WorldWideScience

Sample records for aluoja jakov lik

  1. The Procedure of Putting a Park under Protection Using the Sv. Jakov Park in Opatija as an Example

    Directory of Open Access Journals (Sweden)

    Koraljka Vahtar-Jurković

    2011-06-01

    Full Text Available This article presents the procedure of putting valuable town parks under protection in the category of monuments of park architecture, according to the Law on protection of nature. Besides the procedure itself, the aim is to present the expert documents as the foundation for the procedure using the Sv. Jakov Park in Opatija as an example. Since this is the first park to put under protection according to the new Law, and since this is the result of several years of scientific research, this example can be used for the future protection of parks in our country. The scientific methods used here were the method of analysis and synthesis, historical method, method of proof, case study method and method of induction and deduction. Analysis of data from the Registry of protected natural heritage at the Ministry of Culture showed that no historical parks were protected at that time in the category of the monuments of park architecture according to the new Law on protection of nature. The method of analysis also identified the phases of procedure of protection and the need for cooperation of various experts – architects-urbanists, agronomists, biologists and jurists and also various local, county and republic institutions. Using the historical method, we collected information on the historical development, characteristics and value of the Sv. Jakov Park, and using the method of proof, we established that it was not protected. The case study method was used to examine the procedure of putting the Sv. Jakov Park under protection, and the method of induction and deduction showed that this particular example of protection, based on scientifi c research, should become a model for similar procedures in the Republic of Croatia.

  2. The Procedure of Putting a Park under Protection Using the Sv. Jakov Park in Opatija as an Example

    Directory of Open Access Journals (Sweden)

    Koraljka Vahtar-Jurković

    2014-02-01

    Full Text Available This article presents the procedure of putting valuable town parks under protection in the category of monuments of park architecture, according to the Law on protection of nature. Besides the procedure itself, the aim is to present the expert documents as the foundation for the procedure using the Sv. Jakov Park in Opatija as an example. Since this is the first park to put under protection according to the new Law, and since this is the result of several years of scientific research, this example can be used for the future protection of parks in our country. The scientific methods used here were the method of analysis and synthesis, historical method, method of proof, case study method and method of induction and deduction. Analysis of data from the Registry of protected natural heritage at the Ministry of Culture showed that no historical parks were protected at that time in the category of the monuments of park architecture according to the new Law on protection of nature. The method of analysis also identified the phases of procedure of protection and the need for cooperation of various experts – architects-urbanists, agronomists, biologists and jurists and also various local, county and republic institutions. Using the historical method, we collected information on the historical development, characteristics and value of the Sv. Jakov Park, and using the method of proof, we established that it was not protected. The case study method was used to examine the procedure of putting the Sv. Jakov Park under protection, and the method of induction and deduction showed that this particular example of protection, based on scientifi c research, should become a model for similar procedures in the Republic of Croatia.

  3. Akademisyenlerin Tükenmişlik Düzeylerii

    Directory of Open Access Journals (Sweden)

    Fatma Kayan Fadlelmula

    2014-12-01

    Full Text Available Bu çalışmanın amacı, akademisyenlerin duygusal tükenmişlik, duyarsızlaşma ve kişisel başarı kaybı açısından tükenmişlik düzeylerini araştırmak ve çeşitli kişisel değişkenlerin tükenmişlik düzeyleri üzerindeki etkisini incelemektir. Bu değişkenler başlıca akademisyenlerin cinsiyeti, medeni durumu, çocuk sayısı, yaşı, üniversitedeki toplam hizmet yılı ve ekonomik durumları hakkındaki görüşlerinden oluşmaktadır. Çalışmada veri toplama aracı olarak Maslach ve Jackson tarafından geliştirilmiş ve alan yazınında sıklıkla kullanılmakta olan Maslach Tükenmişlik Ölçeği kullanılmıştır. Ölçek, Mehmet Akif Ersoy Üniversitesi Eğitim Fakültesinde çalışmakta olan 48 öğretim üyesine uygulanmıştır. Veriler, 2012-2013 akademik yılı güz doneminde toplanmıştır. Bulgular genel olarak akademisyenlerin düşük tükenmişlik seviyesine sahip olduğunu göstermektedir. Hem duygusal tükenmişlik hem de kişisel başarı kaybı alt boyutlarında düşük tükenmişlik düzeyi tespit edilmiştir. Özellikle duyarsızlama alt boyutunda ise oldukça düşük tükenmişlik düzeyi elde edilmiştir. Ayrıca, kişisel değişkenlerin hiçbiri duygusal tükenmişlik, duyarsızlaşma ve kişisel başarı kaybı üzerinde anlamlı bir farklılık yaratmamıştır. Sadece kişisel başarı kaybı alt boyutunda akademisyenlerin toplam hizmet yılı göz önünde bulundurulduğunda anlamlı farklılık olduğu belirlenmiştir.

  4. LIK1, a CERK1-interacting kinase, regulates plant immune responses in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Mi Ha Le

    Full Text Available Chitin, an integral component of the fungal cell wall, is one of the best-studied microbe-associated molecular patterns. Previous work identified a LysM receptor-like kinase (LysM-RLK1/CERK1 as the primary chitin receptor in Arabidopsis. In order to identify proteins that interact with CERK1, we conducted a yeast two-hybrid screen using the intracellular kinase domain of CERK1 as the bait. This screen identified 54 putative CERK1-interactors. Screening mutants defective in 43 of these interacting proteins identified only two, a calmodulin like protein (At3g10190 and a leucine-rich repeat receptor like kinase (At3g14840, which differed in their response to pathogen challenge. In the present work, we focused on characterizing the LRR-RLK gene where mutations altered responses to chitin elicitation. This LRR-RLK was named LysM RLK1-interacting kinase 1 (LIK1. The interaction between CERK1 and LIK1 was confirmed by co-immunoprecipitation using protoplasts and transgenic plants. In vitro experiments showed that LIK1 was directly phosphorylated by CERK1. In vivo phosphorylation assays showed that Col-0 wild-type plants have more phosphorylated LIK1 than cerk1 mutant plants, suggesting that LIK1 may be directly phosphorylated by CERK1. Lik1 mutant plants showed an enhanced response to both chitin and flagellin elicitors. In comparison to the wild-type plants, lik1 mutant plants were more resistant to the hemibiotrophic pathogen Pseudomonas syringae, but more susceptible to the necrotrophic pathogen Sclerotinia sclerotiorum. Consistent with the enhanced susceptibility to necrotrophs, lik1 mutants showed reduced expression of genes involved in jasmonic acid and ethylene signaling pathways. These data suggest that LIK1 directly interacts with CERK1 and regulates MAMP-triggered innate immunity.

  5. Dissolved inorganic carbon, pH, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from the JAKOV SMIRNITSKIY in the Beaufort Sea, East Siberia Sea and others from 2008-08-15 to 2008-09-16 (NODC Accession 0108368)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0108368 includes chemical, discrete sample, physical and profile data collected from JAKOV SMIRNITSKIY in the Beaufort Sea, East Siberia Sea, Kara Sea...

  6. maxLik: A package for maximum likelihood estimation in R

    DEFF Research Database (Denmark)

    Henningsen, Arne; Toomet, Ott

    2011-01-01

    This paper describes the package maxLik for the statistical environment R. The package is essentially a unified wrapper interface to various optimization routines, offering easy access to likelihood-specific features like standard errors or information matrix equality (BHHH method). More advanced...

  7. Performance of new 10 kW class MCFC using Li/K and Li/Na electrolyte

    Energy Technology Data Exchange (ETDEWEB)

    Mugikura, Yoshihiro; Yoshiba, Fumihiko; Izaki, Yoshiyuki; Watanabe, Takao [Central Research Institute of Electric Power Industry, Kanagawa-ken (Japan)] [and others

    1996-12-31

    The molten carbonate fuel cell (MCFC) uses generally mixture of lithium carbonate and potassium carbonate (Li/K) as the electrolyte. NiO cathode dissolution is one of serious problems for MCFC life. The NiO cathode has been found to dissolve into the electrolyte as Ni{sup 2+} ion which is reduced to metallic Ni by H{sub 2} in the fuel gas and bridges the anode and the cathode. The bridges short circuit and degrade cell performance and shorten cell life. Since solubility of NiO in mixture of lithium carbonate and sodium carbonate (Li/Na) is lower than in Li/K, it takes longer time to take place slowing by NiO cathode dissolution in Li/Na compared with in Li/K. The ionic conductivity of Li/Na is higher than of Li/K, however, oxygen solubility in Li/Na is lower 9 than in Li/K. A new 10 kW class MCFC stack composed of Li/K cells and Li/Na cells, was tested. Basic performance of the Li/K cells and Li/Na cells of the stack was reported.

  8. The R Package metaLik for Likelihood Inference in Meta-Analysis

    Directory of Open Access Journals (Sweden)

    Annamaria Guolo

    2012-08-01

    Full Text Available Meta-analysis is a statistical method for combining information from different studies about the same issue of interest. Meta-analysis is widely diffuse in medical investigation and more recently it received a growing interest also in social disciplines. Typical applications involve a small number of studies, thus making ordinary inferential methods based on first-order asymptotics unreliable. More accurate results can be obtained by exploiting the theory of higher-order asymptotics. This paper describes the metaLik package which provides an R implementation of higher-order likelihood methods in meta-analysis. The extension to meta-regression is included. Two real data examples are used to illustrate the capabilities of the package.

  9. Stress and burnout among mothersAnnelerde stres ve tükenmişlik

    Directory of Open Access Journals (Sweden)

    Ege Akgün

    2014-07-01

    Full Text Available Stress and burnout are dealt with in the literature as an issue commonly associated with jobs that require human relationships. The significant points highlighted in the definition of burnout are face-to-face relationships in the job environment and exposure to intensive emotional demands. Based on this definition, it may be concluded that mothers are also faced with the risk of stress and burnout, although motherhood is not defined as a profession. Mothers generally bear the main responsibility in the care and education of children and in guiding children’s lives. Since the psychological health of mothers has direct impacts on the mental health of children, it is important to study the prevention of distress and burnout in mothers and relevant coping strategies. The literature mostly presents studies related to burnout in the mother of sick or handicapped children. However, distress and burnout in mothers of children with normal development also need to be studied. In that vein, this study discusses the symptoms, prevention and coping strategies of distress and burnout with regard to motherhood. ÖzetStres ve tükenmişlik insan ile ilişki kuran meslek gruplarında sıklıkla çalışılan bir konu olarak alan yazında yer almaktadır. Tükenmişliğin tanımında meslek gereği insanlarla yüz yüze çalışma ve yoğun duygusal taleplere maruz kalma vurgu yapılan önemli noktalardır. Bu noktadan hareketle annelerin bir çocuğun bakım ve eğitimi ile yaşamına yön vermede genellikle birinci derece sorumlu olan kişi olması nedeni ile bir meslek olarak tanımlanmasa da olumsuz stres ve tükenmişlik yaşama riski bulunmaktadır. Diğer yandan annenin psikolojik sağlığı aynı zamanda çocuklarının ruh sağlığı üzerinde etkili olabileceğinden annelerde olumsuz stres ve tükenmişlik sendromunu önleme ve baş etme stratejilerinin vurgulanması gereken önemli bir konu olduğu düşünülmektedir. Alan yazında genellikle

  10. Jalaccell peatab tootmise / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2008-01-01

    Osaühingu Jalaccell üks osanikest Accell Finess Division otsustas tootmise Eestist Hiinasse ümber kolida, seda põhjusel, et praegusel spordikaupade turul ostetakse seadmeid rohkem odavamast hinnaklassist. Kommenteerib Tööturuameti Järvamaa osakonna juhataja Eha Tasang

