFRDTSISLSSKINIIKHSQHKSNKLPVQRSFPNSNILIMFDNDMDIMSRSTLFNSYS...olyase-like protein Prochlorococcus marinus str. NATL1A MNIFDEANDLLDNFIFNHLNSYHQLRNYDYGIEDRTNVSQISKYTSHRILYE...FDIIEKLKKYDKKQKYTDEILWRIYWKGYLENYKSIWFEYINFKENSNNSYLISSAINGKTGIDCFDTWIEELRENNYLHNHARMWFASIWIFTLGLPWQLGARLFMK...KVYILRNIAINNEFDLSENVSQFKRGLIDKVNKLIPNSEVLKSTDLGINLSGHNFIDVIYPGVGHNLDLINKFANQNQIIFNYIYREDDLKYWNYANSGFYKFKTSFNRINMI ...

  9. Protein (Cyanobacteria): 306398 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available n Prochlorococcus marinus subsp. pastoris str. CCMP1986 MKLFQKLIAVPAVISMSTGFAVNAAEINSIDLNSYSDSSKVASMSDFQSNEF...WDMAVGHSMDASKTWPNACSMNNMVDNLGDCGAANSVDLSGDTSFSASTGFGDGFELGIGVSGGDGTGLFTEQSSDAYGLAVGYETDSYGFTAAYSDKDTASYYGLTAYYS...PEGLPTTLSGGFEFGTPEGTGEDTTQWAFGISGDVGEGTLSANVGTNGQMKDSTTDVYAYDLSYEYPLNDSMSVTPFVYVSEVAGSDNTTGFGSFLSFSF ... ...FPGDWTYESLKELSTKTNNVDSSIFNGKSISRIQAAAVLNSVIQSDDLLAGGEGMMNGSMINRLSDELGSELAIMKGRVDGLEARVNEFEAGQFSETTTMSAGAGFLI...GATDSASGQTGLNNNDTVQFEYILEVDFNTSFTGEDKLNIEIETGNGLTNVGADKVGLDWGSGNADVLKLDDINYSFPVGS

  10. Protein (Cyanobacteria): 122793 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GTSLLGGLLGTANGWLLANCRFPGRRALRVAQLLPLATPAYLLSAILIDLGSRNAIRIHGMGWGILIMALTTYPYVFLLSTESFSICGRRQLEACRSLGVGPWNSFRRIA...ransporter Prochlorococcus marinus str. MIT 9313 MTQDAVPSNYGSNRLRKRHWQPDRLFLNSMAILLAVLALWPLIGLIREALQGFINGSASLGVDGPQQIQGTLTLLI...MSLVGYERRLRRRSRRWTEGVAGGDSPAWQLHGVRALCAQCLALIPPTITLGVPLLWAILNLDQLEQGIDPDLIPLTERSLGLGLAAASLAVVAGLILAIAKRWSSTRWMGNLSFVAGIGYAIPGAVMAIA...LMPFNGAPWNLAWILLLLWGYSDRFLAVAKGGLDAAFERLSPSLDEAATGLGCQWQEVLRRVHLPLLKGPLAVGALLVFVDTVKELPLTFVLRPFDFDTLSVRLYQYAADERMAESILPALIIIALGLIASLALVPGLDQGEQKKPHSSKEPLT ... ...LPMALPAIGAGIALMGMEVVNELGAVALLAIPSLSAGIVETWQMEGNPAGAIGLAMIALIIV

  11. Protein (Cyanobacteria): 57112 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ELSLQSIPVNLKKIFIINDPVDQINKSLSDVSFEELTERNKLIRIITSELNDPKIYKNISKDFENKNFKFLIDEIEKKSNNNSYKPSPDTFDLFKGDRFLYHLLSRKFDFDDSALITKSFSSKMFLKIL...AIRLIPLFTILIGSILALKILWTTIALKKFGWKEIKYLDLELIDMVLLIAGGFVVLGE...IVLNNNNYLSFFLLFLTTTLLAPLFEEIIFRGILLPTLSRNFGVISGIIISAFIFALAHLSLGEMPPLFVLGIGLGITRIASGSLFSSVIMHSLWNGLTFLNLFLLRT ... ...e-associated protease Prochlorococcus marinus str. MIT 9301 MIFKNISKSKLTLAFISIVITFFVWQQGLRDSLNRPSVTFDISQKEQEIA...VVSPLFSISLVELFSRNISNELSQSLKIFFGYLFMAIPPLGIVYYQIKSLNGEFNFKKDYLQFNFLPIKYAIIQGIKGWLTIVPFVLLISLIMNSLIDNQNGSNPLLE

  12. Protein (Cyanobacteria): 57114 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available TNDPIDEINHSLSQVPFDELTERNKLIRIISSESNKPTINKNIFKDFEDKNFNLLMDEIEKKSNDNSYKLNSDNFDFFKGDRFLYHLLSKKFHFDDSSLI...TKSFSSKMFLKILAIRFIPLLTILLGSILALKRLWETISLKKFGWQEIKSLDLGLIDMVLLIAG...GSNPLLEIVLNNNNYLSFFLLFVTTTILAPLFEEIIFRGILLPTLSRDFGIISGIIVSAFIFALAHLSLGEMPPLFVLGIGLGITRIASGSLFSSVIMHSLWNGLTFLNLFLLRT ... ...membrane associated protease Prochlorococcus marinus str. MIT 9202 MIFKNISKAKLSLALISLVITFFVWQQGLRDSLNRPSVSFDITQKEQEILELSVQSIPTNLKNILI...GFVVLGEVISPLFSISLVELFSKNISNELSQSLKIFFGYLFMAIPPLGIVYYQIKSLHGQFTFKKDYLQFNFLPIKYSIIQGIKGWLTIVPFVLLISLIMNSLIDNQN

  13. Protein (Cyanobacteria): 313589 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GSASWWVASKEMGDGTYFVKRQVIWLISSWSIAWFTISISLRKWLKLSRSCLLICLLLVIGTLLFGSTINGSSRWLIVGPIRIQPSELVKPFVILQ...QSLLAIGSGGWFGEGYGLSTQKLLYLPFLSTDFIFAVFAEEFGFVGSLMLVLFLTLIAFVGLRIALRCRNNYSKLIAIGCSTLLVGQAIMHLAVASGSMPTTGLPLPMISYGGNSLLSSLLIGGLLIRCALESTGLIGGLEIKKRLN ... ...AANVFAQWKRLQIDHKIFWLGLFGGLIALILKQPNLSTAALIGILLWLMALSAGIKFSSLLSTAFLGGLIGASSILINEYQKLRVISFINPWQDPQGSGYQLI...on protein FtsW Prochlorococcus marinus str. MIT 9211 MSVQDLQKSNSQKVLTKRSKPYLPRKLHNQTFWQRLLPLPWDIWPAEARLLLALIAFWSFAGLFIL

  14. Protein (Cyanobacteria): 29411 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available carboxypeptidase 3 Prochlorococcus marinus str. MIT 9313 MRILPACSKIAKRNHSQLLIRILGAGGILIGSNVSAAPTVLSPPPPVAIQG...WPSLQSGRLCPSLQRSFKSLLGQGSSAWSVSVLDRHGQLLADINGTIAKVPASNQKLITTAFALDKLGPDFKLRTQLLRRPDGVLEISGEGDPDLGITEIQRFAMAALGQGGSRTFRSHDDLQLLIR...LSLVNHDQVKTSSAQSVLLHEEDSAPMHALVSLANAESHNFTAEVLLRHAAKSWDVRLASREAMRWMQRQNLPLTGLRIADGSGLSRNNRMSSQTLATLLMRMGHHPLAPYYQASMAIA...GQRGTLRKLFRGTSLEGKFWGKTGTLNGVRSISGILETEDGPRYVSAIANGASSPNRTIGLLLKAIQRFSPCSSSLSTSK ... ...EEPQQRWWPSDWHPADRIYAYGAPITRLALTSNALDVAVTNPIGRLQRLLEREIHRQGGSAH

  15. Protein (Cyanobacteria): 57113 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ELSVQSIPVNFKKFFIINDPVVQINKSLSDVSFEELTERNKLIRIITSESNDPLIYKNISKDFQDKNYQFLIDEIEKKSNNNSYKVNSEKFDLFKGDRFLYHLLSRKFDFDDSALITKSFSSKMFFKILAIR...LIPLLTILIGSILALKIIWTTISLKKFGWKEIKSLDLELIDMVLLIAGGFVVLGEVV...LNNNNYLSFFLLFVTTTLLAPLFEEIIFRGILLPTLSRDFGVISGIIVSAFIFALAHLSLGEMPPLFVLGIGLAITRIASGSLFSSVIMHSLWNGLTFLNLFLLRT ... ...e-associated protease Prochlorococcus marinus str. AS9601 MIFQNTSKSKLTLAFISIVITFFVWQQGLRDSLNRPSVSFDISQKEQEIA...SPLFSISLVELFSKNISNELSQSLKIFFGYLFMAIPPLWIVFYQIKSLNGEFTFKKDYLQFNFLPIKYAIIQGIKGWLTIVPFVLLISLIMNSLIDNQNGSNPLLEIV

  16. Protein (Cyanobacteria): 177854 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available KDKNSKIGMLNYSSRETYSEIDEIAHPLIRESLRYLKINNLIEMNSYGFASGGGGLGGSSSFCISFLAALNKAFNLNIANKELAHICSEIEINILGKPIGRQDQYISSLGGIN...ALLYKPKGHVEILNLSKNHIEAIKLVSDELILIPSLRTRSADKVLHNFKNSNKAKESLKDIRSICENFLKTNKSIN...al protein PMT9312_1336 Prochlorococcus marinus str. MIT 9312 MIFIGKCPYRISLLGGGSDLDWFVEDECFGNSIGFSLAKYSYTVINK...ELYDLLNHSIKESWEIKRKMSNVMDLELENQFNIINQIPNNWIRLIGAGSGGYFLLSSKVDINEALSFLSNKDIKALKVELSKEGISACVV ...

  17. Protein (Cyanobacteria): 289801 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available IFQLGNIYLMEKNYEKAIEEFDKAIKIKKDFWQAINNQGLAYFELNKINLSIISFKKALELEESAEPLLALASCLKNKDINKAIVLAKKALNKDPNYVDFNYRKEQLWGKKLQISTEKLFENPQIKKEILVAKTKIK ... ...YLPETKSLQKQGLSIGKEAYQLLYFGQIKDSLNLAKLAVKINNKSEILWTILAETQIANKLYDDALISLDNAQKINPKMSEIYFAKSTIYLKQSKIKKAEISLLSGIKILPKNFKA...etical protein PMM0006 Prochlorococcus marinus subsp. pastoris str. CCMP1986 MKKSLLKILFFSIISSHVFIAESLKALIPYY

  18. Protein (Cyanobacteria): 399653 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available al protein P9211_15661 Prochlorococcus marinus str. MIT 9211 MPSLLLIPSGIGCSIGGYAGDAIPTARLLAAACGSLITHPNVINGAA...ELDRYRKGQGVDLMAGAEAVVSHLLTRHLLLPCAHAPALSALSLSSDLNPLVAAEEMAHTFLPCVLVGLSRAPDLIP...LYWNDERIQYVEGFGIDRFACGEFLLRPVRRQKVGLLLDAGLESELRQRHLQAVDGCRATLGLSIGPVVTTDVPLGISLQRGASGASWGTLDNPDSLLRAGDILKERGATAIAVVTRFPDDVNTA...LNALDKISHRLLLDCISSDQLGAVIATEGALGGEAVLGCLERGTPLIIVSNPGVLNVDSESLGLKDRLSSNQNLVLKASNYFEAAAFLLALREGIEITSLKRPIERTG ...

  19. Protein (Cyanobacteria): 299617 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ISTKNKYKNLNIISFERRRGILFIAFLIKLFSKNKAHNVIIYFNNITSLWVVLGAKIAGVNNLAICVQNLIESFSIKNLKLIFLMRIFNMLNVKLVPCSYAIKNSFLN...IASELGLDIKKIFVGSKLDIPAMLAEADIFAFSTTLSEGFGIALIEAMAARLPIIATDVPACREVLDDGKAGILIPKGRVDLWINSLNEIISSSTKRDYYIEKSAQNLKKYDSKIVKTKWLKLFKE ... ...l protein P9515_13801 Prochlorococcus marinus str. MIT 9515 MTINFHILDGIKIGGIENLALTMSREGMPMEKNYLINLNKNINNFSND...FNKNIIFSNVIPNCINVKSFQNEVQKNIKFRKINSPITIMMVARLDEIKDQETLLRAYAKINKKCNLILVGDGNKRAYLEG

  20. Protein (Cyanobacteria): 119273 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available LNSEGKKLSKRDCVTSIDEFREMGYLPEALSNYMAFLGWSPKSADREILSLEEISKIFDLSEINKAGAKFSWEKLNWINSQYIKNIESIKLIEIMRKYWDDNGWKPPSEEWANKLAILI...RDSMTLLKDSIDQSKPFFLIPTIQKEGQDFLEIRESKLSLKLILNYLIEKNTIKLNKEKAKEIINEISKKHNIKKGILMKSLRVAFFGSLSGPDLIQSWELFAESKTDRTRIERCL ... ...l-tRNA synthetase Prochlorococcus marinus str. MIT 9301 MEKRLRLAPSPTGLFHIGTARTALFNWLYAQKIGGKFLIRIEDTDFLRSKSE...YTKNILEGLKWLGLKWDEEPIKQSDRISIHKSYIKKLLECGAAYRCFTSEDEISELREEQKKKGLPPKHDNRHRSLSKEEIETFISQGRTSVIRFKIDEKIEIKWIDQ...IRGEIKWQGKDLGGDLVLSRRAKGYEIGDPLYNLAVVVDDNFMNITHVVRGEDHISNTAKQILIYKALNFNLPTFSHTPLI

  1. Protein (Cyanobacteria): 528 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available al protein P9303_04231 Prochlorococcus marinus str. MIT 9303 MATRSLISLYALLATSAVITQSAEAAVYSQPNACNPIEANIQGIRNGS...WSLFLRPNNIIFGENDQARSWKNGSGKSWKNGSSSGKWKNGSGKNWKNSSGWRNGGWRNGSSGKWKNGSGGFLNW ...

  2. Interstitial lung disease

    Science.gov (United States)

    Diffuse parenchymal lung disease; Alveolitis; Idiopathic pulmonary pneumonitis (IPP) ... The lungs contain tiny air sacs (alveoli), which is where oxygen is absorbed. These air sacs expand with each ...

  3. A Rare Case of Non-Small Cell Carcinoma of Lung Presenting as Miliary Mottling

    OpenAIRE

    Ballaekere Jayaram Subhashchandra; Mohammed Ismailkhan; Kuppegala Chikkaveeraiah Shashidhar; Moda Gopalakrishna Narahari

    2013-01-01

    Miliary mottling on chest radiography is seen in miliary tuberculosis, certain fungal infections, sarcoidosis, coal miner’s pneumoconiosis, silicosis, hemosiderosis, fibrosing alveolitis, acute extrinsic allergic alveolitis, pulmonary eosinophilic syndrome, pulmonary alveolar proteinosis, and rarely in hematogenous metastases from the primary cancers of the thyroid, kidney, trophoblasts, and some sarcomas. Although very infrequent, miliary mottling can be seen in primary lung cancers. Herein,...

  4. The modular xylanase Xyn10A from Rhodothermus marinus is cell-attached, and its C-terminal domain has several putative homologues among cell-attached proteins within the phylum Bacteroidetes

    DEFF Research Database (Denmark)

    Karlsson, Eva Nordberg; Hachem, Maher Abou; Ramchuran, Santosh;

    2004-01-01

    the light of this, a revision of experimental data present on both Xyn10A and Man26A was performed, and the results all indicate a cell-anchoring role of the domain, suggesting that this domain represents a novel type of module that mediates cell attachment in proteins originating from members of the...

  5. Protein (Cyanobacteria): 274962 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available TPVPVLDMIAAAAVNAQMVIEIAKIHGVKLTNERAKNLALSVGKILATMGIVKGGVSLISSTLSLSLPTLVISKVIQGISVSWLTRIAGASFITYFQQDQDWGDGGIQEVVEYHYNLNKREEYFKSFIRRAYERVIDPLVEKNLKKLPPRSRPPKEGDSSVL ... ...ICGLSYTKKIDWLQNSLRSIFKIKDEKKSLDLSLISKKEAADKSLKSIDHLITLINDKVKAKALKDEKDRVSLELDRGDIILVVFGIGSSGKTSLIRALLKKIVGK...NSRCNDFIGPNDIICTSASPQTIAVTGRKPYQPAPEINSLIRRLANILHEEGEELIADNILLQCSNIGKEGKNLLIKQRTQSAKKCIDKYGWLSSGALIL... and related small G proteins Prochlorococcus marinus str. NATL1A MKIHNSRKIIFYVLIIFISLIIIGLVGAIIRLINIPAILITVLI...VSPEMGSTRGKETFRLKLKGLTRGIRIIDTPGILESGRGGREREKSALMEARKSDLMLVVIEGDLRSEETRTIRSLSKLGKRLLLVLNKIDLRGESEEKRLIEIL

  6. Protein (Cyanobacteria): 29412 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Ala carboxypeptidase 3 (S13) family protein Prochlorococcus marinus str. MIT 9303 MKIIPASFQITKRTHSQLLIRILGAGGILI...VLEISGEGDPDLGITEIQRFAMAALGQGGSRTFRSHDDLQLLIREEPQQRWWPSDWHPADRIYAYGAPITRLALTSNALDV...AVTNPIGRLQRLLEREIHRQGGKAHLSLVNHDQVKTSSAQSVLLHEEDSAPMHALVSLANAESHNFTAEVLLRHAAESWDVRLASREAMRWMQRQNLPLTGLRIADGS...GLSRNNRMSSQTLATLLMRMGHHPLAPYYQASMAIAGQRGTLRKLFRGTSLEGKFWGKTGTLNGVRSISGILETVDGPRYVSAIANGASSPNRTIGLLLKATQRFSPCSSSLSTSN ... ...GSNVNAAPTVLSPPPPVAVQGWPSLQSGRLCPSLQRSFKSLLGQGSSAWSVSVVDRHGQLLADINGTVAKVPASNQKLITTAFALDKLGPDFKLRTQLLRRPDG

  7. Protein (Cyanobacteria): 274965 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available LKKIVGKVSPEMGSTRGKETFRLKLKGLTRGIRIIDTPGILEAGRGGREREKSALIEARKSDLMLVVIEGDLRSEETRTIR...SLSKLGKRLLLVLNKIDLRGESEEKRLIEILNSRCNDFIGPNDIICTSASPQTIAVNGRKPYQPAPEINSLIRRLANILHEEGEELIADNILLQCSNIGKEGKNLLIKQRTQSAKKCIDKYGWLSSGALIL...TPVPVLDMIAAAAVNAQMVIEIAKIHGVKLTNERAKNLALSVGKILATMGIVKGGVSLISSTLSLSLPTLVISKVIQGISVSWLTRIA...ng protein domain-containing protein Prochlorococcus marinus str. NATL2A MKIHNSRKIIFYVLIIFISLIIIGLVGAIIRLINIPAILITVLI...IGGLTYTKKIDWLQNSLRSIFKIKDEKKSLDLSLISKKEAADKSLKSIDHLITLINDKVKAKALKDEKDRVSLELDRGDIILVVFGIGSSGKTSLIRAL

  8. Protein (Cyanobacteria): 132052 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available EINNSIKSSLENLNNFSHDEPSVTSFINQSLKILNKTADFDLKIQKFREKLFNIHADVEDLIFDLKSYLQEIESYESNLPEIQKRLFFLKNLERTFALDLTQLIEKRDQLKMYFQQNDQGNEICRIKAQIE...RPGKDFCVIEAIFSSSIQINNWLIRNGFEITSSELQIKRKSYKKNNKILTKYSLNDLPINRQSLEKLGGFLIDFAGQSDTFIFDSLDKRRLI...NFQSNLNSLFVIQSIERKKIAKQLQNSVMLILSNLGLENANFLIQFSECKPSGDGIDDINFLFSANPDQKLAPLSNVISGGEMSRFLLAIKSSISKQPNTFFL...DEIDSGLSGKSLFSLVELIKEISKNQQVLCITHQPFLAARGSVHFKVNKNVINGITYTSIAKLTTKNQRKNELIELIGGGSCEVIEYASRLLDRSAA ... ... protein RecN, ABC transporter Prochlorococcus marinus str. MIT 9301 MLVQLKIENIALIEIIEINFEKGLNIITGDSGSGKSLILDSLNALFGGTNIPLKHLI

  9. Incidence of fibrinolytic alveolitis, acute infection, edema, and pain longer than two days after dental extraction = Incidência de alveolite fibrinolítica, infecção aguda, edema e dor por mais de dois dias após extração dentária

    Directory of Open Access Journals (Sweden)

    Bortoluzzi, Marcelo Carlos

    2008-01-01

    Full Text Available Objetivo: Este é um estudo prospectivo, observacional e descritivo sobre a incidência de alveolite fibrinolítica (FA, infecção aguda (AI, edema e dor por mais de dois dias (P2D após cirurgia de extração dentária. Metodologia: A amostra foi constituída por 80 casos cirúrgicos de extração dentária realizados por alunos de odontologia da Universidade do Oeste de Santa Catarina. As seguintes complicações foram registradas: 2 casos de FA (2,5%, 2 casos de AI (2,5%, 8 casos de edema significativo (10% e 8 casos de dor com duração por mais de dois dias após a cirurgia (10%. Resultados: O teste do qui-quadrado mostrou associação significativa entre osteotomia e desenvolvimento de FA (P=0,001, e entre P2D (P=0,02 e edema (P=0,01. O relato de extração dentária difícil ou traumática foi relacionado com desenvolvimento de FA (P=0,01, P2D (P < 0,001 e maior edema (P < 0,001. Conclusão: Os resultados sugerem que FA, edema e P2D estavam relacionados com extração dentária mais traumática e realização de osteotomia nesta amostra

  10. Medicinal plants in the healing of dry socket in rats: microbiological and microscopic analysis.

    Science.gov (United States)

    de Melo Júnior, E J M; Raposo, M J; Lisboa Neto, J A; Diniz, M F A; Marcelino Júnior, C A C; Sant'Ana, A E G

    2002-03-01

    The effectiveness of medicinal herbs as antimicrobial agents was tested on isolated microorganisms from an induced alveolitis and on alveolitis in rats. Sixteen ethanolic extracts from plants were prepared and tested. The plant materials were selected from ethnobotanic data and the best result was obtained with Schinus terebinthifolius Raddi. The activity on Enterococcus, Bacillus corineforme, Streptococcus viridans and S. beta-hemolytic was better than the one presented by the antibiotic currently used for the treatment of alveolitis. The extract of Schinus terebinthifolius Raddi has shown good wound-healing activity by histological analysis. PMID:11995943

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-0349 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0349 ref|ZP_05139216.1| conserved hypothetical protein [Prochlorococcus marinus str ... . MIT ... 9202] gb|EEE41041.1| conserved hypothetical protei ... n [Prochlorococcus marinus str. MIT ... 9202] ZP_05139216.1 0.038 27% ...

  12. NCBI nr-aa BLAST: CBRC-RMAC-13-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-13-0001 ref|NP_895535.1| hypothetical protein PMT1708 [Prochlorococcus marinus str. MIT ... emb|CAE21883.1| rodA [Prochlorococcus marinus str. MIT ... 9313] NP_895535.1 0.035 30% ...

  13. Perkinsosis in the clams Ruditapes decussatus and R. philippinarum in the Northeastern Atlantic and Mediterranean Sea: A review.

    Science.gov (United States)

    Ruano, Francisco; Batista, Frederico M; Arcangeli, Giuseppe

    2015-10-01

    Perkinsosis is a disease of gastropod and bivalve molluscs caused by protozoan parasites of the Perkinsus genus. These parasites have been responsible for mass mortalities worldwide, with a significant impact in both fisheries and aquaculture, and resulting in severe economic losses. This review focuses mainly on current knowledge of diagnostic methods and on the distribution of Perkinsus spp. in the Northeastern Atlantic and Mediterranean Sea, which infect the grooved carpet shell clam Ruditapes decussatus and the Japanese carpet shell clam Ruditapes philippinarum. The association between perkinsosis and high mortality rates of R. decussatus and R. philippinarum in southern European countries such as Portugal and Italy is discussed as is the role of environmental factors in those mortality outbreaks. The putative introduction of Perkinsus olseni into the Northeastern Atlantic and Mediterranean Sea is also discussed, as are management strategies that could be used to mitigate the impact of perkinsosis in production of R. decussatus and R. philippinarum. PMID:26239015

  14. Cellular profile of bronchoalveolar lavage fluid in Turkish miners

    OpenAIRE

    Kayacan, O.; Beder, S; KARNAK, D.

    2003-01-01

    Pneumoconiosis is still a health problem in Turkey and has a relatively high incidence. Retired underground miners were investigated to document alveolitis, and to observe the difference in the cellular profiles of bronchoalveolar lavage (BAL) fluid with or without pneumoconiosis.

  15. Disease: H00346 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00346 Extrinsic allergic alveolitis (EAA); Hypersensitivity pneumonitis Extrinsic allergic alveoli...ainly organic antigens by sensitized subjects. This induces a hypersensitivity response in the distal bronchioles and alveoli...tion The McGraw-Hill Companies, Inc. (2007) PMID:16635083 (description, env_factor) Ismail T, McSharry C, Boyd G Extrinsic allergic alveolitis. Respirology 11:262-8 (2006) ...

  16. Expression der NADPH-Oxidasen NOX1 und NOX4 in der Lunge des Kaninchens unter Normoxie und Hypoxie

    OpenAIRE

    Selbitz, Anne-Christine

    2008-01-01

    Die hypoxische pulmonale Vasokonstriktion (HPV) gewährleistet unter physiologischen Bedingungen eine optimale Anpassung der lokalen Perfusion an die Ventilationsverhältnisse der Lunge. Auslöser der HPV ist eine lokale alveoläre Hypoventilation, die in minderbelüfteten Lungenbezirken zur reflektorischen pulmonalarteriellen Vasokonstriktion und somit einer Umleitung des Blutflusses zu besser belüfteten Lungenarealen führt. Chronische alveoläre Hypoxie führt dagegen zu pulmonaler Hypertonie, Cor...

  17. Gene : CBRC-PMAR-01-0360 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE273115 /gi=111169992 /ug=Pma.7410 /len=694 1e-18 49% MCVVCVSYVCRM...CVVCVSYVCRMCVVCVSCVCCVCVVCVSYVSCVCRVCVVCVSYVCRVYVVCMLYVCCVYVVCISYVCRMCVVCVSCVCRM...CVVCVSYVCRVYVVFMSYVCRMCVVCVSCLCSVYVVCMSYVCRMYVVCMLRLCCVYLVCLLYVCRMYVVCVSYVCCVYVVCMLYVCRMCVVCMLYVCRMYFVCMYACRM

  18. Mouth of a lamprey

    OpenAIRE

    Editorial Staff, Frontiers of Biogeography

    2013-01-01

    cover: Mouth of a Petromyzon marinus lamprey, taken at Aquarium Finisterrae (Coruña, Galicia, Spain). The original has been rotated. Picture by Drow male (http://commons.wikimedia.org/wiki/User:Drow_male), Creative Commons license.

  19. Gene : CBRC-PMAR-01-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE276047 /gi=111173437 /ug=Pma.1199 /len=495 0.004 30% MRPVI...TRPIIATPIITAHILTARVITRPVITRPVIATPIITAHILTARVITRPVITSAVIATPIITAHILTAPVITRPIITSPVI...ATPIITAHILTAPVITRPVITSPVIATPIITAHILTAPVITRPVITSAVIATPIITAHILTAPVITRPVITSAVIATPIITAHILTARVITGSVTTRAVMTCPWRTCLPSGLAVQHVCN ...

  20. Draft Genome Sequences of Gammaproteobacterial Methanotrophs Isolated from Marine Ecosystems.

    Science.gov (United States)

    Flynn, James D; Hirayama, Hisako; Sakai, Yasuyoshi; Dunfield, Peter F; Klotz, Martin G; Knief, Claudia; Op den Camp, Huub J M; Jetten, Mike S M; Khmelenina, Valentina N; Trotsenko, Yuri A; Murrell, J Colin; Semrau, Jeremy D; Svenning, Mette M; Stein, Lisa Y; Kyrpides, Nikos; Shapiro, Nicole; Woyke, Tanja; Bringel, Françoise; Vuilleumier, Stéphane; DiSpirito, Alan A; Kalyuzhnaya, Marina G

    2016-01-01

    The genome sequences of Methylobacter marinus A45, Methylobacter sp. strain BBA5.1, and Methylomarinum vadi IT-4 were obtained. These aerobic methanotrophs are typical members of coastal and hydrothermal vent marine ecosystems. PMID:26798114

  1. Draft Genome Sequences of Gammaproteobacterial Methanotrophs Isolated from Marine Ecosystems

    OpenAIRE

    Flynn, James D.; Hirayama, Hisako; Sakai, Yasuyoshi; Dunfield, Peter F.; Klotz, Martin G.; Knief, Claudia; Op Den Camp, Huub J M; Jetten, Mike S. M.; Khmelenina, Valentina N; Trotsenko, Yuri A.; Murrell, J. Colin; Semrau, Jeremy D.; Svenning, Mette M.; Stein, Lisa Y.; Kyrpides, Nikos

    2016-01-01

    The genome sequences of Methylobacter marinus A45, Methylobacter sp. strain BBA5.1, and Methylomarinum vadi IT-4 were obtained. These aerobic methanotrophs are typical members of coastal and hydrothermal vent marine ecosystems.

  2. Draft Genome Sequences of Gammaproteobacterial Methanotrophs Isolated from Marine Ecosystems

    Science.gov (United States)

    Flynn, James D.; Hirayama, Hisako; Sakai, Yasuyoshi; Dunfield, Peter F.; Knief, Claudia; Op den Camp, Huub J. M.; Jetten, Mike S. M.; Khmelenina, Valentina N.; Trotsenko, Yuri A.; Murrell, J. Colin; Semrau, Jeremy D.; Svenning, Mette M.; Stein, Lisa Y.; Kyrpides, Nikos; Shapiro, Nicole; Woyke, Tanja; Bringel, Françoise; Vuilleumier, Stéphane; DiSpirito, Alan A.

    2016-01-01

    The genome sequences of Methylobacter marinus A45, Methylobacter sp. strain BBA5.1, and Methylomarinum vadi IT-4 were obtained. These aerobic methanotrophs are typical members of coastal and hydrothermal vent marine ecosystems. PMID:26798114

  3. Protein (Cyanobacteria): 433086 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available antitermination protein NusG Prochlorococcus marinus str. MIT 9312 MSNELTTNLASSKANTSIARWYAVQVASSCEKKVKATLEQR...YP_396705.1 1117:25313 1212:957 1217:957 1218:957 1219:957 74546:217 transcription

  4. Protein (Cyanobacteria): 174468 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available s with different specificities Prochlorococcus marinus str. MIT 9202 MINSTKNDKTIGITGASGALGKELTKLFRQKGYKVIGFS...ZP_05138363.1 1117:3468 1212:440 1217:440 1218:440 1219:440 93058:866 dehydrogenase

  5. Protein (Cyanobacteria): 158688 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_397847.1 1117:3219 1212:425 1217:425 1218:425 1219:425 74546:294 dehydrogenase with different specificiti...es Prochlorococcus marinus str. MIT 9312 MNLDLKDKFIIIAGGLGGIGLETVKDLISEGAEISILTQNES

  6. Mercury concentrations in gafftopsail catfish and other fishes in waters adjacent to Hobe Sound National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From September 22-26, 1990, 20 gafftopsail catfish (Bagre marinus) and 3 other fish species (n=4) were collected from marine waters adjacent to Hobe Sound National...