  11. Meslek lisesi öğretmenlerinin mesleki tükenmişlik düzeylerinin incelenmesi [Investigating the professional burnout levels of vocational high school teachers

    Directory of Open Access Journals (Sweden)

    Atilla ERKUL

    2014-10-01

    Full Text Available Bu araştırmada meslek lisesi öğretmenlerinin tükenmişlik düzeyleri tükenmişlik alt boyutlarında; branş, mesleki kıdem, öğrenim durumu, cinsiyet, medeni durum ve öğretmenlik mesleğini isteyerek seçip seçmemeleri değişkenlerine göre incelenmiştir. Araştırmanın evrenini 2011–2012 eğitim-öğretim döneminde İstanbul ili Şişli İlçesinde Meslek liselerinde görev yapan 542 öğretmen oluşturmaktadır. Araştırmanın örneklemini ise bu okullardan araştırmaya gönüllü olarak katılan 215 öğretmen oluşturmaktadır. Araştırmada öğretmenlerin tükenmişlik düzeylerini belirlemek üzere, Maslach Tükenmişlik Envanteri ve Kişisel Bilgi Formu kullanılmıştır. Elde edilen verilerin istatistiksel analizinde, aritmetik ortalama, t-testi ve tek yönlü varyans analizi (ANOVA kullanılmıştır. Araştırma bulgularına göre en fazla tükenmişlik “Duygusal Tükenme” alt boyutunda görülmektedir. Bu boyutu sırası ile “Kişisel başarı” ve “Duyarsızlaşma” boyutları takip etmektedir. Araştırmada cinsiyet ve branş değişkenlerine göre, duyarsızlaşma ve kişisel başarı alt boyutlarında anlamlı bir farklılık bulunmazken; duygusal tükenme boyutunda anlamlı farklılık saptanmıştır. Buna göre kadın öğretmenlerin erkek öğretmenlere göre; kültür dersi öğretmenlerinin meslek dersi öğretmenlerine göre daha fazla duygusal tükenme yaşadığı görülmektedir. Araştırmada mesleğini istemeden seçen öğretmenlerin mesleği isteyerek seçenlere göre daha fazla duygusal tükenme ve duyarsızlaşma yaşadığı saptanmıştır. Araştırmada ayrıca öğretmenlerin tükenmişlik alt boyutlarında medeni durum, eğitim düzeyi ve kıdem değişkenlerine göre tükenmişlik düzeylerinin anlamlı düzeyde farklılık göstermediği belirlenmiştir.

  12. Pilistvere rehehoones tapetakse Rasputin / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  13. Electrochemical studies on Li+/K+ ion exchange behaviour in K4Fe(CN)6 cathode material for Li, K-ion battery

    Indian Academy of Sciences (India)

    Bikash Mandal; I Basumallick; Susanta Ghosha

    2015-01-01

    The electrochemical studies of anhydrous K4Fe(CN)6 is reported. Anhydrous material was produced after dehydrating K4Fe(CN)6.3H2O crystal at 200°C in an open atmosphere. The material, as obtained, was characterized by various spectroscopic techniques, such as UV-Visible, FTIR, powder X-ray diffraction and FESEM-EDX. Electrochemical and Li+/K+ ion exchange behaviour of the synthesized material were studied by cyclic voltametry (CV), chronoamperometry (CA) and galvanostatic charge-discharge method after preparing a laboratory model cell against lithium anode instead of potassium. During anodic scan in the 1st cycle, peak maximum was observed at 3.93 V vs. Li+/Li due to removal of K+ ions from the ferrocyanide matrix, whereas, in the reverse scan (cathodic sweep) as well as in consequent cycles, peak maxima due to Li+ ion insertion and extraction were observed at 2.46 V and 3.23 V vs. Li+/Li, respectively. Cell, assembled using ferrocyanide cathode and lithium anode, shows an open circuit potential of 3.08 V and delivers a maximum capacity of 61 mAh g-1 (theoretical capacity 72 mAh g-1) at a rate of 0.2 C at room temperature.

  14. Beden Eğitimi Öğretmenlerinin Tükenmişlik Düzeylerinin Saptanması ve Karşılaştırılması

    OpenAIRE

    Kelgökmen, Ali Haydar; Uzunöz, Fatma Saçlı; Demirhan, Gıyasettin

    2016-01-01

    Araştırmanın amacı, ilköğretim okullarında görev yapan beden eğitimi öğretmenlerinin tükenmişlik düzeylerini saptamak ve cinsiyet, medeni durum, mesleki hizmet yılı, haftalık ders yükü açısından karşılaştırmaktır. Araştırmaya, Ankara’da görev yapan 127 beden eğitimi öğretmeni katılmıştır. Veri toplama aracı olarak, Maslach Tükenmişlik Ölçeği (Maslach Burnout Inventory) (Maslach ve Jackson, 1981), verilerin analizinde ise tanımlayıcı istatistik, t-testi ve tek yönlü varyans analizi (ANOVA) kul...

  15. Tükenmişlik Ölçeğinin Türkçe Uyarlaması: Geçerlik ve Güvenirlik Çalışması

    Directory of Open Access Journals (Sweden)

    Burhan ÇAPRİ

    2006-06-01

    Full Text Available Bu çalışmanın amacı, yalnızca insanlarla yüz yüze çalışan meslek dallarında değil, tüm meslekdallarında çalışanların tükenmişlik düzeylerini ölçmek amacıyla geliştirilmiş olan TükenmişlikÖlçeği’nin (TÖ (Pines ve Aronson, 1988 Türkçe uyarlama çalışmasını yapmaktır. Araştırmanınçalışma grubu, Mersin İli Belediye sınırları içinde çeşitli meslek gruplarında çalışmakta olan 876çalışandan oluşmaktadır. Ölçeğin yapı geçerliği için yapılan faktör analizi sonucunda, orijinal ölçeğebenzer sonuçlar elde edilmiştir. Ölçeğin güvenirliğini belirlemek için hesaplanan Cronbach alfa iç tutarlık katsayısı α=0,93 olarak bulunmuştur. Test tekrar test güvenirlik katsayısı ise tekstil atölyesigrubu için 0,85, öğretmen grubu için 0,83 olarak bulunmuştur. Ölçeğin ölçüt bağıntılı geçerliğiniincelemek amacıyla Maslach ve Jackson (1981 tarafından geliştirilen ve Ergin (1992 tarafındanTürkçe’ye uyarlanan Maslach Tükenmişlik Envanteri-Eğitimci Formu (MTE-EF uygulanmıştır.Tükenmişlik Ölçeği toplam puanları ve Maslach Tükenmişlik Envanteri-Eğitimci Formu (MTE-EFalt ölçek puanları arasındaki korelasyonlar sırasıyla 0,57, 0,30 ve -0,22 olarak hesaplanmıştır.Bulgular literatür ışığında tartışılmıştır.

  16. Defitsit spetsialistov - ne vdrug voznikshaja problema / Jakov Freiman

    Index Scriptorium Estoniae

    Freiman, Jakov

    2006-01-01

    Eesti kõrgkoolid konkureerivad oma üliõpilaste pärast välisriikide õppeasutustega, kõrgharidusega spetsialistide vajadus näitab kasvutendentsi, võimekamate noorte lahkumine välismaale õppima ja tööle. Probleemi olemus ja majanduslik hinnang Ida-Virumaa näitel

  17. Defitsit spetsialistov - ne vdrug voznikshaja problema / Jakov Freiman

    Index Scriptorium Estoniae

    Freiman, Jakov

    2006-01-01

    Eesti kõrgkoolid konkureerivad oma üliõpilaste pärast välisriikide õppeasutustega, kõrgharidusega spetsialistide vajadus näitab kasvutendentsi, võimekamate noorte lahkumine välismaale õppima ja tööle. Probleemi olemus ja majanduslik hinnang Ida-Virumaa näitel

  18. Kolu mõis kaardilt ei kao / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2003-01-01

    Kolu külavanem ja sealse mõisa töödejuht Ülo Ormus näeb majandusraskustes vaevleva Concordia eraülikooli rektorile Mart Susile esitatud süüdistustes poliitilist survet. Kommenteerib haridusminister Mailis Rand

  19. Järvamaa tehas peatab tootmise / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2008-01-01

    Kuigi Järvamaal Paide vallas Mündis trenazhööre tootval firmal Jalaccell on läinud seni hästi, on tehase juhtkond sunnitud tegevuse peatama ja 51 töötajat koondama, kuna üks osanikest, ACCell Fitness Division, otsustas tootmise Eestist Hiinasse kolida

  20. Nukud tegid Lätis ilma / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2000-01-01

    Rahvusvahelisel näitusel Riias "Balti nukk 2000" osaleb 14 eesti kunstnikku (Resa Tiitsmaa, Eva Kõivu, Terje Kiho, Siiri Talli, Meeri Säre, Ave Maser, Mare Hunt, Kalli Kalde) 137 nukuga, lisaks Jarõna Ilo 3 graafilise lehega. Lähemalt Resa Tiitsmaa nukkudest. Korraldajate Inara Liepa ja Tamara Tshudonovskaja ning eesti esinduse kokkupanija Tiia Toometi kommentaarid

  1. Kooliõpilased noppisid filmifestivalil auhindu / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2002-01-01

    1.-27.04.2002 kestnud 37. üleriigilisest amatöörfilmide festivalist. Türi Majandusgümnaasiumi näiteringil Sillus valmis 2001.a. suvel Türi 75. aastapäevaks üheksaminutine lühifilm "Moodsad tuuled" (festivalil linastus pealkirja "Kevad südames" all), mis pärjati ühe žüriiliikme eriauhinnaga ja tõsteti esile nende edukat debüüti

  2. Öğretmen Adaylarının Meslek Öncesi Tükenmişlik Düzeyleri The Prevocational Burnout Levels of Teacher Candidates

    Directory of Open Access Journals (Sweden)

    İbrahim ÇANKAYA

    2012-09-01

    meslek öncesi süreçte yer alan öğretmen adaylarında tükenmişliğin azaltılması onların kişisel başarılarının artırılmasına, yöneticilerin onlara sosyal destek sağlamasına, sürekli öğrenmeyi teşvik etmesine ve takım çalışmasını özendirmesine bağlıdır. Bu araştırmanın amacı öğretmen adaylarının meslek öncesi tükenmişlik düzeyine ilişkin görüşlerini tespit etmektir. Araştırma tarama modelindedir. Araştırmanın çalışma grubu 2011-2012 eğitim-öğretim yılı bahar döneminde Uşak Üniversitesi Halil Kaya Gedik Eğitim Fakültesinde öğrenim gören matematik, türkçe, fen bilgisi, sınıf ve sosyal bilgiler öğretmenliği son sınıf öğrencilerinden oluşmaktadır. Araştırmada Tümkaya, Çam ve Çavuşoğlu tarafından geliştirilen tükenmişlik ölçeği kullanılmıştır. Ölçek 10 maddeden oluşan tek faktörlü 5’li likert tipi bir ölçektir (tablo 2. Araştırmada ölçeğe doğrulayıcı faktör analizi uygulanmıştır. Araştırmada örneklem seçimine gidilmemiştir. Çalışma grubunda bulunan 373 öğretmen adayından geriye dönen 176 ölçek değerlendirilmiştir. Öğretmen adaylarının genel olarak “nadiren” düzeyinde tükenmişlik yaşadıkları belirlenmiştir. Öğretmen adaylarının tükenmişlik düzeyleri arasında cinsiyet ve ailevi durum değişkeni açısından anlamlı bir farklılık görülmemiştir.

  3. Joining together the volunteer and the youth tourism: An implication for Eskişehir/TurkeyGönüllü ve gençlik turizminin birlikte ele alınması: Eskişehir’e yönelik bir öneri

    Directory of Open Access Journals (Sweden)

    Begüm İlbay

    2015-07-01

    Full Text Available The volunteer and the youth tourism that are among the important types of the social tourism are not desired levels in Turkey. The volunteer tourism that the major participants are youth is interraleted with youth tourism owing to participants’profiles and motivations, and the need for institutional support. Handling together thevolunteer and youth tourism, this study aims to investigate the aims of youth and the institutional authorities, and thus suggesting a proposal for future implementation. In this purpose, a mixed-method study was carried out in Eskişehir/Turkey. First, the data from the 384 college students derived by questionnaire method. Secondly, the data 9 represantatives of local governments and Non-Governemental Organizations’ as institutional authorities derived by interview method. The quantitaive data was analysed mainly by factor analysis, while the qualitative data analysed by content analysis. Findings suggest that participation the tourism among young people are not much higher, however, many of them are willing to participate to the volunteer tourism. Institutional authorities are also positive considerations towards volunteer and youth tourism, however their support is relatively on supplying. Thus, the need for intermediary individual or institution, and the support of universities and the local people are among the other important aspects in planning and implementing. In sum, the findings of the study generally demonstrate that young people and the institutional authorities relatively have positive aims regarding volunteer and youth tourism, and thus a practical implication was provided.   Özet Sosyal turizmin önemli türlerinden gönüllü ve gençlik turizmi Türkiye’de beklenen düzeyde değildir. Başlıca katılımcılarını gençlerin oluşturduğu gönüllü turizmi, katılımcıların profili, motivasyonları ve ayrıca ihtiyaç duyulan kurumsal destek açısından gençlik turizmi ile yakın ili

  4. Investigation of burnout scores of high school students according to socio-demographic variables, psychological symptoms and attachment stylesLise öğrencilerinin tükenmişlik puanlarının sosyo-demografik değişkenler, psikolojik belirtiler ve bağlanma stilleri açısından incelenmesi

    Directory of Open Access Journals (Sweden)

    Burhan Çapri

    2013-09-01

    Full Text Available The purpose of this research is to investigate the contributions of psychological symptoms with attachment styles to indicate the prediction of burnout scores of high school students by identifying whether there is a difference in burnout scores according to gender, class level and school type variables. The research group is consisting of 1260 students. 649 of them (%51, 5 are female and 611 of them (% 48,5 are male and they are chosen by simple random sampling method from the 9th, 10th, 11th and 12th classes of different kinds of high schools in four center districts (Akdeniz, Mezitli, Toroslar and Yenişehir of Mersin Province. The data have been collected with "Maslach Burnout Inventory-Student Survey (MBI-SS", "The Brief Symptom Inventory (BSI", "Relationship Scales Questionnaire (RSQ" and "Personal Information Form". Confirmatory factor analysis (CFA, t-test, analysis of variance (ANOVA, multiple analysis of variance (MANOVA, correlation analysis and multiple regression analysis have been used in the analysis of data. The results indicated that gender, class level and school type variables have effective on MBI-SS subscale scores and attachment styles and psychological symptoms have been predictive relations. The results were discussed in the light of the literature. Özet Bu araştırmanın amacı, lise öğrencilerinin; tükenmişlik puanlarının cinsiyet, sınıf düzeyi ve okul türü değişkenleri açısından farklılaşıp farklılaşmadığını belirleyerek, psikolojik belirtiler ile bağlanma stillerinin tükenmişlik puanlarını yordamadaki katkılarını incelemektir. Araştırma grubu, Mersin İlinin dört merkez ilçesindeki (Akdeniz, Mezitli, Toroslar ve Yenişehir farklı türdeki liselerin 9, 10, 11 ve 12. sınıflarından basit tesadüfi örnekleme yöntemi ile seçilen ve 649’u (% 51.5 kız ve 611’i (% 48.5 erkek olmak üzere toplam 1260 öğrenciden oluşmaktadır. Veriler, “Maslach Tükenmişlik Envanteri

  5. Public employee’ job satisfaction, life satisfaction and burnout levels’ assessment by some socia-demographic factorsKamu çalışanlarının iş doyumu, yaşam doyumu ve tükenmişlik düzeylerinin bazı sosyo-demografik unsurlara göre değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    Yurdanur Ural Uslan

    2016-08-01

    Full Text Available This research aims to assess whether the public employees' job satisfaction, life satisfaction and level of burnout differentiate by some demographic variables. Besides, the research addresses the correlations among the job satisfaction, life satisfaction and level of burnout of the public employees. The research's units of analysis are the 436 public staff that perform their duties in Kilis province center and the connected towns. Minnesota Job Satisfaction Index, Life Satisfaction Index, Maslach Burnout Index and Personal Information Form are used as the data collection tools. Explanatory factor analysis and cronbach's alpha analysis are utilized to identify validity and reliability of the sub-dimensions of the burnout and job satisfaction. Mann-Whitney U test and Kruskal Wallis test are conducted in the data analysis. In addition, the significance test among the variables are analyzed by the Spearman Rank Correlation technic. The research findings are; a positive correlation between job satisfaction and life satisfaction and a negative correlation between burnout variable with both job satisfaction and life satisfaction. A significant differentiation is also observed in the public employees' job satisfaction, life satisfaction and burnout levels in accordance with their changing demographic variables.   Özet Bu araştırma kamu çalışanlarının iş doyumları, yaşam doyumları ve tükenmişlik düzeylerinin bazı demografik değişkenlere göre faklılaşıp farklılaşmadığını incelemek amacıyla yapılmıştır. Ayrıca araştırma kamu çalışanlarının iş doyumları, yaşam doyumları ve tükenmişlikleri arasındaki ilişkiyi ele almaktadır. Araştırma Kilis ili merkezinde ve ilçelerinde görev yapan 436 kamu çalışanından oluşmaktadır. Veri toplama aracı olarak, Minnesota İş Doyumu Ölçeği, Yaşam Doyumu Ölçeği, Maslach Tükenmişlik Ölçeği ve Kişisel Bilgi Formu Kullanılmıştır. Tükenmişlik ve i

  6. Noorterong ergutas päevamuredele kaasa mõtlema / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2003-01-01

    Euroopa Liidu haridusprogrammi "Euroopa noored" Eesti büroo ja Edelaraudtee korraldasid noorteürituse, mille puhuks pandi liikuma erirong. Ürituse eesmärk oli noori aktiivselt ühiskondlikult tähtsates küsimustes kaasa rääkima panna

  7. Le corps des rois des rois dans la ville : Ménélik II et Haylé Sellasé à Addis Abeba The bodies of kings of kings in the city: Menelik II and Haile Selassie in Addis Ababa

    Directory of Open Access Journals (Sweden)

    Estelle Sohier

    2012-01-01

    Full Text Available Ménélik II et Haylé Sellasé, les deux principaux souverains éthiopiens du xxe siècle, ont tous deux connu des fins de règne et de vie troubles, caractérisées par l’absence de funérailles au moment de leur disparition. Différentes sources endogènes et exogènes sont disponibles pour mieux appréhender leur histoire, au nombre desquelles des monuments visibles aujourd’hui dans la capitale éthiopienne. Le croisement des sources et des regards éthiopiens et étrangers permet de démêler l’écheveau des circonstances de la disparition de Ménélik II et les raisons de la dissimulation du corps du roi défunt. Il permet aussi de comprendre comment son successeur, Haylé Sellasé, a géré politiquement le corps – et, partant, la mémoire – de son prédécesseur, en plaçant également au cœur de sa politique symbolique son propre futur lieu de sépulture. Les monuments d’Addis Abeba transmettent nombre d’informations sur l’histoire des funérailles royales en Éthiopie au xxe siècle, mais aussi sur la place du corps des souverains défunts dans le système politico-religieux de la royauté éthiopienne contemporaine.Menelik II and Haile Selassie, the two major Ethiopian sovereigns during the 20th century, both experienced troubles in their lives and at the end of their reigns: no funeral ceremonies were held at the time of their death. Various sources are available for understanding these historical events, among them the monuments that can still be seen in the country’s capital. By crossing sources and viewpoints, both Ethiopian and foreign, we can unravel the set of circumstances surrounding the death of Menelik II and the reasons for concealing the body of the deceased. We thus understand how his successor, Haile Selassie, politically managed his predecessor’s corpse (and the memory of him by placing his own future place of burial at the center of this political symbolism. The monuments in Addis Ababa

  8. Examination of relationship between communication skills, burnout levels and life satisfaction levels of football coaches Futbol antrenörlerinin iletişim becerileri, tükenmişlik düzeyleri ve yaşam tatminleri arasındaki ilişkinin incelenmesi

    Directory of Open Access Journals (Sweden)

    Yakup Akif Afyon

    2013-06-01

    Full Text Available The purpose of this study is to examine the relationship between burnout levels, communication skills and life satisfaction levels of football coaches. A survey was applied to 120 football coaches who attended to Football Coach Development Seminar that was held in July 2012 in Muğla and 80 surveys were evaluated after removing 40 incorrect surveys. As a result, a negative relationship (r=-.293, p<,05 was determined between communication skills and emotional burnout levels of football coaches. A positive relationship (r=.280, p<,05 was found between coaches' life satisfaction levels and the variable of age and a negative relationship (r=-.275, p<,05 was found between coaches' life satisfaction levels and their education levels. In addition, a negative relationship (r=-.295, p<,05 was observed between football coaches' communication skills and life satisfaction levels. These results show us that the higher communication skills of coaches decrease their occupational burnout levels but increase their life satisfaction levels. Özet Bu çalışmanın amacı, futbol antrenörlerinin tükenmişlik düzeyleri, iletişim becerileri ve yaşam tatminleri arasındaki ilişkinin incelenmesidir. Muğla ilinde 2012 Temmuz ayında düzenlenen Futbol Antrenör Gelişim Seminerine katılan 120 antrenöre, anket uygulaması yapılmış, hatalı 40 anket çıkartılarak, 80 anket değerlendirmeye alınmıştır. Sonuç olarak; futbol antrenörlerinin iletişim becerileri ile duygusal tükenmişlik düzeyleri arasında negatif (r=-.293, p<,05 bir ilişki saptanmıştır. Antrenörlerin yaşam tatmin düzeyleri ile yaş değişkeni arasında pozitif (r=.280, p<,05, eğitim durumları arasında ise negatif bir ilişki (r=-.275, p<,05 bulunmuştur. Ayrıca futbol antrenörlerinin iletişim becerileri ile yaşam tatmin düzeyleri arasında negatif (r=-.295, p<,05 bir ilişki vardır. Bu sonuçlar bize, antrenörlerin iletişim becerilerinin yükseldikçe mesleki t

  9. La lapidación como castigo de las relaciones sexuales no legales (zinā en el seno de la escuela Mālikí: doctrina, práctica legal y actitudes individuales frente al delito (ss. XI y XII

    Directory of Open Access Journals (Sweden)

    Serrano Ruano, Delfina

    2005-12-01

    Full Text Available The Maliki jurist Ibn Rushd al-Jadd (d.520/1126 issued a fatwā regarding stoning as a punishment for zinā (unlawful sexual relations. This article examines this fatwā, focusing on three problems: 1 the scarcity of references to implementation of stoning as a punishment for zinā in the pre-modem period, 2 the generally contradictory attitude of pre-modem Muslim jurists, who stressed the validity of stoning as a punishment for zinā but also called for a strict observance of the law, a factor that made it almost impossible to implement, and 3 the importance of the legal opinions offered by pre-modern fuqahā' with regard to contemporary discussions on stoning.