  7. Mercury in fishes of the J.N. "Ding" Darling National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From June 26 to 30,1990 spotted gar (Lepisosteus oculatus), spotted seatrout (Cynoscion nebulosus), gafftopsail catfish (Bagre marinus), and largemouth bass...

  8. Mercury in fishes of the Chassahowitzka National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From August 24 to 28, 1990, spotted seatrout (Cynoscion nebulosus), hardhead catfish (Arius felis) and gafftopsail catfish (Bagre marinus) were collected from...

  9. Gene : CBRC-PMAR-01-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...

  10. Lijst van de Nederlandsche visschen aanwezig in 's Rijks Museum van Natuurlijke Historie te Leiden, tevens eene vermelding van de tot nu toe in en bij Nederland waargenomen visschen

    NARCIS (Netherlands)

    Popta, C.M.L.

    1924-01-01

    Afd.: CHORDATA. Groep III: CEPHALOCHORDATA. Fam.: BRANCHIOSTOMATIDAE. Branchiostoma lanceolata (Pallas) — slakprik, niet aanwezig. Groep IV: CRANIATA. Klasse: Marsipobranchii. Fam.: PETROMYZONIDAE. Petromyzon marinus L. — zeeprik. 1 ex. beschadigd, Noordzee, uit het oude kabinet, in spir. no. 4277.

  11. [Toxic and drug-induced lesions of the pulmonary parenchyma].

    Science.gov (United States)

    Russi, E

    1992-05-01

    Pulmonary tissue may be damaged by certain toxins or drugs in a dose-dependent way or by a hypersensitivity reaction. Pathological changes consist of a permeability pulmonary edema, an alveolar hemorrhage, an alveolitis and finally the formation of pulmonary fibrosis. Ingestion of the weed killer paraquat may induce a rapidly progressive and lethal form of fibrosing alveolitis, the inhalation of nitrous oxides may elicit lung edema. The most common drugs causing lung damage are cytotoxic agents, often used in combination, and the noncytotoxic drugs amiodarone and nitrofurantoin. PMID:1589677

  12. Asbestos and Probable Microscopic Polyangiitis

    OpenAIRE

    George S Rashed Philteos; Kelly Coverett; Rajni Chibbar; Ward, Heather A; Cockcroft, Donald W

    2004-01-01

    Several inorganic dust lung diseases (pneumoconioses) are associated with autoimmune diseases. Although autoimmune serological abnormalities are common in asbestosis, clinical autoimmune/collagen vascular diseases are not commonly reported. A case of pulmonary asbestosis complicated by perinuclear-antineutrophil cytoplasmic antibody (myeloperoxidase) positive probable microscopic polyangiitis (glomerulonephritis, pericarditis, alveolitis, multineuritis multiplex) is described and the possible...

  13. Pædodontisk parodontologi

    DEFF Research Database (Denmark)

    Nørregaard, Marie-Louise Milvang; Kongstad, Johanne; Poulsen, Anne Havemose; Haubek, Dorte

    2015-01-01

    Pædodontisk parodontologi En tidlig alder for sygdomsdebut, høj sygdomsprogression, fravær af systemisk sygdom og involvering af flere tænder med et karakteristisk mønster for tab af den alveolære knogle er vigtige diagnostiske elementer ved den aggressive marginale parodontitis. Hos børn og unge...

  14. Cholestasis and pneumonitis induced by gold therapy.

    Science.gov (United States)

    Farre, J M; Perez, T; Hautefeuille, P; Tonnel, F; Colombel, J F; Duquesnoy, B; Delcambre, B

    1989-12-01

    The authors describe the association of gold salt-induced cholestasis and lymphocytic alveolitis proved by liver biopsy and broncho-alveolar lavage. To our knowledge this is the third case report on the combination of liver disease and pulmonary infiltration induced by gold compounds. PMID:2612124

  15. Evaluation of lung function abnormalities prevalence in poultry workers

    OpenAIRE

    Dias, Hermínia Brites; Clérigo, Anália; Carolino, Elisabete; Viegas, Carla

    2012-01-01

    Introduction - Poultry workers can be at an increased risk of occupational respiratory diseases, like asthma, chronic obstructive pulmonary disease and extrinsic allergic alveolitis. Spirometry screening is fundamental to early diagnosis trough the identification of related ventilatory defects. Purpose - We aimed to assess the prevalence of lung function abnormalities in poultry workers.

  16. Cryptogenic organizing pneumonia after radiotherapy for breast cancer

    OpenAIRE

    Fumagalli Giorgio; Sanguinetti Claudio M

    2010-01-01

    Abstract We report a case of fever, dyspnea, respiratory failure and migratory, recurrent and bilateral lung opacities 4 months after radiotherapy and hormone therapy following surgery for breast cancer. Computerized tomography (CT) scans showed infiltrates outside the radiation fields. Bronchoalveolar lavage revealed lymphocytic alveolitis, whereas laboratory analysis demonstrated a mild systemic inflammation. Systemic steroids resulted in clinical and radiological improvement, but a disease...

  17. Idiopathic pulmonary fibrosis and collagen vascular diseases - high resolution CT findings

    International Nuclear Information System (INIS)

    The aspects of the thorax high-resolution computed tomography of 15 patients with idiopathic pulmonary fibrosis and 11 patients with collagen vascular diseases are described and characterized mainly by the presence of reticular lesions with little cysts predominantly in the periphery and lower lobes. They may be associated with ground-glass lesions that, as usual, means areas of alveolitis. (author)

  18. Genome Sequence of Ureaplasma diversum Strain ATCC 49782.

    Science.gov (United States)

    Marques, Lucas M; Guimarães, Ana M S; Martins, Hellen B; Rezende, Izadora S; Barbosa, Maysa S; Campos, Guilherme B; do Nascimento, Naíla C; Dos Santos, Andrea P; Amorim, Aline T; Santos, Verena M; Messick, Joanne B; Timenetsky, Jorge

    2015-01-01

    Here, we report the complete genome sequence of Ureaplasma diversum strain ATCC 49782. This species is of bovine origin, having an association with reproductive disorders in cattle, including placentitis, fetal alveolitis, abortion, and birth of weak calves. It has a small circular chromosome of 975,425 bp. PMID:25883297

  19. Multiple genes of apparent algal origin suggest ciliates may once have been photosynthetic

    OpenAIRE

    Reyes-Prieto, Adrian; Moustafa, Ahmed; Bhattacharya, Debashish

    2008-01-01

    Plantae (sensu Cavalier-Smith 1981) [1] plastids evolved via primary endosymbiosis whereby a heterotrophic protist enslaved a photosynthetic cyanobacterium. This 'primary' plastid spread into other eukaryotes via secondary endosymbiosis. An important but contentious theory in algal evolution is the chromalveolate hypothesis that posits chromists (cryptophytes, haptophytes, and stramenopiles) and alveolates (ciliates, apicomplexans, and dinoflagellates) share a common ancestor that contained a...

  20. Cryptic infection of a broad taxonomic and geographic diversity of tadpoles by Perkinsea protists

    Czech Academy of Sciences Publication Activity Database

    Chambouvet, A.; Gower, D.J.; Jirků, Miloslav; Yabsley, M. J.; Davis, A. K.; Leonard, A.; Maguire, F.; Doherty-Bone, T.M.; Bittencourt-Silva, G.B.; Wilkinson, M.; Richards, T.A.

    2015-01-01

    Roč. 112, č. 34 (2015), E4743-E4751. ISSN 0027-8424 R&D Projects: GA ČR GAP506/10/2330 Institutional support: RVO:60077344 Keywords : frog decline * emerging disease * parasite * alveolates * molecular diversity Subject RIV: EG - Zoology Impact factor: 9.674, year: 2014

  1. Dicty_cDB: Contig-U13889-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 095_1881( CP000095 |pid:none) Prochlorococcus marinus str. NA... 66 7e-10 CP000838_96( CP000838 |pid:none) Acaryochloris marin...eq.d (612 letters) Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters Searching...............-1Q) /CSM_Contig/Contig-U13889-1Q.Seq.d (612 letters) Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters Searchin...lorococcus marinus MIT9313... 65 2e-09 BX294151_174( BX294151 |pid:none) Rhodopirellula baltica...... 65 2e-09 CP000554_962( CP000554 |pid:none) Prochlorococcus marinus str. MIT... 65 2e-09 CP001101_100( CP

  2. Assessment of virally vectored autoimmunity as a biocontrol strategy for cane toads.

    Directory of Open Access Journals (Sweden)

    Jackie A Pallister

    Full Text Available BACKGROUND: The cane toad, Bufo (Chaunus marinus, is one of the most notorious vertebrate pests introduced into Australia over the last 200 years and, so far, efforts to identify a naturally occurring B. marinus-specific pathogen for use as a biological control agent have been unsuccessful. We explored an alternative approach that entailed genetically modifying a pathogen with broad host specificity so that it no longer caused disease, but carried a gene to disrupt the cane toad life cycle in a species specific manner. METHODOLOGY/PRINCIPAL FINDINGS: The adult beta globin gene was selected as the model gene for proof of concept of autoimmunity as a biocontrol method for cane toads. A previous report showed injection of bullfrog tadpoles with adult beta globin resulted in an alteration in the form of beta globin expressed in metamorphs as well as reduced survival. In B. marinus we established for the first time that the switch from tadpole to adult globin exists. The effect of injecting B. marinus tadpoles with purified recombinant adult globin protein was then assessed using behavioural (swim speed in tadpoles and jump length in metamorphs, developmental (time to metamorphosis, weight and length at various developmental stages, protein profile of adult globin and genetic (adult globin mRNA levels measures. However, we were unable to detect any differences between treated and control animals. Further, globin delivery using Bohle iridovirus, an Australian ranavirus isolate belonging to the Iridovirus family, did not reduce the survival of metamorphs or alter the form of beta globin expressed in metamorphs. CONCLUSIONS/SIGNIFICANCE: While we were able to show for the first time that the switch from tadpole to adult globin does occur in B. marinus, we were not able to induce autoimmunity and disrupt metamorphosis. The short development time of B. marinus tadpoles may preclude this approach.

  3. Dicty_cDB: SSF655 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3' end seq. - Length of 3' end seq. - Connected seq. ID - Connected seq. - Length of connected seq. - Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...mfsiitipmfmlvwlmlvglqvivisfm vhwqmxqqllslrvllfiqlqhvigkwynvikslnsiqhqlqfvh**nsqyhllnnpinh...occus marinus subsp. marinus str. CCMP1375 section 4 of 6 of the complete genome....SS (Link to library) SSF655 (Link to dictyBase) - - - Contig-U16501-1 SSF655F (Link...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16501-1 Original site URL http://dict

  4. Patchy zooplankton grazing and high energy conversion efficiency: ecological implications of sandeel behavior and strategy

    DEFF Research Database (Denmark)

    Deurs, Mikael van; Christensen, Asbjørn; Rindorf, Anna

    2013-01-01

    prey. Here we studied zooplankton consumption and energy conversion efficiency of lesser sandeel (Ammodytes marinus) in the central North Sea, using stomach data, length and weight-at-age data, bioenergetics, and hydrodynamic modeling. The results suggested: (i) Lesser sandeel in the Dogger area depend...

  5. Dicty_cDB: VFI784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ococcus marinus str. MI... 38 0.12 AY623918_1( AY623918 |pid:none) Nyctotherus ovalis pyruvate dehydr...... 38 0.12 AY623920_1( AY623920 |pid:none) Nyctotherus ovalis pyruvate dehydr... 37 0.2

  6. Does Implicit Learning in Non-Demented Parkinson's Disease depend on the Level of Cognitive Functioning?

    Science.gov (United States)

    Vandenbossche, Jochen; Deroost, Natacha; Soetens, Eric; Kerckhofs, Eric

    2009-01-01

    We investigated the influence of the level of cognitive functioning on sequence-specific learning in Parkinson's disease (PD). This was done by examining the relationship between the scales for outcomes in Parkinson's disease-cognition [SCOPA-COG, Marinus, J., Visser, M., Verwey, N. A., Verhey, F. R. J., Middelkoop, H. A. M.,Stiggelbout, A., et…

  7. Evaluation of the role of Carnobacterium piscicola in spoilage of vacuum- and modified-atmosphere-packed cold-smoked salmon stored at 5 degrees C

    DEFF Research Database (Denmark)

    Paludan-Müller, Christine; Dalgaard, Paw; Huss, Hans Henrik; Gram, Lone

    1998-01-01

    -packed salmon was dominated by a Vibrio sp., resembling V. marinus, Enterobacteriaceae (Enterobacter agglomerans, Serratia liquefaciens and Rahnella aquatilis) and occasionally Aeromonas hydrophila. Irrespective of the addition of nisin and/or CO2- atmosphere, the LAB microflora was dominated by Carnobacterium...

  8. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  9. Unigene BLAST: CBRC-PMAR-01-0310 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0310 gnl|UG|Pma#S35157087 PMAO-aad66g05.g1 Lamprey_EST_Embryo Petromyzon marinus cD ... cture Of The Complex Between The Gef Domain Of The Salmonella ... Typhimurium Sope Toxin And Human Cdc42 pdb|1GZS|C ...

  10. Apuntes sobre la reproduccion de algunos Bagres marinos

    NARCIS (Netherlands)

    Luengo, José A.

    1973-01-01

    Mouthbreeding in the male, and modifications of the pelvic fins of the female are recorded for the first time in Selenaspis herzbergii. The pelvic girdle of Selenaspis herzbergii is compared with those of Sciadeichthys proops, Arius spixii, and Bagre marinus. Data are given on eggs and fry in the bu

  11. Gene : CBRC-PMAR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0009 Novel UN D UNKNOWN NU4M_APILI 2e-06 24% ref|XP_001074123.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  12. Gene : CBRC-PMAR-01-0091 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0091 Novel UN D UNKNOWN HKR1_YEAST 1e-05 25% ref|XP_001255721.1| PREDICTED: similar ... gnl|UG|Pma#S35119759 PMAL-aac33h09.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  13. Gene : CBRC-PMAR-01-0875 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0875 Novel UN D UNKNOWN LMP1_EBVR 3e-11 35% ref|XP_001074123.1| PREDICTED: hypothet ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  14. Gene : CBRC-PMAR-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0447 Novel UN D UNKNOWN NU5M_TRYBB 0.007 18% ref|XP_001473318.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  15. Gene : CBRC-PMAR-01-0119 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0119 Novel UN D UNKNOWN FIBH_BOMMO 6e-10 29% ref|XP_001367026.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  16. Gene : CBRC-PMAR-01-0193 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0193 Novel UN D UNKNOWN KRA45_HUMAN 3e-24 45% gb|EAK90720.1| hypothetical protein C ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  17. Gene : CBRC-PMAR-01-0780 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0780 Novel UN D UNKNOWN KRA43_HUMAN 1e-32 46% ref|XP_001102465.1| PREDICTED: hypoth ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  18. Gene : CBRC-PMAR-01-0178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0178 Novel UN D UNKNOWN NU4M_APILI 3e-11 23% ref|XP_001074123.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  19. Gene : CBRC-PMAR-01-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0001 pseudo Novel UN B UNKNOWN KYK1_DICDI 8e-45 40% ref|XP_001054809.1| PREDICTED: ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  20. Gene : CBRC-PMAR-01-0622 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0622 Novel UN C UNKNOWN BTD_MOUSE 8e-56 38% ref|XP_418738.1| PREDICTED: hypothetica ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  1. Gene : CBRC-PMAR-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0428 Novel UN D UNKNOWN CHS7_ASPOR 0.63 29% ref|XP_001472026.1| PREDICTED: hypothet ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  2. Gene : CBRC-PMAR-01-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0007 Novel UN B UNKNOWN AAC2_DICDI 1e-49 51% ref|XP_001056611.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  3. Gene : CBRC-PMAR-01-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0098 Novel UN B UNKNOWN ATP6_TRYBB 9e-04 18% ref|XP_001473318.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  4. Gene : CBRC-PMAR-01-0538 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0538 Novel UN D UNKNOWN SREC2_MOUSE 0.73 24% emb|CAJ16905.1| hypothetical protein [ ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  5. Gene : CBRC-PMAR-01-0095 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0095 Novel UN D UNKNOWN CYB_LEITA 9e-04 21% ref|XP_001060374.1| PREDICTED: hypothet ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  6. Gene : CBRC-PMAR-01-0079 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0079 Novel UN B UNKNOWN AAC2_DICDI 1e-46 36% ref|XP_001056611.1| PREDICTED: hypothe ... gnl|UG|Pma#S35065250 PMAL-aaa46b06.b1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 3', mRNA sequence /clone_e ...

  7. Gene : CBRC-PMAR-01-0380 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0380 Novel UN C UNKNOWN ADCY4_RAT 4e-04 26% ref|XP_001477713.1| PREDICTED: hypothet ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  8. Gene : CBRC-PMAR-01-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0037 Novel UN C UNKNOWN Y233_METJA 5e-04 19% ref|XP_001074123.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  9. Gene : CBRC-PMAR-01-0521 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0521 UN D UNKNOWN NU4M_APILI 4e-15 22% ref|XP_001472026.1| PREDICTED: hypothetical ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  10. Gene : CBRC-PMAR-01-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0049 Novel UN C UNKNOWN NU4M_APILI 4e-06 26% ref|XP_001477713.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  11. Gene : CBRC-PMAR-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0607 Novel UN D UNKNOWN GPI10_CANAL 0.098 25% ref|XP_001472026.1| PREDICTED: hypoth ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  12. Gene : CBRC-PMAR-01-0477 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0477 Novel UN D UNKNOWN YJP1_SCHPO 1e-07 26% ref|XP_001060371.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  13. Gene : CBRC-PMAR-01-0781 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0781 Novel UN D UNKNOWN GRP1_PETHY 2e-05 41% gb|ABD65100.1| hypothetical protein 31 ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  14. Gene : CBRC-PMAR-01-0513 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0513 Novel UN D UNKNOWN DAN4_YEAST 2e-14 33% ref|XP_995184.2| PREDICTED: hypothetic ... gnl|UG|Pma#S35090321 PMAL-aaa99a10.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  15. Gene : CBRC-PMAR-01-0157 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0157 Novel UN D UNKNOWN RSF1_HUMAN 1e-15 91% ref|XP_001472026.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  16. Gene : CBRC-PMAR-01-0552 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0552 Novel UN D UNKNOWN LMP1_EBV 4e-09 34% ref|XP_001074123.1| PREDICTED: hypotheti ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  17. Gene : CBRC-PMAR-01-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0104 Novel UN C UNKNOWN MRGRE_RAT 0.008 23% dbj|BAE36777.1| unnamed protein product ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  18. Gene : CBRC-PMAR-01-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0031 pseudo Novel UN B UNKNOWN AAC2_DICDI 8e-52 37% ref|XP_001063898.1| PREDICTED: ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  19. Gene : CBRC-PMAR-01-0463 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0463 Novel UN B UNKNOWN CO4A2_MOUSE 3e-24 39% ref|XP_001346045.1| PREDICTED: hypoth ... gnl|UG|Pma#S35064993 PMAL-aaa41e04.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  20. Gene : CBRC-PMAR-01-0856 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0856 Novel UN C UNKNOWN DYHC_ONCMY 1e-13 20% ref|XP_001067326.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  1. Gene : CBRC-PMAR-01-0470 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0470 Novel UN C UNKNOWN ATP6_TRYBB 2e-13 30% ref|XP_001472026.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  2. Gene : CBRC-PMAR-01-0509 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0509 Novel UN B UNKNOWN KYK1_DICDI 2e-41 36% ref|XP_001056611.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  3. Gene : CBRC-PMAR-01-0330 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0330 Novel UN B UNKNOWN AAC2_DICDI 3e-50 56% ref|XP_001056611.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  4. Gene : CBRC-PMAR-01-0346 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0346 Novel UN D UNKNOWN EBNA1_EBV 6e-26 66% gb|AAY41125.1| unknown [Human herpesvir ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  5. Gene : CBRC-PMAR-01-0237 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0237 Novel UN D UNKNOWN SP96_DICDI 9e-20 35% ref|XP_001477240.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  6. Gene : CBRC-PMAR-01-0759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0759 Novel UN D UNKNOWN NU5H_NYCOV 5e-06 19% ref|XP_001477713.1| PREDICTED: hypothe ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  7. Gene : CBRC-PMAR-01-0282 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0282 Novel UN D UNKNOWN ANP_NOTCO 4e-15 27% ref|XP_995184.2| PREDICTED: hypothetica ... gnl|UG|Pma#S35120154 PMAL-aab53h06.g1 Lamprey_EST_Tissues ... Petromyzon marinus cDNA 5', mRNA sequence /clone_e ...

  8. A novel pathway for the synthesis of inositol phospholipids uses cytidine diphosphate (CDP)-inositol as donor of the polar head group.

    Science.gov (United States)

    Jorge, Carla D; Borges, Nuno; Santos, Helena

    2015-07-01

    We describe a novel biosynthetic pathway for glycerophosphoinositides in Rhodothermus marinus in which inositol is activated by cytidine triphosphate (CTP); this is unlike all known pathways that involve activation of the lipid group instead. This work was motivated by the detection in the R. marinus genome of a gene with high similarity to CTP:L-myo-inositol-1-phosphate cytidylyltransferase, the enzyme that synthesizes cytidine diphosphate (CDP)-inositol, a metabolite only known in the synthesis of di-myo-inositol phosphate. However, this solute is absent in R. marinus. The fate of radiolabelled CDP-inositol was investigated in cell extracts to reveal that radioactive inositol was incorporated into the chloroform-soluble fraction. Mass spectrometry showed that the major lipid product has a molecular mass of 810 Da and contains inositol phosphate and alkyl chains attached to glycerol by ether bonds. The occurrence of ether-linked lipids is rare in bacteria and has not been described previously in R. marinus. The relevant synthase was identified by functional expression of the candidate gene in Escherichia coli. The enzyme catalyses the transfer of L-myo-inositol-1-phosphate from CDP-inositol to dialkylether glycerol yielding dialkylether glycerophosphoinositol. Database searching showed homologous proteins in two bacterial classes, Sphingobacteria and Alphaproteobacteria. This is the first report of the involvement of CDP-inositol in phospholipid synthesis. PMID:25472423

  9. Unigene BLAST: CBRC-PMAR-01-0108 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0108 gnl|UG|Pma#S35121104 Petromyzon marinus clone Int.39 variable lym...phocyte receptor 5' LRR region (VLR) mRNA, partial sequence /gb=DQ151402 /gi=76096554 /ug=Pma.9655 /len=943 5.3 30% ...

  10. Unigene BLAST: CBRC-PMAR-01-0331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0331 gnl|UG|Pma#S35120760 Petromyzon marinus clone T.B6 variable lymph...ocyte receptor diversity region (VLR) mRNA, partial cds /cds=p(1,654) /gb=DQ151325 /gi=76162296 /ug=Pma.9197 /len=654 0.005 39% ...

  11. Unigene BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0572 gnl|UG|Pma#S35120761 Petromyzon marinus clone T.B4 variable lymph...ocyte receptor diversity region (VLR) mRNA, partial cds /cds=p(1,555) /gb=DQ151324 /gi=76162293 /ug=Pma.9198 /len=555 0.017 25% ...

  12. Unigene BLAST: CBRC-PMAR-01-0113 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0113 gnl|UG|Pma#S38438354 Petromyzon marinus isolate PmVLRA.1C09 varia...ble lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,591) /gb=EF094658 /gi=126570353 /ug=Pma.9506 /len=591 1.6 37% ...

  13. Unigene BLAST: CBRC-PMAR-01-0678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0678 gnl|UG|Pma#S35161357 PMAO-aae16e03.g1 Lamprey_EST_Embryo Petromyzon mar...inus cDNA 5' similar to ref|XP_137183.1| similar to olfactory receptor MOR142-1 [Mus musculus], mRNA s

  14. Unigene BLAST: CBRC-PMAR-01-0753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0753 gnl|UG|Pma#S35161357 PMAO-aae16e03.g1 Lamprey_EST_Embryo Petromyzon mar...inus cDNA 5' similar to ref|XP_137183.1| similar to olfactory receptor MOR142-1 [Mus musculus], mRNA s

  15. Unigene BLAST: CBRC-PMAR-01-0852 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0852 gnl|UG|Pma#S35120728 Petromyzon marinus clone T.E6 variable lymph...ocyte receptor diversity region (VLR) mRNA, partial cds /cds=p(1,798) /gb=DQ151357 /gi=76162367 /ug=Pma.9181 /len=798 1e-08 30% ...

  16. Unigene BLAST: CBRC-PMAR-01-0426 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0426 gnl|UG|Pma#S35161357 PMAO-aae16e03.g1 Lamprey_EST_Embryo Petromyzon mar...inus cDNA 5' similar to ref|XP_137183.1| similar to olfactory receptor MOR142-1 [Mus musculus], mRNA s

  17. Unigene BLAST: CBRC-PMAR-01-0807 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0807 gnl|UG|Pma#S38438427 Petromyzon marinus isolate PmVLRB.124.C09 var...iable lymphocyte receptor B diversity region (VLRB) mRNA, partial cds /cds=p(1,513) /gb=EF094584 /gi=126507805 /ug=Pma.9553 /len=513 6.8 41% ...

  18. Unigene BLAST: CBRC-PMAR-01-0738 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0738 gnl|UG|Pma#S38438429 Petromyzon marinus isolate PmVLRB.124.C07 var...iable lymphocyte receptor B diversity region (VLRB) mRNA, partial cds /cds=p(1,465) /gb=EF094582 /gi=126507801 /ug=Pma.9555 /len=465 1.5 30% ...

  19. Unigene BLAST: CBRC-PMAR-01-0733 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0733 gnl|UG|Pma#S38438347 Petromyzon marinus isolate PmVLRA.1D04 varia...ble lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,675) /gb=EF094665 /gi=126570374 /ug=Pma.9499 /len=675 1.5 35% ...

  20. Spatial differences in growth of lesser sandeel in the North Sea

    DEFF Research Database (Denmark)

    Rindorf, Anna; Wright, Peter J.; Jensen, Henrik;

    2016-01-01

    Lesser sandeel, Ammodytes marinus, is a key prey to a variety of North Sea predators, including species such as single load seabirds which are highly sensitive to prey size and condition. Whilst differences in weight at age across the North Sea have been investigated previously, the scale and cause...

  1. Water-Striders of the American Genus Trochopus

    NARCIS (Netherlands)

    Drake, Carl J.; Doesburg , van P.H.

    1966-01-01

    In April 1898 the veliid genus Trochopus Carpenter was erected to hold a new halophilous water-strider from Jamaica, described as marinus. The specimens were netted in numbers on standing salt waters beneath mangrove trees in swamps near the head of Kingston Harbour. In August of the same year CHAMP

  2. Unigene BLAST: CBRC-PMAR-01-0297 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0297 gnl|UG|Pma#S35054800 PMAH-aaa35b01.g1 Lamprey_EST_Olfactory Petro...myzon marinus cDNA 5' similar to sp|P09967|GLB1_PETMA Globin I >pir||A26042 globin I - sea lamprey, mRNA seq

  3. Gene : CBRC-PMAR-01-0443 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available RNA sequence /clone_end=5' /gb=EE742359 /gi=114317647 /ug=Pma.7595 /len=649 4e-04 27% MAVVAHGKLTMAVVAH...GNLTMAVLAHGKLAMAVLAHGNLTMAVVAHGKLAMAVLAHGKLTMAVVAHGKLTMAVVAHGKLTMAVDAHDKLAMAVLAHYKLAMAVVAHGKLAMAVVALDKLTMAVVAH...DELTMAVVAHGKLAMAVVAHGKLAMAVVALDKLAMAVVGHGKLAMAVVAHGKLTMAVVGHGKLAMAVVGHGKLTMAVVGHGKLPMAVVGHGKLTMAVVAHDELAMA...VVAHGKLTMAVVGHGKLTMAVVAHGKLTMAVVAHDELAMAVVAHDELAMAVVAHGKTGDGCSCPR ... ...ctensis] 7e-30 25% gnl|UG|Pma#S35115813 PMAH-aac06g06.g1 Lamprey_EST_Olfactory Petromyzon marinus cDNA 5', m

  4. Protein (Cyanobacteria): 289899 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available NP_894770.1 1117:4957 1212:101 1217:101 1218:101 1219:101 74547:17 TPR repeat-contai...ning protein Prochlorococcus marinus str. MIT 9313 MSRKRTALAASLSLLQLGQPLLLGSTAALLTGLLLLSTQAADAQSAVLYKKSGNAKVGSGDYQAAIADYNKAI...VINPKDADAYNNRGLAKSKSGDNQGAIADFNKAIEINPQYVRAYNNRGLAKSKSGDNQGAIVDYNMAIAINPVYLYGFLNRGLAKKNLNKYQEAIVDYNKAI...VINPQLAVAYHKRGLAKVDLKDYQGAIADFNKAITLNPKDAAAYNNRGAVKGKSGDNQAAIADFNKAIEI...DLQYADAYINRGLAKYNLGDNQGAITDYSEAIKIDPQDVFAYNNRGYVTWKLKDYQSACNDFKKAASLGSQSTAQWINRVDGAWCRNMR ...