    Partiendo del análisis de una fetua en la que se plantea la posibilidad de condenar a la lapidación a una mujer acusada de haber mantenido relaciones sexuales ilícitas con un hombre, se analiza la doctrina legal sobre zinā de Ibn Rušd el abuelo (m. 520/1126, uno de los juristas mālikíes más relevantes de todos los tiempos. El análisis de esta doctrina conduce a una reflexión acerca de tres cuestiones: 1 la escasez de referencias a la aplicación del castigo de lapidación en el período pre-moderno, 2 la actitud contradictoria de los juristas musulmanes de ese mismo período, los cuales, por una parte sostienen la vigencia del castigo y por otra parte insisten en el respeto escrupuloso de una doctrina que hace que sea prácticamente imposible aplicarlo y 3 la vigencia del corpus de opiniones creado por estos juristas en los debates contemporáneos acerca de la práctica de la lapidación.

  10. Filmitegijate vaba vaim Palamusel / Tiina Säälik

    Index Scriptorium Estoniae

    Säälik, Tiina

    2007-01-01

    Theodor Lutsu 12.filmipäev Palamusel : nähtud ja auhinnatud filmidest (Katrin Rannaste dokk "Imre", Ringo Ramuli mängufilm "Raudtee", Joosep Matjuse operaatoritöö filmis "Suvine dokumentaal", Palamuse õpilaste animafilm "Teadvustamise jõud", filmitudeng Martin Oja animafilm "Rain terrain", EKLi Vaba vaimu priisi saaja Jaan-Jürgen Klaus filmi "Erakpoeet Marko Kompus eest"). Auhindadeks olid kunstnik Ene Luik-Mudisti tassid

  11. Võru kõrisulghäälik / Sulev Iva

    Index Scriptorium Estoniae

    Iva, Sulev, 1969-

    2003-01-01

    Võru keele foneetilisest erijoonest, kõrisulghäälikust ehk larüngaalklusiilist: selle olemusest ja kohast häälikusüsteemis ning sellest, kuidas ta tegelikult välja hääldub. Sisaldab jooniseid, tabeleid, lisasid ja spektrogramme

  12. Võru kõrisulghäälik / Sulev Iva

    Index Scriptorium Estoniae

    Iva, Sulev, 1969-

    2003-01-01

    Võru keele foneetilisest erijoonest, kõrisulghäälikust ehk larüngaalklusiilist: selle olemusest ja kohast häälikusüsteemis ning sellest, kuidas ta tegelikult välja hääldub. Sisaldab jooniseid, tabeleid, lisasid ja spektrogramme

  13. Filmitegijate vaba vaim Palamusel / Tiina Säälik

    Index Scriptorium Estoniae

    Säälik, Tiina

    2007-01-01

    Theodor Lutsu 12.filmipäev Palamusel : nähtud ja auhinnatud filmidest (Katrin Rannaste dokk "Imre", Ringo Ramuli mängufilm "Raudtee", Joosep Matjuse operaatoritöö filmis "Suvine dokumentaal", Palamuse õpilaste animafilm "Teadvustamise jõud", filmitudeng Martin Oja animafilm "Rain terrain", EKLi Vaba vaimu priisi saaja Jaan-Jürgen Klaus filmi "Erakpoeet Marko Kompus eest"). Auhindadeks olid kunstnik Ene Luik-Mudisti tassid

  14. Okulöncesi öğretmenliği anabilim dalı öğretim elemanlarının benlik saygıları, iş doyum ve tükenmişlik düzeyleri arasındaki ilişkinin bazı değişkenler açısından incelenmesi

    OpenAIRE

    Balkar, Hava

    2009-01-01

    Okulöncesi öğretim elemanları 0-6 yaş aralığındaki çocukların eğitimini üstlenecek öğretmenlerin eğitiminden sorumludur. Bu kapsamda kendi tükenmişlikleri, iş doyumlarının ve benlik saygılarının yetiştireceği öğretmen adaylarına ve dolayısıyla çocuklara etkisi olacaktır. Bu nedenle bu çalışmada, okulöncesi öğretmenliği anabilim dalı öğretim elemanlarının benlik saygıları, tükenmişlik düzeyleri ve iş doyumlarının farklılaşıp farklılaşmadığı bazı değişkenler açısından incelenm...

  15. ÖRGÜTSEL GÜVEN, ÖRGÜTSEL ÖZDEŞLEŞME VE ÖRGÜTSEL VATANDAŞLIK DAVRANIŞI ARASINDAKİ İLİŞKİ: BİR DEVLET HASTANESİNDE ARAŞTIRMA

    Directory of Open Access Journals (Sweden)

    Emrah TOKGÖZ

    2013-01-01

    Full Text Available ÖRGÜTSEL GÜVEN, ÖRGÜTSEL ÖZDEŞLEŞME VE ÖRGÜTSEL VATANDAŞLIK DAVRANIŞI ARASINDAKİ İLİŞKİ: BİR DEVLET HASTANESİNDE ARAŞTIRMAÖzet: Bilimciler, örgütsel davranış kavramlarından biri olan örgütsel vatandaşlık davranışını verimlilik ve etkinliği artırıcı en önemli değişkenlerden biri olarak kabul etmişlerdir. Yapılan araştırmalarda örgütsel vatandaşlık davranışlarıyla sonuçlandığı düşünülen birçok bağımsız değişken ileri sürülmüştür. Bu bağımsız değişkenlerden en önemlilerinden biri örgütsel güven kavramıdır. Bu araştırmalarda, örgütsel güven ile örgütsel vatandaşlık davranışı arasındaki ilişkiye aracılık yapabilecek faktörler aranmıştır. Bu çalışmada diğerlerinden farklı olarak, örgütsel özdeşleşmenin, örgütsel güven ile örgütsel vatandaşlık davranışı arasındaki ilişkiye aracılık etkisi yapacağı ileri sürülmüştür. Bu nedenle araştırmanın örneklemi, Balıkesir Devlet Hastanesi ve Balıkesir Ağız ve Diş Sağlığı Merkezi’ndeki 220 işgörenden anket aracılığıyla elde edilmiştir. Araştırma bulgularına göre, örgütsel güven, örgütsel özdeşleşme ve örgütsel vatandaşlık davranışı arasında anlamlı ve pozitif bir ilişki vardır. Ayrıca, örgütsel özdeşleşme, örgütsel güven ve örgütsel vatandaşlık davranışı arasındaki ilişkide aracılık rolü oynamıştır.RELATIONSHIP BETWEEN ORGANIZATIONAL TRUST, ORGANIZATIONAL IDENTIFICATION AND ORGANIZATIONAL CITIZENSHIP BEHAVIOR: A STUDY AT A STATE HOSPITALAbstract: Organizational citizenship behavior, which increases productivity and efficiency, has been recognized as one of the most important concepts of organizational behavior by scientists. Organizational citizenship behaviors are thought to result in many of the studies suggested that the independent variable. The concept of organizational trust is one of the most important

  16. Bölgesel Gelişmişlik Farklılıklarının Bir SosyoEkonomik Politika Göstergesi Olan Sağlık Verileri Kapsamında Değerlendirilmesi: TRB1 Bölgesi Örneği (As A Socio-Economic Policy, Researching Regional Development Differences With Health Datas: TRB1 Region

    Directory of Open Access Journals (Sweden)

    Ali Rıza GÖKBUNAR

    2016-01-01

    ölgelerin ihtiyaçlarının hızla karşılanması hedeflenmiştir. Bu kapsamda gerek kalkınma ajansları gerekse yerel ve merkezi otoritelerce faklı politikalar yürütülmektedir. Çalışmamız TRB1 bölgesinin sağlık alanında bölgesel gelişmişlik düzeyini ortaya koymak amacıyla bölgenin sağlık verilerini Türkiye geneliyle karşılaştırmaktadır. İncelenen veriler kapsamında bölgedeki sağlık yatırımlarını da kapsayan kamu yatırımları artış trendi bölgede ve Türkiye’de benzer bir seyir izlemektedir. Bölgede sağlık personeli artış hızı incelenen dönemde Türkiye ortalamasının üzerinde yer almaktadır. Bölgedeki yüzbin kişiye düşen yatak sayısı da Türkiye ortalamasının üzerinde yer almaktadır. İncelenen sağlık göstergelerinden negatif bir gösterge olarak sadece bebek ölüm oranı bölgede Türkiye ortalamasının üzerinde yer almaktadır.

  17. TÜRKİYE ÖZEL VE KAMU SAĞLIK SİGORTACILIĞI PRİM/HASAR SAĞLIK HARCAMASI DEĞERLENDİRMESİ

    Directory of Open Access Journals (Sweden)

    Güvenç KOÇKAYA

    2016-01-01

    Full Text Available Reforms under Health Transformation Program was commenced in 2002 by Ministry of Health in Turkey brings significant improvements. These changes targeted at improving access to health services(HS and quality of HS. Social Security Institution(SSI is only government payer covering of population. In addition to public health insurance(HI there are also private HI companies(PHIC covering 3% of population. Aim of analysis is to understand difference between premium/claims of HI system in Turkey. With this aim the official data of premiums and claims of PHIC for years 2009-2013 was obtained from Turkish PHIC Association together with same data of government HI for the same years was obtained from SSI. Descriptive analysis were conducted with premiums and claims data of government and private health insurers. Total collected preimum of PHIC were 2.3 billion TL and claims were 1.7 billion TL on the year 2013. Premiums and claims of PHIC per capita were 822 TL and 631TL in 2013, respectively. Difference of premium/claims of all PHC was equal to 638 million TL or 26%. Same year, premiums and claims of SSI for HI were 53 billion and 49.9 billion TL. Premiums and claims of SSI per capita were 691 TL and 650 TL in 2013, respectively. Difference of premiums/claims of SSI HI was 4.1 billion and 6%. SSI has become monopsonic payer in health system with HI premium collection from all citizens. SSI determines its revenues and costs as it also determines the premium levels and reimbursement price of HS. This shows the success of SSI`s management while covering the whole population for a very comprehensive health care package. However, the SSI`s per capita premium is lower and its claims is higher than private sector averages. Question marks that come upon the productivity issue imply that the situation should be examined thoroughly.

  18. Vähemused tüliks EL-is / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Euroopa Komisjoni pressiesindaja Diego de Ojeda sõnul on Venemaa andnud nõusoleku partnerlusleppe laiendamiseks uutele EL-i riikidele alates 1. maist. Ainsaks probleemiks laieneva EL-i ja Venemaa suhetes jääb vähemustemaatika

  19. llköğretim Öğretmenlerinde Tükenmişlik

    Directory of Open Access Journals (Sweden)

    Bülent GÜNDÜZ

    2005-06-01

    Full Text Available Bu çalmann amac, öretmenlerde tükenmiliin; ‘mezun olunan okul’ ve ‘sosyal destekkayna’ deikenlerine göre farkllap farkllamadn incelemektir. Aratrmaya 2003-2004öretim ylnda Mersin ilindeki devlet ve özel ilköretim okullarnda görev yapan 633 öretmenkatlmtr. Aratrmada, tükenmilii ölçmek için Maslach ve Jackson (1981 tarafndan gelitirilenve Türkçe’ye Ergin (1992 tarafndan uyarlanan Maslach Tükenmilik Envanteri (MTE; kiisel vemesleki özellikleri belirlemek üzere aratrmac tarafndan gelitirilen Kiisel Bilgi Formukullanlmtr. Aratrmadan elde edilen verilerin istatistiksel analizleri için SPSS paket programnn11.0 sürümü kullanlm, ANOVA ve t testinden yararlanlmtr. Post-hoc test olarak Tukey testikullanlan aratrmada hata pay üst snr 0.05 olarak kabul edilmitir. Öretmenlerin meslekideikenleri ile MTE alt ölçek puanlar incelendiinde; duygusal tükenmilik, duyarszlama vekiisel baar alt ölçek puanlarnn, mezun olunan okul ve sosyal destek kaynana göre farkllatgörülmütür.

  20. Suur maksukoormus kasvule kasuks ei tule / Andrus Säälik

    Index Scriptorium Estoniae

    Säälik, Andrus

    2003-01-01

    Autor teeb ülevaate Eestis toimunud ja plaanisolevatest maksumuudatustest ja tõdeb, et tänu suunale maksukoormuse vähendamiseks kuulub Eesti rahvusvahelises võrdluses madalama maksukoormusega riikide hulka. Autor analüüsib maksude positiivset ja pärssivat mõju majandusele. Lisa: 45% maksukoormus pärsib majanduskasvu

  1. Hoolimata ülikõrgest intressist võetakse mobiili teel agaralt laenu / Signe Kalberg

    Index Scriptorium Estoniae

    Kalberg, Signe, 1959-

    2006-01-01

    Osaühingu SMS Laen pakutavat SMS-laenu on võtnud praeguseks ligi 10 000 inimest, firma loodab hõivata kolmandiku mobiillaenude turust. Teistest SMS-i vahendusel laenu pakkujatest. Lisad: Eesti Pank hoiatab liiga agaraid; Hätta võib sattuda 4500 laenanud peret; Eesti Panga prognoos

  2. Küülik kübarast, sperma naise tüvirakkudest / Maris Meiessaar

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2008-01-01

    Briti teadlased on valmis muutma naise luuüdi spermaks ning mehi sellega elu loomise protsessist kõrvale jätma. Newcastle upon Tyneѫi ülikooli teadlased loodavad oma tehnikast abi viljatuse ravimiseks

  3. EList ja tööpuudusest / Andrus Säälik

    Index Scriptorium Estoniae

    Säälik, Andrus

    2003-01-01

    Ilmunud ka: Delovõje Vedomosti 3. september lk. 9. Vastukaja 19.augusti Äripäevas ilmunud Uno Silbergi artiklile "Euroliitumine toob kaasa tööpuuduse kasvu". Diagrammid: tööpuuduse dünaamika Kesk- ja Ida-Euroopa riikides 1991-2002; tööpuuduse dünaamika Soomes, Rootsis, Iirimaal, USA-s, Jaapanis ja Euroopa Liidus 1970-2000

  4. Küülik kübarast, sperma naise tüvirakkudest / Maris Meiessaar

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2008-01-01

    Briti teadlased on valmis muutma naise luuüdi spermaks ning mehi sellega elu loomise protsessist kõrvale jätma. Newcastle upon Tyneѫi ülikooli teadlased loodavad oma tehnikast abi viljatuse ravimiseks

  5. Hoolimata ülikõrgest intressist võetakse mobiili teel agaralt laenu / Signe Kalberg

    Index Scriptorium Estoniae

    Kalberg, Signe, 1959-

    2006-01-01

    Osaühingu SMS Laen pakutavat SMS-laenu on võtnud praeguseks ligi 10 000 inimest, firma loodab hõivata kolmandiku mobiillaenude turust. Teistest SMS-i vahendusel laenu pakkujatest. Lisad: Eesti Pank hoiatab liiga agaraid; Hätta võib sattuda 4500 laenanud peret; Eesti Panga prognoos

  6. Vähemused tüliks EL-is / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Euroopa Komisjoni pressiesindaja Diego de Ojeda sõnul on Venemaa andnud nõusoleku partnerlusleppe laiendamiseks uutele EL-i riikidele alates 1. maist. Ainsaks probleemiks laieneva EL-i ja Venemaa suhetes jääb vähemustemaatika

  7. POZİTİF ÖRGÜTSEL DAVRANIŞ DEĞİŞKENLERİ İLE YENİ ARAŞTIRMA MODELLERİ GELİŞTİRME ARAYIŞLARI: POZİTİF ÖRGÜTSEL DAVRANIŞ DEĞİŞKENLERİNİN İŞE ADANMIŞLIK, TÜKENMİŞLİK VE SİNİZM ÜZERİNE ETKİLERİ VE BU ETKİLEŞİMDE ÖRGÜTSEL ADALET ALGISININ ARACILIK ROLÜ ÜZERİNE BİR ARAŞTIRMA (TOWARDS DEVELOPING NEW RESEARCH MODELS WITH POSITIVE ORGANIZATIONAL BEHAVIOUR VARIABLES: IMPACT OF POSITIVE ORGANIZATIONAL BEHAVIOUR VARIABLES ON CYNISM, BURNOUT AND WORK ENGAGEMENT AND MEDIATING ROLE OF PERCEPTION OF ORGANIZATIONAL JUSTICE IN THIS INTERACTION

    Directory of Open Access Journals (Sweden)

    Sezer Cihan ÇALIŞKAN

    2014-07-01

    Full Text Available ÖZ: Bu araştırmanın amacı, yazında 2000’li yıllardan sonra önemi giderek artan pozitif örgütsel davranış değişkenlerinin (ümit, iyimserlik, dayanıklılık ve öz-yeterlilik işletmeler açısından önemini vurgulayarak, çalışan davranışları üzerindeki etkilerini ortaya koymaktır. Araştırma modeli çerçevesinde, pozitif örgütsel davranış değişkenleri ile ilişkili olabilecek iki olumsuz çalışan davranışı (“sinizm” ve “tükenmişlik” ve bunlara zıtlık teşkil eden ve kendisi de pozitif örgütsel davranış akımının bir parçası olarak kabul edilen“işe adanmışlık” kavramları bağımlı değişkenler olarak seçilmiştir. Araştırma bulguları, pozitif örgütsel davranış değişkenlerinin, işe adanmışlık üzerinde pozitif yönlü, anlamlı bir açıklayıcı güce sahip olduğunu ve tükenmişlik ve sinizm üzerinde ise negatif yönlü anlamlı bir açıklayıcı güce sahip olduğunu doğrulamaktadır. Araştırma modelinde bu doğrudan etkileşimlerin yanı sıra, örgütsel adalet değişkeninin aracılık etkisi de test edilmiş ve tükenmişlik ve sinizm değişkenleri için ara değişken etkisi kanıtlanmıştır. Sonuç ve tartışma kısmında bulguların yönetim uygulamalarına etkisi tartışılmakta ve geleceğe yönelik araştırma modeli önerileri getirilmektedir. Anahtar Kelimeler: Pozitif Örgütsel Davranış Değişkenleri, Çalışmaya Tutkunluk, Tükenmişlik, Sinizm, Örgütsel Adalet Algısı. ABSTRACT: The purpose of this study is to prove the importance of Positive Organizational Behaviour variables (hope, optimism, resiliency and self-efficacy on employee attitudes and behaviours and business companies. Within the scope of the research model, “cynism” and “burnout” which can be considered as negative and counterproductive employee attitudes and “work engagement” which is also considered as one of the dimensions of positive organizational

  8. Ajutine juht - jube kallis, aga see-eest väga kasu(m)lik / Irja Rae

    Index Scriptorium Estoniae

    Rae, Irja

    2005-01-01

    Ajutise juhi (interim manager) ehk üleminekujuhi palkamisest ettevõttes. Vt. samas: Kus teda näha võib. Kommenteerib juhtimiskonsultatsioonide firma PW Partnersi vanemkonsultant Jana Võrk. Vt. samas: Keskpaik, Ivar. Eesti tuntuim üleminekujuht

  9. Ajutine juht - jube kallis, aga see-eest väga kasu(m)lik / Irja Rae

    Index Scriptorium Estoniae

    Rae, Irja

    2005-01-01

    Ajutise juhi (interim manager) ehk üleminekujuhi palkamisest ettevõttes. Vt. samas: Kus teda näha võib. Kommenteerib juhtimiskonsultatsioonide firma PW Partnersi vanemkonsultant Jana Võrk. Vt. samas: Keskpaik, Ivar. Eesti tuntuim üleminekujuht

  10. Raamat, milleta ma oma eriala ette ei kujuta / Tõnu Kollo

    Index Scriptorium Estoniae

    Kollo, Tõnu, 1948-

    2014-01-01

    Raamatututvustus: Perelman, Jakov. Elav matemaatika : lugusid matemaatikast ja nuputamisülesandeid. Tallinn, 1989. Anderson, Theodore W. An Introduction to Multivariate Statistical Analysis. Wiley, 2003

  11. Raamat, milleta ma oma eriala ette ei kujuta / Tõnu Kollo

    Index Scriptorium Estoniae

    Kollo, Tõnu, 1948-

    2014-01-01

    Raamatututvustus: Perelman, Jakov. Elav matemaatika : lugusid matemaatikast ja nuputamisülesandeid. Tallinn, 1989. Anderson, Theodore W. An Introduction to Multivariate Statistical Analysis. Wiley, 2003

  12. Õpetajad pälvisid tunnustuse / Bianca Mikovitš

    Index Scriptorium Estoniae

    Mikovitš, Bianca

    2006-01-01

    Tallinnas toimunud Euroopa innovaatiliste õpetajate foorumil tunnistati Türi Gümnaasiumi õpetajad Kristel Vahtra ja Laine Aluoja Euroopa uuendusmeelseimaks. Õpetajad koostasid 18 ainetunnise õppekava, mille alusel pidid 6. ja 9. klasside õpilased ühistööna koostama virtuaalse ajakirja teemal "Eeskujud aitavad soorolle kujundada"

  13. TEMEL ETİK KURAMLAR AÇISINDAN ADALET ve SAĞLIK HAKKI KAVRAMLARININ DEĞERLENDİRMESİ1,2

    Science.gov (United States)

    Ekmekçi, Perihan Elif; Arda, Berna

    2015-01-01

    Sağlık hakkı temel bir insan hakkıdır. Ancak günümüzde sağlık hakkının hayata geçmesi, sağlık sunumunda gereksinim duyulan kaynakların kısıtlı olması nedeniyle engeller ile karşılaşmaktadır. Ayrıca tıp alanındaki hızlı teknolojik ilerlemeler, tanı ve tedavi imkânlarının her geçen gün gelişmesine yol açmaktadır. Bu durum, sağlık hizmetlerinin sunumunu dağıtıcı adaletin bir süjesi haline getirmektedir. Adalet kavramının tanımlanabilmesi için öncelikle, birey ya da toplulukların bir şeye ilişkin hak talebinde bulunmalarının koşullarını tanımlanmalı daha sonra hak edilenin kim tarafından ve nasıl verileceğinin belirlenmelidir. Etik kuramlar, etik açıdan doğru eyleyebilmek için hangi dayanak noktalarından yola çıkarak hangi değerleri önceleyerek karar vermek gerektiği konusunda kendi paradigmalarını oluşturmuşlardır. Adalet ve sağlık hakkı gibi temel kavramlar, temel etik kuramlar tarafından, o kuramın bağlamı içinde değerlendirilmekte ve anlam kazanmaktadır. Sağlık hakkı bazı etik kuramlar tarafından insan varlığının doğal bir bileşeni olarak tanımlanırken, bazı etik kuramlar tarafından bağlamsal olarak kabul edilmekte bazıları tarafından ise reddedilmekte, adalet kavramı ve bağlantılı olarak adaletin materyal ve formal ilkeleri gibi kavramların içerikleri ve taşıdıkları değerler içinden bakılan etik kuramın paradigmasına bağlı olarak farklıklar içermektedir. Etik kuramların paradigmaları sadece kavramların tanımlanmasında değil, aynı zamanda pratik uygulamalarda da farklı yaklaşımları gerektirmektedir. Bu çalışmada, erdem etiği, faydacı etik kuram, ödev etiği, liberal etik kuram ve kommuniteryan etik kuramın adalet ve sağlık hakkını nasıl kavramsallaştırdıklarını ortaya konmaktır. Bu amaçla öncelikle her bir etik kuramın genel çerçevesi tanımlanmış ve bu çerçevenin çizdiği teorik paradigma içinde adalet kavramının konumlandırılışı anlatılmıştır. Ardından her bir etik kuram bağlamında sağlık hakkı kavramının temellendirilmesinin imkânı tartışılmıştır. PMID:26677346

  14. Patau sendromlu üç olgu: Sendroma klinik triad (mikroftalmi, yarık dudak/ damak, polidaktili) her zaman eşlik eder mi?