  5. Protein (Cyanobacteria): 289903 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available NP_894129.1 1117:4957 1212:101 1217:101 1218:101 1219:101 74547:17 TPR repeat-contai...ning protein Prochlorococcus marinus str. MIT 9313 MSRRRTGAIAIGVGAATAVVLSLVGAKTPVVIGSAAALGVAGGVVAGRKGGGKNADEYLESGKSKLEKKDFYGAI...EDLNKEIEINSQDVAAYSKRANLKEKLGDHKGAIDDFTKAIEIDPNHAHPYYNRGFSKWQLGDIQGAIADYNHALAIYPLFKDVYFFRGMAKDQIGNFDGAI...ADYSKVIEIDPDQLYKYRDECSAYFHRGKAKHSSGNISGAIADYSKAIEIDPKNDSAYNNRGIIEDDLGQRKLDDFYYQLAIADYDKAI...DINPSNADAYLNRGHTKLNQRDFDGAIADFNHALNIDPQVDNIYLKRGVAKDELGNHQGAIADYTKAIEIDPQDALAYNNRGVAKSKSNDFQGSISDCTKAI

  6. Unigene BLAST: CBRC-PMAR-01-0149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,666) /gb=EF094716 /gi=126570506 /ug=Pma.9450 /len=666 2.2 35% ... ...CBRC-PMAR-01-0149 gnl|UG|Pma#S38438297 Petromyzon marinus isolate PmVLRA.9 variable

  7. Unigene BLAST: CBRC-PMAR-01-0149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094756 /gi=126570624 /ug=Pma.9410 /len=660 4.8 43% ... ...CBRC-PMAR-01-0149 gnl|UG|Pma#S38438257 Petromyzon marinus isolate PmVLRA.C6 variabl

  8. Unigene BLAST: CBRC-PMAR-01-0203 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,663) /gb=EF094798 /gi=126570709 /ug=Pma.9369 /len=663 0.006 31% ... ...CBRC-PMAR-01-0203 gnl|UG|Pma#S38438215 Petromyzon marinus isolate PmVLRA.G7 variabl

  9. Unigene BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available e lymphocyte receptor A diversity region (VLRA) mRNA, partial cds /cds=p(1,660) /gb=EF094807 /gi=126570727 /ug=Pma.9360 /len=660 0.049 27% ... ...CBRC-PMAR-01-0572 gnl|UG|Pma#S38438206 Petromyzon marinus isolate PmVLRA.H7 variabl

  10. Dicty_cDB: Contig-U06768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cens Pf0-1, ... 35 1.1 EF134045_1( EF134045 |pid:none) Perkinsus chesapeaki isolate Pch...romos... 35 1.1 CP001227_258( CP001227 |pid:none) Rickettsia peacockii str. Rustic... 34 ...ar. neo... 61 1e-08 EF085639_1( EF085639 |pid:none) Picea sitchensis clone WS0273... 3e-04 EF676867_1( EF676867 |pid:none) Picea sitchensis clone WS02756_I23... 46 5e-04 CR954246_2185( CR95424...6, complete... 39 0.056 CP000394_1671( CP000394 |pid:none) Granulibacter bethesde

  11. HRCT of the lung in collagen vascular diseases

    International Nuclear Information System (INIS)

    Collagen vascular diseases, representing systemic soft tissue disorders, may cause a broad spectrum of pathologic changes of the respiratory tract. The type and extent of manifestations can vary considerably among individuals and entities. This survey describes the chest radiographic and, in particular, high-resolution computed tomographic and, in particular, high-resolution computed tomographic (HRCT) findings of individual lesions of the respiratory tract. It includes fibrosing alveolitis (alveolitis, interstitial pneumonia, pulmonary fibrosis) and bronchial (bronchitis/bronchiolitis, bronchiectasis), pleural and vascular manifestations, as well as lymphadenopathy and abnormalities related to therapy. We present typical patterns of changes in progressive systemic sclerosis (PSS, scleroderma), systemic lupus erythematosus (SLE), mixed connective tissue disease (MCTD, Sharp syndrome), Sjoegren syndrome, overlap syndrome and rheumatoid arthritis (RA). Furthermore, we describe findings which are specific for individual entities such as esophageal involvement in PSS, acute pneumonitis and pulmonary hemorrhage in SLE, lymphoproliferative disease in Sjoegren syndrome and necrobiotic nodules in RA. (orig.)

  12. High resolution CT in interstitial pulmonary disease

    International Nuclear Information System (INIS)

    High-resolution CT images were assessed in 39 patients with confirmed interstitial lung disease. 22 patients with fibrosing alveolitis, 12 patients with lymphangitic spread of tumour and 5 patients with lymphangioleiomyomatosis of the lung were included. In fibrosing alveolitis the dominant features on HR-CT were honeycomb cysts with concomitant fibrosis in a predominantly peripheral subpleural distribution. In contrast to this the patients with LAM showed cystic lesions without any predominance - throughout the lung fields and without any fibrotic changes. In lymphangitic spread of tumour, polygonal lines and septal lines as well as nodules were found along the bronchovascular bundles. The patterns seen on HR-CT of the thorax correlate extremely well with the underlying pathology and make it possible to differentiate between the three disease entities by means of characteristic features. (orig.)

  13. Pathologic changes in the maxillary sinus wall after conservative therapy in odontogenic maxillary sinusitis. Examination using bone scintigraphy

    International Nuclear Information System (INIS)

    Single photon emission computed tomographic bone scintigraphy (bone SPECT) was performed in 16 patients with odontogenic maxillary sinusitis to compare inflammatory changes in the maxillary sinus wall including the alveolar process (bony lesions) before and after conservative therapy. Morphologic changes in bony lesions as evaluated by bone SPECT images correlated with those of the maxillary sinus mucosa (mucosal lesions) as evaluated by CT images. Morphologic changes in the bony lesions also correlated with changes in inflammatory activity in the maxillary alveolar process as functionally evaluated by bone SPECT before and after conservative therapy. Odontogenic maxillary sinusitis is considered a disease in which maxillary alveolitis causes mucosal lesions as well as bony lesions. Changes in alveolitis are associated with morphologic changes in bony lesions after conservative therapy, and these changes affect the pathophysiologic nature of odontogenic maxillary sinusitis. Bone SPECT is valuable for predicting outcome and treatment planning in patients with odontogenic maxillary sinusitis. (author)

  14. Dehydroepiandrosterone inhibits the spontaneous release of superoxide radical by alveolar macrophages in vitro in asbestosis

    Energy Technology Data Exchange (ETDEWEB)

    Rom, W.N.; Harkin, T. (New York Univ. Medical Center, New York (United States))

    1991-08-01

    Asbestosis is characterized by an alveolar macrophage alveolitis with injury and fibrosis of the lower respiratory tract. Alveolar macrophages recovered by bronchoalveolar lavage spontaneously release exaggerated amounts of oxidants including superoxide anion and hydrogen peroxide that may mediate alveolar epithelial cell injury. Dehydroepiandrosterone (DHEA) is a normally occurring adrenal androgen that inhibits glucose-6-phosphate dehydrogenase, the initial enzyme in the pentose phosphate shunt necessary for NADPH generation and superoxide anion formation. In this regard, the authors hypothesized that DHEA may reduce asbestos-induced oxidant release. DHEA added in vitro to alveolar macrophages lavaged from 11 nonsmoking asbestos workers significantly reduced superoxide anion release. DHEA is an antioxidant and potential anticarcinogenic agent that may have a therapeutic role in reducing the increased oxidant burden in asbestos-induced alveolitis of the lower respiratory tract.

  15. Nitrate reduction by fungi in marine oxygen-depleted laboratory microcosms

    Digital Repository Service at National Institute of Oceanography (India)

    Manohar, C.S.; Raghukumar, C.

    of many groups such as alveolates, straminopiles and fungi in oxygen-depleted marine environments (Takishita et al. 2005, 2007a, b, Stoeck et al. 2006). Several terrestrial forms such as Fusarium oxysporum Schltdl., Aspergillus oryzea (Ahlb.) E. Cohn... the pathway largely stops with the reduction of NO to N 2 O. Fungal denitrification accounts for nearly 80% of the microbial nitrous oxide production in grassland ecosystems (Laughlin et al. 2009). Fungi are also involved in co-denitrification and chemo...

  16. The Glycoprofile Patterns of Endothelial Cells in Usual Interstitial Pneumonia

    OpenAIRE

    Barkhordari, A.; CJP Jones; RW Stoddart; SF McClure; McClure, J; S Rahimi Moghadam

    2014-01-01

    [THIS ARTICLE HAS BEEN RETRACTED FOR DUPLICATE PUBLICATION] Background: The pathological classification of cryptogenic fibrosing alveolitis has been a matter of debate and controversy for histopathologists.Objective: To identify and specify the glycotypes of capillary endothelial cells in usual interstitial pneumonia (UIP) compared to those found in normal tissue.Methods: Sections of formalin-fixed, paraffin-embedded blocks from 16 cases of UIP were studied by lectin histochemistry with a pan...

  17. The Effects of Aerosolized STAT1 Antisense Oligodeoxynucleotides on Rat Pulmonary Fibrosis

    OpenAIRE

    Wang, Wenjun; Liao, Bin; Zeng, Ming; Zhu, Chen; Fan, Xianming

    2009-01-01

    Previous study showed that aerosolized signal transducer and activator of transcription-1 (STAT1) antisense oligodeoxynucleotide (ASON) inhibited the expression of STAT1 and ICAM-1 mRNA and protein in alveolar macrophages (AMs) and decreased the concentrations of TGF-β, PDGF and TNF-α in bronchioalveolar lavage fluid (BALF) in bleomycin (BLM)-induced rat pulmonary fibrosis. Administration of STAT1 ASON ameliorated alveolitis in rat pulmonary fibrosis. However, further investigations are neede...

  18. Mechanisms of neutrophil accumulation in the lungs of patients with idiopathic pulmonary fibrosis.

    OpenAIRE

    Hunninghake, G W; Gadek, J E; Lawley, T J; Crystal, R G

    1981-01-01

    Neutrophils are a characteristic feature of the alveolitis of idiopathic pulmonary fibrosis (IPF). a chronic disorder limited to lung. One mechanism by which neutrophils may be selectively attracted to lung and not other tissues is via the secretion of the neutrophil-specific chemotactic factor by alveolar macrophages. To evaluate the role of alveolar macrophages in modulating the migration of neutrophils to he lung in IPF, alveolar macrophages, obtained by bronchoalveolar lavage of patients ...

  19. Effects of inflammation and fibrosis on pulmonary function in diffuse lung fibrosis.

    OpenAIRE

    Chinet, T; Jaubert, F; Dusser, D.; Danel, C.; Chrétien, J.; Huchon, G J

    1990-01-01

    To investigate the relation between lung function and inflammation and fibrosis in patients with diffuse lung fibrosis, a study was made of untreated patients without appreciable airway obstruction (14 patients with cryptogenic fibrosing alveolitis and seven with pneumoconiosis). Quantitative assessment of inflammatory infiltration and fibrosis was carried out on open lung biopsy specimens and compared with lung volumes, carbon monoxide transfer factor (TLCO), TLCO corrected for alveolar volu...

  20. High-Resolution Computed Tomography and Chest X-Ray Findings of Interstitial Lung Disease Related to Systemic Sclerosis

    OpenAIRE

    V. Sheikh; Z. Basiri; F. Esna Ashari; M. Jabari; Y. Pishva

    2012-01-01

    Introduction & Objective: Interstitial lung disease is the leading cause of mortality and morbidity in patients with scleroderma. For this reason an early diagnosis of lung involvement is warranted. The best approach to detect pulmonary disease particularly alveolitis (inflammatory NSIP) as a reversible phase is controversial. The aim of this study is estimating the advantage of HRCT as a noninvasive screening test to detect the pattern of ILD related to systemic sclerosis.Materials & Methods...

  1. サルコイドーシスの肺肉芽腫形成に対する Propionibacterium acens の関与に関する研究 第1編 サルコイドーシス肺胞リンパ球のPropionibacterium acens に対する Interleukin-2 産生及び Interleukin-2 受容体発現のついて

    OpenAIRE

    森,由弘

    1992-01-01

    We previously reported that alveolar lymophocytes in patients with active sarcoidosis are sensitized Propionibacterium acnes (P. acnes) which may play a significant role in the induction of alveolitis in these patients. We further investigated the production of Interleukin-2 (IL-2), and the responsiveness to IL-2 of alveolar lymphocytes obtained from sarcoidosis patients and stimulated by P. acnes in vitro. In 21 untreated sarcoidosis patients, 7 treated patients and 13 control subjects, the...

  2. Survival of Campylobacter jejuni in Waterborne Protozoa

    OpenAIRE

    Snelling, W. J.; McKenna, J. P.; Lecky, D. M.; Dooley, J. S. G.

    2005-01-01

    The failure to reduce the Campylobacter contamination of intensively reared poultry may be partially due to Campylobacter resisting disinfection in water after their internalization by waterborne protozoa. Campylobacter jejuni and a variety of waterborne protozoa, including ciliates, flagellates, and alveolates, were detected in the drinking water of intensively reared poultry by a combination of culture and molecular techniques. An in vitro assay showed that C. jejuni remained viable when in...

  3. BCG-induced pneumonitis with lymphocytic pleurisy in the absence of elevated KL-6

    OpenAIRE

    Tobiume, Makoto; Shinohara, Tsutomu; Kuno, Takahira; Mukai, Shinji; Naruse, Keishi; Hatakeyama, Nobuo; OGUSHI, FUMITAKA

    2014-01-01

    Background Pneumonitis is a rare complication of bacillus Calmette-Guerin (BCG) immunotherapy seen in patients with urothelial cancer following the repeated administration of BCG. However, no case of BCG-induced pleurisy has been reported. Case presentation We here report the first case of pneumonitis with lymphocytic pleurisy following bacillus Calmette-Guerin (BCG) immunotherapy. Although marked T helper cell alveolitis was found by bronchoalveolar lavage and transbronchial biopsies, no aci...

  4. Serum marker KL-6/MUC1 for the diagnosis and management of interstitial pneumonitis

    OpenAIRE

    Kohno, Nobuoki

    1999-01-01

    Interstitial pneumonitis includes more than a hundred diseases in which alveolitis is the main manifestation of the affected lung. Symptoms such as dry cough and exertional dyspnea, fine crackles on chest auscultation, interstitial infiltrates on chest X-ray films and CT scans, respiratory function tests, and Ga-67 scintigraphy have been used for the diagnosis and the evaluation of disease activity. However, the poor prognosis of some types of interstitial pneumonitis has not been improved . ...

  5. Vacuolar ATPase Regulates Surfactant Secretion in Rat Alveolar Type II Cells by Modulating Lamellar Body Calcium

    OpenAIRE

    Chintagari, Narendranath Reddy; Mishra, Amarjit; Su, Lijing; Wang, Yang; Ayalew, Sahlu; Hartson, Steven D; Liu, Lin

    2010-01-01

    Lung surfactant reduces surface tension and maintains the stability of alveoli. How surfactant is released from alveolar epithelial type II cells is not fully understood. Vacuolar ATPase (V-ATPase) is the enzyme responsible for pumping H+ into lamellar bodies and is required for the processing of surfactant proteins and the packaging of surfactant lipids. However, its role in lung surfactant secretion is unknown. Proteomic analysis revealed that vacuolar ATPase (V-ATPase) dominated the alveol...

  6. HRCT of the lung in collagen vascular diseases; HRCT der Lunge bei Kollagenosen

    Energy Technology Data Exchange (ETDEWEB)

    Diederich, S. [Inst. fuer Klinische Radiologie, Westfaelische Wilhelms-Univ., Muenster (Germany); Roos, N. [Inst. fuer Klinische Radiologie, Westfaelische Wilhelms-Univ., Muenster (Germany); Schmitz-Linneweber, B. [Medizinische Klinik B, Westfaelische Wilhelms-Univ., Muenster (Germany); Gaubitz, M. [Medizinische Klinik B, Westfaelische Wilhelms-Univ., Muenster (Germany); Peters, P.E. [Inst. fuer Klinische Radiologie, Westfaelische Wilhelms-Univ., Muenster (Germany)

    1996-07-01

    Collagen vascular diseases, representing systemic soft tissue disorders, may cause a broad spectrum of pathologic changes of the respiratory tract. The type and extent of manifestations can vary considerably among individuals and entities. This survey describes the chest radiographic and, in particular, high-resolution computed tomographic and, in particular, high-resolution computed tomographic (HRCT) findings of individual lesions of the respiratory tract. It includes fibrosing alveolitis (alveolitis, interstitial pneumonia, pulmonary fibrosis) and bronchial (bronchitis/bronchiolitis, bronchiectasis), pleural and vascular manifestations, as well as lymphadenopathy and abnormalities related to therapy. We present typical patterns of changes in progressive systemic sclerosis (PSS, scleroderma), systemic lupus erythematosus (SLE), mixed connective tissue disease (MCTD, Sharp syndrome), Sjoegren syndrome, overlap syndrome and rheumatoid arthritis (RA). Furthermore, we describe findings which are specific for individual entities such as esophageal involvement in PSS, acute pneumonitis and pulmonary hemorrhage in SLE, lymphoproliferative disease in Sjoegren syndrome and necrobiotic nodules in RA. (orig.) [Deutsch] Die Kollagenosen koennen als systemische Bindegewebserkrankungen auch zu einem breiten Spektrum pathologischer Veraenderungen am Respirationstrakt fuehren, wobei sich Art und Ausmass der Manifestationen innerhalb einzelner Entitaeten und zwischen verschiedenen Krankheitsbildern erheblich unterscheiden koennen. In der vorliegenden Uebersicht werden die entsprechenden Befunde von Thoraxuebersichtsaufnahme und insbesondere hochaufloesender Computertomographie (HRCT) beschrieben. Beruecksichtigt werden dabei die fibrosierende Alveolitis (Alveolitis, interstitielle Pneumonie, Lungenfibrose), bronchiale (Bronchitis/Bronchiolitis, Bronchiektasen), pleurale und vaskulaere Manifestationen sowie Lymphadenopathie und therapie-induzierte Befunde. Typische Befundmuster

  7. Diversity in a hidden world: potential and limitation of next-generation sequencing for surveys of molecular diversity of eukaryotic microorganisms

    OpenAIRE

    MEDINGER, RALPH; Nolte, Viola; Pandey, Ram Vinay; Jost, Steffen; OTTENWÄLDER, BIRGIT; Schlötterer, Christian; BOENIGK, JENS

    2010-01-01

    With the delivery of millions of sequence reads in a single experiment, next-generation sequencing (NGS) is currently revolutionizing surveys of microorganism diversity. In particular, when applied to Eukaryotes, we are still lacking a rigorous comparison of morphological and NGS-based diversity estimates. In this report, we studied the diversity and the seasonal community turnover of alveolates (Ciliophora and Dinophyceae) in an oligotrophic freshwater lake by SSU amplicon sequencing with NG...

  8. Ectasias of the subcapsular sinus in lymph nodes of athymic and euthymic rats, a relation to immunodeficiency

    OpenAIRE

    Sainte-Marie, G; Peng, F S; Guay, G.

    1997-01-01

    This paper describes a morphologically unusual feature occurring in lymph nodes of some aged euthymic animals but mostly athymic animals. It initially consists of small alveole-like excrescences of the cortical wall of the subcapsular sinus. With dilatation, an excrescence becomes an ectasia which expands into the cortex. Observations suggest that ectasias enlarge under the influence of an increased pressure of the afferent lymph of a node. Such condition conce...

  9. Asbestos and Probable Microscopic Polyangiitis

    Directory of Open Access Journals (Sweden)

    George S Rashed Philteos

    2004-01-01

    Full Text Available Several inorganic dust lung diseases (pneumoconioses are associated with autoimmune diseases. Although autoimmune serological abnormalities are common in asbestosis, clinical autoimmune/collagen vascular diseases are not commonly reported. A case of pulmonary asbestosis complicated by perinuclear-antineutrophil cytoplasmic antibody (myeloperoxidase positive probable microscopic polyangiitis (glomerulonephritis, pericarditis, alveolitis, multineuritis multiplex is described and the possible immunological mechanisms whereby asbestosis fibres might be relevant in induction of antineutrophil cytoplasmic antibodies are reviewed in the present report.

  10. The possibilities of computer tomography in paecilomycosis of lungs

    OpenAIRE

    Abdusalom Ashurov; Rohila Jabbarova

    2010-01-01

    We have analyzed computed tomography (CT) results of chest in 56 patients with lung injures caused by paecilomycosis fungus at the age from 17 to 59 years. In our investigations, the perverted lung pattern due to pathology of interstitial tissue was observed in 52 (93%) patients of 56 (with chronic bronchitis - 100%, exogenous-allergic alveolitis - 93%, recurrent pneumonia - 100% and with bronchial asthma - 80%). Analysis showed that CT provides wide opportunities in visualization of all spec...

  11. FIRST RECORD OF THE RARE MARINE REPTILE THOLODUS SCHMIDI FROM THE MIDDLE TRIASSIC OF THE SOUTHERN ALPS

    OpenAIRE

    FABIO MARCO DALLA VECCHIA

    2004-01-01

    Tholodus schmidi, a rare marine reptile of debated affinity and with a peculiar durophagous dentition, is for the first time recorded outside the Muschelkalk Basin of Central Europe. Parts of a mandibular ramus and a maxilla, both bearing teeth and nearly uncrushed, have been found in the upper Anisian (Balatonicus Subzone) of northeastern Italy. The tooth implantation is relatively complex, with both "alveolate" and "ankylosed" teeth. Disarticulated postcranial bones of an ichthyosaur have b...

  12. Exposure of water consumers to mesophilic actinomycetes.

    OpenAIRE

    Ojanen, T H; Katila, M. L.; Mäntyjärvi, R.; Seppänen, H.; Muittari, A; Kuusisto, P.; Virtanen, P.

    1983-01-01

    In autumn 1978 an epidemic of respiratory disease resembling allergic alveolitis occurred in a small Finnish community. The disease was caused by repeated exposures to tap water aerosol. The raw water of the community and the sand filters of the purification system were heavily contaminated with mesophilic actinomycetes. Fourteen different strains of actinomycetes were isolated. Exposed persons with and without symptoms as well as unexposed control persons were tested for antibodies against f...

  13. Role of the NFkB subunit p50 in particle induced, aseptic lung inflammation

    OpenAIRE

    Yin, Renfu

    2013-01-01

    We tested the hypothesis that pulmonary exposure to sterile carbon nanoparticles (CNP), a main constituent of urban air pollution, generates an acute inflammatory response by involving the p50 subunit of NFkB1, a pathway generally crucial for inflammatory gene expression in sepsis. Exposing wt and p50-deficinet mice to CNP caused an acute, aseptic neutrophilic alveolitis. While the storm of acute phase cytokines was much more pronounced in p50 mice, no genotype related difference in the numbe...

  14. Pulmonary Alveolar Proteinosis in Workers at an Indium Processing Facility

    OpenAIRE

    Cummings, Kristin J.; Donat, Walter E.; Ettensohn, David B; Roggli, Victor L; Ingram, Peter; Kreiss, Kathleen

    2009-01-01

    Two cases of pulmonary alveolar proteinosis, including one death, occurred in workers at a facility producing indium-tin oxide (ITO), a compound used in recent years to make flat panel displays. Both workers were exposed to airborne ITO dust and had indium in lung tissue specimens. One worker was tested for autoantibodies to granulocytemacrophage–colonystimulating factor (GM-CSF) and found to have an elevated level. These cases suggest that inhalational exposure to ITO causes pulmonary alveol...

  15. The diffuse interstitial lung disease - with emphasis in the idiopathic interstitial pneumonias

    International Nuclear Information System (INIS)

    The term diffuse interstitial lung disease, it refers to those diseases that commit the interstice basically, the space between the membrane basal epithelial and endothelial, although the damage can also commit the outlying air spaces and the vessels; the supplement is centered in the diffuse interstitial lung illness of unknown cause; well-known as idiopathic interstitial pneumonias, making emphasis in the more frequents, the pulmonary fibrosis idiopathic or cryptogenic fibrosant alveolitis

  16. Angiogenic activity of sera from interstitial lung disease patients in relation to pulmonary function

    OpenAIRE

    Zielonka, TM; Demkow, U; Radzikowska, E; Bialas, B; Filewska, M; Zycinska, K; Obrowski, MH; Kowalski, J; Wardyn, KA; Skopinska-Rozewska, E

    2010-01-01

    Objective Chronic inflammation and fibrosis are characteristic of interstitial lung diseases (ILD) and are accompanied by neovascularisation. The aim of this study was to examine the relationship between the angiogenic activity of sera from ILD patients and pulmonary function tests. Material and methods Serum samples were obtained from 225 ILD patients: 83 with sarcoidosis, 31 with idiopathic pulmonary fibrosis, 29 with extrinsic allergic alveolitis, 16 with collagen vascular diseases, 13 wit...

  17. Bronchoalveolar lavage in pulmonary fibrosis: comparison of cells obtained with lung biopsy and clinical features

    OpenAIRE

    Haslam, P L; Turton, C W G; Heard, B; Lukoszek, A; Collins, J V; Salsbury, A. J.; Turner-Warwick, M.

    1980-01-01

    Bronchoalveolar lavage, open lung biopsy, and cell extraction from the biopsy material have been studied in 21 symptomatic patients with progressive pulmonary fibrosis (18 with cryptogenic fibrosing alveolitis, fulfilling also the criteria for “usual interstitial pneumonia” (UIP), and three with rapidly progressive disease probably related to asbestos exposure). The total and differential cell counts between the three different samples have been compared as well as the influence on them of sm...

  18. Medical image of the week: sarcoidosis

    OpenAIRE

    Knox KS

    2013-01-01

    A 42 year old African-American man from Indianapolis presented with cough and skin lesions. ACE level was elevated at 86 μg/L. Spirometry was normal except for a diffusing capacity 52% of predicted. Imaging was suggestive of sarcoidosis versus granulomatous infection. Bronchoscopy with bronchoalveolar lavage cytospin revealed a lymphocytic alveolitis (27% lymphocytes) with a CD4:CD8 ratio of 6.2:1 by flow cytometry. Biopsy showed classic noncaseating granulomas and no organisms supportin...

  19. Idiopathic pulmonary fibrosis and collagen vascular diseases - high resolution CT findings; Pneumopatias intersticiais difusas idiopaticas e associadas a colagenoses - aspectos da tomografia computadorizada de alta resolucao

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira Neto, Armando Leao; Mogami, Roberto [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Centro Biomedico. Inst. de Radiologia; Marchiori, Edson [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Inst. Biomedico. Dept. de Radiologia; Capone, Domenico [Universidade Estadual, Rio de Janeiro, RJ (Brazil). Dept. de Penumologia

    1996-09-01

    The aspects of the thorax high-resolution computed tomography of 15 patients with idiopathic pulmonary fibrosis and 11 patients with collagen vascular diseases are described and characterized mainly by the presence of reticular lesions with little cysts predominantly in the periphery and lower lobes. They may be associated with ground-glass lesions that, as usual, means areas of alveolitis. (author) 31 refs., 5 figs.

  20. Pneumonitis and lethal pulmonary fibrosis (Hamman-Rich syndrome) due to Parathione (E605) poisoning

    International Nuclear Information System (INIS)

    A patient with chronic Parathione (E 605) poisoning was observed over a period of 55 days. During that time he developed progressive changes, which were identical to those of progressive idiopathic pulmonary fibrosis. The rapid development of an alveolitis, followed by a lethal pulmonary fibrosis, differed in no way, macroscopically nor microscopically, from the lung changes in paraquat poisoning (paraquat lung). The radiologic course has been correlated with the clinical and post mortem findings. (orig.)

  1. PREPARATION AND CHARACTERIZATION OF SUPER-HYDROPHOBIC SURFACES ON ALUMINUM AND STAINLESS STEEL SUBSTRATES

    OpenAIRE

    ZHIJIA YU; YUEFEI YU; YANFENG LI; SHANPENG SONG; SUBIN HUO; XIUYAN HAN

    2010-01-01

    Hierarchical alveolate structures in nano- to microscale were fabricated on both aluminum and stainless steel substrates via a chemical etching. On aluminum surfaces, sharp edged caves and plateaus were found. On stainless steel substrate, fine papillae stand on protuberances. These surfaces exhibit super-hydrophobic properties after the fluorination treatment, their water contact angles are 158° and 160°, respectively, with the contact angle hysteresis of about 5°. The roll off angle is abou...

  2. Nanoparticle delivery in infant lungs

    OpenAIRE

    Semmler-Behnke, Manuela; Kreyling, Wolfgang G; Schulz, Holger; Takenaka, Shinji; James P Butler; Henry, Frank S.; Tsuda, Akira

    2012-01-01

    The lung surface is an ideal pathway to the bloodstream for nanoparticle-based drug delivery. Thus far, research has focused on the lungs of adults, and little is known about nanoparticle behavior in the immature lungs of infants. Here, using nonlinear dynamical systems analysis and in vivo experimentation in developing animals, we show that nanoparticle deposition in postnatally developing lungs peaks at the end of bulk alveolation. This finding suggests a unique paradigm, consistent with th...

  3. Combined use of non-invasive techniques to predict pulmonary arterial pressure in chronic respiratory disease.

    OpenAIRE

    Bishop, J M; Csukas, M

    1989-01-01

    The value of non-invasive procedures for predicting pulmonary arterial pressure was investigated in 370 patients with chronic obstructive lung diseases and in 73 with fibrosing alveolitis in a combined study at nine centres in six European countries. Measurements included forced expiratory volume in one second, arterial blood gas tensions, standard electrocardiogram, radiographic dimensions of pulmonary artery, right ventricle dimensions by M mode echocardiography, and myocardial scintigraphy...

  4. Accidental Sulfur Poisoning in a Group of Holstein Heifers

    OpenAIRE

    Gunn, Moira F.; Baird, John D.; Wilkie, Judith S. Nimmo

    1987-01-01

    Fourteen animals died or were euthanized after toxic levels of elemental sulfur were accidentally fed to a group of 120 Holstein heifers. Dehydration, rumen stasis, tachycardia, and diarrhea were seen along with metabolic acidosis, hypokalemia, and hypochloremia. The majority of deaths occurred from 3 to 10 days after the sulfur was fed to the heifers. Postmortem examination showed rumenitis, acute alveolitis, and renal tubular necrosis. The toxicity of ingested sulfur was attributed to the c...

  5. Importance of Bacterial Replication and Alveolar Macrophage-Independent Clearance Mechanisms during Early Lung Infection with Streptococcus pneumoniae

    OpenAIRE

    Camberlein, Emilie; Cohen, Jonathan M.; José, Ricardo; Hyams, Catherine J.; Callard, Robin; Chimalapati, Suneeta; Yuste, Jose; Edwards, Lindsey A.; Marshall, Helina; van Rooijen, Nico; Noursadeghi, Mahdad; Brown, Jeremy S.

    2015-01-01

    Although the importance of alveolar macrophages for host immunity during early Streptococcus pneumoniae lung infection is well established, the contribution and relative importance of other innate immunity mechanisms and of bacterial factors are less clear. We have used a murine model of S. pneumoniae early lung infection with wild-type, unencapsulated, and para-amino benzoic acid auxotroph mutant TIGR4 strains to assess the effects of inoculum size, bacterial replication, capsule, and alveol...

  6. Estudio de las complicaciones postoperatorias tras la extracción quirúrgica de 190 terceros molares mandibulares incluidos

    OpenAIRE

    Peñarrocha Diago, Miguel; Sáez Cuesta, U.; Sanchis Bielsa, José María; Bagán Sebastián, José Vicente; Gay Escoda, Cosme

    2000-01-01

    Presentamos un estudio de las complicaciones surgidas en la extracción quirúrgica de 190 terceros molares inferiores incluidos. No se produjeron complicaciones intraoperatorias. Encontramos en 25 casos complicaciones postoperatorias (13%), las más frecuentes fueron edema persistente en 17 casos (9%) y alveolitis seca en 4 casos (2%). Otras complicaciones recogidas fueron 2 pacientes con parestesia del nervio dentario inferior, 1 con parestesia del nervio lingual y 1 caso de hemorragia postope...

  7. Lungefunksjon, lungevolum, diffusjonskapasitet og respiratorisk muskelstyrke hos svømmere: en observasjonell kasus-kontroll studie

    OpenAIRE

    Hellesøy, Ingrid Decube

    2016-01-01

    Bakgrunn: Tidligere studier av svømmere viser at svømmerne skiller seg fra aktive kontroller, ikke-aktive kontroller og har bedre enn forventede verdier for lungefunksjon, lungevolum, diffusjonskapasitet og respiratorisk muskelstyrke. De økte verdiene hos svømmere kan skyldes ulike årsaker; antropometri, respiratorisk muskelstyrke, treningsmengde og økt antall alveoler. Ingen studier har hittil bekreftet eller avkreftet de ulike teoriene. Hovedmålet med den foreliggende studien...