    OpenAIRE

    Hazan, F; Olukman, Ö; Gökaslan, F; Çalkavur, Ş; Meşe, T; Tavlı, V.; Atlıhan, F

    2013-01-01

    Trisomy 13 (Patau's syndrome) is a chromosomal disease characterized by midline defects, central nervous system, heart, urogenital system anomalies and motor mental retardation. The prevalence is between 1:10.000 and 1:20.000 births. A vast majority of the patients die in the first year. Patau's syndrome is characterized by the clinical triad including microphtalmia, cleft lip/palate, and polydactyly. Here, we present three patients who were diagnosed with Patau's syndrome both clinically and...

  15. VATANDAŞLIK VE DEMOKRASİ EĞİTİMİNDE MASAL KULLANIMI / USE OF TALES IN CITIZENSHIP AND DEMOCRACY EDUCATION

    Directory of Open Access Journals (Sweden)

    Mehmet Fatih YİĞİT

    2015-09-01

    Full Text Available Türk halk edebiyatının kapsamına giren anonim türler, geçmişten günümüze kültürel etkileşimi ve iletişimi sağlayan bir köprü işlevindedir. Anonim halk edebiyatının nesir türlerinden biri olan ve halk arasında en çok ilgi görenlerinden birisi de masallardır. Evrensel bir anlatı türü olan ve muhtevasında toplumların kültürel zenginliklerini barındıran masallar, yüzyıllar boyu gerek sözlü ve gerekse yazılı kültür ortamı içerisinde gelişmiş, daha sonra elektronik kültür ortamına aktarılmış ve işlevselliğini kaybetmeden günümüze intikal etmiştir. Halk biliminin bir bilim dalı olarak akademik hayattaki yerini almasıyla birlikte Türkiye’de masallar üzerine yapılan çalışmaların artmaya başladığını söyleyebiliriz. Çok kültürlü toplumlarda ortak değerlerin ön plana çıkarılmasının toplumsal barış ve huzur adına önemi büyüktür. Bu anlamda masallar, toplumlar arasındaki müşterek unsurları tespit etmede önemli bir rol üstlenirler. Bunun yanında toplumun genelinde kabul gören değerlerin bir anda ortaya çıkmadığı, bunların özellikle yaşça büyük olan bireyler tarafından yeni nesillere aktarıldığı ve öğretildiği düşünüldüğünde, masalların değerlerin aktarılmasında ne kadar önemli olduğu anlaşılacaktır. Yardımseverlik, doğruluk, bencil olmamak, yalan söylememek, misafirperverlik, büyüklere saygı, anne ve babaya saygı, fedakârlık, cömertlik, iyilik, açgözlü olmamak, paylaşmak ve adil olmak değerlerinin Naki Tezel’in derlemiş olduğu masallar aracılığıyla verilebileceği görülmektedir. Bu değerlerin masallar aracılığıyla öğretilmesi öğrencileri hem doğru vatandaş olma yolunda yetiştirecek, hem de millî ve manevi açıdan geçmişiyle kopuk olmayan nesillerin yetişmesine öncülük edecektir. Bu çalışmanın kapsamına giren masal metinleri Naki Tezel’in iki ciltten oluşan ve ilk baskısı 1971 yılında Millî Eğitim Basımevi tarafından gerçekleştirilip “Türk Kültürü Kaynak Eserleri” dizisi için hazırlanmış olan “Türk Masalları” adlı kitabından seçilmiştir. Çalışma kapsamında seçilen masallar nitel araştırma türlerinden biri olan ölçüt örnekleme kullanılarak belirlenmiştir. Bu çalışmada örneklem seçiminde ele alınacak olan ölçütler araştırmacılar tarafından belirlenmiştir. Buna göre, söz konusu eserde yer alan üç masalın Vatandaşlık ve Demokrasi Eğitimi ders kitabında verilmesi planlanan değerlerden en az iki değeri içeriyor olması temel ölçüt olarak alınmıştır. Masallar araştırmacılar tarafından farklı zamanlarda ve farklı mekânlarda okunmuş, içerdiği değerler not edilmiş ve daha sonra bu notlar bir araya getirilerek her iki araştırmacının üzerinde uzlaştığı ortak değerlerin bulunduğu masallar çalışmaya dâhil edilmiştir. / Anonymous Turkish folk stories play an important role in creating a cultural interaction of the past and present. Tales are among the most appealing anonymous folk literature types. Tales are also universal oral narrative contents that represent the cultural heritage of societies and have developed orally and in written over time. The last phase was to transfer those tales into electronic platforms and keep their functionality they have since the old times. We can say that the number of academic works on tales in Turkey has increased after accepting folklore as a scientific discipline. In this regard, we believe that highlighting the common values in a multicultural society has an important role on keeping social stability and peace. The tales can be effectively used in identifying those common values in such communities. Besides, if we think that socially accepted values are not existed suddenly and transferred to the next generations by the older people, the importance of the tales might be understood easily in transferring common values. In this study, we show that the values such as benevolence, righteousness, not to be selfish, not to lie, hospitality, respect for elders and parents, sacrifice, generosity, kindness, sharing and justice can be taught to students by using the tales compiled and transferred by Naki Tezel. Teaching those values through the tales selected in this study will train students in becoming good citizens and lead to the growth of generations that are not disconnected from their histories. The tales selected for our study were taken from the book titled ‘Turkish Tales’ by Naki Tezel prepared for “Turkish Culture Source Materials” series published by National Education Press in 1971. The tales were selected by using criterion sampling method which is among the methods of qualitative studies. The criteria for selecting the appropriate tales were selected by the authors. In this sense, the main criteria was to have tales containing at least two value judgements given in Citizenship and democracy education textbook. The tales were read by the researchers in different places. The researchers, then came together and compared their findings. Then, the researchers gave the final decisions about which tales should be selected.

  16. Maslach Tükenmişlik Envanteri-Eğitimci Formu’nu Türkçe’ye Uyarlama Çalışması

    Directory of Open Access Journals (Sweden)

    Nuri Barış İnce

    2015-11-01

    Full Text Available In this study, it is aimed to make Turkish adaptation study of Maslach Burnout Inventory-Educators Survey, which was obtained as a result of adaptation of Maslach Burnout Inventory, developed by Maslach and Jackson, to the educators with some modifications by Maslach, Jackson and Schwab. The study group of the research consisted of 760 classroom teachers working in central district and provinces of Ankara. Validity and reliability studies of the scale, of which the original form consists of 22 items in 7 point Likert type and 3 dimensions, (emotional exhaustion, depersonalization and personal accomplishment, applied to the study group in Turkish form indicated that the original structure of the scale has been preserved. Cronbach's alpha coefficient calculated separately for each sub-dimension was determined as 0.88 for emotional exhaustion, 0.78 for depersonalization and 0.74 for personal accomplishment. Considering the item-total correlations, the items in the scale are understood to have a good discrimination indice. Model-fit indices such as AGFI, GFI, RMSEA, CFI and NFI obtained as a result of confirmatory factor analysis applied for the construct validity show that the model established for compliance have acceptable level of model-fit.

  17. Maslach Tükenmişlik Envanteri-Eğitimci Formu’nu Türkçe’ye Uyarlama Çalışması

    OpenAIRE

    Nuri Barış İnce; Ali E. Şahin

    2015-01-01

    In this study, it is aimed to make Turkish adaptation study of Maslach Burnout Inventory-Educators Survey, which was obtained as a result of adaptation of Maslach Burnout Inventory, developed by Maslach and Jackson, to the educators with some modifications by Maslach, Jackson and Schwab. The study group of the research consisted of 760 classroom teachers working in central district and provinces of Ankara. Validity and reliability studies of the scale, of which the original form c...

  18. Patau sendromlu üç olgu: Sendroma klinik triad (mikroftalmi, yarık dudak/ damak, polidaktili) her zaman eşlik eder mi?

    OpenAIRE

    Hazan, F; Olukman, Ö; Gökaslan, F; Çalkavur, Ş; Meşe, T.; Tavlı, V.; Atlıhan, F

    2013-01-01

    Trisomy 13 (Patau's syndrome) is a chromosomal disease characterized by midline defects, central nervous system, heart, urogenital system anomalies and motor mental retardation. The prevalence is between 1:10.000 and 1:20.000 births. A vast majority of the patients die in the first year. Patau's syndrome is characterized by the clinical triad including microphtalmia, cleft lip/palate, and polydactyly. Here, we present three patients who were diagnosed with Patau's syndrome both clinically and...

  19. Ревель (Таллин) / Рига : рефлексии русских литераторов Латвии (1920-1930-е гг.) / Людмила Спорге

    Index Scriptorium Estoniae

    Спроге, Людмила

    2006-01-01

    Peamiselt ajakirjanduses ilmunud artiklite, reisikirjade ja ilukirjanduslike teoste alusel, autoriteks Ivan Lukaš, Juri Galitš, Andrei Sedõhh (tegel. Jakov Tsvibak), Nikolai Andrejev ja Andrei Mintslov

  20. Restavratsija monumenta-pamjatnika Sovetskomu soldatu

    Index Scriptorium Estoniae

    2003-01-01

    Berliini Treptow pargi Vene memoriaali monumendi "Nõukogude sõdurile" restaureerimisest. Nõukogude memoriaal Treptow pargis avati 8. mail 1949, autorite kollektiivi juhtisid arhitekt Jakov Belopolski ja skulptor Jevgeni Vutshetitsh

  1. Meenutusi kolleegidest / Jaan Einasto

    Index Scriptorium Estoniae

    Einasto, Jaan, 1929-

    2006-01-01

    Meenutusi Roopi Hallimäest, Taavet Rootsmäest, Vladimir Riivesest, Ernst Öpikust, Grigori Kuzminist, Aksel Kipperist, Gustav Naanist, Heino Eelsalust, Lauri Luuast, Charles Villmannist, Pavel Parenagost, Jevgeni Haradzest ja Jakov Zeldovitšist

  2. Dicty_cDB: CHS289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AATAATAATAATAATAAA AAATAAAGTTATNATAAAT sequence update 2002.10.25 Translated Amino Acid sequence gllei*qfk*lik**hyi*n*illqlynn...iiiiiknkvn**iylnk*kk--- ---ksnnsns*snsnitykikyyynytiifikknnnnnnnnkk*syxk Frame B: gllei*qfk*lik**hyi*n*illqlynn...itykikyyynytiifikknnnnnnnnkk*s*linifk*ikkk--- ---i*qfk*lik**hyi*n*illqlynnfykkk**

  3. TAMAMLAYICI BAKIM VE ALTERNATİF TEDAVİ YÖNTEMİ OLAN MÜZİK TERAPİYE İLİŞKİN SAĞLIK PROFESYONELLERİNİN GÖRÜŞLERİ

    OpenAIRE

    Ciğerci, Yeliz; Kurt, Hatice; Çelebi, Şerife

    2016-01-01

    Tanımlayıcı tipte planlanan bu çalışmada, sağlık profesyoneli olan doktor ve hemşirelerin, müzik terapiye ilişkin görüşlerinin belirlenmesi amaçlanmıştır. 07-25.03.2016 tarihleri arasında yapılan çalışmanın örneklemi, toplamda 219 sağlık profesyonelinden oluşmaktadır. Çalışmanın verileri iki bölümden oluşan anket formu ile toplanmıştır. Anketin birinci bölümü demografik bilgileri içeren 16, ikinci bölümü ise araştırmacılar tarafından literatür taranarak hazırlanan, hemşire v...