  8. PAS staining of bronchoalveolar lavage cells for differential diagnosis of interstital lung disease

    OpenAIRE

    Zabel Peter; Hauber Hans P

    2009-01-01

    Abstract Bronchoalveolar lavage (BAL) is a useful diagnostic tool in interstitial lunge diseases (ILD). However, differential cell counts are often non specific and immunocytochemistry is time consuming. Staining of glyoproteins by periodic acid Schiff (PAS) reaction may help in discriminating different forms of ILD. In addition, PAS staining is easy to perform. BAL cells from patients with idiopathic pulmonary fibrosis (IPF) (n = 8), sarcoidosis (n = 9), and extrinsic allergic alveolitis (EA...

  9. 2005 dossier: granite. Tome: architecture and management of the geologic disposal

    International Nuclear Information System (INIS)

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the geologic disposal of high-level and long-lived radioactive wastes in granite formations. Content: 1 - Approach of the study: main steps since the December 30, 1991 law, ANDRA's research program on disposal in granitic formations; 2 - high-level and long-lived (HLLL) wastes: production scenarios, waste categories, inventory model; 3 - disposal facility design in granitic environment: definition of the geologic disposal functions, the granitic material, general facility design options; 4 - general architecture of a disposal facility in granitic environment: surface facilities, underground facilities, disposal process, operational safety; 5 - B-type wastes disposal area: primary containers of B-type wastes, safety options, concrete containers, disposal alveoles, architecture of the B-type wastes disposal area, disposal process and feasibility aspects, functions of disposal components with time; 6 - C-type wastes disposal area: C-type wastes primary containers, safety options, super-containers, disposal alveoles, architecture of the C-type wastes disposal area, disposal process in a reversibility logics, functions of disposal components with time; 7 - spent fuels disposal area: spent fuel assemblies, safety options, spent fuel containers, disposal alveoles, architecture of the spent fuel disposal area, disposal process in a reversibility logics, functions of disposal components with time; 8 - conclusions: suitability of the architecture with various types of French granites, strong design, reversibility taken into consideration. (J.S.)

  10. 2005 dossier: granite. Tome: architecture and management of the geologic disposal; Dossier 2005: granite. Tome architecture et gestion du stockage geologique

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the geologic disposal of high-level and long-lived radioactive wastes in granite formations. Content: 1 - Approach of the study: main steps since the December 30, 1991 law, ANDRA's research program on disposal in granitic formations; 2 - high-level and long-lived (HLLL) wastes: production scenarios, waste categories, inventory model; 3 - disposal facility design in granitic environment: definition of the geologic disposal functions, the granitic material, general facility design options; 4 - general architecture of a disposal facility in granitic environment: surface facilities, underground facilities, disposal process, operational safety; 5 - B-type wastes disposal area: primary containers of B-type wastes, safety options, concrete containers, disposal alveoles, architecture of the B-type wastes disposal area, disposal process and feasibility aspects, functions of disposal components with time; 6 - C-type wastes disposal area: C-type wastes primary containers, safety options, super-containers, disposal alveoles, architecture of the C-type wastes disposal area, disposal process in a reversibility logics, functions of disposal components with time; 7 - spent fuels disposal area: spent fuel assemblies, safety options, spent fuel containers, disposal alveoles, architecture of the spent fuel disposal area, disposal process in a reversibility logics, functions of disposal components with time; 8 - conclusions: suitability of the architecture with various types of French granites, strong design, reversibility taken into consideration. (J.S.)

  11. Genomic and genome-wide association of susceptibility to radiation-induced fibrotic lung disease in mice

    International Nuclear Information System (INIS)

    Background and purpose: To identify genes which influence the fibrotic response to thoracic cavity radiotherapy, we combined a genome wide single nucleotide polymorphism (SNP) association evaluation of inbred strain response with prior linkage and gene expression data. Material and methods: Mice were exposed to 18 Gy whole thorax irradiation and survival, bronchoalveolar cell differential, and histological alveolitis and fibrosis phenotypes were determined. Association analyses were completed with 1.8 million SNPs in single markers and haplotypes. Results: Nine strains developed significant fibrosis and 11 strains succumbed to alveolitis only or alveolitis with minimal fibrosis. Post irradiation survival time (p −6; by permutation test), with the most significant SNP within a conserved non-coding region downstream of cell adhesion molecule 1 (Cadm1). Haplotype and SNP analyses performed within previously-identified loci revealed additional genes containing SNPs associated with fibrosis including Slamf6 and Cdkn1a. Conclusion: Combining genomic approaches identified variation within specific genes which function in the tissue response to injury as associated with fibrosis following thoracic irradiation in mice.

  12. Dicty_cDB: Contig-U10064-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available full-length cDNA c... 46 3.1 1 ( DB531062 ) Homo sapiens hippocampus cDNA, RIKEN...31 AE017340_1658( AE017340 |pid:none) Idiomarina loihiensis L2TR, com... 69 4e-10 BX548175_146( BX548175 |pid:none) Prochlorococc...us marinus MIT9313 ... 65 4e-09 CP000113_3772( CP000113 |pid:none) Myxococcus xanthus D...CB15, com... 62 3e-08 CP000554_170( CP000554 |pid:none) Prochlorococcus marinus str. MIT... 58 6e-07 CP00092...rinomonas sp. MWYL1, complete ... 53 2e-05 AE017346_141( AE017346 |pid:none) Cryptococc

  13. [Specification of species status of some colleciton strains of methanotrophs].

    Science.gov (United States)

    Romanovskaia, V A; Rokitko, P V; Shilin, S O; Chernaia, N A

    2009-01-01

    Sequence-analysis of genes 16S rRNA has demonstrated the high-level relationship (99%) of the strains Methylobacter ucrainicus UCM B-3159, and Methylobacter marinus A45(T). The strain UCM B-3159 has lower coefficients of similarity (97.4-96.4%) for other species of that genus. These strains are similar as to their phenotypical properties and form one branch on the dendrogram which demonstrates species relations of Methylococcaceae family, that permitted reclassifying M. ucrainicus as M. marinus. Phylogenetic analysis has confirmed the belonging of strains UCM B-3002 and UCM B-3494 to Methylococcus capsulatus species. Those strains were earlier related to this species on the basis of phenotype features. PMID:19663320

  14. Unigene BLAST: CBRC-PMAR-01-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0161 gnl|UG|Pma#S35157439 PMAO-aad74g04.g1 Lamprey_EST_Embryo Petromyzon marinus cD ... NA 5' similar to sp|Q99814|PAS 1_HUMAN Endothelial PAS ... domain protein 1 (EPAS -1) ( ... Member of PAS ... protein 2) (MOP2) gb|AAC51212.1| PAS ... protein 2, mR ...

  15. Het belang van migratie voor de visstand in de Maas

    OpenAIRE

    Winter, H.V.; Buijse, T.

    2003-01-01

    In het Nederlandse deel van de Maas komen nagenoeg alle oorspronkelijke vissoorten voor, zelfs soorten die over lange afstanden migreren, zoals Zeeprik (Petromyzon marinus) en Zeeforel (Salmo trutta). Deze restpopulaties zijn een belangrijke basis voor ecologisch herstel. Door de sterk doorgevoerde normalisatie en de waterkwaliteit wordt de visstand echter sterk gedomineerd door niet specifieke soorten, zoals Blankvoorn (Rutius rutilus), Brasem (Abramis brama) en Snoekbaars (Sander lucioperca...

  16. Decline of electrogenic Na+/K+ pump activity in rod photoreceptors during maintained illumination

    OpenAIRE

    1986-01-01

    Light-evoked changes in membrane voltage were recorded intracellularly from rod photoreceptors in the isolated retina preparation of the toad, Bufo marinus, during superfusion with a solution containing pharmacological agents that blocked voltage-dependent conductances. Under these conditions, the amplitude of the hyperpolarizing photoresponse became much greater than under control conditions. The results of several experiments support the conclusion that this increase in photoresponse amplit...

  17. Cyanobacteria of the Genus Prochlorothrix †

    OpenAIRE

    Pinevich, Alexander; Velichko, Natalia; Ivanikova, Natalia

    2012-01-01

    Green cyanobacteria differ from the blue–green cyanobacteria by the possession of a chlorophyll-containing light-harvesting antenna. Three genera of the green cyanobacteria namely Acaryochloris, Prochlorococcus, and Prochloron are unicellular and inhabit marine environments. Prochlorococcus marinus attracts most attention due to its prominent role in marine primary productivity. The fourth genus Prochlorothrix is represented by the filamentous freshwater strains. Unlike the other green cyanob...

  18. Gene : CBRC-PMAR-01-0129 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0129 Novel UN D UNKNOWN RBM12_MOUSE 6e-09 30% ref|XP_001626432.1| predicted protein ... omyzon marinus cDNA 5' similar to ref|NP_005787.1| nuclear ... transport factor 2; placental protein 15 [Homo sap ... iens] >ref|NP_080808.1| nuclear ... transport factor 2 [Mus musculus] >ref|XP_214685.1 ...

  19. Macroalgae as feedstock for cultivation of marine bacteria

    OpenAIRE

    França, Lucas Vagueiro de

    2015-01-01

    Alginate, laminarin and mannitol amount up to 60% of dry weight in brown macroalgae. The presence of alginate and laminarin-degrading enzymes and mannitol metabolic machinery have been confirmed by Matís, a partner in European BlueGenics project. Thus, in a biorefinery perspective, R. marinus can potentially perform the saccharification and fermentation of brown macroalgae carbohydrates to yield commercial valuable biocompounds, as thermostable enzymes and glycosidic carotenoids. Rhodothermus...

  20. Perpetual production of hair cells and maturational changes in hair cell ultrastructure accompany postembryonic growth in an amphibian ear.

    OpenAIRE

    Corwin, J T

    1985-01-01

    Sensory hair cells are produced in the ears of birds and mammals only during early development, so that a programmed termination of hair cell proliferation leaves adult birds and mammals susceptible to irreversible deafness and balance disorders. This study reports that this is not an inherent feature of hair cells and is not shared through all the vertebrate classes. In toads (Bufo marinus) hair cells accumulate throughout life, increasing in the sacculus from approximately 400 cells at meta...

  1. Squalamine as a broad-spectrum systemic antiviral agent with therapeutic potential

    OpenAIRE

    Zasloff, Michael; Adams, A. Paige; Beckerman, Bernard; Campbell, Ann; Han, Ziying; Luijten, Erik; Meza, Isaura; Julander, Justin; Mishra, Abhijit; Qu, Wei; Taylor, John M; Scott C Weaver; Wong, Gerard C. L.

    2011-01-01

    Antiviral compounds that increase the resistance of host tissues represent an attractive class of therapeutic. Here, we show that squalamine, a compound previously isolated from the tissues of the dogfish shark (Squalus acanthias) and the sea lamprey (Petromyzon marinus), exhibits broad-spectrum antiviral activity against human pathogens, which were studied in vitro as well as in vivo. Both RNA- and DNA-enveloped viruses are shown to be susceptible. The proposed mechanism involves the capacit...

  2. AcEST: DK945817 [AcEST

    Lifescience Database Archive (English)

    Full Text Available u... 49 2e-05 sp|Q46J69|CH10_PROMT 10 kDa chaperonin OS=Prochlorococcus marinu... 49 2e-05 sp|A2C4I3|CH10_PR...IKLGSDEYVLLSEK-DILAVV 102 >sp|A2C4I3|CH10_PROM1 10 kDa chaperonin OS=Prochlorococcus marinus (strain NATL1A)

  3. Unigene BLAST: CBRC-PMAR-01-0793 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0793 gnl|UG|Pma#S35052147 PMAD-aac08j21.g1 Lamprey_WGS_pCMV-sport6 Petromyzon mar...inus cDNA 5' similar to gb|AAH45362.1| Similar to citrate synthase [Danio rerio], mRNA sequence /clone_end=5' /gb=DW021162 /gi=83670754 /ug=Pma.4046 /len=887 5.3 29% ...

  4. Unigene BLAST: CBRC-PMAR-01-0271 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0271 gnl|UG|Pma#S35112282 PMAH-aab50h07.g1 Lamprey_EST_Olfactory Petromyzon marinus ... cDNA 5' similar to ref|NP_776765.1| histidine ... triad nucleotide binding protein 2 [Bos taurus] gb ... |AAM00370.1| histidine ... triad protein 3 [Bos taurus], mRNA sequence /clone ...

  5. Unigene BLAST: CBRC-PMAR-01-0315 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0315 gnl|UG|Pma#S35112282 PMAH-aab50h07.g1 Lamprey_EST_Olfactory Petromyzon marinus ... cDNA 5' similar to ref|NP_776765.1| histidine ... triad nucleotide binding protein 2 [Bos taurus] gb ... |AAM00370.1| histidine ... triad protein 3 [Bos taurus], mRNA sequence /clone ...

  6. Utilización de glucosa por Prochlorococcus: caracterización del transportador Pro 1404 y efectos metabólicos

    OpenAIRE

    Muñoz Marín, Mª Carmen

    2013-01-01

    Prochlorococcus is responsible for a significant part of CO2 fixation in the ocean. It was long considered an autotrophic cyanobacterium, but our group has shown in laboratory experiments that Prochlorococcus can take up glucose like a heterotrophic organism. However, the mechanisms of glucose uptake and its occurrence in the ocean have not been shown. Here we report that the gene melB confers capability for glucose uptake in P. marinus SS120. We utilized a cyanobacterium un...

  7. The complete nucleotide sequence of the mitochondrial DNA of the dogfish, Scyliorhinus canicula.

    OpenAIRE

    Delarbre, C; Spruyt, N; Delmarre, C; Gallut, C; Barriel, V.; Janvier, P.; Laudet, V; Gachelin, G

    1998-01-01

    We have determined the complete nucleotide sequence of the mitochondrial DNA (mtDNA) of the dogfish, Scyliorhinus canicula. The 16,697-bp-long mtDNA possesses a gene organization identical to that of the Osteichthyes, but different from that of the sea lamprey Petromyzon marinus. The main features of the mtDNA of osteichthyans were thus established in the common ancestor to chondrichthyans and osteichthyans. The phylogenetic analysis confirms that the Chondrichthyes are the sister group of th...

  8. A surface tow net for collection of parasitic-phase sea lampreys

    Science.gov (United States)

    Dahl, Frederick H.

    1968-01-01

    A STUDY OF MIGRATORY BEHAVIOR of parasitic sea lampreys (Petromyzon marinus) in the Great Lakes required a means of capturing lampreys for tagging and releasing in St. Marys River, Lake Huron. Smith and Elliott (1953) fished specially made gill and trap nets for sea lampreys, but stationary nets could not be used in the St. Marys River because of boat traffic, interference with sport fishermen, and fast currents.

  9. Unigene BLAST: CBRC-PMAR-01-0244 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0244 gnl|UG|Pma#S35092879 PMAH-aaa88a09.g1 Lamprey_EST_Olfactory Petromyzon marinus ... cDNA 5' similar to ref|NP_031714.1| cofilin 2, muscle ... [Mus musculus] ref|XP_234155.1| similar to cofilin ... 2, muscle ... [Mus musculus] [Rattus norvegicus] sp|P45591|COF2_ ... MOUSE Cofilin, muscle ... isoform> /clone_end=5' /gb=EC383728 /gi=109186346 ...

  10. Unigene BLAST: CBRC-PMAR-01-0678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0678 gnl|UG|Pma#S35054800 PMAH-aaa35b01.g1 Lamprey_EST_Olfactory Petro...myzon marinus cDNA 5' similar to sp|P09967|GLB1_PETMA Globin I >pir||A26042 globin I - sea lamprey, mRNA sequence /clone_end=5' /gb=DW023815 /gi=83673407 /ug=Pma.780 /len=785 7.4 40% ...

  11. A Suspected Parasite Spill-Back of Two Novel Myxidium spp. (Myxosporea) Causing Disease in Australian Endemic Frogs Found in the Invasive Cane Toad

    Czech Academy of Sciences Publication Activity Database

    Hartigan, A.; Fiala, Ivan; Dyková, Iva; Jirků, Miloslav; Okimoto, B.; Rose, K.; Phalen, D. N.; Šlapeta, J.

    2011-01-01

    Roč. 6, č. 4 (2011), e18871. E-ISSN 1932-6203 R&D Projects: GA AV ČR KJB600960701 Grant ostatní: GA ČR(CZ) GP204/09/P519 Institutional research plan: CEZ:AV0Z60220518 Keywords : EW-SOUTH-WALES * BUFO-MARINUS * BIOLOGICAL INVASIONS * INFECTIOUS-DISEASES * NORTH-AMERICA * TREE FROG * MYXOZOA * SEQUENCES * PHYLOGENY * ECOLOGY Subject RIV: EG - Zoology Impact factor: 4.092, year: 2011

  12. Croceicoccus naphthovorans sp. nov., a polycyclic aromatic hydrocarbons-degrading and acylhomoserine-lactone-producing bacterium isolated from marine biofilm, and emended description of the genus Croceicoccus.

    Science.gov (United States)

    Huang, Yili; Zeng, Yanhua; Feng, Hao; Wu, Yuehong; Xu, Xuewei

    2015-05-01

    A polycyclic aromatic hydrocarbons-degrading and acylhomoserine-lactone-producing marine bacterium, designated strain PQ-2(T), was isolated from marine biofilm collected from a boat shell at a harbour of Zhoushan island in Zhejiang Province, PR China. Strain PQ-2(T) is Gram-stain-negative, yellow-pigmented, non-motile and short rod-shaped. Optimal growth of strain PQ-2(T) was observed at 32 °C, at pH 7.0 and in 2% (w/v) NaCl. The 16S rRNA gene sequence of strain PQ-2(T) showed highest similarity to Croceicoccus marinus E4A9(T) (96.3%) followed by Novosphingobium malaysiense MUSC 273(T) (95.6%) and Altererythrobacter marinus H32(T) (95.6%). Phylogenetic analysis with all species of the family Erythrobacteraceae with validly published names revealed that strain PQ-2(T) formed a phyletic line with Croceicoccus marinus E4A9(T) that was distinct from other members of the family Erythrobacteraceae . The sole respiratory quinone was ubiquinone 10 (Q-10). The predominant fatty acids were C18 : 1ω7c, C17 : 1ω6c and summed feature 3 (C16 : 1ω7c and/or iso-C15 : 0 2-OH). The genomic DNA G+C content was 61.7 mol%. In the polar lipid profile, phosphatidylethanolamine, phosphatidylcholine, phosphatidylglycerol, one unidentified phospholipid and one sphingoglycolipid were the major compounds; and another sphingoglycolipid was present in a minor amount. Based on the genotypic and phenotypic data, strain PQ-2(T) represents a novel species of the genus Croceicoccus , for which the name Croceicoccus naphthovorans sp. nov. is proposed. The type strain is PQ-2(T) ( =CGMCC 1.12805(T) =NBRC 110381(T)). In addition, emended descriptions for the genus Croceicoccus and the species C. marinus are given. PMID:25713040

  13. Physiological and structural properties of saponin-skinned single smooth muscle cells

    OpenAIRE

    1987-01-01

    The study of the fundamental events underlying the generation and regulation of force in smooth muscle would be greatly facilitated if the permeability of the cell membrane were increased so that the intracellular environment of the contractile apparatus could be manipulated experimentally. To initiate such an analysis, we developed a saponin permeabilization procedure that was used to "skin" isolated smooth muscle cells from the stomach of the toad, Bufo marinus. Suspensions of single cells ...

  14. Unigene BLAST: CBRC-PMAR-01-0262 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0262 gnl|UG|Pma#S35072509 PMAH-aaa73b06.g1 Lamprey_EST_Olfactory Petromyzon marinus ... biquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast ); UbcH5B; ubiquitin-conjugating enzyme E2D 2 (homo ... logous to yeast ... UBC4/5) [Homo sapiens] >ref|NP_064> /clone_end=5' ...

  15. Unigene BLAST: CBRC-PMAR-01-0343 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0343 gnl|UG|Pma#S35109215 PMAO-aad58f11.g1 Lamprey_EST_Embryo Petromyzon marinus cD ... NA 5' similar to ref|NP_054772.1| feline leukemia virus ... subgroup C cellular receptor; FLVCR protein [Homo ... sapiens] gb|AAD45243.1|AF118637_1 feline leukemia virus ... subgroup C receptor FLVCR [Homo s> /clone_end=5' / ...

  16. Assessing estuarine quality: A cost-effective in situ assay with amphipods.

    Science.gov (United States)

    Martinez-Haro, Monica; Acevedo, Pelayo; Pais-Costa, Antónia Juliana; Taggart, Mark A; Martins, Irene; Ribeiro, Rui; Marques, João Carlos

    2016-05-01

    In situ assays based on feeding depression can be powerful ecotoxicological tools that can link physiological organism-level responses to population and/or community-level effects. Amphipods are traditional target species for toxicity tests due to their high sensitivity to contaminants, availability in the field and ease of handling. However, cost-effective in situ assays based on feeding depression are not yet available for amphipods that inhabit estuarine ecosystems. The aim of this work was to assess a short-term in situ assay based on postexposure feeding rates on easily quantifiable food items with an estuarine amphipod. Experiments were carried out under laboratory conditions using juvenile Echinogammarus marinus as the target individual. When 60 Artemia franciscana nauplii (as prey) were provided per individual for a period of 30 min in dark conditions, feeding rates could be easily quantified. As an endpoint, postexposure feeding inhibition in E. marinus was more sensitive to cadmium contamination than mortality. Assay calibration under field conditions demonstrated the relevance of sediment particle size in explaining individual feeding rates in uncontaminated water bodies. An evaluation of the 48-h in situ bioassay based on postexposure feeding rates indicated that it is able to discriminate between unpolluted and polluted estuarine sites. Using the harmonized protocol described here, the in situ postexposure feeding assay with E. marinus was found to be a potentially useful, cost-effective tool for assessing estuarine sediment and water quality. PMID:26874320

  17. The Nuclear DNA Content and Genetic Diversity of Lampetra morii

    Science.gov (United States)

    Yan, Xinyu; Meng, Wenbin; Wu, Fenfang; Xu, Anlong; Chen, Shangwu; Huang, Shengfeng

    2016-01-01

    We investigated the nuclear DNA content and genetic diversity of a river lamprey, the Korean lamprey Lampetra morii, which is distributed in the northeast of China. L. morii spends its whole life cycle in fresh water, and its adult size is relatively small (~160 mm long) compared with that of other lampreys. The haploid nuclear DNA content of L. morii is 1.618 pg (approximately 1.582 Gb) in germline cells, and there is ~15% germline DNA loss in somatic cells. These values are significantly smaller than those of Petromyzon marinus, a lamprey with a published draft genome. The chromosomes of L. morii are small and acrocentric, with a diploid modal number of 2n = 132, lower than some other lampreys. Sequence and AFLP analyses suggest that the allelic polymorphism rate (~0.14% based on examined nuclear and mitochondrial DNA sequences) of L. morii is much lower than that (~2%) of P. marinus. Phylogenetic analysis based on a mitochondrial DNA fragment confirms that L. morii belongs to the genus Lampetra, which, together with the genus Lethenteron, forms a sister group to P. marinus. These genetic background data are valuable for subsequent genetic and genomic research on L. morii. PMID:27388621

  18. Diversity of Picoeukaryotes at an Oligotrophic Site off the Northern Red Sea Coast

    KAUST Repository

    Espinosa, Francisco Jose Acosta

    2012-05-01

    Picoeukaryotes are protist 3 µm belonging to a wide diversity of taxonomic groups, and they are an important constituent of the ocean microbiota, performing essential ecological roles in marine trophic chains and in nutrient and carbon budgets. Despite this, the true extent of their diversity is currently unknown, and in the last decade molecular surveys have uncovered a substantial number of previously unknown groups from all taxonomic levels. No studies on this group have been done so far on the Red Sea, a unique marine environment characterized by oligotrophic conditions and high irradiance, salinity and water temperature. We sampled the surface waters of a site near the northern Red Sea coast, and analyzed the picoeukaryotic diversity through the construction of PCR clone libraries using the 18S ribosomal gene. The community captured by our library is dominated by three main groups, the alveolates (32%), chlorophytes (32%) and Stramenopiles (20.55%). Members of Radiolaria, Cercozoans and Haptophyta were also found, although in low abundances. Photosynthetic organisms are especially diverse and abundant in the sample, with heterotrophic organism mostly composed by the mostly parasitic novel alveolates and bacterivorous stramenopiles. Novel clades were detected among the Novel Alveolates- II and the photosynthetic stramenopiles taxa, which suggests that they may be part of a number of groups unique to the basin and adapted to the high salinity and temperature conditions. This is the first study done on the Red Sea focusing on the diversity of the complete picoeukaryotic fraction, and provides a stepping stone in the characterization of the picoeukaryotic component of the microbial diversity of the basin.

  19. CXC Receptor 1 and 2 and Neutrophil Elastase Inhibitors Alter Radiation-induced Lung Disease in the Mouse

    Energy Technology Data Exchange (ETDEWEB)

    Fox, Jessica [Department of Medicine and the Meakins-Christie Laboratories, McGill University, Montreal, Quebec (Canada); Haston, Christina K., E-mail: christina.haston@mcgill.ca [Department of Medicine and the Meakins-Christie Laboratories, McGill University, Montreal, Quebec (Canada)

    2013-01-01

    Purpose: We previously reported increased numbers of neutrophils to be associated with the development of the radiation-induced lung responses of alveolitis (pneumonitis) and fibrosis in mice. In the present study we investigated whether CXC receptor 1 and 2 antagonism with DF2156A, a small molecule inhibitor of neutrophil chemotaxis, or the neutrophil elastase inhibitor sivelestat decreases the lung response to irradiation. Methods and Materials: KK/HIJ mice received 14 Gy whole-thorax irradiation, and a subset of them received drug treatment 3 times per week from the day of irradiation until they were killed because of respiratory distress symptoms. Results: Irradiated mice receiving sivelestat survived 18% longer than did mice receiving radiation alone (73 vs 60 days for female mice, 91 vs 79 days for male mice), whereas postirradiation survival times did not differ between the group of mice receiving DF2156A and the radiation-only group. The numbers of neutrophils in lung tissue and in bronchoalveolar lavage fluid did not differ among groups of irradiated mice, but they significantly exceeded the levels in unirradiated control mice. The extent of alveolitis, assessed histologically, did not differ between irradiated mice treated with either drug and those receiving radiation alone, when assessed at the end of the experiment, but it was significantly reduced, as were the neutrophil measures, in sivelestat-treated mice at the common kill time of 60 days after irradiation. Mice treated with radiation and DF2156A developed significantly less fibrosis than did mice receiving radiation alone, and this difference was associated with decreased expression of interleukin-13 in lung tissue. Conclusions: We conclude that neutrophil elastase inhibition affects alveolitis and prolongs survival, whereas CXCR1/2 antagonism reduces radiation-induced fibrotic lung disease in mice without affecting the onset of distress.

  20. CXC Receptor 1 and 2 and Neutrophil Elastase Inhibitors Alter Radiation-induced Lung Disease in the Mouse

    International Nuclear Information System (INIS)

    Purpose: We previously reported increased numbers of neutrophils to be associated with the development of the radiation-induced lung responses of alveolitis (pneumonitis) and fibrosis in mice. In the present study we investigated whether CXC receptor 1 and 2 antagonism with DF2156A, a small molecule inhibitor of neutrophil chemotaxis, or the neutrophil elastase inhibitor sivelestat decreases the lung response to irradiation. Methods and Materials: KK/HIJ mice received 14 Gy whole-thorax irradiation, and a subset of them received drug treatment 3 times per week from the day of irradiation until they were killed because of respiratory distress symptoms. Results: Irradiated mice receiving sivelestat survived 18% longer than did mice receiving radiation alone (73 vs 60 days for female mice, 91 vs 79 days for male mice), whereas postirradiation survival times did not differ between the group of mice receiving DF2156A and the radiation-only group. The numbers of neutrophils in lung tissue and in bronchoalveolar lavage fluid did not differ among groups of irradiated mice, but they significantly exceeded the levels in unirradiated control mice. The extent of alveolitis, assessed histologically, did not differ between irradiated mice treated with either drug and those receiving radiation alone, when assessed at the end of the experiment, but it was significantly reduced, as were the neutrophil measures, in sivelestat-treated mice at the common kill time of 60 days after irradiation. Mice treated with radiation and DF2156A developed significantly less fibrosis than did mice receiving radiation alone, and this difference was associated with decreased expression of interleukin-13 in lung tissue. Conclusions: We conclude that neutrophil elastase inhibition affects alveolitis and prolongs survival, whereas CXCR1/2 antagonism reduces radiation-induced fibrotic lung disease in mice without affecting the onset of distress.

  1. Exogenous lipid pneumonia: a retrospective multicentre study of 44 cases in France.

    Science.gov (United States)

    Gondouin, A; Manzoni, P; Ranfaing, E; Brun, J; Cadranel, J; Sadoun, D; Cordier, J F; Depierre, A; Dalphin, J C

    1996-07-01

    A nationwide retrospective study of exogenous lipid pneumonia (ELP) was carried out to update the data on this disease, with emphasis on thoracic computed tomography (CT) scan and bronchoalveolar lavage (BAL) findings. The inclusion criteria were: 1) presence of abnormal imaging features compatible with the diagnosis of ELP; 2) presence of intrapulmonary lipids; and 3) exogenous origin of the lipid pneumonia. Forty four cases were included (20 males and 24 females; mean age 62 +/- 11 yrs), of which four were occupational (chronic inhalation of cutting mist or oily vapour in an industrial environment). Thirty of the 40 nonoccupational cases were related to aspiration of liquid paraffin used for the treatment of constipation. A condition possibly favouring oil aspiration or inhalation was present in 34 patients (77%), most commonly gastro-oesophageal reflux (n = 20) and neurological or psychiatric illness (n = 14). Fever (39%), weight loss (34%), cough (64%), dyspnoea (50%) and crepitations (45%) were the most frequent symptoms. BAL was performed in 39 cases: 23% had a lymphocytic alveolitis; 14% neutrophilic alveolitis; and 31% a mixed alveolitis (lymphocytic and neutrophilic). Alveolar consolidations (57%), ground glass opacities (39%), and alveolar nodules (23%) were the most common radiological abnormalities. The changes were bilateral (79%), predominant in the posterior and lower zones of the lobes concerned (74%), hypodense (71%), and spared the subpleural zones (52%). In 13 cases, hypodensity was retrospectively established on CT scan by the presence of a "positive angiogram". This sign may be of diagnostic value when the density measurement is either not possible or not reliable. In conclusion, this study provides an update of the clinical, biological and radiological profile of exogenous lipid pneumonia and, in particular, confirms the diagnostic benefit of computed tomography scan, which revealed bilateral and hypodense changes in a large majority of cases

  2. Influenza virus infection, ozone exposure, and fibrogenesis.

    Science.gov (United States)

    Jakab, G J; Bassett, D J

    1990-05-01

    Oxidant exposure following chemically induced lung injury exacerbates the tendency to develop pulmonary fibrosis. Influenza virus pneumonitis causes severe acute lung damage that, upon resolution, is followed by a persistent alveolitis and parenchymal changes characterized by patchy interstitial pneumonia and collagen deposition in the affected areas. To determine whether oxidant exposure exacerbates the virus-induced alveolitis and residual lung damage, mice were infected by aerosol inhalation with influenza A virus and continuously exposed to 0.5 ppm ozone or ambient air. Noninfected control mice were exposed to either ambient air or ozone. On various days during the first month after infection, groups of mice were sacrificed and their lungs assessed for acute injury (lung lavage albumin, total and differential cell counts, wet/dry ratios, and morphometry). At 30, 60, 90, and 120 days after infection, groups of mice were sacrificed for total and differential lavage cell counts, lung hydroxyproline content, and morphometric analysis. Ozone exposure did not alter the proliferation of virus in the lungs as quantitated by infectious virus titers of lung homogenates at 1, 4, 7, 10, and 15 days after virus infection but mitigated the virus-induced acute lung injury by approximately 50%. After Day 30 a shift in the character of the pulmonary lesions was observed in that continuous exposure to ozone potentiated the postinfluenzal alveolitis and structural changes in the lung parenchyma. Additional studies suggest that the mechanism for the enhanced postinfluenzal lung damage may be related to the oxidant impairing the repair process of the acute influenzal lung damage. These data demonstrate that ozone exposure mitigates acute virus-induced lung injury and potentiates residual lung damage. PMID:2339849

  3. 2005 dossier: clay. Tome: phenomenological evolution of the geologic disposal

    International Nuclear Information System (INIS)

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the phenomenological processes taking place in an argilite-type geologic disposal facility for high-level and long-lived (HLLL) radioactive wastes. Content: 1 - introduction: goal, input data, time and space scales, long-time forecasting of the phenomenological evolution; 2 - the Meuse/Haute-Marne site, the HLLL wastes and the disposal concepts: impact of the repository architecture; 3 - initial state of the geologic environment prior to the building up of the repository: general framework, geologic formations, tectonics and fractures, surface environment, geologic synthesis; 4 - phenomenological processes: storage-related processes, geodynamics-related processes, time scales of processes and of radionuclides migration, independence and evolution similarities of the repository and of the geologic environment; 5 - heat loads: heat transfers between containers and geologic formations, spatial organization of the thermal load, for C-type wastes and spent fuels, for B-type wastes, synthesis of the repository thermal load; 6 - flows and liquid solution and gas transfers: hydraulic behaviour of surrounding Jurassic formations (Tithonian, Kimmeridgian, Callovian, Oxfordian); 7 - chemical phenomena: chemical evolution of ventilated facilities (alveoles, galleries, boreholes), chemical evolution of B-type waste alveoles and of gallery and borehole sealing after closure, far field chemical evolution of Callovo-Oxfordian argilites and of other surrounding formations; 8 - mechanical evolution of the disposal and of the surrounding geologic environment: creation of an initial excavated damaged zone (EDZ), mechanical evolution of ventilated galleries, alveoles and sealing before and after closure, large-scale mechanical evolution; 9 - geodynamical evolution of the Callovo-Oxfordian and other surrounding formations and of the surface environment: internal

  4. Pulmonary toxicity of simulated lunar and Martian dusts in mice: I. Histopathology 7 and 90 days after intratracheal instillation

    Science.gov (United States)

    Lam, Chiu-Wing; James, John T.; McCluskey, Richard; Cowper, Shawn; Balis, John; Muro-Cacho, Carlos

    2002-01-01

    NASA is contemplating sending humans to Mars and to the moon for further exploration. Volcanic ashes from Arizona and Hawaii with mineral properties similar to those of lunar and Martian soils, respectively, are used to simulate lunar and Martian environments for instrument testing. Martian soil is highly oxidative; this property is not found in Earth's volcanic ashes. NASA is concerned about the health risk from potential exposure of workers in the test facilities. Fine lunar soil simulant (LSS), Martian soil simulant (MSS), titanium dioxide, or quartz in saline was intratracheally instilled into groups of 4 mice (C57BL/6J) at 0.1 mg/mouse (low dose, LD) or 1 mg/mouse (high dose, HD). Separate groups of mice were exposed to ozone (0.5 ppm for 3 h) prior to MSS instillation. Lungs were harvested for histopathological examination 7 or 90 days after the single dust treatment. The lungs of the LSS-LD groups showed no evidence of inflammation, edema, or fibrosis; clumps of particles and an increased number of macrophages were visible after 7 days but not 90 days. In the LSS-HD-7d group, the lungs showed mild to moderate alveolitis, and perivascular and peribronchiolar inflammation. The LSS-HD-90d group showed signs of mild chronic pulmonary inflammation, septal thickening, and some fibrosis. Foci of particle-laden macrophages (PLMs) were still visible. Lung lesions in the MSS-LD-7d group were similar to those observed in the LSS-HD-7d group. The MSS-LD-90d group had PLMs and scattered foci of mild fibrosis in the lungs. The MSS-HD-7d group showed large foci of PLMs, intra-alveolar debris, mild-to-moderate focal alveolitis, and perivascular and peribronchiolar inflammation. The MSS-HD-90d group showed focal chronic mild-to-moderate alveolitis and fibrosis. The findings in the O(3)-MSS-HD-90d group included widespread intra-alveolar debris, focal moderate alveolitis, and fibrosis. Lung lesions in the MSS groups were more severe with the ozone pretreatment. The effects of

  5. Telonemia, a new protist phylum with affinity to chromist lineages

    DEFF Research Database (Denmark)

    Shalchian-Tabrizi, K.; Eikrem, W.; Klaveness, D.; Vaulot, D.; Minge, M.A.; Le Gall, F.; Romari, K.; Throndsen, J.; Botnen, A.; Massana, R.; Thomsen, Helge Abildhauge; Jakobsen, K.

    2006-01-01

    the alveolates and heterokonts. Using the same approach on coastal samples, we have identified a novel group of protist small subunit (SSU) rDNA sequences that do not correspond to any phylogenetic group previously identified. Comparison with other sequences obtained from cultures of heterotrophic...... protists showed that the environmental sequences grouped together with Telonema, a genus known since 1913 but of uncertain taxonomic affinity. Phylogenetic analyses using four genes (SSU, Hsp90, alpha-tubulin and beta-tubulin), and accounting for gamma- and covarion-distributed substitution rates, revealed...

  6. Intraossäre Anästhesie X-tip® bei Zahnextraktionen

    OpenAIRE

    Augello, M; Furrer, T; Locher, M.

    2009-01-01

    Zusammenfassung: Ziel der vorliegenden Studie war es herauszufinden, ob mit alleiniger Applikation der IOA mit dem intraossären Anästhesie-Applikations-System X-tip® eine ausreichende Anästhesie möglich ist sowie Nebenwirkungen festzustellen. Bei 55 Patienten wurden 62 Zähne extrahiert, bei einem Zahn eine Pulpektomie durchgeführt und einmal eine Kürettage bei Alveolitis sicca vorgenommen. Nach der Schleimhautanästhesie mit Ubistesin forte® wurde mit dem X-tip® die Kortikalis perforiert...

  7. Rapamycin attenuates bleomycin-induced pulmonary fibrosis in rats and the expression of metalloproteinase-9 and tissue inhibitors of metalloproteinase-1 in lung tissue

    Institute of Scientific and Technical Information of China (English)

    Jin Xiaoguang; Dai Huaping; Ding Ke; Xu Xuefeng; Pang Baosen; Wang Chen

    2014-01-01

    Background Idiopathic pulmonary fibrosis (IPF) is the most common and devastating form of interstitial lung disease (ILD) in the clinic.There is no effective therapy except for lung transplantation.Rapamycin is an immunosuppressive drug with potent antifibrotic activity.The purpose of this study was to examine the effects of rapamycin on bleomycininduced pulmonary fibrosis in rats and the relation to the expression of metalloproteinase-9 (MMP-9) and tissue inhibitor of metalloproteinase-1 (TIMP-1).Methods Sprague-Dawley rats were treated with intratracheal injection of 0.3 ml of bleomycin (5 mg/kg) in sterile 0.9% saline to make the pulmonary fibrosis model.Rapamycin was given at a dose of 0.5 mg/kg per gavage,beginning one day before bleomycin instillation and once daily until animal sacrifice.Ten rats in each group were sacrificed at 3,7,14,28 and 56 days after bleomycin administration.Alveolitis and pulmonary fibrosis were semi-quantitatively assessed after HE staining and Masson staining under an Olympus BX40 microscope with an IDA-2000 Image Analysis System.Type Ⅰ and Ⅲ collagen fibers were identified by Picro-sirius-polarization.Hydroxyproline content in lung tissue was quantified by a colorimetric-based spectrophotometric assay,MMP-9 and TIMP-1 were detected by immunohistochemistry and by realtime quantitative reverse transcriptase polymerase chain reaction (RT-PCR).Results Bleomycin induced alveolitis and pulmonary fibrosis of rats was inhibited by rapamycin.Significant inhibition of alveolitis and hydroxyproline product were demonstrated when daily administration of rapamycin lasted for at least 14 days.The inhibitory efficacy on pulmonary fibrosis was unremarkable until rapamycin treatment lasted for at least 28 days (P <0.05).It was also demonstrated that rapamycin treatment reduced the expression of MMP-9 and TIMP-1 in lung tissue that was increased by bleomycin.Conclusion These results highlight the significance of rapamycin in alleviating

  8. Adenosine regulation of alveolar fluid clearance

    OpenAIRE

    Factor, Phillip; Mutlu, Göskhan M.; Chen, Lan; Mohameed, Jameel; Akhmedov, Alexander T.; Meng, Fan Jing; Jilling, Tamas; Lewis, Erin Rachel; Johnson, Meshell D.; Xu, Anna; Kass, Daniel; Martino, Janice M.; Bellmeyer, Amy; Albazi, John S.; Emala, Charles

    2007-01-01

    Adenosine is a purine nucleoside that regulates cell function through G protein-coupled receptors that activate or inhibit adenylyl cyclase. Based on the understanding that cAMP regulates alveolar epithelial active Na+ transport, we hypothesized that adenosine and its receptors have the potential to regulate alveolar ion transport and airspace fluid content. Herein, we report that type 1 (A1R), 2a (A2aR), 2b (A2bR), and 3 (A3R) adenosine receptors are present in rat and mouse lungs and alveol...

  9. Medical image of the week: sarcoidosis

    Directory of Open Access Journals (Sweden)

    Knox KS

    2013-02-01

    Full Text Available A 42 year old African-American man from Indianapolis presented with cough and skin lesions. ACE level was elevated at 86 μg/L. Spirometry was normal except for a diffusing capacity 52% of predicted. Imaging was suggestive of sarcoidosis versus granulomatous infection. Bronchoscopy with bronchoalveolar lavage cytospin revealed a lymphocytic alveolitis (27% lymphocytes with a CD4:CD8 ratio of 6.2:1 by flow cytometry. Biopsy showed classic noncaseating granulomas and no organisms supporting the diagnosis of sarcoidosis. The patient’s symptoms and radiographic findings improved with 20 mg prednisone every other day for 3 months duration.

  10. Tracking X-ray microscopy for alveolar dynamics in live intact mice

    OpenAIRE

    Chang, Soeun; Kwon, Namseop; Weon, Byung Mook; Kim, Jinkyung; Rhee, Chin Kook; Choi, Han Sung; Kohmura, Yoshiki; Yamamoto, Masaki; Ishikawa, Tetsuya; Je, Jung Ho

    2013-01-01

    Here we report a tracking X-ray microscopy (TrXM) as a novel methodology by using upper right lung apices alveoli in live intact mice. By enabling tracking of individual alveolar movements during respiration, TrXM identifies alveolar dynamics: individual alveoli in the upper lung apices show a small size increment as 4.9 ± 0.4% (mean ± s.e.m.) during respiration while their shapes look almost invariant. TrXM analysis in alveolar dynamics would be significant for better understanding of alveol...

  11. A comparative study of the pulmonary effects of NO2 in the rat and hamster.

    OpenAIRE

    Foster, J R; Cottrell, R C; Herod, I. A.; Atkinson, H. A.; Miller, K

    1985-01-01

    A study of the response of rat and hamster to nitrogen dioxide (NO2) under identical conditions has been undertaken. Exposure to 20 parts/IO6 NO2 for 24 h produced a mild cytotoxic effect on the terminal bronchiole and proximal alveoli in the rat, whereas the hamster developed a moderate to severe bronchiolitis and alveolitis. Electron microscopic examination of tissue sections showed accumulation of surfactant in lamellar bodies of the alveolar type II cell in the rat but not in the hamster,...

  12. Radiological findings and differential diagnosis in childhood asthma

    International Nuclear Information System (INIS)

    In children with asthma, routine chest X-ray typically shows bilaterally increased air volume, low diaphragms, wide diaphragmatic angles, and often a slender cardiac silhouette with a prominent pulmonic arch. Such an X-ray is not diagnostic of asthma itself, however, but rather of its complications: pneumonitis (particularly in toddlers with infectious asthma), atelectasis due to mucus obstruction, and, rarely, extra-alveolar air trapping (pneumomediastinum with or without cutaneous emphysema more often than pneumothorax). The differential diagnosis has to rule out 'pseudoasthma' due to cystic fibrosis, alveolitis, achalasia, and foreign body aspiration. (orig.)

  13. Hamman-Rich syndrome in a goldsmith

    International Nuclear Information System (INIS)

    We report the case of a 54-year-old goldsmith admitted because of dyspnea on exertion, persistent cough, and weakness under the suspicion of exogenous allergic alveolitis. He rapidly developed progressive lung fibrosis with exitus letalis 7 weeks after admission. Radiological examination (chest X-ray and HRCT) first showed ground glass opacities, and later rapid development of severe interstitial pattern with architectural distraction. The findings were similar to idiopathic lung fibrosis; however, the rare Hamman-Rich syndrome was confirmed by progressive course of the disease. Correlations between Hamann-Rich syndrome and idiopathic lung fibrosis are discussed. (orig.)

  14. Síndrome de Goldenhar asociado a fisura labio alveolo palatina. Reporte de un caso

    OpenAIRE

    Nayaret Soto; Patricio Encalada

    2012-01-01

    RESUMEN En la literatura actual se puede encontrar amplia variedad de síndromes asociados a fisuras palatinas, por eso frente pacientes que presentan esta alteración es fundamental preguntar si la afectación está o no asociada a algún tipo de síndrome polimalformativo. Necesario para otorgar el tratamiento adecuado.Reporte de caso: Al Servicio de Ortodoncia, Hospital Las Higueras fue derivado paciente de sexo femenino, nacido el 22 de junio de 2012. Diagnóstico clínico fue fisura labio-alveol...

  15. Development of a Fluorescence Quantitative PCR Method for Detection of Marteilia refringens in Shellfish

    Institute of Scientific and Technical Information of China (English)

    Liji XIE; Zhixun XIE; Yaoshan PANG; Jiabo LIU; Xianwen DENG; Zhiqin XIE

    2012-01-01

    Abstract [Objective] This paper was to develop a fluorescence quantitative PCR method for detection of M. refringens in shellfish. [Method] A pair of primers and a TaqMan probe were designed and synthesized according to the conserved gene se- quences of M. refringens in GenBank, so as to develop a fluorescence quantitative PCR method for detection of M. refringens. The developed fluorescence quantitative PCR method was compared with conventional PCR detection. [Result] The fluores- cence quantitative PCR could detect 40 template copies of plasmid DNA, and its sensitivity was 100 times higher than the conventional PCR. The detection results of Perkinsus sp, Haplosporidium sp, Aeromonas hydrophila, Pseudomonas fluorescens, Vibrio parahaemolyticu, Vibrio alginolyticu, Vibrio rluvialis and Vibrio mimicus were negtive. [Conclusion] The fluorescence quantitative PCR method for M. refringens es- tablished in this paper is specific, sensitive, rapid and quantitative with good re- peatability, which can be used for clinical detection of M. refringens infection.

  16. [Respiratory disease caused by MMVF fibers and yarn].

    Science.gov (United States)

    Riboldi, L; Rivolta, G; Barducci, M; Errigo, G; Picchi, O

    1999-01-01

    The non-carcinogenic effects of vitreous fibres on the human respiratory apparatus have been the subjects of numerous studies on large exposed populations. No evidence seems to have been produced of the existence of a fibrogenic effect. However, no definite and agreed opinion has yet been expressed by the main Agencies and Institutions working in the field of prevention. As a contribution to the discussion, the paper presents the experience of the Clinica del Lavoro of Milano involving 1000 subjects who underwent broncho-alveolar lavage during assessment and checking for suspected occupational respiratory disease. A group of 23 cases was selected who were exposed to vitreous fibres without other significant exposures to factors considered hazardous for the respiratory apparatus, especially asbestos. We observed 7 cases of alveolitis; 6 cases with pleural thickening; 2 cases of interstitial disease. On the basis of the nature of exposure (duration, latency from beginning and from the end of hazardous occupation), of the data obtained from the examination of the bronchial lavage liquid (presence of vitreous fibres, siderocytes, cellularity), and of the clinical and laboratory data (X-ray, PFR), the view expressed is tendentially reassuring concerning the possible effects of vitreous fibres on the respiratory apparatus. Although the existence of an irritative type of lesion that manifests in the form of alveolitis and localised pleural thickening seems possible, albeit in a limited number of cases, it does however appear much more difficult to admit the existence of a fibrogenic effect. PMID:10339954

  17. Metabolic pathway redundancy within the apicomplexan-dinoflagellate radiation argues against an ancient chromalveolate plastid.

    Science.gov (United States)

    Waller, Ross F; Gornik, Sebastian G; Koreny, Ludek; Pain, Arnab

    2016-01-01

    The chromalveolate hypothesis presents an attractively simple explanation for the presence of red algal-derived secondary plastids in 5 major eukaryotic lineages: "chromista" phyla, cryptophytes, haptophytes and ochrophytes; and alveolate phyla, dinoflagellates and apicomplexans. It posits that a single secondary endosymbiotic event occurred in a common ancestor of these diverse groups, and that this ancient plastid has since been maintained by vertical inheritance only. Substantial testing of this hypothesis by molecular phylogenies has, however, consistently failed to provide support for the predicted monophyly of the host organisms that harbour these plastids-the "chromalveolates." This lack of support does not disprove the chromalveolate hypothesis per se, but rather drives the proposed endosymbiosis deeper into the eukaryotic tree, and requires multiple plastid losses to have occurred within intervening aplastidic lineages. An alternative perspective on plastid evolution is offered by considering the metabolic partnership between the endosymbiont and its host cell. A recent analysis of metabolic pathways in a deep-branching dinoflagellate indicates a high level of pathway redundancy in the common ancestor of apicomplexans and dinoflagellates, and differential losses of these pathways soon after radiation of the major extant lineages. This suggests that vertical inheritance of an ancient plastid in alveolates is highly unlikely as it would necessitate maintenance of redundant pathways over very long evolutionary timescales. PMID:27066182

  18. A rare case of non-small cell carcinoma of lung presenting as miliary mottling.

    Science.gov (United States)

    Jayaram Subhashchandra, Ballaekere; Ismailkhan, Mohammed; Chikkaveeraiah Shashidhar, Kuppegala; Gopalakrishna Narahari, Moda

    2013-03-01

    Miliary mottling on chest radiography is seen in miliary tuberculosis, certain fungal infections, sarcoidosis, coal miner's pneumoconiosis, silicosis, hemosiderosis, fibrosing alveolitis, acute extrinsic allergic alveolitis, pulmonary eosinophilic syndrome, pulmonary alveolar proteinosis, and rarely in hematogenous metastases from the primary cancers of the thyroid, kidney, trophoblasts, and some sarcomas. Although very infrequent, miliary mottling can be seen in primary lung cancers. Herein, we report the case of a 28-year-old female with chest X-ray showing miliary mottling. Thoracic computed tomography (CT) features were suggestive of tuberculoma with miliary tuberculosis. CT-guided fine needle aspiration cytology confirmed the diagnosis as lower-lobe, left lung non-small cell carcinoma (adenocarcinoma). It is rare for the non-small cell carcinoma of the lung to present as miliary mottling. The rarity of our case lies in the fact that a young, non-smoking female with miliary mottling was diagnosed with non-small cell carcinoma of the lung. PMID:23645961

  19. [Dental technician's pneumoconiosis; a case report].

    Science.gov (United States)

    Karaman Eyüboğlu, Canan; Itil, Oya; Gülşen, Aşkin; Kargi, Aydanur; Cimrin, Arif

    2008-01-01

    Since 1939, it has been known that, silicosis and extrinsic allergic alveolitis can be seen among dental technicians. The interstitial disease caused by the exposure to complex substances used by dental technicians is classified as a special group called dental technician's pneumoconiosis. A 36-year-old man, who has no smoking history, presented with severe dyspnea. He had worked in different dental laboratories for 22 years, but he did not have respiratory symptoms until five years ago. After that date, he had hospitalized and had been examined for respiratory pathologies for many times. He had came to our clinic, because of the progression of his dyspnea. Diffuse pulmonary parenchymal infiltrates which can be related with pneumoconiosis and chronic type 1 respiratory deficiency had been diagnosed as the result of the examinations. While he has no history of smoking or any other risk factors or diseases in his medical history, the case was accepted as dental technician's pneumoconiosis. The factors related with the pathogenesis of dental technician's pneumoconiosis are; the complex compound of the substances (metal dusts, silica, plaster, wax and resins, chemical liquids, methyl methacrylate) used in this sector and their effects on the lung parenchyma. Extrinsic allergic alveolitis related with methyl methacrylate has been reported. The most important factor to acquire an occupational lung disease is a complex occupational exposure. The insufficient workplace airing and the lack of preventive measures added on this exposure, the risks become much more greater. PMID:18701982

  20. Genetic diversity of picoeukaryotes in eight lakes differing in trophic status.

    Science.gov (United States)

    Zhao, Biying; Chen, Meijun; Sun, Ying; Yang, Jiaxin; Chen, Feizhou

    2011-02-01

    The genetic diversity of picoeukaryotes (0.2-5.0 µm) was investigated in 8 lakes differing in trophic status in Nanjing, China. Denaturing gradient gel electrophoresis (DGGE) and cloning and sequencing of 18S rRNA genes were applied to analyze the picoeukaryotic communities. DGGE analysis showed that among the 8 lakes, the diversity of picoeukaryotes was greatest in the mesotrophic Lake Nan (24 bands) and least in the oligotrophic Lake Qian (12 bands). Cluster analysis of DGGE profiles revealed that the 8 lakes were grouped into 2 distinct clusters. Cluster 1 contained lakes Mochou, Zixia, Huashen, Nan, Pipa, and Qian, while cluster 2 contained lakes Xuanwu and Baijia. Clone libraries were constructed from the mesotrophic Lake Xuanwu and the oligotrophic Lake Zixia, and the 2 libraries were compared using the program LIBSHUFF. This analysis indicated that the picoeukaryotic community composition differed significantly between the 2 lakes (p = 0.001). A total of 25 operational taxonomic units were detected; 18 (62 clones) were related to known eukaryotic groups, while 7 (30 clones) were not affiliated with any known eukaryotic group. Alveolates and stramenopiles were the dominant groups in Lake Xuanwu, while alveolates and chlorophyta predominated in Lake Zixia. Multivariate statistical analysis indicated that the differences in the picoeukaryotic community composition of the 8 lakes might be related to trophic status and top-down regulation by metazooplankton. PMID:21326353

  1. Tc-99m erythromycin lactobionate inhalation scintigraphy in parenchymal lung diseases

    Energy Technology Data Exchange (ETDEWEB)

    Durak, Hatice E-mail: hdurak@kordon.deu.edu.tr; Aktogu, Serir; Degirmenci, Berna; Sayit, Elvan; Ertay, Tuerkan; Dereli, Sevket

    1999-08-01

    We have investigated Technetium 99m erythromycin lactobionate (Tc 99m EL) clearance from the lungs after inhalation, in the presence of an alveolitis. Eighteen patients (6 sarcoidosis, 7 idiopathic fibrosis, and 5 miliary tuberculosis) were imaged after the patients inhaled 1,110 MBq of Tc 99m EL. Clearance half time for the first 45 min, for 24 h, and retention at 24 h correlated with percentage of lymphocytes in bronchoalveolar lavage fluid (BAL) (r=.729, r=.883, and r=.826, respectively). There was a positive correlation between peripheral penetration (PP) and forced expiratory volume in 1 s (FEV{sub 1}) (r=.806) and forced vital capacity (FVC) (r=.781). Retention was more marked in sarcoidosis compared with tuberculosis (0.025alveolitis. Long residency time of Tc 99m EL in the lungs implies that erythromycin can also be administered by inhalation for therapeutic purposes.

  2. Tc-99m erythromycin lactobionate inhalation scintigraphy in parenchymal lung diseases

    International Nuclear Information System (INIS)

    We have investigated Technetium 99m erythromycin lactobionate (Tc 99m EL) clearance from the lungs after inhalation, in the presence of an alveolitis. Eighteen patients (6 sarcoidosis, 7 idiopathic fibrosis, and 5 miliary tuberculosis) were imaged after the patients inhaled 1,110 MBq of Tc 99m EL. Clearance half time for the first 45 min, for 24 h, and retention at 24 h correlated with percentage of lymphocytes in bronchoalveolar lavage fluid (BAL) (r=.729, r=.883, and r=.826, respectively). There was a positive correlation between peripheral penetration (PP) and forced expiratory volume in 1 s (FEV1) (r=.806) and forced vital capacity (FVC) (r=.781). Retention was more marked in sarcoidosis compared with tuberculosis (0.025< p≤0.05). Radioaerosol lung imaging may reflect the pulmonary function impairment in parenchymal lung diseases. Retention of Tc 99m EL may be related to number of BAL cells or presence of a lymphocytic alveolitis. Long residency time of Tc 99m EL in the lungs implies that erythromycin can also be administered by inhalation for therapeutic purposes

  3. A Rare Case of Non-Small Cell Carcinoma of Lung Presenting as Miliary Mottling

    Directory of Open Access Journals (Sweden)

    Ballaekere Jayaram Subhashchandra

    2013-03-01

    Full Text Available Miliary mottling on chest radiography is seen in miliary tuberculosis, certain fungal infections, sarcoidosis, coal miner’s pneumoconiosis, silicosis, hemosiderosis, fibrosing alveolitis, acute extrinsic allergic alveolitis, pulmonary eosinophilic syndrome, pulmonary alveolar proteinosis, and rarely in hematogenous metastases from the primary cancers of the thyroid, kidney, trophoblasts, and some sarcomas. Although very infrequent, miliary mottling can be seen in primary lung cancers. Herein, we report the case of a 28-year-old female with chest X-ray showing miliary mottling. Thoracic computed tomography (CT features were suggestive of tuberculoma with miliary tuberculosis. CT-guided fine needle aspiration cytology confirmed the diagnosis as lower-lobe, left lung non-small cell carcinoma (adenocarcinoma. It is rare for the non-small cell carcinoma of the lung to present as miliary mottling. The rarity of our case lies in the fact that a young, non-smoking female with miliary mottling was diagnosed with non-small cell carcinoma of the lung.

  4. Metabolic pathway redundancy within the apicomplexan-dinoflagellate radiation argues against an ancient chromalveolate plastid

    KAUST Repository

    Waller, Ross F.

    2015-12-08

    The chromalveolate hypothesis presents an attractively simple explanation for the presence of red algal-derived secondary plastids in 5 major eukaryotic lineages: “chromista” phyla, cryptophytes, haptophytes and ochrophytes; and alveolate phyla, dinoflagellates and apicomplexans. It posits that a single secondary endosymbiotic event occurred in a common ancestor of these diverse groups, and that this ancient plastid has since been maintained by vertical inheritance only. Substantial testing of this hypothesis by molecular phylogenies has, however, consistently failed to provide support for the predicted monophyly of the host organisms that harbour these plastids—the “chromalveolates.” This lack of support does not disprove the chromalveolate hypothesis per se, but rather drives the proposed endosymbiosis deeper into the eukaryotic tree, and requires multiple plastid losses to have occurred within intervening aplastidic lineages. An alternative perspective on plastid evolution is offered by considering the metabolic partnership between the endosymbiont and its host cell. A recent analysis of metabolic pathways in a deep-branching dinoflagellate indicates a high level of pathway redundancy in the common ancestor of apicomplexans and dinoflagellates, and differential losses of these pathways soon after radiation of the major extant lineages. This suggests that vertical inheritance of an ancient plastid in alveolates is highly unlikely as it would necessitate maintenance of redundant pathways over very long evolutionary timescales.

  5. Marine protist diversity in European coastal waters and sediments as revealed by high-throughput sequencing.

    Science.gov (United States)

    Massana, Ramon; Gobet, Angélique; Audic, Stéphane; Bass, David; Bittner, Lucie; Boutte, Christophe; Chambouvet, Aurélie; Christen, Richard; Claverie, Jean-Michel; Decelle, Johan; Dolan, John R; Dunthorn, Micah; Edvardsen, Bente; Forn, Irene; Forster, Dominik; Guillou, Laure; Jaillon, Olivier; Kooistra, Wiebe H C F; Logares, Ramiro; Mahé, Frédéric; Not, Fabrice; Ogata, Hiroyuki; Pawlowski, Jan; Pernice, Massimo C; Probert, Ian; Romac, Sarah; Richards, Thomas; Santini, Sébastien; Shalchian-Tabrizi, Kamran; Siano, Raffaele; Simon, Nathalie; Stoeck, Thorsten; Vaulot, Daniel; Zingone, Adriana; de Vargas, Colomban

    2015-10-01

    Although protists are critical components of marine ecosystems, they are still poorly characterized. Here we analysed the taxonomic diversity of planktonic and benthic protist communities collected in six distant European coastal sites. Environmental deoxyribonucleic acid (DNA) and ribonucleic acid (RNA) from three size fractions (pico-, nano- and micro/mesoplankton), as well as from dissolved DNA and surface sediments were used as templates for tag pyrosequencing of the V4 region of the 18S ribosomal DNA. Beta-diversity analyses split the protist community structure into three main clusters: picoplankton-nanoplankton-dissolved DNA, micro/mesoplankton and sediments. Within each cluster, protist communities from the same site and time clustered together, while communities from the same site but different seasons were unrelated. Both DNA and RNA-based surveys provided similar relative abundances for most class-level taxonomic groups. Yet, particular groups were overrepresented in one of the two templates, such as marine alveolates (MALV)-I and MALV-II that were much more abundant in DNA surveys. Overall, the groups displaying the highest relative contribution were Dinophyceae, Diatomea, Ciliophora and Acantharia. Also, well represented were Mamiellophyceae, Cryptomonadales, marine alveolates and marine stramenopiles in the picoplankton, and Monadofilosa and basal Fungi in sediments. Our extensive and systematic sequencing of geographically separated sites provides the most comprehensive molecular description of coastal marine protist diversity to date. PMID:26119494

  6. A culture-dependent survey of thermophilic bacteria from hot springs in Xiamen area in China

    Institute of Scientific and Technical Information of China (English)

    YANG Bo; OUYANG Jianping; AO Jingqun; CHEN Xinhua

    2009-01-01

    Microbes are believed to play important roles in ecosystem function in many environments. The hot springs of Xiamen Island are close to the Xiamen Sea, and may have some characteristics different from those of inland hot springs. Microbes living in the hot springs of Xiamen may have new characteristics. However, little is known about microbial communities of hot springs close to the Xiamen Sea. A cuhure-dependent survey of microbial population in the Xiamen hot springs was pcrformed by using an approach combining total cellular protein profile identification and 16S rRNA gene sequencing. A total of 328 isolates of bacteria were obtained from liquid and sediment samples from the Xiamen hot springs, including neutrophilie thermophilic bacteria and moderately thermophilic acidophiles. Neutrophilic thermophilic bacteria, which grow at a temperature range of 55-90℃ including Rhodothermus marinus (Strain 1) , Thermus thermophilus (Strain 2), Thermus thiopara (Strain 3) , Geobacillus stearothermophilus(Strain 4) , Geobacillus thermoleovorans (Strain 5) , and Pseudomonas pseudoal-caligenes (Strain 6), were recovered by 2216E plates. Moderately thermophilic acidophiles, which can grow at temperatures above 50℃ and a pH range of 1. 8-3.5 such as Alicyclobacillus acidoterrestris (Strain 8) , Sul-fobacillus acidophilus (Strain 9), and Sulfobacillus thermosulfidooxidans (Strain 10), were isolated on selective solid medium containing sulfur and Fe2+. Among these strains, Rhodothermus marinus, Thermus thermophilus and Geobacillus stearothermophilus are not only thermophilcs, but also halophiles. One bacterium strain (Strain 6) shared 99% nucleotide sequence homology with Pseudomonas pseudoalcaligenes on the 16S rRNA gene se-quence, but was quite different from Pseudomonas pseudoalcaligenes in biological characteristics, suggesting that it may represent a novel thermophilic species. Results indicated that various species of neutrophilic thermophiles and moderately thermophilic

  7. The weak link: do muscle properties determine locomotor performance in frogs?

    Science.gov (United States)

    Roberts, Thomas J; Abbott, Emily M; Azizi, Emanuel

    2011-05-27

    Muscles power movement, yet the conceptual link between muscle performance and locomotor performance is poorly developed. Frog jumping provides an ideal system to probe the relationship between muscle capacity and locomotor performance, because a jump is a single discrete event and mechanical power output is a critical determinant of jump distance. We tested the hypothesis that interspecific variation in jump performance could be explained by variability in available muscle power. We used force plate ergometry to measure power produced during jumping in Cuban tree frogs (Osteopilus septentrionalis), leopard frogs (Rana pipiens) and cane toads (Bufo marinus). We also measured peak isotonic power output in isolated plantaris muscles for each species. As expected, jump performance varied widely. Osteopilus septentrionalis developed peak power outputs of 1047.0 ± 119.7 W kg(-1) hindlimb muscle mass, about five times that of B. marinus (198.5 ± 54.5 W kg(-1)). Values for R. pipiens were intermediate (543.9 ± 96.2 W kg(-1)). These differences in jump power were not matched by differences in available muscle power, which were 312.7 ± 28.9, 321.8 ± 48.5 and 262.8 ± 23.2 W kg(-1) muscle mass for O. septentrionalis, R. pipiens and B. marinus, respectively. The lack of correlation between available muscle power and jump power suggests that non-muscular mechanisms (e.g. elastic energy storage) can obscure the link between muscle mechanical performance and locomotor performance. PMID:21502120

  8. AcEST: BP914120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_B02 546 Adiantum capillus-veneris mRNA. clone: YMU001_000042_B02. BP914120 - Show ... lni... 34 5.0 tr|Q7V595|Q7V595_PROMM CpeS homolog, phycoerythrin ... linker-protei... 33 6.5 tr|Q7RT32|Q7RT32_PLAYO Put ... AELSSEPR 177 >tr|Q7V595|Q7V595_PROMM CpeS homolog, phycoerythrin ... linker-proteins region OS=Prochlorococcus marinus ...