  4. LES INFLUENCES DES OBJETS DANS LA JALOUSIE D’ALAIN ROBBE-GRILLET / ALAIN ROBBE-GRILLET’NİN KISKANÇLIK ESERİNDE NESNELERİN ETKİLERİ

    Directory of Open Access Journals (Sweden)

    Emel ÖZKAYA

    2011-01-01

    Full Text Available Alain Robbe-Grillet, çok fazla seyahat etmesine neden olan ziraat mühendisliği mesleğini yapar. Bu meslek ona nesneleri ve insanları gözlemleme zevkini verir. Yazar, Yeni Roman’ın gelişip olgunlaşmasında kuramcı ve önde gelen üstadı olarak kabul edilir. Klasik romanın kişileri ön planda tutmasına karşılık, Yeni roman nesnelerin evreni olarak kabul edilir. Alain Robbe-Grillet’nin Kıskançlık isimli eseri bu belirgin aşamayı görmemize olanak sağlar. Romanın başlığında, hem bir duyguyu hem de bir nesneyi belirten çift anlam bulunur. Açıkçası, bu eserin ana konusu karısının tüm şüpheli davranışlarını ortaya koyan anlatıcı-kocanın kıskançlık duygusudur. Anlatı boyunca, karısının onu aldatıp aldatmadığından emin olamaz. Fakat Kıskançlık romanına yenilik katan şey, yazarın anlatı yöntemidir. Bu eserde her şey, karısı A.’yı gözlemleyen kıskanç anlatıcı-kocanın bakış açısından betimlenir. Yazar bize geleneksel bir tablo sunar, ki bu tablo evli bir kadın olan A.’dan, karısı Christiane’ı evde bırakarak düzenli bir şekilde onu ziyarete gelen evli erkek Franck’tan ve her şeyi gözlemleyen anlatıcı-kocadan oluşur. Kitap boyunca anlatıcının adının söylenmemesine rağmen, sıkıntıları ve kaygılarıyla onun var olduğunu anlarız. Kıskanç kişinin şüpheleri, görünümün düzenini, gözlemlenmiş detayların seçimini gizli bir şekilde doğrular.

  5. SAĞLIK KURUMLARINDA AĞIZDAN AĞIZA PAZARLAMA VE BİR PİLOT ÇALIŞMA - WORD OF MOUTH MARKETING IN HEALTH CARE ORGANIZATIONS AND A PILOT STUDY

    Directory of Open Access Journals (Sweden)

    Beyza UZUNAL

    2010-07-01

    Full Text Available Özet:Sağlık hizmetleri kişilerin sağlığının korunması, teşhis,tedavi ve bakım için kişisel ve kurumsal olarak kamu veya özelşahısların vermiş olduğu hizmetler olarak tanımlanabilir.Sağlık hizmeti sunan kuruluşlarda pazarlamanın amacı;işletme amaçlarına uygun olarak hedef pazarın tatmindüzeyini geliştirerek, tüketicilerin beklentilerini karşılayandaha nitelikli hizmetleri sunmaktır.Günümüzde sağlık hizmetleri, profesyonel işletmecilikanlayışıyla şekillenmektedir. Artık sağlık yöneticilerininhedefleri arasında, daha çok hastayı çekerek gelen hastalarımemnun etmek ve hastanın tekrar aynı hastaneyi tercihetmesini sağlamak yer almaktadır.Ağızdan ağıza pazarlama ise güvene dayanan, tüketicilerinçevrelerindeki sosyal bağlantılarıyla ve diğer tüketicilerleürünler / hizmetler / markalar hakkındaki bilgi alışverişidir.Günümüzde tüketicilerin kendi aralarında bilgi vedeneyimlerini paylaşımı, geleneksel reklam ve pazarlamafaaliyetleriyle birlikte giderek artan bir öneme sahip olmayabaşlamıştır.Bu çalışmada genel anlamda ağızdan ağıza pazarlamanıntemel kavramları hakkında bilgi verilerek, sağlık sektöründeağızdan ağza pazarlamanın etkinliği anlaşılmaya çalışılmıştır.Abstract:Health care can be described as service personallyand institutionally by public or private operations in order todiagnosis, treatment and care the health of individuals. Aim ofmarketing in institutions offering health care to improve thelevel target market’s satisfaction and the institutions is toreach by presenting more qualified service to meet theexpectancy of consumersNowadays health care services are shaped by a professionalbusiness approach. Among the objectives of health caremanagers who take more satisfied patients by pulling them andthe patients prefer to allow a repetition of the same hospital islocated.Word of mouth marketing is basically sharing knowledgeregarding the products/ services/brands with the socialnetwork and the other consumers, as well. Nowadaysconsumers sharing among themselves their knowledge andexperiences, as well as traditional advertising and marketingactivities have begun to have an increasingly important role.In this study, the overall knowledge about the basic concepts ofword of mouth marketing by giving word of mouth marketingin the health sector's activity has been analyzed.

  6. AVRUPA BİRLİĞİ ÜYESİ VE ADAY ÜLKELERİN SAĞLIK HARCAMALARI AÇISINDAN BENZERLİK VE FARKLILIK ANALİZİ

    Directory of Open Access Journals (Sweden)

    Canser BOZ

    2016-02-01

    Full Text Available Bu çalışmanın amacı, (Dünya Sağlık Örgütü WHO tarafından belirlenen temel sağlık harcaması göstergeleri çerçevesinde, Türkiye ve diğer AB üyesi-aday ülke konumundaki ülkelerin grafiksel düzlemde gösteriminin sağlanarak alt gruplara ayrılması, aralarında var olabilecek benzerlik ve farklılıkların ortaya konulması ve ülkemizin genel eğilime göre konumunun tespitinin yapılmasıdır. Dünya Sağlık Örgütü’nün açıklamış olduğu raporlardan ve istatistiklerden elde edilen veriler 28 ülke için toplanmış ve ilgili veriler Çok Boyutlu Ölçekleme (Multidimensional Scaling- MDS yöntemi ile analiz edilmiştir. MDS analizi sonucunda ülkelerin amaca uygun şekilde iki grup altında toplandıkları görülmüştür. Yapılan analiz sonucunda birinci boyutta Avusturya, Danimarka, Fransa, Almanya, Lüksemburg ve Hollanda analiz kapsamına alınan sağlık harcaması göstergeleri bakımından benzer ülkelerdir ve bir alt grup olarak düşünülebilirler. Ayrıca birinci boyutta Türkiye, Bulgaristan, Estonya, Letonya, Polonya, Romanya ve Makedonya’nın benzer ülke olarak algılandıkları tespit edilmiştir. Sağlık harcamaları açısından Türkiye’nin en benzer olduğu ülkelerin Polonya ve Romanya olduğu görülmüştür. Yirmi sekiz Avrupa ülkesi arasında sağlık harcaması göstergeleri bakımından Hollanda ve Kıbrıs birbirine en benzemez ülkelerdir. Farklılık matrisine göre Türkiye’nin sağlık harcamaları açısından en farklı olduğu ülkelerin ise Avusturya, Belçika, Kıbrıs, Danimarka, Fransa, Almanya, İrlanda, İsveç olduğu tespit edilmiştir. Kişi başına toplam sağlık harcaması düzeyi, ulusal sağlık harcamasının Gayri Safi Milli Hasıla (GSMH’daki payı, kişi başına toplam kamu sağlık harcaması düzeyi ve genel kamu harcamaları içinde kamu sağlık harcamalarının payı gibi göstergelerde Türkiye’nin gelişmiş Avrupa ülkelerinden geride olduğu görülmüştür.

  7. Tükenmişlik Kavramı: Birey ve Örgütler Açısından Önemi( The Concept of Burnout: Its Importance For Individuals and Organizations

    Directory of Open Access Journals (Sweden)

    Güler SAĞLAM ARI

    2008-01-01

    Full Text Available When the literature of burnout is examined from the first studies (Freudenberger,1974; Maslach ve Jackson,1981 up to today, it is seen that while on one hand the level of burnout in the wiev of different kinds of proffesions has been tried to be determined on the other hand the theoretical body relating the concept has been tried to be established. The purpose of this research is to establish a conceptual framework relating the concept of burnout. Burnout, which is formed by three sub-dimensions that are emotional exhaustion, depersonalization, low personal accomplishment shows itself by emotional, behavioural,and physical symptoms in the individuals.The gender, the age,the period of working,the personality,individual and social charachteristics such as social support, the workload, the level of controlling on work,the awards, the features relating to the work such as commitment to the organization and justice makes the level of burnout increase and decrease. Finally in this research the answer to the question of what could be done to overcome the burnout individually and in the organizational level is tried to be find.

  8. Özdemir Asaf Şiirinde Egzistansiyalist Ögeler ve “Kendi”lik Kavramı Existentialist Factors And The Concept Of Self In Özdemir Asaf’s Poems

    Directory of Open Access Journals (Sweden)