  9. Downstream migration of recently transformed sea lampreys before and after treatment of a Lake Michigan tributary with a lampricide

    Science.gov (United States)

    Hodges, John W.

    1972-01-01

    After the Pere Marquette River was treated with a lampricide in May 1964, the number of recently transformed sea lampreys (Petromyzon marinus) collected in the water-intake structure of a chemical plant near the mouth of the stream dropped 99.5%, from 13,913 (average for 1962-63 and 1963-64) to 76 (average for the next four migration seasons). Average length of the lampreys caught increased markedly after the treatment. In five of the six migration seasons, the catch of downstream migrants was higher in the fall than in the spring.

  10. An all-season trap for downstream-migrating fish and other aquatic organisms

    Science.gov (United States)

    McLain, Alberton; Manion, Patrick J.

    1967-01-01

    AN INVESTIGATION OF THE LARVAL STAGES OF THE SEA LAMPREY (Petromyzon marinus), which started in 1960, required a trap that could capture lamprey larvae moving downstream, and that would operate efficiently throughout the year. Sub zero temperatures in the winter and flooding during the spring were the most critical operational problems. Part of the trap was based on the principles of an inclined-plane trap described by Wolf (1951), but the design also incorporated features to prevent ice formation during the winter and to and to strain high flows during the spring runoff.

  11. Does copepod size determine food consumption of particulate feeding fish?

    DEFF Research Database (Denmark)

    Deurs, Mikael van; Koski, Marja; Rindorf, Anna

    2014-01-01

    on adult particulate feeding fish is unknown. In the present study, we investigated the hypothesis that the availability of the large copepods determines food consumption and growth conditions of lesser sandeel (Ammodytes marinus) in the North Sea. Analysis of stomach content suggested that food...... consumption is higher for fish feeding on large copepods, and additional calculations revealed how handling time limitation may provide part of the explanation for this relationship. Comparing stomach data and zooplankton samples indicated that lesser sandeel actively target large copepods when these are...

  12. AcEST: DK955746 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca ... 42 0.003 sp|Q6DCD5|TMTC2_XENLA Transmemb...33 + D +NLGI A + Y+ A K K + LG + Sbjct: 545 IQPD------FAAAWMNLGIVQNSLKRFEEAEQSYRTAIKHRRKYPDC... A K K + LG + Sbjct: 545 IQPD------FAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLN 598 Query: 434 DFRVAENALREAIALKPD...rococcus marinus (st... 91 7e-17 tr|A2CCD1|A2CCD1_PROM3 Putative uncharacterized ...HRAFKLLGSALYGIGDFRVAENALREAIALKPDFADAHCDLGSTLHALG 535 Y+EAA L P ++RA KLLGSAL+G+G++R A AL EAI LKPD+ADAHCDL S+

  13. Status Report of the Pacific Lamprey (Lampetra Trzdentata) in the Columbia River Basin.

    Energy Technology Data Exchange (ETDEWEB)

    Close, David A.; Parker, Blaine; James, gary

    1995-07-01

    The widespread decline of Pacific lamprey (Lampetra tridentata) in the Pacific Northwest, especially in the Columbia River system has led to concerns and questions from a number of regional agencies, Native American tribes, and the public. To address these concerns, new research efforts must focus on specific problems associated with this understudied species. The preservation and restoration of this species is critical for a number of reasons, including its importance to the tribes and its importance as an indicator of ecosystem health. Historically lamprey have been labeled a pest species due to the problems associated with the exotic sea lamprey, (Petromyzon marinus), invading the Great Lakes.

  14. AcEST: BP919731 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .38 sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosa... 34 0.49 sp|Q80TY4|ST18_MOUSE Suppression of tumori...hylococcu... 32 1.4 sp|O60284|ST18_HUMAN Suppression of tumorigenicity protein 18... Trigger factor OS=Prochlorococcus marinus (s... 32 2.4 sp|Q9QX27|ST18_RAT Suppression of tumorigenicity pro...Y4|ST18_MOUSE Suppression of tumorigenicity protein 18 OS=Mus musculus GN=St18 PE

  15. Differential effects of a local industrial sand lance fishery on seabird breeding performance

    DEFF Research Database (Denmark)

    Frederiksen, M.; Jensen, Henrik; Daunt, F.;

    2008-01-01

    Fisheries management across the world is moving toward an ecosystem-based approach, implying that fishery effects on nontarget species should be taken into account. However, such effects are often not well understood, partly because they can be difficult to distinguish from impacts of environmental...... fluctuations. We evaluated the effects of an industrial sand lance (Ammodytes marinus) fishery off the North Sea coast of the United Kingdom, which has been opened and closed in a quasi-experimental fashion, on sand-lance-dependent breeding seabirds. Controlling for environmental variation ( sea surface...... tool for future ecosystem-based fisheries management....

  16. NHE-1 sequence and expression in toad, snake and fish red blood cells

    DEFF Research Database (Denmark)

    Thomsen, Steffen Nyegaard; Wang, Tobias; Kristensen, Torsten

    Red blood cells (RBC) from reptiles appear not to express regulatory volume increase (RVI) upon shrinkage (Kristensen et al., 2008). In other vertebrates, the RVI response is primarily mediated by activation of the Na+/H+ exchanger (NHE-1) and we, therefore decided to investigate whether red cells...... of reptiles express a different NHE-1 that responds less to volume activation compared to other vertebrates or simply lack the Na+/H+ exchanger. Using various tissues from the ball python (Python regius), Cane toad (Bufo marinus) and European perch (Perca fluviatilis), cDNA libraries were created and...

  17. Phylogenetic positions of two marine ciliates, Metanophrys similis and Pseudocohnilembus hargisi (Protozoa, Ciliophora, Scuticociliatia), inferred from complete small subunit rRNA gene sequences

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The small subunit rRNA (SSrRNA) gene was sequenced for two marine scuticociliates Metanophrys similis and Pseudocohnilembus hargisi. The results show that this gene comprises 1763 and 1753 nucleotides in the two marine ciliates respectively.Metanophrys similis is phylogenetically closely related to the clade containing Mesanophrys carcini and Anophyroides haemophila, which branches basally to other species within the order Philasterida. Pseudocohnilembus hargisi groups with its congener, P. marinus, with strong bootstrap support. Paranophrys magna groups with the clade including Cohnilembus and Uronema, representing a sister clade to that containing the two Pseudocohnilembus species.

  18. Status report of the Pacific lamprey (Lampetra tridentata) in the Columbia River Basin

    International Nuclear Information System (INIS)

    The widespread decline of Pacific lamprey (Lampetra tridentata) in the Pacific Northwest, especially in the Columbia River system has led to concerns and questions from a number of regional agencies, Native American tribes, and the public. To address these concerns, new research efforts must focus on specific problems associated with this understudied species. The preservation and restoration of this species is critical for a number of reasons, including its importance to the tribes and its importance as an indicator of ecosystem health. Historically lamprey have been labeled a pest species due to the problems associated with the exotic sea lamprey, (Petromyzon marinus), invading the Great Lakes

  19. Dicty_cDB: Contig-U15213-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rochlorococcus marinus str. NAT... 95 4e-18 CP000937_1559( CP000937 |pid:none) Francisella philomiragi...:none) Methylobacterium nodulans ORS 2... 88 4e-16 AP006841_3263( AP006841 |pid:none) Bacteroides fragili...:none) Shewanella denitrificans OS217,... 105 4e-21 CP000115_205( CP000115 |pid:none) Nitrobacter winogra...:none) Lactobacillus gasseri ATCC 33323... 100 9e-20 AE014299_2458( AE014299 |pid:none) Shewanella oneide... sp. JS666, complete... 99 3e-19 AM902716_1733( AM902716 |pid:none) Bordetella petrii strain DSM 12... 99 3e

  20. An assessment of beaked redfish (S. mentella and S. fasciatus) in NAFO division 3M (with an approach to the likely impact of recent 3M cod growth on redfish natural mortality)

    OpenAIRE

    Ávila de Melo, A.; SABORIDO-REY Fran; González-Troncoso, Diana; Pochtar, Maria; Alpoim, R. (Ricardo)

    2011-01-01

    The 3M redfish assessment is focused on the beaked redfish, regarded as a management unit composed of two populations from two very similar species: the Flemish Cap S. mentella and S. fasciatus. The reason for this approach is the historical dominance of this group in the 3M redfish commercial catch until 2005. However a new golden redfish fishery (S. marinus) started on September 2005 on shallower depths of the Flemish Cap bank above 300m. This new reality implied a revision of c...

  1. Dicty_cDB: Contig-U14734-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y: 712 length of database: 5,674,871 effective HSP length: 16 effective length of quer...y: 696 effective length of database: 5,564,391 effective search space: 3872816136 effe...ia monocytogenes HCC23, c... 39 0.12 AD1417( AD1417 ) drug-efflux transporters homolog lmo2741 ...r 6b ... 39 0.16 CP000095_2138( CP000095 |pid:none) Prochlorococcus marinus str. NA... 39 0.16 AF1792( AF1792 ) drug-efflux tran...ktis ... 39 0.21 CP000238_242( CP000238 |pid:none) Baumannia ci

  2. Dicty_cDB: Contig-U05913-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK223250 |pid:none) Homo sapiens mRNA for cell divisio... 106 1e-21 CU928174_159( CU928174 |pid:none) Zygosacch...rysogenum Wiscons... 87 9e-16 CU928175_480( CU928175 |pid:none) Zygosacch...CU928176_17( CU928176 |pid:none) Zygosaccharomyces rouxii strain C... 45 0.006 AM...000552_6( CP000552 |pid:none) Prochlorococcus marinus str. MIT 9... 41 0.092 AE010299_1324( AE010299 |pid:none) Methanosarcina ac... Debaryomyces hansenii strain CBS... 41 0.092 AE010299_3605( AE010299 |pid:none) Methanosarcina acetivorans

  3. Estimation of feeding patterns for piscivorous fish using individual prey data from stomach contents

    DEFF Research Database (Denmark)

    Berg, Casper Willestofte; Temming, Axel

    2011-01-01

    The problem of estimating temporal feeding patterns using stomach data is considered, where the time of ingestion for each prey item can be predicted through a gastric evacuation model. The arrival of prey is modelled as a nonhomogeneous Poisson process with known periodic intensity. A maximum...... likelihood approach is used to estimate the intensity, which is assumed to be the same for all predators, incorporating different uncertainties for the arrival time of each prey item. The method is applied to a case where a population of whiting (Merlangius merlangus) is feeding on sandeel (Ammodytes marinus...

  4. Excitabilidad iterativa y actividad rítmica de los músculos estriados: contracción prosténica

    OpenAIRE

    Ordoñez, Hernando

    2011-01-01

    Se hace un estudio sobre la historia de la excitabilidad iterativa. Se relaciona la excitabilidad iterativa con la contracción prosténica. Se describen los caracteres de esta variedad de contracción muscular, a saber: contracción rítmica que aparece en el músculo gastrocnemio de varias clases de ranas, hyla labialis, rana esculenta, bufo marinus; excitación directa; la excitación repetida puede ser choques de inducción, descargas de condensadores, estimulación electrónica; la frecuencia de lo...

  5. Dicty_cDB: Contig-U09825-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne) Staphylothermus marinus F1, comp... 34 9.1 >AY421721_1( AY421721 |pid:none) Cryptococcus neoformans var. neofo...ne) Cryptococcus neoformans var. neofo... 162 2e-38 FM992691_439( FM992691 |pid:no...mosome 14 section 2... 38 0.20 12 ( DJ387414 ) Diagnosis of Diseases Associated with Apopto...37_4059( CP001037 |pid:none) Nostoc punctiforme PCC 73102, c... 61 7e-08 CP000301_762( CP000301 |pid:none) Rhodop...hizobium caulinodans ORS 571... 60 1e-07 CP000157_1522( CP000157 |pid:none) Erythrobacter litor

  6. Properties of Lactate Dehydrogenase in a Psychrophilic Marine Bacterium

    OpenAIRE

    Mitchell, P; Yen, H. C.; Mathemeier, P. F.

    1985-01-01

    Lactate dehydrogenase (EC 1.1.1.27) from Vibrio marinus MP-1 was purified 15-fold and ammonium activated. The optimum pH for pyruvate reduction was 7.4. Maximum lactate dehydrogenase activity occurred at 10 to 15 degrees C, and none occurred at 40 degrees C. The crude-extract enzyme was stable between 15 and 20 degrees C and lost 50% of its activity after 60 min at 45 degrees C. The partially purified enzyme was stable between 8 and 15 degrees C and lost 50% of its activity after 60 min at 30...

  7. AcEST: DK959640 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ences; 148,809,765 total letters Searching..................................................done Score E Seq...ldococcus jannaschii GN=MJ0052 PE=4 SV=1 Length = 222 Score = 32.3 bits (72), Expect =...nyl-tRNA synthetase OS=Prochlorococcus marinus (strain NATL2A) GN=argS PE=3 SV=1 Length = 607 Score = 32.0 bits (71), Expec...dicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_128722 PE=4 SV=1 Length = 197 Score...lis GN=nfrkb PE=2 SV=1 Length = 1265 Score = 35.4 bits (80), Expec

  8. AcEST: BP912565 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q00161|VG43_ICHV1 Uncharacterized gene 43 protein OS=Ictaluri... 29 9.9 sp|Q9USU9|TOA1_SCHPO Transcri...LYTTVYRNFYGLGDFLALVATSLHLDNIWPL 197 >sp|Q9USU9|TOA1_SCHPO Transcription initiatio...D_PROMS 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=isp...YMU001_000020_D06 487 Adiantum capillus-veneris mRNA. clone: YMU001_000020_D06. BP9...12565 - Show BP912565 Clone id YMU001_000020_D06 Library YMU01 Length 487 Definition Adiantum capillus-veneris

  9. The increasing of fibroblast growth factor 2, osteocalcin, and osteoblast due to the induction of the combination of Aloe vera and 2% xenograft concelous bovine

    Directory of Open Access Journals (Sweden)

    Utari Kresnoadi

    2012-12-01

    Full Text Available Background: To make a successfull denture prominent ridge is needed, preservation on tooth extraction socket is needed in order to prevent alveol bone resorption caused by revocation trauma. An innovative modification of the material empirically suspected to be able reduce inflammation caused by the revocation trauma is a combination of Aloe vera and xenograft concelous bovine (XCB and Aloe vera is a biogenic stimulator and accelerating the growth of alveolar ridge bone after tooth extraction. Purpose: The research was aimed to determine of the increasing alveol bone formation by inducing the combination of Aloe vera and 2% xenograft concelous bovine. Methods: To address the problems, the combination of Aloe vera and xenograft concelous bovine was induced into the tooth extraction sockets of Cavia cabayas which devided on 8 groups. Groups control, filled with XCB, Aloe vera and Aloe vera and XCB combination, at 7 days and 30 days after extraction. Afterwards, immunohistochemical examination was conducted to examine the expressions of FGF-2 and osteocalcin, as the product of the growth of osteoblasts. Results: There were significantly increases expression of FGF-2 and osteocalcyn on group which filled with XCB, Aloe vera and combined Aloe vera and XCB. Conclusion: It may be concluded that the induction of the combination of Aloe vera and xenograft concelous bovine into the tooth sockets can enhance the growth expressions of FGF-2 and osteocalcin as the product of osteoblasts, thus, the growth of alveolar bone was increased.Latar belakang: Untuk keberhasilan pembuatan gigitiruan diperlukan ridge yang prominent, maka diperlukan suatu preservasi soket pencabutan gigi untuk mencegah terjadinya resopsi tulang alveolar akibat trauma pencabutan. Suatu inovasi modifikasi bahan yang diduga secara empiris dapat mengurangi keradangan karena trauma pencabutan adalah berupa kombinasi Aloe vera dan xenograft concelous bovine (XCB. Aloe vera yang merupakan

  10. Active urea transport by the skin of Bufo viridis: Amiloride- and phloretin-sensitive transport sites

    International Nuclear Information System (INIS)

    Urea is actively transported inwardly (Ji) across the skin of the green toad Bufo viridis. Ji is markedly enhanced in toads adapted to hypertonic saline. The authors studied urea transport across the skin of Bufo viridis under a variety of experimental conditions, including treatment with amiloride and phloretin, agents that inhibit urea permeability in the bladder of Bufo marinus. Amiloride (10-4 M) significantly inhibited Ji in both adapted and unadapted animals and was unaffected by removal of sodium from the external medium. Phloretin (10-4 M) significantly inhibited Ji in adapted animals by 23-46%; there was also a reduction in Ji in unadapted toads at 10-4 and 5 x 10-4 M phloretin. A dose-response study revealed that the concentration of phloretin causing half-maximal inhibition (K1/2) was 5 x 10-4 M for adapted animals. Ji was unaffected by the substitution of sucrose for Ringer solution or by ouabain. They conclude (1) the process of adaptation appears to involve an increase in the number of amiloride- and phloretin-inhibitable urea transport sites in the skin, with a possible increase in the affinity of the sites for phloretin; (2) the adapted skin resembles the Bufo marinus urinary bladder with respect to amiloride and phloretin-inhibitable sites; (3) they confirm earlier observations that Ji is independent of sodium transport

  11. An investigation into intersex amphipods and a possible association with aquaculture.

    Science.gov (United States)

    Ford, Alex T; Read, Paul A; Jones, Tim L; Michino, Fumiko; Pang, Yvonne; Fernandes, Teresa F

    2007-10-01

    The amphipod, Echinogammarus marinus, is common in sheltered coastal inlets, such as estuaries and sea lochs, in Scotland and exhibits increased levels of intersex in some contaminated areas. Sea lochs are commonly the location for coastal aquaculture development, and some chemicals used in fish-farming are specifically designed to target the crustacean nervous system. Therefore it was hypothesised that these chemicals may also affect neuro-endocrine pathways, causing morphological and reproductive abnormalities in non-target Crustacea. Based upon this hypothesis, Echinogammarus marinus amphipods from two different Scottish sea lochs containing salmon farms were investigated. Morphology, intersexuality, and the incidence of microsporidian parasites were recorded at sites close and at distance from fish-farms. Results suggest a higher incidence of intersexuality at sites within sea lochs, comparable to that observed in industrially contaminated sites elsewhere in Scotland. The data suggest that fish farming activity may influence the observed distributions of intersexuality within lochs. Intersex specimens were more likely to be infected by microsporidian parasites than non-intersex specimens. Normal females were found more likely to be infected by microsporidian parasites at sites associated with high intersexuality, suggesting the parasite as the probable feminiser. The cause(s) for the observed patterns of intersexuality are unclear, although suggestions relating to discharges from fish farms are discussed. PMID:17499352

  12. Isolation, cultivation and genomic analysis of magnetosome biomineralization genes of a new genus of South-seeking magnetotactic cocci within the Alphaproteobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Morillo, Viviana [Universidade Federal do Rio de Janeiro; Abreu, Fernanda [Universidade Federal do Rio de Janeiro; Araujo, Ana C [Universidade Federal do Rio de Janeiro; de Almeida, Luiz G [Laboratorio Nacional de Computacao Cientifica; Enrich-Prast, Alex [Universidade Federal do Rio de Janeiro; Farina, Marcos [Universidade Federal do Rio de Janeiro; de Vasconcelos, Ana T [Laboratorio Nacional de Computacao Cientifica; Bazylinski, Dennis A [Ames Laboratory; Lins, Ulysses [Universidade Federal do Rio de Janeiro

    2014-01-01

    Although magnetotactic bacteria (MTB) are ubiquitous in aquatic habitats, they are still considered fastidious microorganisms with regard to growth and cultivation with only a relatively low number of axenic cultures available to date. Here, we report the first axenic culture of an MTB isolated in the Southern Hemisphere (Itaipu Lagoon in Rio de Janeiro, Brazil). Cells of this new isolate are coccoid to ovoid in morphology and grow microaerophilically in semi-solid medium containing an oxygen concentration ([O2]) gradient either under chemoorganoheterotrophic or chemolithoautotrophic conditions. Each cell contains a single chain of approximately 10 elongated cuboctahedral magnetite (Fe3O4) magnetosomes. Phylogenetic analysis based on the 16S rRNA gene sequence shows that the coccoid MTB isolated in this study represents a new genus in the Alphaproteobacteria; the name Magnetofaba australis strain IT-1 is proposed. Preliminary genomic data obtained by pyrosequencing shows that M. australis strain IT-1 contains a genomic region with genes involved in biomineralization similar to those found in the most closely related magnetotactic cocci Magnetococcus marinus strain MC-1. However, organization of the magnetosome genes differs from M. marinus.

  13. Gull contributions of phosphorus and nitrogen to a Cape Cod kettle pond

    Science.gov (United States)

    Portnoy, J.W.; Soukup, M.A.

    1990-01-01

    Nutrient excretion rates and the annual contribution of P from the feces of the gulls Larus argentatus and L. marinus (and of N from L. argentatus) to the nutrient budget of Gull Pond (Wellfleet), a soft water seepage lake, have been estimated. Intensive year-round gull counts by species were combined with determinations of defecation rate and the nutrient content of feces to quantitatively assess the P loading rates associated with regular gull use of this coastal pond on a seasonal and annual basis. Total P loading from gulls was estimated to be 52 kg yr?1, with 17 kg from L. argentatus and 35 kg from L. marinus, resulting from about 5.0 ? 106 h yr?1 and 1.7 ? 106 h yr?1 of pond use. This compares with P loading estimates of 67 kg yr?1 from upgradient septic systems, 2 kg yr?1 from precipitation and 3 kg yr?1 from unpolluted ground water. Fifty-six percent of annual gull P loading was associated with migratory activity in late fall. Estimated annual N loading by L. argentatus was 14 kg TKN, 206 g NO3-N, and 1.85 g g NH3-N.

  14. Specialized Hydrocarbonoclastic Bacteria Prevailing in Seawater around a Port in the Strait of Malacca.

    Directory of Open Access Journals (Sweden)

    Maki Teramoto

    Full Text Available Major degraders of petroleum hydrocarbons in tropical seas have been indicated only by laboratory culturing and never through observing the bacterial community structure in actual environments. To demonstrate the major degraders of petroleum hydrocarbons spilt in actual tropical seas, indigenous bacterial community in seawater at Sentosa (close to a port and East Coast Park (far from a port in Singapore was analyzed. Bacterial species was more diverse at Sentosa than at the Park, and the composition was different: γ-Proteobacteria (57.3% dominated at Sentosa, while they did not at the Park. Specialized hydrocarbonoclastic bacteria (SHCB, which use limited carbon sources with a preference for petroleum hydrocarbons, were found as abundant species at Sentosa, indicating petroleum contamination. On the other hand, SHCB were not the abundant species at the Park. The abundant species of SHCB at Sentosa were Oleibacter marinus and Alcanivorax species (strain 2A75 type, which have previously been indicated by laboratory culturing as important petroleum-aliphatic-hydrocarbon degraders in tropical seas. Together with the fact that SHCB have been identified as major degraders of petroleum hydrocarbons in marine environments, these results demonstrate that the O. marinus and Alcanivorax species (strain 2A75 type would be major degraders of petroleum aliphatic hydrocarbons spilt in actual tropical seas.

  15. Isolation and characterization of the Prochlorococcus carboxysome reveal the presence of the novel shell protein CsoS1D.

    Science.gov (United States)

    Roberts, Evan W; Cai, Fei; Kerfeld, Cheryl A; Cannon, Gordon C; Heinhorst, Sabine

    2012-02-01

    Cyanobacteria, including members of the genus Prochlorococcus, contain icosahedral protein microcompartments known as carboxysomes that encapsulate multiple copies of the CO(2)-fixing enzyme ribulose 1,5-bisphosphate carboxylase/oxygenase (RubisCO) in a thin protein shell that enhances the catalytic performance of the enzyme in part through the action of a shell-associated carbonic anhydrase. However, the exact mechanism by which compartmentation provides a catalytic advantage to the enzyme is not known. Complicating the study of cyanobacterial carboxysomes has been the inability to obtain homogeneous carboxysome preparations. This study describes the first successful purification and characterization of carboxysomes from the marine cyanobacterium Prochlorococcus marinus MED4. Because the isolated P. marinus MED4 carboxysomes were free from contaminating membrane proteins, their protein complement could be assessed. In addition to the expected shell proteins, the CsoS1D protein that is not encoded by the canonical cso gene clusters of α-cyanobacteria was found to be a low-abundance shell component. This finding and supporting comparative genomic evidence have important implications for carboxysome composition, structure, and function. Our study indicates that carboxysome composition is probably more complex than was previously assumed based on the gene complements of the classical cso gene clusters. PMID:22155772

  16. P67-phox (NCF2 lacking exons 11 and 12 is functionally active and leads to an extremely late diagnosis of chronic granulomatous disease (CGD.

    Directory of Open Access Journals (Sweden)

    Joachim Roesler

    Full Text Available Two brothers in their fifties presented with a medical history of suspected fungal allergy, allergic bronchopulmonary aspergillosis, alveolitis, and invasive aspergillosis and pulmonary fistula, respectively. Eventually, after a delay of 50 years, chronic granulomatous disease (CGD was diagnosed in the index patient. We found a new splice mutation in the NCF2 (p67-phox gene, c.1000 + 2T → G, that led to several splice products one of which lacked exons 11 and 12. This deletion was in frame and allowed for remarkable residual NADPH oxidase activity as determined by transduction experiments using a retroviral vector. We conclude that p67-phox which lacks the 34 amino acids encoded by the two exons can still exert considerable functional activity. This activity can partially explain the long-term survival of the patients without adequate diagnosis and treatment, but could not prevent progressing lung damage.

  17. Early aggressive intra-venous pulse cyclophosphamide therapy for interstitial lung disease in a patient with systemic sclerosis. A case report.

    LENUS (Irish Health Repository)

    Peshin, R

    2009-06-01

    Interstitial lung disease is an important cause of mortality and morbidity in patients with systemic sclerosis (SSc). There are currently no recommended guidelines for management of these patients. This is probably due to the rarity of this condition, as well as clinical trials with only a small number of cases. There are published case report and case series along with the two main trials, viz. Scleroderma Lung Study and the Fibrosing Alveolitis Study, but again, there is no consensus on treatment protocols. In this report, we present a case of aggressive interstitial lung disease in a patient with SSc, which improved dramatically on treatment with intra-venous cyclophosphamide and high dose prednisolone therapy.

  18. Aspergillus-Related Lung Disease

    Directory of Open Access Journals (Sweden)

    Alia Al-Alawi

    2005-01-01

    Full Text Available Aspergillus is a ubiquitous dimorphic fungus that causes a variety of human diseases ranging in severity from trivial to life-threatening, depending on the host response. An intact host defence is important to prevent disease, but individuals with pre-existing structural lung disease, atopy, occupational exposure or impaired immunity are susceptible. Three distinctive patterns of aspergillus-related lung disease are recognized: saprophytic infestation of airways, cavities and necrotic tissue; allergic disease including extrinsic allergic alveolitis, asthma, allergic bronchopulmonary aspergillosis, bronchocentric granulomatosis and chronic eosinophilic pneumonia; and airway and tissue invasive disease -- pseudomembranous tracheobronchitis, acute bronchopneumonia, angioinvasive aspergillosis, chronic necrotizing aspergillosis and invasive pleural disease. A broad knowledge of these clinical presentations and a high index of suspicion are required to ensure timely diagnosis and treatment of the potentially lethal manifestations of aspergillus-related pulmonary disease. In the present report, the clinical, radiographic and pathological aspects of the various aspergillus-related lung diseases are briefly reviewed.

  19. Pulmoner Hemosiderozisde Toraks BT Bulguları: Olgu Sunumu

    OpenAIRE

    Üner, Abdurrahman; Etlik, Ömer; Uzun, Kürşat; Temizöz, Osman; Gencer, Mehmet; UYGAN, İsmail

    2009-01-01

    SüleymanDemirel Üniversitesi TIP FAKÜLTESİ DERGİSİ: 2000 Mart; 7(1) Pulmoner Hemosiderozisde Toraks BT Bulguları: Olgu Sunumu Abdurrahman Üner, Ömer Etlik, Kürşat Uzun, Osman Temizöz, Mehmet Gencer, İsmail Uygan Özet: İdiopatik pulmoner hemosiderozis (IPH), akciğerde rekurren alveoler hemoraji, hemoptizi atakları ve demir eksikliği anemisi ile karekterize olan bir hastalıktır. Genellikle çocuklarda ve genç adultlarda görülür. İlk kez 4 ay önce öksürükle...

  20. The bifunctional dihydrofolate reductase thymidylate synthase of Tetrahymena thermophila provides a tool for molecular and biotechnology applications

    Directory of Open Access Journals (Sweden)

    Tiedtke Arno

    2006-03-01

    Full Text Available Abstract Background Dihydrofolate reductase (DHFR and thymidylate synthase (TS are crucial enzymes in DNA synthesis. In alveolata both enzymes are expressed as one bifunctional enzyme. Results Loss of this essential enzyme activities after successful allelic assortment of knock out alleles yields an auxotrophic marker in ciliates. Here the cloning, characterisation and functional analysis of Tetrahymena thermophila's DHFR-TS is presented. A first aspect of the presented work relates to destruction of DHFR-TS enzyme function in an alveolate thereby causing an auxotrophy for thymidine. A second aspect is to knock in an expression cassette encoding for a foreign gene with subsequent expression of the target protein. Conclusion This system avoids the use of antibiotics or other drugs and therefore is of high interest for biotechnological applications.

  1. Morphology, Ultrastructure and Life Cycle of Vitrella brassicaformis n. sp., n. gen., a Novel Chromerid from the Great Barrier Reef

    KAUST Repository

    Oborník, Miroslav

    2012-03-01

    Chromerida are photoautotrophic alveolates so far only isolated from corals in Australia. It has been shown that these secondary plastid-containing algae are closely related to apicomplexan parasites and share various morphological and molecular characters with both Apicomplexa and Dinophyta. So far, the only known representative of the phylum was Chromera velia. Here we provide a formal description of another chromerid, Vitrella brassicaformis gen. et sp. nov., complemented with a detailed study on its ultrastructure, allowing insight into its life cycle. The novel alga differs significantly from the related chromerid C. velia in life cycle, morphology as well as the plastid genome. Analysis of photosynthetic pigments on the other hand demonstrate that both chromerids lack chlorophyll c, the hallmark of phototrophic chromalveolates. Based on the relatively high divergence between C. velia and V. brassicaformis, we propose their classification into distinct families Chromeraceae and Vitrellaceae. Moreover, we predict a hidden and unexplored diversity of the chromerid algae. © 2011 Elsevier GmbH.

  2. Development and X-ray morphology of amiodarone pneumopathy. Die Entwicklung und Roentgenmorphologie der Amiodaronpneumopathie

    Energy Technology Data Exchange (ETDEWEB)

    Billmann, P. (Kreiskrankenhaus Lahr (Germany, F.R.). Radiologisches Inst.); Fleischmann, D. (Kreiskrankenhaus Lahr (Germany, F.R.). Kardiologische Klinik); Baumeister, L. (Sankt-Josefs-Krankenhaus, Offenburg am Main (Germany, F.R.). Radiologische Abt.)

    1991-04-01

    Besides general extracardiac physical side effects, the antiarrhythmic amiodarone hydrochloride gives rise to morphologically manifest organ changes. Pneumopathy has been reported in up to 8% of the patients treated with this preparation. Radiologically and histologically, the clinical picture can resemble that of exogenous allergic alveolitis. When the course is protracted there is interstitial fibrotic degeneration of the pulmonary parenchyma with a corresponding morphological correlate in the X-ray. The extent to which the changes observed result from dose-dependent toxicity of amiodarone has not been completely elucidated even now, since pulmonary changes suggestive of an immune process can occur even at low doses. When there is reason suspect the presence of amiodarone pneumopathy, the preparation should be discontinued. Radiological and clinical findings generally regress with cortisone treatment. (orig.).

  3. Development and X-ray morphology of amiodarone pneumopathy

    International Nuclear Information System (INIS)

    Besides general extracardiac physical side effects, the antiarrhythmic amiodarone hydrochloride gives rise to morphologically manifest organ changes. Pneumopathy has been reported in up to 8% of the patients treated with this preparation. Radiologically and histologically, the clinical picture can resemble that of exogenous allergic alveolitis. When the course is protracted there is interstitial fibrotic degeneration of the pulmonary parenchyma with a corresponding morphological correlate in the X-ray. The extent to which the changes observed result from dose-dependent toxicity of amiodarone has not been completely elucidated even now, since pulmonary changes suggestive of an immune process can occur even at low doses. When there is reason suspect the presence of amiodarone pneumopathy, the preparation should be discontinued. Radiological and clinical findings generally regress with cortisone treatment. (orig.)

  4. FIRST RECORD OF THE RARE MARINE REPTILE THOLODUS SCHMIDI FROM THE MIDDLE TRIASSIC OF THE SOUTHERN ALPS

    Directory of Open Access Journals (Sweden)

    FABIO MARCO DALLA VECCHIA

    2004-07-01

    Full Text Available Tholodus schmidi, a rare marine reptile of debated affinity and with a peculiar durophagous dentition, is for the first time recorded outside the Muschelkalk Basin of Central Europe. Parts of a mandibular ramus and a maxilla, both bearing teeth and nearly uncrushed, have been found in the upper Anisian (Balatonicus Subzone of northeastern Italy. The tooth implantation is relatively complex, with both "alveolate" and "ankylosed" teeth. Disarticulated postcranial bones of an ichthyosaur have been found close to, but not in articular association with, the dentigerous bones of Tholodus. The humerus resembles that of immature individuals of the Chinese genus Chaohusaurus. This association, and some features of teeth and dentigerous bones, suggests that Tholodus might be a grippiid ichthyosaur. 

  5. Subclinical pulmonary involvement in collagen vascular diseases

    International Nuclear Information System (INIS)

    A recruitment of immune and inflammatory cells into alveolar spaces has been reported in patients with collagen vascular diseases (CVD) and a normal chest radiograph. These findings defined the concept of subclinical alveolitis (SCA). To determine whether SCA may be associated with CT signs of interstitial lung disease (ILD), the authors of this paper compared bronchoalveolar lavage (BAL) findings and high-resolution (HRCT) scans in 36 patients with CVD and normal chest radiographs (systemic sclerosis [SS, n = 21], rheumatoid arthritis [RA, n = 9], primary Sjogren's syndrome [PS, n = 6]). HRCT scans were obtained in supine and prone positions. Results of BAL revealed SCA in 17/36 patients (47%); lymphocyte SCA in 4/36 (24%); neutrophil SCA in 7/36 (41%); and mixed SCA in 6/36 (35%)

  6. The Chinese Herbal Medicine Formula mKG Suppresses Pulmonary Fibrosis of Mice Induced by Bleomycin

    Directory of Open Access Journals (Sweden)

    Ying Gao

    2016-02-01

    Full Text Available Pulmonary fibrosis (PF is a serious progressive lung disease and it originates from inflammation-induced parenchymal injury with excessive extracellular matrix deposition to result in the destruction of the normal lung architecture. Modified Kushen Gancao Formula (mKG, derived from traditional Chinese herbal medicine, has a prominent anti-inflammatory effect. The present study is to explore the inhibitory effects of mKG on bleomycin (BLM-induced pulmonary fibrosis in mice. mKG significantly decreased pulmonary alveolitis, fibrosis scores, and interleukin-6 (IL-6, interleukin-17 (IL-17, transforming growth factor-β (TGF-β and hydroxyproline (HYP levels in lung tissue of mice compared with BLM treatment. It markedly alleviated the increase of HYP content in the lung tissues and pathologic changes of pulmonary fibrosis caused by BLM instillation. In conclusion, mKG has an anti-fibrotic effect and might be employed as a therapeutic candidate agent for attenuating pulmonary fibrosis.

  7. The respiratory effects of cobalt

    Energy Technology Data Exchange (ETDEWEB)

    Cugell, D.W.; Morgan, W.K.; Perkins, D.G.; Rubin, A. (Northwestern Univ. Medical School, Chicago, IL (USA))

    1990-01-01

    We studied seven subjects with certain manifestations of cobalt-induced lung disease. All worked with cobalt and were involved in either the production or use of hard metal. The mode of presentation varied from an acute hypersensitivity pneumonitis that cleared completely when exposure ceased to progressive severe interstitial fibrosis of the lungs. In one subject reexposure was followed by a recurrence of the symptoms. All subjects showed restrictive ventilatory impairment and a reduction of their diffusing capacity. The radiologic appearances varied greatly. While two subjects had clear roentgenograms with small lung volumes, others had a micronodular pattern or small blotchy nodular infiltrates, and one had diffuse reticulonodulation as is seen in cryptogenic fibrosing alveolitis. The pathologic appearances varied between desquamative interstitial pneumonia and overt mural fibrosis of the alveoli. Six of the seven patients had multinucleated giant cells in their biopsy specimens or bronchoalveolar lavage fluid.

  8. Cryptogenic organizing pneumonia after radiotherapy for breast cancer

    Directory of Open Access Journals (Sweden)

    Fumagalli Giorgio

    2010-12-01

    Full Text Available Abstract We report a case of fever, dyspnea, respiratory failure and migratory, recurrent and bilateral lung opacities 4 months after radiotherapy and hormone therapy following surgery for breast cancer. Computerized tomography (CT scans showed infiltrates outside the radiation fields. Bronchoalveolar lavage revealed lymphocytic alveolitis, whereas laboratory analysis demonstrated a mild systemic inflammation. Systemic steroids resulted in clinical and radiological improvement, but a disease relapse was evident at withdrawal of therapy, with definitive clinical and radiological normalization after a second cycle of therapy. This is a case of cryptogenic organizing pneumonia (COP (previously known as bronchiolitis obliterans organizing pneumonia primed by radiotherapy, as in previously reported cases. It is extremely important to be aware of the possibility of this complication, in order to optimize radiation and hormone treatment of breast cancer.

  9. The respiratory effects of cobalt

    International Nuclear Information System (INIS)

    We studied seven subjects with certain manifestations of cobalt-induced lung disease. All worked with cobalt and were involved in either the production or use of hard metal. The mode of presentation varied from an acute hypersensitivity pneumonitis that cleared completely when exposure ceased to progressive severe interstitial fibrosis of the lungs. In one subject reexposure was followed by a recurrence of the symptoms. All subjects showed restrictive ventilatory impairment and a reduction of their diffusing capacity. The radiologic appearances varied greatly. While two subjects had clear roentgenograms with small lung volumes, others had a micronodular pattern or small blotchy nodular infiltrates, and one had diffuse reticulonodulation as is seen in cryptogenic fibrosing alveolitis. The pathologic appearances varied between desquamative interstitial pneumonia and overt mural fibrosis of the alveoli. Six of the seven patients had multinucleated giant cells in their biopsy specimens or bronchoalveolar lavage fluid

  10. Smoking can be good for you.

    Science.gov (United States)

    Wolf, R; Orion, E; Matz, H; Maitra, S; Rowland-Payne, C

    2004-04-01

    Smoking is without doubt one of the greatest causes of avoidable illness and death in the modern world. Most well known is the relationship between smoking and numerous cancers, cerebrovascular and cardiovascular disease. Smoking and most especially nicotine, are, however, sometimes beneficial in certain diseases, including Parkinson's, Alzheimer's, allergic alveolitis, nausea and vomiting of pregnancy, pre-eclampsia, fibroids, carcinoma of body of uterus, ulcerative colitis, pyoderma gangrenosum, aphthous stomatitis and ulceration, pemphigus, herpes simplex and acne. In the immensely justifiable enthusiasm to discredit this dangerous activity, the mechanisms behind these beneficial effects tend to have been un-discussed or ignored. It is the aim of this paper to spur interest in the reasons for these effects. If the mechanisms are elucidated, therapeutic advances may be possible. PMID:17147565

  11. Pulmonary eosinophilia associated to treatment with natalizumab

    Directory of Open Access Journals (Sweden)

    Elena Curto

    2016-01-01

    Full Text Available Natalizumab (Tysabri® is a leukocytes chemotaxis inhibitor that decreases the leukocytes passage through the hematoencephalic barrier and it is currently used in relapsing-remitting forms of multiple sclerosis (MS. We present a patient with allergic rhinoconjunctivitis diagnosed with MS who started treatment with natalizumab. She began to show mild asthmatic symptoms until she needed admission to the hospital due to respiratory insufficiency. Blood tests showed peripheral eosinophilia and the thoracic computed tomography scan demonstrated pulmonary infiltrates. The bronchoscopy with the bronchoalveolar lavage resulted in eosinophilic alveolitis. No evidence of bacterial, fungal and parasitic infection, connective tissue disease, or vasculitis were observed. After discontinuation of natalizumab, the patient improved without other treatments. As MS is a prevalent disease and the use of natalizumab is increasing, we consider important to point out that this drug can be associated with pulmonary eosinophilia, especially in patients with allergic rhinoconjunctivitis or asthma.

  12. Morphological nutlet characteristics of some lamiaceae Taxa in Saudi Arabia and their taxonomic significance

    International Nuclear Information System (INIS)

    The nutlet characters in the Lamiaceae are of great taxonomic significance. Macro and micro morphology nutlets of 23 taxa belonging to 12 genera of Lamiaceae from Al-Taif, Saudi Arabia have been studied for the first time by both light and scanning electron microscope. Observations revealed that nutlet color, shape, size, presence of areole are of limited taxonomic value. However the pericarp sculpturing are the most important diagnostic characters for differentiating the species through a constructed key. Three main distinct types of nutlets sculpture can be distinguished; smooth, partly sculptured and sculptured, within these types 12 subtypes are also recognized (reticulate, reticulate-foveate alveolate, granulate, rugose-scalariform, favulariate, protuberance, colliculate, ruminate, ocellate, verrucate and tuberculate). The relationships between the studied taxa were demonstrated as a phenogram. (author)

  13. KİŞİYE ÖZEL DENTAL İMPLANT ABUTMENTLARI

    OpenAIRE

    ÖZTÜRK, Özgür

    2015-01-01

    ÖZETDişsiz alanların implant destekli protez ile restorasyonu günümüzde konvansiyonel protetik tedavilere karşı geçerli bir tedavi seçeneği haline gelmiştir. İmplant destekli restorasyonların başarısında implant ile restorasyon arasındaki bağlantı oldukça önemlidir. Diş çekim sonrası alveol kemiği ve yumuşak dokuda oluşan değişiklikler kişiden kişiye fark etmektedir. Bu nedenle her vakada prefabrike abutmentlar ile uygun bağlantı ve yumuşak doku konturu elde edilememektedir. Bu durumlarda kiş...

  14. Clearance of inhaled technetium-99m-DTPA as a clinical index of pulmonary vascular disease in systemic sclerosis

    Energy Technology Data Exchange (ETDEWEB)

    Kon, O.M.; Daniil, Z.; Bois, R.M. du [Royal Brompton Hospital, Interstitial Lung Disease Unit, London (United Kingdom); Black, C.M. [Royal Free Hospital, Dept. of Rheumatology, London (United Kingdom)

    1999-01-01

    This study evaluated the utility of the clearance time of inhaled diethylenetriamine pentaacetate (DTPA) to distinguish pulmonary vascular disease from early fibrosing alveolitis (FA) in patients with systemic sclerosis (SSc) It was hypothesized that this would be preserved in patients with vascular disease compared with FA, despite similar gas-transfer deficits and matching lung volumes, because of the preservation of alveolar epithelial integrity. All patients had SSc and were categorized into a control group (C; n=9), pulmonary vascular group (VAS; n=14) or FA group (n=14) dependent on the appearance on a computed tomography (CT) scan and the transfer factor of the lung for carbon monoxide (TL,CO) (VAS and FA {<=}70%, C {>=}80%). All patients had a forced vital capacity (FVC) of >80%. The TL,CO (median) was similar in the VAS (57.5%) and FA (60%) groups. There was a significant difference in median DTPA clearance half-times between FA (21.25 min) and VAS (46.5 min) (p=0.014) and between FA and C (84.5 min) (p=0.0004). No difference was found between VAS and C (p=0.0778). Follow-up data from the VAS group showed no subsequent development of FA on the CT scan and no decrease in FVC (n=13, mean 42 months). These results suggest that clearance of diethylenetriamine pentaacetate is preserved in patients likely to have pulmonary vascular disease and may be useful in distinguishing fibrosing alveolitis from vascular disease in systemic sclerosis. (au) 22 refs.

  15. Seasonal population dynamics and trophic role of planktonic nanoflagellates in coastal surface waters of the Southern Baltic Sea.

    Science.gov (United States)

    Piwosz, Kasia; Pernthaler, Jakob

    2010-02-01

    We investigated the temporal dynamics and trophic role of different nanoflagellates in surface waters of the Gulf of Gdańsk (Baltic Sea) between April and October 2007. Two 18S rRNA gene clone libraries were constructed from samples collected in spring and summer, and weekly changes in the abundances of five phylogenetic groups were studied by fluorescence in situ hybridization with newly designed probes. Stramenopiles affiliated with MAST-6 and Pedinellales were most numerous in spring but rare in summer. Both groups formed short-lived blooms during a sudden drop of salinity due to riverine influx (from 7.1 to 6.2 practical salinity units). The analysis of food vacuole content suggested that MAST-6 nanoflagellates were herbivorous, whereas bacterivory was found both in plastidic and aplastidic pedinellid populations. Members of an uncultured lineage of aplastidic, bacterivorous cercozoans distantly related to Ebria tripartita were more abundant in summer when water temperatures exceeded 17 degrees C. Multicellular trophonts and/or free-living single cell stages of two lineages of Group 1 parasitic Syndiniales (alveolates) were present in spring and early summer. One of these alveolate populations repeatedly peaked before and after the freshwater influx, but was conspicuously absent throughout the period of decreased salinity. Our results indicate that nanoflagellate populations in coastal surface waters may form short-lived blooms that can only be detected by high-frequency sampling, and that may be related both to seasonal development and to sporadic (e.g. mixing) events. In view of their trophic diversity we moreover suggest that nanoflagellates in eutrophic coastal waters should not be regarded as a single functional unit. PMID:19799618

  16. Diversity and distribution of microbial eukaryotes in the deep tropical and subtropical North Atlantic Ocean

    Science.gov (United States)

    Morgan-Smith, Danielle; Clouse, Melissa A.; Herndl, Gerhard J.; Bochdansky, Alexander B.

    2013-08-01

    Employing a combination of 4',6-diamidino-2-phenylindole and fluorescein isothiocyanate (DAPI-FITC) staining and catalyzed reporter deposition fluorescence in situ hybridization (CARD-FISH), we distinguished a variety of taxonomic and morphological types of eukaryotic microbes in the central and deep water masses of the tropical and subtropical North Atlantic Ocean. Samples were taken along a transect across the tropical Atlantic, along the equatorial upwelling and into the West-African upwelling region. Samples were collected as deep as 7000 m in the Romanche Fracture Zone within the Mid-Atlantic Ridge. Approximately 50-70% of FISH-identified eukaryotes in deep water masses belong to one of seven groups: kinetoplastids, labyrinthulomycetes, fungi, diplonemids, group II alveolates, MAST 4 (stramenopiles), and an unidentified organism with a peculiar nuclear morphology. A smaller percentage of total eukaryotes was identified in the Central Water, especially in the oxygen minimum zone, than in deep water masses. CARD-FISH probes designed to identify broad taxonomic groups revealed kinetoplastids and fungi were more abundant than noted in previous studies employing 18S rRNA gene clone libraries. Group II alveolates, in contrast, were much less prevalent than previously reported. On a second survey, eukaryotic microbes were enumerated in the deep-sea basins below the North Atlantic subtropical gyre including the Vema Fracture Zone, which is another prominent trench in the Mid-Atlantic Ridge. The abundance of eukaryotes and chlorophyll concentrations were significantly different between the two cruises, which covered very different hydrographic regimes with associated high and low levels of primary production, respectively.

  17. Artesunate modulates expression of matrix metalloproteinases and their inhibitors as well as collagen-IV to attenuate pulmonary fibrosis in rats.

    Science.gov (United States)

    Wang, Y; Huang, G; Mo, B; Wang, C

    2016-01-01

    The aim of this study was to determine the effect of artesunate on extracellular matrix (ECM) accumulation and the expression of collagen-IV, matrix metalloproteinase (MMP), and tissue inhibitor of matrix metalloproteinase (TIMP) to understand the pharmacological role of artesunate in pulmonary fibrosis. Eighty Sprague-Dawley rats were randomly assigned to four groups that were administered saline alone, bleomycin (BLM) alone, BLM + artesunate, or artesunate alone for 28 days. Lung tissues from 10 rats in each group were used to obtain lung fibroblast (LF) primary cells, and the rest were used to analyze protein expression. The mRNA expression of collagen-IV, MMP-2, MMP-9, TIMP-1, and TIMP-2 in lung fibroblasts was detected by real-time quantitative reverse transcriptase polymerase chain reaction. The protein levels of collagen-IV, MMP-2, MMP-9, TIMP-1, and TIMP-2 protein in lung tissues were analyzed by western blotting. Artesunate treatment alleviated alveolitis and pulmonary fibrosis induced by bleomycin in rats, as indicated by a decreased lung coefficient and improvement of lung tissue morphology. Artesunate treatment also led to decreased collagen-IV protein levels, which might be a result of its downregulated expression and increased MMP-2 and MMP-9 protein and mRNA levels. Increased TIMP-1 and TIMP- 2 protein and mRNA levels were detected after artesunate treatment in lung tissues and primary lung fibroblast cells and may contribute to enhanced activity of MMP-2 and -9. These findings suggested that artesunate attenuates alveolitis and pulmonary fibrosis by regulating expression of collagen-IV, TIMP-1 and 2, as well as MMP-2 and -9, to reduce ECM accumulation. PMID:27323108

  18. A case study for effects of operational taxonomic units from intracellular endoparasites and ciliates on the eukaryotic phylogeny: phylogenetic position of the haptophyta in analyses of multiple slowly evolving genes.

    Directory of Open Access Journals (Sweden)

    Hisayoshi Nozaki

    Full Text Available Recent multigene phylogenetic analyses have contributed much to our understanding of eukaryotic phylogeny. However, the phylogenetic positions of various lineages within the eukaryotes have remained unresolved or in conflict between different phylogenetic studies. These phylogenetic ambiguities might have resulted from mixtures or integration from various factors including limited taxon sampling, missing data in the alignment, saturations of rapidly evolving genes, mixed analyses of short- and long-branched operational taxonomic units (OTUs, intracellular endoparasite and ciliate OTUs with unusual substitution etc. In order to evaluate the effects from intracellular endoparasite and ciliate OTUs co-analyzed on the eukaryotic phylogeny and simplify the results, we here used two different sets of data matrices of multiple slowly evolving genes with small amounts of missing data and examined the phylogenetic position of the secondary photosynthetic chromalveolates Haptophyta, one of the most abundant groups of oceanic phytoplankton and significant primary producers. In both sets, a robust sister relationship between Haptophyta and SAR (stramenopiles, alveolates, rhizarians, or SA [stramenopiles and alveolates] was resolved when intracellular endoparasite/ciliate OTUs were excluded, but not in their presence. Based on comparisons of character optimizations on a fixed tree (with a clade composed of haptophytes and SAR or SA, disruption of the monophyly between haptophytes and SAR (or SA in the presence of intracellular endoparasite/ciliate OTUs can be considered to be a result of multiple evolutionary reversals of character positions that supported the synapomorphy of the haptophyte and SAR (or SA clade in the absence of intracellular endoparasite/ciliate OTUs.

  19. Clearance of inhaled technetium-99m-DTPA as a clinical index of pulmonary vascular disease in systemic sclerosis

    International Nuclear Information System (INIS)

    This study evaluated the utility of the clearance time of inhaled diethylenetriamine pentaacetate (DTPA) to distinguish pulmonary vascular disease from early fibrosing alveolitis (FA) in patients with systemic sclerosis (SSc) It was hypothesized that this would be preserved in patients with vascular disease compared with FA, despite similar gas-transfer deficits and matching lung volumes, because of the preservation of alveolar epithelial integrity. All patients had SSc and were categorized into a control group (C; n=9), pulmonary vascular group (VAS; n=14) or FA group (n=14) dependent on the appearance on a computed tomography (CT) scan and the transfer factor of the lung for carbon monoxide (TL,CO) (VAS and FA ≤70%, C ≥80%). All patients had a forced vital capacity (FVC) of >80%. The TL,CO (median) was similar in the VAS (57.5%) and FA (60%) groups. There was a significant difference in median DTPA clearance half-times between FA (21.25 min) and VAS (46.5 min) (p=0.014) and between FA and C (84.5 min) (p=0.0004). No difference was found between VAS and C (p=0.0778). Follow-up data from the VAS group showed no subsequent development of FA on the CT scan and no decrease in FVC (n=13, mean 42 months). These results suggest that clearance of diethylenetriamine pentaacetate is preserved in patients likely to have pulmonary vascular disease and may be useful in distinguishing fibrosing alveolitis from vascular disease in systemic sclerosis. (au)

  20. Alterations in pulmonary surfactant protein a metabolism and its diagnostic value in onset of radiation pneumonitis

    International Nuclear Information System (INIS)

    Radiation pneumonitis (RP) is a serious disorder caused by radiation therapy, for the detection of which there exists no simple and sensitive clinical examination. In this study, we examined whether the measurement of serum pulmonary surfactant protein A (SP-A) levels could be effective for detecting the onset of RP. Of the 18 patients included in the study, 9 suffered RP complication after radiation therapy. Serum SP-A levels in patients with RP (64.1±6.5 ng/ml) were 1.82 times as high as those of pre-radiation (36.2±4.0 ng/ml). The difference between them was significant (p=0.0003), while the SP-A value in patients without RP after radiation therapy was almost the same as the pre-radiation level. To study the mechanisms of these elevations, we developed a model of whole lung irradiation (20 Gy) in adult rats. Prior to alveolitis, which was a histological change seen at day 28, levels of SP-A in lung tissue homogenates and bronchoalveolar lavage fluid had become elevated by day 21. Serum SP-A levels in the irradiated rats were significantly elevated by day 21, peaking at day 35, and then declined. Hydroxyproline contents in lung tissues were elevated by day 42 and remained so through day 56. Therefore, the increase in serum SP-A level may be reflected by alveolitis but not fibrosis. In conclusion, determination of serum SP-A could be helpful in detecting the onset of RP. (author)

  1. Atrofik maksillanın iliak greft kullanılarak gerçekleştirilen kemik augmentasyonunu takiben uygulanan implant tedavisi: Olgu sunumu

    Directory of Open Access Journals (Sweden)

    Ufuk Tatlı

    2013-01-01

    Full Text Available

    Alveolar bone resorption which occurs as a result of teeth extraction or periodontal disease causes functional and esthetic problems. In case of severe jaw-bone atrophy, bone augmentation procedures are becoming necessary prior to implant placement. During the planning of such cases, cone-beam computed tomography (CBCT examination provides detailed qualitative and quantitative data about maxillofacial bones with reduced radiation exposure. This article illustrated the implant treatment of a patient with severe atrophic maxilla following bone augmentation using iliac graft in the light of CBCT examination with 2-year of follow-up.

    Keywords: Alveolar atrophy, alveolar augmentation, CBCT, iliak graft, implant treatment.

     

    ÖZET

    Diş çekimi veya periodontal harabiyet sonucu oluşan alveoler kemik rezorpsiyonu, estetik ve fonksiyonel problemlere neden olur. İleri düzeyde çene kemiği atrofisi gözlenen durumda implant tedavisi öncesinde augmentasyon işlemleri kaçınılmaz olmaktadır. Bu tür olguların planlanmasında konik hüzmeli bilgisayarlı tomografi incelemesi çene-yüz kemikleri hakkında detaylı kalitatif ve kantitatif verileri, düşük radyasyon dozu eşliğinde sağlamaktadır. Bu makalede, maksillada ileri düzeyde alveoler kemik atrofisi bulunan bir hastada, CBCT incelemesi ışığında, iliak greft kullanılarak yapılan kemik augmentasyon işlemleri ve sonrasında uygulanan implant tedavisi 2 yıllık takibi eşliğinde sunulmuştur.

  2. 2005 dossier: clay. Tome: architecture and management of the geologic disposal facility

    International Nuclear Information System (INIS)

    This document makes a status of the researches carried out by the French national agency of radioactive wastes (ANDRA) about the design of a geologic disposal facility for high-level and long-lived radioactive wastes in argilite formations. Content: 1 - approach of the study: goal, main steps of the design study, iterative approach, content; 2 - general description: high-level and long-lived radioactive wastes, purposes of a reversible disposal, geologic context of the Meuse/Haute-Marne site - the Callovo-Oxfordian formation, design principles of the disposal facility architecture, role of the different disposal components; 3 - high-level and long-lived wastes: production scenarios, description of primary containers, inventory model, hypotheses about receipt fluxes of primary containers; 4- disposal containers: B-type waste containers, C-type waste containers, spent fuel disposal containers; 5 - disposal modules: B-type waste disposal modules, C-type waste disposal modules, spent-fuel disposal modules; 6 - overall underground architecture: main safety questions, overall design, dimensioning factors, construction logic and overall exploitation of the facility, dimensioning of galleries, underground architecture adaptation to different scenarios; 7 - boreholes and galleries: general needs, design principles retained, boreholes description, galleries description, building up of boreholes and galleries, durability of facilities, backfilling and sealing up of boreholes and galleries; 8 - surface facilities: general organization, nuclear area, industrial and administrative area, tailings area; 9 - nuclear exploitation means of the facility: receipt of primary containers and preparation of disposal containers, transfer of disposal containers from the surface to the disposal alveoles, setting up of containers inside alveoles; 10 - reversible management of the disposal: step by step disposal process, mastery of disposal behaviour and action capacity, observation and

  3. Dicty_cDB: Contig-U09811-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4055_1( D64055 |pid:none) Petromyzon marinus mRNA for LMPX of la... 33 5.8 EF558549_25( EF558549 |pid:none) Halorubr...hanobrevibacter smithii ATCC... 36 0.69 FJ866624_1( FJ866624 |pid:none) Citrus maxima 20S proteasome bet... DSM 30... 33 4.5 EF584011_1( EF584011 |pid:none) Brassica rapa clone P2 hypothetica... 33 4.5 CP000504_746(...2_1( AY542982 |pid:none) Bigelowiella natans proteasome bet... 108 1e-22 AM910984_53( AM910984 |pid:none) Plasmodium knowlesi stra...00 2e-20 (Q9Y7T8) RecName: Full=Probable proteasome subunit beta type-3; ... 100 2e-20 BC049010_1( BC049010

  4. Dicty_cDB: Contig-U05104-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 75 |pid:none) Homo sapiens erbb2 interacting pro... 55 2e-06 BX908798_38( BX908798 |pid:none) Parachlamydia-related symbio...13 ( AC116963 ) Dictyostelium discoideum chromosome 2 map 4657875... 38 8e-04 13 ( BA000021 ) Wigglesworthia glossinidia endosymbio... CTD-2122K7, compl... 36 0.26 8 ( CP000993 ) Borrelia recurrentis A1, complete genome. 34 0.26 18 ( U42597 ) Dictyostelium di...ence from clone CH73-64P10 in l... 46 0.006 5 ( EU677193 ) Oedogonium cardiacum strain SAG 575-1b chloroplas...ococcus marinus MED4 complete genome. 36 0.016 19 ( CP001205 ) Borrelia burgdor

  5. Growth, age at metamorphosis, and sex ratio of northern brook lamprey in a tributary of southern Lake Superior

    Science.gov (United States)

    Purvis, Harold A.

    1970-01-01

    Growth was studied of five year classes of the northern brook lamprey, Ichthyomyzon fossor, collected from the Sturgeon River during intervals between treatment of the stream with a lampricide. Growth varied considerably among year classes. Larvae of the 1963 year class were slightly longer at age II and 30% longer at age III than the III-group larvae of the 1960 year class. About 6% of 558 III-group lampreys of the 1963 year class had metamorphosed by 17 August 1966. Although the sex ratio of larvae was about 1:1, 97% of the metamorphosed lampreys were males. The distribution of pigmentation on the caudal fin and upper lip in ammocoetes less than 40 mm long permitted accurate and rapid separation of northern brook lampreys from the sea lamprey, Petromyzon marinus.

  6. A portable trap with electric lead catches up to 75% of an invasive fish species

    Science.gov (United States)

    Johnson, Nicholas S.; Miehls, Scott; O’Connor, Lisa M.; Bravener, Gale; Barber, Jessica; Thompson, Henry; Tix, John A.; Bruning, Tyler

    2016-01-01

    A novel system combining a trap and pulsed direct current electricity was able to catch up to 75% of tagged invasive sea lamprey Petromyzon marinus in free-flowing streams. Non-target mortality was rare and impacts to non-target migration were minimal; likely because pulsed direct current only needed to be activated at night (7 hours of each day). The system was completely portable and the annual cost of the trapping system was low ($4,800 U.S. dollars). Use of the technology is poised to substantially advance integrated control of sea lamprey, which threaten a fishery valued at 7 billion U.S. dollars annually, and help restore sea lamprey populations in Europe where they are native, but imperiled. The system may be broadly applicable to controlling invasive fishes and restoring valued fishes worldwide, thus having far reaching effects on ecosystems and societies. PMID:27341485

  7. Spatial patterns and trends in abundance of larval sandeels in the North Sea: 1950–2005

    DEFF Research Database (Denmark)

    Lynam, Christopher P.; Halliday, Nicholas C.; Höffle, Hannes;

    2013-01-01

    Early recruitment indices based on larval fish data from the Continuous Plankton Recorder (CPR) have the potential to inform stock assessments of Ammodytes marinus in the North Sea. We evaluate whether the CPR data are reliable for sandeel larvae. Spatially, CPR larval data were comparable with...... catches by dedicated larval samplers (Gulf and bongo nets) during ICES coordinated surveys in 2004 and 2009. ICES data are also used to explore environmental influences on sandeel distributions. Temporally, CPR data correlate with larval data from plankton surveys off Stonehaven (1999–2005), with sandeel...... 0-group trawl data at the east Fair Isle ground (since 1984), and with recruitment data (since 1983) for the Dogger Banks stock assessment area. Therefore, CPR data may provide an early recruit index of relative abundance for the Dogger Banks assessment area, where the majority of the commercial...

  8. Dicty_cDB: Contig-U12103-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Prochlorococcus marinus str. AS9... 96 3e-18 AY057845_38( AY057845 |pid:none) Zymomonas mobili...962( AM263198 |pid:none) Listeria welshimeri serovar 6b s... 94 2e-17 CP000879_1482( CP000879 |pid:none) Petrotoga mobili...( AY427777 |pid:none) Canis familiaris isolate AS22 ABCA... 141 8e-32 AY028899_1( AY028899 |pid:none) Homo sapiens ATP-bi..._1961( CP000885 |pid:none) Clostridium phytofermentans ISD... 102 3e-20 CP000117_418( CP000117 |pid:none) Anabaena variabili...acter thermautotr... 98 7e-19 CP001034_1544( CP001034 |pid:none) Natranaerobius thermophil

  9. Dicty_cDB: Contig-U05345-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .073 (Q4V8I7) RecName: Full=Leucine-rich repeat-containing protein 8A... 41 0.073 CP001574_677( CP001574 |pid:none) Micromon...ngylocentrotus purpuratus clone R3-44M22, WOR... 50 0.17 1 ( CP000552 ) Prochlorococcus marinus str... ) rf50d06.y2 Meloidogyne hapla J2 pAMP1 v1 Meloidog... 42 5.3 2 ( AM177607 ) Lycopersicon esculentum mRNA for putr...e) Magnetococcus sp. MC-1, complete... 36 0.066 CP001325_782( CP001325 |pid:none) Micromonas sp. RCC299 chro...=Leucine-rich repeat-containing protein 1;... 36 2.4 AJ276703_1( AJ276703 |pid:none) Aspergillus fumi

  10. Dicty_cDB: Contig-U01204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension...: 2 Number of Hits to DB: 38,251 Number of Sequences: 8361 Number of extensions: 38251 Number of successful extensions...DB: 1,094,584,214 Number of extensions: 74969121 Number of successful extensions: 8972648 Number of sequence...cose cotransporter 5; AltName: ... 35 2.8 CP000095_482( CP000095 |pid:none) Prochlorococcus marinus... s... 34 8.0 CP000609_237( CP000609 |pid:none) Methanococcus maripaludis C5, co... 34 8.0 BT084018_1( BT084018 |pid:none) Zea ma

  11. Dicty_cDB: SSH604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Macaca fascicularis brain cDNA clo... 52 1e-05 AB292479_1( AB292479 |pid:none) Amoeba proteus AQP gene for aquapo...ant alignments: (bits) Value AF218314_1( AF218314 |pid:none) Aedes aegypti aquapo...AF020620_1( AF020620 |pid:none) Bufo marinus aquaporin-1 homolog (... 57 4e-07 EU673709_1( EU673709 |pid:non...n; &AE013599_1356(AE013599|pid:n... 54 3e-06 AB458833_1( AB458833 |pid:none) Bombyx mori aqp mRNA for aquapo...rin... 54 5e-06 EU939753_1( EU939753 |pid:none) Saccoglossus kowalevskii aquaporin... 52 1e-05 AB170709_1( AB170709 |pid:non

  12. Spatio-temporal dynamics of growth and survival of Lesser Sandeel early life-stages in the North Sea: Predictions from a coupled individual-based and hydrodynamic-biogeochemical model

    DEFF Research Database (Denmark)

    Gurkan, Zeren; Christensen, Asbjørn; Maar, Marie; Møller, Eva Friis; Madsen, Kristine Skovgaard; Munk, Peter; Mosegaard, Henrik

    2013-01-01

    Accounting for the individual variability and regional variations are important when predicting recruitment in fish species. Spatially explicit descriptions for recruitment in sandeels are necessary and sandeel growth and survival depend locally on zooplankton prey. We investigate the responses of...... larval and early juvenile Lesser Sandeel (Ammodytes marinus) in the North Sea to local feeding conditions by an adapted version of a generic bioenergetic individual-based model for larval fish describing growth and survival. Prey encounter and physiological processes are described explicitly in the model......, which allows analyzing the influence of prey on the growth and survival of sandeel. The model is coupled to a hydrodynamic-biogeochemical model with physical and prey fields and implemented in temporal and three-dimensional spatial settings. Zooplankton biomass simulated by the biogeochemical model is...

  13. Dicty_cDB: Contig-U15751-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5( CP000113 |pid:none) Myxococcus xanthus DK 1622, com... 84 3e-14 AE014292_924( AE014292 |pid:none) Brucella... 3e-14 AE008918_335( AE008918 |pid:none) Brucella melitensis 16M chromoso... 84 3e-14 CP000951_2520( CP000951 |pid:none) Synechococc...obium phaeobacteroides DSM ... 88 2e-15 CP000709_795( CP000709 |pid:none) Brucella ovis ATCC 25840 chromos..... suis 1330 chromosome II... 84 3e-14 CP000888_240( CP000888 |pid:none) Brucella abortus S19 chromosome ... ... |pid:none) Prochlorococcus marinus str. MI... 73 6e-11 CP001280_2233( CP001280 |pid:none) Methylocella silv

  14. Squalamine as a broad-spectrum systemic antiviral agent with therapeutic potential.

    Science.gov (United States)

    Zasloff, Michael; Adams, A Paige; Beckerman, Bernard; Campbell, Ann; Han, Ziying; Luijten, Erik; Meza, Isaura; Julander, Justin; Mishra, Abhijit; Qu, Wei; Taylor, John M; Weaver, Scott C; Wong, Gerard C L

    2011-09-20

    Antiviral compounds that increase the resistance of host tissues represent an attractive class of therapeutic. Here, we show that squalamine, a compound previously isolated from the tissues of the dogfish shark (Squalus acanthias) and the sea lamprey (Petromyzon marinus), exhibits broad-spectrum antiviral activity against human pathogens, which were studied in vitro as well as in vivo. Both RNA- and DNA-enveloped viruses are shown to be susceptible. The proposed mechanism involves the capacity of squalamine, a cationic amphipathic sterol, to neutralize the negative electrostatic surface charge of intracellular membranes in a way that renders the cell less effective in supporting viral replication. Because squalamine can be readily synthesized and has a known safety profile in man, we believe its potential as a broad-spectrum human antiviral agent should be explored. PMID:21930925

  15. Acute Toxicity of the Lampricides TFM and Niclosamide to Three Species of Unionid Mussels

    Science.gov (United States)

    Boogaard, Michael A.

    2006-01-01

    The sea lamprey (Petromyzon marinus), a jawless parasitic eel-like fish native to the Atlantic Ocean (fig. 1), was accidentally introduced into the Great Lakes in the early 20th century through the construction of shipping canals. A member of the Petromyzonidae family, the primitive parasite has been identified as a major cause of the collapse of the Great Lakes fishery in the 1940s and 1950s. The lampricides 3-trifluoromethyl-4-nitrophenol (TFM) and 2'5-dichloro-4'-nitrosalicylanilide (niclosamide) have been used to control larval sea lampreys in tributaries of the Great Lakes since the early 1960s. The lampricide TFM is the main compound used to keep sea lamprey populations in check while niclosamide is used primarily in combination with TFM as a cost-saving measure. The addition of niclosamide at a ratio of 1% to TFM will reduce the amount of TFM required for effective treatment by about 40%.

  16. Distribution of the early larval stages of cod, plaice and lesser sandeel across haline fronts in the North Sea

    DEFF Research Database (Denmark)

    Munk, Peter; Wright, P.J.; Pihl, Niels Jørgen

    2002-01-01

    A number of commercially important fish species spawn in the coastal areas of the North Sea in the late winter, including cod (Gadus morhua), plaice (Pleuronectes platessa) and lesser sandeel (Ammodytes marinus). The distribution of the early stages of these species overlap to some extent...... goals were to ascertain the major traits of larval distribution patterns and the spatial correspondence among species, focusing on the relationship between larval distributions and hydrographic characteristics. Larvae of all three species were found distributed within the shallow Regions of Freshwater...... Influence (ROFI), predominantly in the Dogger Bank and German Bight areas. There was a high degree of overlap between the distributions of cod and plaice, while the maximal abundance of lesser sandeel was found inshore of the other species. Larval distributions were to a large extent confined by the frontal...

  17. Crystal structure and functional characterization of a light-driven chloride pump having an NTQ motif.

    Science.gov (United States)

    Kim, Kuglae; Kwon, Soon-Kyeong; Jun, Sung-Hoon; Cha, Jeong Seok; Kim, Hoyoung; Lee, Weontae; Kim, Jihyun F; Cho, Hyun-Soo

    2016-01-01

    A novel light-driven chloride-pumping rhodopsin (ClR) containing an 'NTQ motif' in its putative ion conduction pathway has been discovered and functionally characterized in a genomic analysis study of a marine bacterium. Here we report the crystal structure of ClR from the flavobacterium Nonlabens marinus S1-08(T) determined under two conditions at 2.0 and 1.56 Å resolutions. The structures reveal two chloride-binding sites, one around the protonated Schiff base and the other on a cytoplasmic loop. We identify a '3 omega motif' formed by three non-consecutive aromatic amino acids that is correlated with the B-C loop orientation. Detailed ClR structural analyses with functional studies in E. coli reveal the chloride ion transduction pathway. Our results help understand the molecular mechanism and physiological role of ClR and provide a structural basis for optogenetic applications. PMID:27554809

  18. Dicty_cDB: Contig-U14334-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-30 FN392321_999( FN392321 |pid:none) Pichia pastoris GS115 chromosome... 134 6e-30 CU633900_247( CU633900...erichia fergusonii ATCC 3546... 47 0.001 AE008691_879( AE008691 |pid:none) Thermo...cus marinus str. MI... 45 0.003 CU651637_2198( CU651637 |pid:none) Escherichia coli LF82 chromosom...04 CP000300_623( CP000300 |pid:none) Methanococcoides burtonii DSM 62... 45 0.004 U58768_4( U58768 |pid:none) Escherichia...lcerans Agy99, c... 44 0.006 CP000970_2351( CP000970 |pid:none) Escherichia coli SMS-3-5, compl... 44 0.006

  19. Dicty_cDB: Contig-U00945-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 42 0.036 AY130431_1( AY130431 |pid:none) Scyliorhinus canicula protein kin...1,051,180,864 total letters Searching..................................................done Score E Sequences producing significa...rs) Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters Searching............................pu... 44 0.26 2 ( AL385054 ) Medicago truncatula EST MtBC26A11R1 : T7 end of c... 40 0.30 2 ( CP000552 ) Prochlorococcus marinus...ce from clone RP11-799G19 on chro... 36 9.6 5 ( DN563650 ) 92203858 Sea Urchin primary mesenchyme cell cDNA

  20. Dicty_cDB: Contig-U14416-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available occus pyogenes M1 GAS, c... 35 1.5 AB467372_1( AB467372 |pid:none) Enterococcus faeci...9_9( AM412319 |pid:none) [Polyangium] brachysporum glidobac... 33 5.5 (A9MHQ8) RecName: Full=Succinyl-diaminopimelate desucci...006470 |pid:none) Chlorobium tepidum TLS, complete... 40 0.045 CP000411_1490( CP000411 |pid:none) Oenococc...421 ... 36 0.50 CP000878_1830( CP000878 |pid:none) Prochlorococcus marinus str. M...o... 35 0.85 AM295007_1436( AM295007 |pid:none) Streptococcus pyogenes Manfredo... 35 1.5 AE004092_356( AE004092 |pid:none) Streptoc

  1. AcEST: DK953640 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 05 >sp|Q9VP05|MED1_DROME Mediator of RNA polymerase II transcription subunit 1 OS=Drosophila melanogas...--protei... 30 6.2 sp|A8G4E3|CCSA_PROM2 Cytochrome c biogenesis protein ccsA OS=Pro... 30 6.2 sp|O73700|CAC1... 25 OS=Homo... 30 8.1 sp|Q31BB2|CCSA_PROM9 Cytochrome c biogenesis protein ccsA OS=Pro... 30 8.1 >sp|Q54PY1|...4E3|CCSA_PROM2 Cytochrome c biogenesis protein ccsA OS=Prochlorococcus marinus (strain MIT 9215) GN=ccsA PE=... Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search prog

  2. Effects of changes in sandeel availability on the reproductive output of seabirds

    DEFF Research Database (Denmark)

    Rindorf, Anna; Wanless, S.; Harris, M.P.

    2000-01-01

    lower when availability peaked early. We speculate that these effects are linked to annual variations in sandeel Life history events and, in particular, to the onset of burying behaviour of 1+ group fish and the arrival of 0 group sandeels on the seabirds' feeding grounds. Although the timing of these......The lesser sandeel Ammodytes marinus is a key prey species for many marine birds in the North Sea. This fish is currently the target of the largest single species fishery in the area, and this has led to concern about the potential impact of the fishery on seabirds. There are 2 critical issues......: does the breeding success of seabirds depend on sandeel availability and does the fishery reduce sandeel availability to a level at which avian reproductive output is affected? This paper investigates the first question in detail and briefly touches on the second by testing for correlations between...

  3. Dicty_cDB: Contig-U14684-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Mus musculus 12 days embryo spinal... 45 0.007 DQ843899_1( DQ843899 |pid:none) Listeria monocytogenes st...EF094731_1( EF094731 |pid:none) Petromyzon marinus isolate PmVLRA.... 39 0.37 EU408810_1( EU408810 |pid:none) Listeria monocytogene...rosophila erecta voucher stock #1... 37 1.4 DQ302559_1( DQ302559 |pid:none) Listeria monocytogenes st...N... 51 9e-05 FJ025009_2( FJ025009 |pid:none) Listeria monocytogenes strain NRRL... 49 5e-04 FJ024980_2( FJ024980 |pid:none) List...eria monocytogenes strain NRRL... 47 0.002 CP000448_1327( CP000448 |pid:none

  4. A portable trap with electric lead catches up to 75% of an invasive fish species

    Science.gov (United States)

    Johnson, Nicholas S.; Miehls, Scott; O’Connor, Lisa M.; Bravener, Gale; Barber, Jessica; Thompson, Henry; Tix, John A.; Bruning, Tyler

    2016-06-01

    A novel system combining a trap and pulsed direct current electricity was able to catch up to 75% of tagged invasive sea lamprey Petromyzon marinus in free-flowing streams. Non-target mortality was rare and impacts to non-target migration were minimal; likely because pulsed direct current only needed to be activated at night (7 hours of each day). The system was completely portable and the annual cost of the trapping system was low ($4,800 U.S. dollars). Use of the technology is poised to substantially advance integrated control of sea lamprey, which threaten a fishery valued at 7 billion U.S. dollars annually, and help restore sea lamprey populations in Europe where they are native, but imperiled. The system may be broadly applicable to controlling invasive fishes and restoring valued fishes worldwide, thus having far reaching effects on ecosystems and societies.

  5. Dicty_cDB: Contig-U14701-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llulosum 'So ce 56'... 42 0.067 CP000090_564( CP000090 |pid:none) Ralstonia eutropha JMP134 chr...da F1, complete... 41 0.15 CU914168_627( CU914168 |pid:none) Ralstonia solanacearum strain IP... 41 0.15 CP0...one CH211-278A6 in ... 36 1.5 6 ( AL929352 ) Plasmodium falciparum strain 3D7, chromosome 5, s... 36 1.6 11 ( AM574384 ) Paracentr...ue AC116925_15( AC116925 |pid:none) Dictyostelium discoideum chromoso... 508 0.0 AD2014( AD2014 ) hypothetical...01252 |pid:none) Shewanella baltica OS223, compl... 59 5e-07 CP000825_1004( CP000825 |pid:none) Prochlorococcus marinus str

  6. Dicty_cDB: Contig-U12375-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Caenorhabditis elegans cosmid F26F4, ... 97 2e-18 ( Q19825 ) RecName: Full=Probable arginyl...ochlorococcus marinus str. MIT... 107 1e-21 (Q5RA20) RecName: Full=Arginyl-tRNA synthetase, cytoplasmic; ......hypothetical protei... 102 3e-20 ( P37880 ) RecName: Full=Arginyl-tRNA synthetase, cytoplasmi...T... 99 3e-19 AE014188_179( AE014188 |pid:none) Plasmodium falciparum 3D7 chromo... 99 4e-19 (B8CI29) RecName: Full=Arginyl...7 CP000961_4378( CP000961 |pid:none) Shewanella woodyi ATCC 51908, c... 93 2e-17 (A2CDB7) RecName: Full=Arginyl

  7. Dicty_cDB: Contig-U11982-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone: QflA-21346,... 42 0.27 2 ( BX548174 ) Prochlorococcus marinus MED4 complete genome. 34 0.27 23 ( AC175890 ) Strongylocentro...494955 |pid:none) Leishmania braziliensis chromosom... 79 4e-13 BC085415_1( BC085415 |pid:none) Danio rerio mitogen-activated pro.... 75 3e-12 (Q8NJT7) RecName: Full=Mitogen-activated protein kinase HOG1; ... 75 3e-12 AF435805_1( AF435805 |pid:none) Malus microm...71_292( AP007171 |pid:none) Aspergillus oryzae RIB40 genomic... 71 6e-11 AE014297_4458( AE014297 |pid:none) Drosophila melanogaster...71 7e-11 ( P49762 ) RecName: Full=Serine/threonine-protein kinase Doa; ... 71 7e-11 CP001324_562( CP001324 |pid:none) Microm

  8. Lífshættir flundru (Platichthys flesus) á ósasvæði Hvítár í Borgarfirði

    OpenAIRE

    Ásgeir Valdimar Hlinason 1964

    2013-01-01

    Með hækkandi sjávarhita hefur nýjum fisktegundum í hafinu umhverfis Íslands fjölgað. Á undanförnum árum virðast fjórar nýjar tegundir hafa náð fótfestu hérlendis steinsuga (Petromyzon marinus), sandrækja (Crangon crangon), grjótkrabbi (Cancer irroratus) og flundra (Platichthys flesus), sem einnig nýtir búsvæði í árósum og ferskvatni á hluta lífsferilsins, en tegundin var fyrst greind á Íslandi árið 1999. Markmið rannsóknarinnar var að kanna útbreiðslu flundru við Ísland, og lífshætti fl...

  9. Growth and survival of larval and early juvenile lesser sandeel in patchy prey field in the North Sea: An examination using individual-based modelling

    DEFF Research Database (Denmark)

    Gürkan, Zeren; Christensen, Asbjørn; Deurs, Mikael van;

    2012-01-01

    Disentangling physical–biological interaction processes during early life-stages of fish is crucial for the understanding of fish stock recruitment. Among many individual and environmental aspects affecting mortality during the early life-stages of fish, encountering food at greater than average...... concentrations is regarded important for survival. Intense aggregations of zooplankton in near-surface waters provide these conditions for larval fish. Simulation studies by individual-based modeling can help understanding of the mechanisms for survival during early life-stages. In this study, we examined how...... growth and survival of larvae and early juveniles of Lesser Sandeel (Ammodytes marinus) in the North Sea are influenced by availability and patchiness of the planktonic prey by adapting and applying a generic bioenergetic individual-based model for larval fish. Input food conditions were generated by...

  10. Detection of arsenic-containing hydrocarbons in a range of commercial fish oils by GC-ICPMS analysis

    DEFF Research Database (Denmark)

    Sele, Veronika; Amlund, Heidi; Berntssen, Marc H. G.;

    2013-01-01

    The present study describes the use of a simple solid-phase extraction procedure for the extraction of arsenic-containing hydrocarbons from fish oil followed by analysis using gas chromatography (GC) coupled to inductively coupled plasma mass spectrometry (ICPMS). The procedure permitted the...... of Atlantic herring, Atlantic cod (Gadus morhua) and saithe (Pollachius virens)). Total arsenic concentrations in the fish oils and in the extracts of the fish oils were determined by microwave-assisted acid digestion and ICPMS. The arsenic concentrations in the fish oils ranged from 5.9 to 8.7 mg kg...... analysis of a small sample amount, and the method was applied on a range of different commercial fish oils, including oils of anchovy (Engraulis ringens), Atlantic herring (Clupea harengus), sand eel (Ammodytes marinus), blue whiting (Micromesistius poutassou) and a commercial mixed fish oil (mix of oils...

  11. Dicty_cDB: Contig-U10807-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 CP000828_559( CP000828 |pid:none) Acaryochloris marina MBIC11017, ... 50 2e-04 (Q6YZI0) RecName: Full=Probable UDP-N-acetylglucosam...coccus marinus str. MI... 50 2e-04 (Q8RVB2) RecName: Full=Probable UDP-N-acetylglucosamine--pep...e: Full=Probable UDP-N-acetylglucosamine--peptide... 52 4e-05 CP001100_2545( CP001100 |pid:none) Chloro...nhu... 52 6e-05 ( Q96301 ) RecName: Full=Probable UDP-N-acetylglucosamine--peptide... 52 7e-05 CP000440_146(...um erythraeum IMS101... 51 9e-05 ( O82039 ) RecName: Full=Probable UDP-N-acetylglucosamine--pepti

  12. Dicty_cDB: Contig-U05106-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fruit normalization and subtr... 44 4.5 1 ( DQ366726 ) Uncultured Prochlorococcus marinus clon... 0.44 5 ( EJ341255 ) 1092963517516 Global-Ocean-Sampling_GS-28-01-01-1... 36 0.51 2 ( AC016397 ) Homo sapiens chromosome 10 clon....5 1 ( FH416255 ) CHO_OF4876xj09f1.ab1 CHO_OF4 Nicotiana tabacum ge... 44 4.5 1 ( ER592642 ) 1093016205865 Global-Ocean-Sampli...559900_1( CS559900 |pid:none) Sequence 487 from Patent WO2006032... 33 4.1 AY657030_1( AY657030 |pid:none) Salvia miltiorrhiza cal...ng_GS-36-01-01-2... 44 4.5 1 ( ER341083 ) 1092344347147 Global-Ocean-Sampling_GS-34-01-01-

  13. Dicty_cDB: Contig-U11685-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Kluyveromyces lactis ndi1 gene for putative mitoc... 46 0.94 2 ( AM452956 ) Vitis vinifera contig VV78X092722.13, whole geno...e CH251-499A2 from chromo... 42 1.3 6 ( DQ927305 ) Tetrahymena pigmentosa strain UM1060 mitochon..... 49 5e-04 CP000681_1234( CP000681 |pid:none) Shewanella putrefaciens CN-32, ... 49 5e-04 CP000431_7201( CP000431 |pid:none) Rhodoc...9 CP000584_378( CP000584 |pid:none) Ostreococcus lucimarinus CCE9901... 43 0.019 AE016830_3039( AE016830 |pid:none) Enterococ...hlorococcus marinus str. MIT ... 41 0.073 CP000485_2159( CP000485 |pid:none) Bacillus thuringien

  14. Dicty_cDB: Contig-U13289-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Coprinellus disseminatus strain C3... 166 1e-39 CU928162_3278( CU928162 |pid:none) Escherichia...nsis str. LM... 165 2e-39 CP000542_3873( CP000542 |pid:none) Verminephrobacter eiseniae EF01... 16... 34 4.7 BX571867_145( BX571867 |pid:none) Photorhabdus luminescens subsp. ... 34 4.7 CP000013_76( CP000013 |pid:none) Borrelia garin...orrhagic septicemia virus... 34 6.1 AL844505_65( AL844505 |pid:none) Plasmodium falciparum 3D7 chrom...) Prochlorococcus marinus str. MIT... 34 6.1 AF143862_2( AF143862 |pid:none) Viral hemorrhagic septicemia

  15. Seabirds maintain offspring provisioning rate despite fluctuations in prey abundance: A multi-species functional response for guillemots in the North Sea

    DEFF Research Database (Denmark)

    Smout, Sophie; Rindorf, Anna; Wanless, Sarah;

    2013-01-01

    links consumption rates to the availability of multiple prey types, but fitting multi-species functional responses to field data can be difficult, requiring consumption measurements over a range of different prey abundances. Such detailed data may be especially difficult to obtain in marine ecosystems....... 3. We used annual time-series data on chick provisioning for the common guillemot Uria aalge together with abundance indices for its two main prey (lesser sandeel Ammodytes marinus and sprat Sprattus sprattus) to parameterize a multi-species functional response for parents provisioning chicks...... their parents despite fluctuating prey abundances, conferring some resilience in the face of environmental variation. The parameterized multi-species functional response model can be used to estimate levels of severe prey shortage that compromise provisioning. It also enables us to interpret predator...

  16. Dicty_cDB: Contig-U01028-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .41 5 ( DW342668 ) PP_LEc0011I23f Peach shoot Prunus persica cDNA cl... 44 0.41 2...ST Petromyzon marinus cD... 36 0.83 3 ( FE671020 ) mh1_0001_B06 Drought-stressed chickpea lea... ( AC115578 ) Dictyostelium discoideum chromosome 2 map complem... 36 0.073 4 ( FG833367 ) UCRVU04_CCNI15896_g1 Cowpea...L_259_95 Cotton fiber 0-10 day post anthesis Go... 34 1.8 3 ( DN135979 ) tam63c01.y2 Hydra_EST_HyEch...abase: 620,718,517 Effective search space: 233390162392 Effective search space used: 233390162392 Neighboring words thres

  17. AcEST: DK961188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _id A7S850 Definition tr|A7S850|A7S850_NEMVE Predicted protein OS=Nematos... BlastX Result : Swiss-Prot sp_hit_id Q6KZJ6 Definition sp|Q6KZJ6|APGM_PICTO 2,3-bisphosphoglycerat...ficant alignments: (bits) Value tr|A7S850|A7S850_NEMVE Predicted protein OS=Nematos...0_PHYPA Predicted protein OS=Physcomitrella paten... 51 6e-05 tr|A9BD49|A9BD49_PROM4 Glutamine--fructos...D49_PROM4 Glutamine--fructose-6-phosphate transaminase (Isomerizing) OS=Prochlorococcus marinus (stra

  18. Visualization of Iron-Binding Micelles in Acidic Recombinant Biomineralization Protein, MamC

    Energy Technology Data Exchange (ETDEWEB)

    Kashyap, Sanjay [Ames Laboratory; Woehl, Taylor [Ames Laboratory; Valverde-Tercedor, Carmen [University of Granada; Sanchez-Quesada, Miguel [University of Granada; Lopez, Concepcion Jimenez [University of Granada; Prozorov, Tanya [Ames Laboratory

    2014-03-07

    Biological macromolecules are utilized in low-temperature synthetic methods to exert precise control over nanoparticle nucleation and placement. They enable low-temperature formation of a variety of functional nanostructured materials with properties often not achieved via conventional synthetic techniques. Here we report on the in situ visualization of a novel acidic bacterial recombinant protein, MamC, commonly present in the magnetosome membrane of several magnetotactic bacteria, including Magnetococcus marinus, strain MC-1. Our findings provide an insight into the self-assembly of MamC and point to formation of the extended protein surface, which is assumed to play an important role in the formation of biotemplated inorganic nanoparticles. The self-organization of MamC is compared to the behavior of another acidic recombinant iron-binding protein, Mms6.

  19. Dicty_cDB: Contig-U06081-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N320319_1( FN320319 |pid:none) Schistosoma japonicum isolate Anhu... 275 2e-72 CR380948_179( CR380948 |pid:none) Candi...AF526207 |pid:none) Argopecten irradians isolate iolsa... 212 2e-53 CP000080_113( CP000080 |pid:none) Leishman.... 104 6e-21 CP001399_1369( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 103 1e-20 (A7I5P0) RecName: Full=50S riboso...d:none) Staphylothermus marinus F1, com... 106 2e-21 CP001403_1389( CP001403 |pid:none) Sulfolobus islandicu...00_1282( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 104 5e-21 EU68663

  20. A portable trap with electric lead catches up to 75% of an invasive fish species.

    Science.gov (United States)

    Johnson, Nicholas S; Miehls, Scott; O'Connor, Lisa M; Bravener, Gale; Barber, Jessica; Thompson, Henry; Tix, John A; Bruning, Tyler

    2016-01-01

    A novel system combining a trap and pulsed direct current electricity was able to catch up to 75% of tagged invasive sea lamprey Petromyzon marinus in free-flowing streams. Non-target mortality was rare and impacts to non-target migration were minimal; likely because pulsed direct current only needed to be activated at night (7 hours of each day). The system was completely portable and the annual cost of the trapping system was low ($4,800 U.S. dollars). Use of the technology is poised to substantially advance integrated control of sea lamprey, which threaten a fishery valued at 7 billion U.S. dollars annually, and help restore sea lamprey populations in Europe where they are native, but imperiled. The system may be broadly applicable to controlling invasive fishes and restoring valued fishes worldwide, thus having far reaching effects on ecosystems and societies. PMID:27341485