    Gökay DURMUŞ

    2013-03-01

    Full Text Available Özdemir Asaf, one of the person as of Republic Era TurkishPoetry, has not been adequately examined yet. Asaf is alwaysconsidered among self-contained persons in the studies of our literaturehistory but comprehensive and profound analyses are not done.Therefore, opinions and reasons for these opinions about theacknowledgement of his self-containment are discussed in theintroduction, The middle part of the study is about his poems acquiringexistentialism as a framework since existentialism is the focus of hispoetics and perception of life. For this reason, first, the main principlesof existentialism are introduced in this section. The effect of thisphilosophical system on contemporary writers and on the atmosphere ofour literature and the repercussion met in this atmosphere werereviewed. The traces of existentialism in Turkish literature are alsomonitored.The issue that how Asaf expresses the main principles ofexistentialism in his poems creates the frame of middle part of thisstudy Özdemir Asaf was affected by the approach of existentialism tohuman beings. The essence of this approach is human who was sent tothis world without his will, but nonetheless he alters this negativity bycorrect choices, and who was expected to determine his ownpredestination.Özdemir Asaf accepts the second person, i.e., “you” as the centerand addresses to all humans via “you”. While doing this, Özdemir Asafuses his poems as his tools, weaves them with thought, and warns“you” to be yourself, not to leave someone else the management of yourlife, and to value worldly life. Because he thinks that an individual canalso coordinate social life and increase human life and ethic standardsby valuing his own life. Thus, that the poet’s invitations towards “you”can influence all readers desiring to comprehend the poem they havebeen reading.In the last section, the essence of those opinions examinedpreviously was stressed and it was concluded that the poet reflects theprinciple of “being himself” to his own life too. Özdemir Asaf, Cumhuriyet Dönemi Türk Şiiri’nin henüz yeterince tahlil edilmemiş isimlerinden birisidir. Asaf, edebiyat tarihimize yönelik çalışmalarda, daima, “müstakil şahsiyetler” arasında sayılır; fakat şiiriyle ilgili geniş ve derin analizler yapılmaz. Bu nedenle çalışmanın giriş bölümünde, Asaf’ın müstakil kabul edilişine dair kanılar ve bu kanıların nedenleri tartışılmıştır.Çalışmanın gelişme bölümü, Asaf’ın egzistansiyalizmi arka plan edinen şiiri üzerine kuruludur; çünkü egzistansiyalizm onun hem yaşam algısının hem de poetikasının odak noktasıdır. Bu nedenle, bölümde önce, egzistansiyalizmin temel ilkeleri tanıtılmaya çalışılmıştır. Bu felsefî sistemin, Asaf’la çağdaş edebiyatçılara ve edebiyat ortamımıza etkisine, bu ortamda bulduğu yankıya da değinilmiş; Türk edebiyatında egzistansiyalizmin izi sürülmüştür.Asaf’ın egzistansiyalizmin ilkelerini şiirine nasıl yansıttığı meselesi, gelişme bölümünün çatısını oluşturmaktadır. Özdemir Asaf, egzistansiyalizmin, insana yaklaşım tarzından etkilenmiştir. Bu yaklaşımın özünü, dünyaya kendi iradesi dışında gönderildiği halde, bu olumsuzluğu lehine çevirmesi, böylece yapacağı doğru seçimlerle, yazgısını kendi elleriyle yazması beklenen insan oluşturmaktadır.Özdemir Asaf, ikinci kişiyi, yani “sen”i merkez edinir ve “sen” aracılığıyla tüm insanlığa seslenir. Bunu yaparken şiiri vasıta kılan, dolayısıyla düşünce şiiri yazan Özdemir Asaf, “sen”i, kendi olması, hayatının yönetimini başkalarına devretmemesi ve dünyevî yaşamını değerli kılması için uyarır. Çünkü her bir bireyin, kendi yaşamını değerli kılarak, toplumun da yaşamını düzenleyeceğini, toplumun yaşam ve ahlâk standardını yükselteceğini düşünür. Dolayısıyla şairin “sen”e yönelik çağrıları, okuduğu şiire nüfuz etmeye çalışan her okurda yankı bulabilecek türdendir.Sonuç bölümünde ise çalışmanın seyri içinde daha önce varılan yargıların özü üzerinde durulmuş ve şairin “kendi olmak” ilkesini hayatına da yansıttığı kanısına varılmıştır.

  9. Detjam kapitana Granta privezli iz Ameriki bizonov i straussov / Margarita Golovanova

    Index Scriptorium Estoniae

    Golovanova, Margarita

    2006-01-01

    Kuidas "Mosfilmis" filmiti Jules Verne'i järgi mängufilmi "Kapten Granti lapsed" : režissöör Vladimir Vainshtok : helilooja Isaak Dunajevski : näitlejad Nikolai Tsherkassov, Jakov Segel : NSV Liit 1936

  10. Beg / Aleksandr Vais

    Index Scriptorium Estoniae

    Vais, Aleksandr

    2006-01-01

    Mihhail Bulgakovi teoste esimene ekraniseering Nõukogude Liidus "Põgenemine" ("Beg") : režissöörid Aleksandr Alov, Vladimir Naumov : Mosfilm 1970. Ajaloolisest taustast, eelkõige kindral Hludovi (Vladislav Dvorzhetski) prototüübist Jakov Slashtshov-Krõmskist (1886-1929)

  11. Detjam kapitana Granta privezli iz Ameriki bizonov i straussov / Margarita Golovanova

    Index Scriptorium Estoniae

    Golovanova, Margarita

    2006-01-01

    Kuidas "Mosfilmis" filmiti Jules Verne'i järgi mängufilmi "Kapten Granti lapsed" : režissöör Vladimir Vainshtok : helilooja Isaak Dunajevski : näitlejad Nikolai Tsherkassov, Jakov Segel : NSV Liit 1936

  12. Paksud modellid uuesti löögi all / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2009-01-01

    Mõne aasta eest läks moemaailmas moodi ülikõhnade modellide tõrjumine. Saksa moeajakiri "Brigitte" otsustas edaspidi avaldada "reaalsete naiste" pilte, kuid selle vastu on saksa moekunstnik Karl Lagerfeld. Prantsuse moekunstniku Ralph Laureni reklaamfotol töödeldi modell Filippa Hamilton digitaalselt ülikõhnaks

  13. Kaks head naist - üks istub saalis, teine mängib laval / Aime Jõgi

    Index Scriptorium Estoniae

    Jõgi, Aime, 1958-

    2005-01-01

    3. dets. esietendub Ugalas E. Vetemaa "Püha Susanna ehk Meistrite kool", lavastab näitlejanna L. Säälik, peaosalist mängib L. Komissarov. Kommenteerivad ka teatrijuht Peeter Tammearu ja lavastaja Leila Säälik

  14. Eksperimente ja kilde kultuuriloost / Riina Mägi

    Index Scriptorium Estoniae

    Mägi, Riina, 1957-

    2008-01-01

    Theodor Lutsu 13. filmipäevad ja 10. lahtine lühifilmide konkurss Palamusel 15. augustil. Auhinnatud filmidest (anima-, dokumentaal-, mängu- ja ekperimentaalfilmid). Žüriisse kuulusid Helle Karis, Jaak Lõhmus, Erika Laansalu ja Tiina Säälik. Filmipäevade korraldajad olid taas Tiina Säälik ja Arne Tegelmann

  15. Bağlılık Boyutlarının Tükenmişlik Boyutları Üzerindeki Etkisinin İncelenmesi(An Analysis about The Effects of Commitment Dimensions on The Burnout Dimensions

    Directory of Open Access Journals (Sweden)

    Sema POLATCI

    2014-12-01

    Full Text Available The purpose of this study was to explore the effect of commitment dimensions - affective commitment, continuance commitment, normative commitment- on the burnout dimensions - emotional exhaustion, depersonalization, personal accomplishment. Within this aim a model was developed which handle the dimensions of organizational commitment and burnout. The sample of this study consists of 192 health personnel working in a private hospital. According to the results increase in affective and normative commitment cause decrease in emotional exhaustion and depersonalization, also increase in personal accomplishment. On the other hand increase in continuance commitment causes increase in emotional exhaustion and depersonalization, also decrease in personal accomplishment.

  16. Al-Ṭaṣawwuf fī Indūnīsīyā: Dirāsah li Nuskhah al-Kitāb Maṭālib al-Sālikīn Ta’līf Yūsuf al-Makāsārī

    Directory of Open Access Journals (Sweden)

    Awis Kami

    2014-03-01

    Full Text Available Muhammad Yusuf al-Makasari (1627-1699 was one of the Muslim thinkers Nusantara (Indonesian who lived around the leading 17th century. The other two are Nuruddin ar-Raniri (d. 1658 and as-Singkili Abdurrauf (1615-1693 derived from the Sultanate of Aceh .Yusuf al-Makasari has devoted his life to the propagation of Islam. He has focused his attention on the study of various fields, especially with respect to kalam (theology, tasawwuf (Sufism, and the shari'ah (Islamic law and write no less than 23 books in Arabic.Matalib al-Salikin (MS is one of the interesting work of Yusuf al-Makasari. Arable field which he wrestled in this book is tasawwuf, with the main thesis of the separation between tawhid impossible (oneness of God , ma'rifah (divine knowledge, and worship (Rite. He maintains the view that if someone lost one of the elements of the integral, then it has fallen on an idolatrous attitude.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v3i2.810

  17. İŞYERİNDE MOBBİNG DAVRANIŞLARININ SPOR VE FİZİKSEL ETKİNLİK İŞLETMELERİ ÇALIŞANLARININ ÖRGÜTSEL VATANDAŞLIK DAVRANIŞINA ETKİSİ

    Directory of Open Access Journals (Sweden)

    Süleyman Murat YILDIZ

    2016-03-01

    Full Text Available ÖZ: Bu çalışmada spor ve fiziksel etkinlik hizmeti sunan işletmelerde, mobbingin örgütsel vatandaşlık davranışına etkisi incelenmiştir. Veriler ticari olarak faaliyet gösteren fitness merkezleri ve yüzme havuzu işletmelerinde görev yapan antrenörler ile Spor Genel Müdürlüğü taşra teşkilatı çalışanlarından elde edilmiştir. Veri toplama aracı olarak, mobbingi ölçmede Einarsen, Hoelb ve Notelaers’in (2009 geliştirdiği “Olumsuz Davranışlar Ölçeği”, örgütsel vatandaşlık davranışını ölçmede ise Bolat’ın (2008 geliştirdiği örgütsel vatandaşlık davranışı ölçeği kullanılmıştır. Araştırma hipotezlerini test etmek amacıyla korelasyon analizi ile hiyerarşik regresyon analizi uygulanmıştır. Elde edilen bulgular mobbingin örgütsel vatandaşlık davranışı üzerinde orta düzeyde, anlamlı ve negatif etkili olduğunu ortaya koymuştur. ABSTRACT: In this study, the effect of mobbing on organizational citizenship behavior in sports and physical activity organizations was investigated. The data were obtained from the trainers of swimming and fitness centers and the employees of Sports General Directorate. Negative Acts Questionnaire-Revised scale developed by Einarsen, Hoelb, and Notelaers (2009 was used to measure mobbing and organizational citizenship behavior scale developed by Bolat (2008 was used to organizational citizenship behavior. In order to test the hypothesis of this study, correlation analyzes and hierarchical regression analyzes were applied. The findings of the study demonstrated that mobbing significantly and inversely influenced organizational citizenship behavior of trainers and employees.

  18. ÖĞRETMENLERİN ÖRGÜTSEL BAĞLILIKLARININ, ÖRGÜTSEL VATANDAŞLIK DAVRANIŞLARI ÜZERİNDEKİ ETKİSİ: NEVŞEHİR İLİ ÖRNEĞİ - THE EFFECT OF TEACHER’S ORGANIZATIONAL COMMITMENT ON THEIR ORGANIZATIONAL CITIZENSHIP BEHAVIORS: CASE OF NEVSEHİR

    Directory of Open Access Journals (Sweden)

    Korhan KARACAOĞLU

    2010-07-01

    Full Text Available Özet:Bu araştırmanın amacı, öğretmenlerin örgütselbağlılıkları ile örgütsel vatandaşlık davranışları arasındakiilişki ve etkileşimin belirlenmesinden oluşmaktadır.Araştırmanın örneklemini Nevşehir İl Merkezinde bulunandokuz ortaöğretim okulunda çalışan toplam 206 öğretmenoluşturmaktadır. Araştırmada kullanılan veriler, iki ölçektenoluşan anket yardımı ile toplanmıştır.Araştırma bulgularına göre, öğretmenlerin örgütselbağlılıkları ile örgütsel vatandaşlık davranışları arasındapozitif yönde fakat düşük bir ilişkinin olduğu, regresyonanalizi sonuçlarına göre ise, eğitim çalışanlarının örgütselvatandaşlık davranışlarının ortaya çıkmasında, örgütselbağlılığın boyutlarından duygusal bağlılık ve normatif(minnet bağlılık boyutlarının etkili olduğu tespit edilmiştir.Ayrıca çalışanların örgütsel vatandaşlık davranışınındemografik değişkenlerden yaşa göre, örgütsel bağlılığın isegörev yapılan okullara göre farklılık gösterdiği tespitedilmiştir.Abstract:The purpose of this research is the determination of therelationship and interactions between teachers’ organizationalcommitment and their organizational citizenship behaviors.The sample of this research is 206 teachers working at 9 differenthigh schools in Nevsehir. Data used in this research wasgathered by a questionnaire composed of two scales.According to research findings, it was determined that there is apositive but low correlation between the teachers’ organizationalcommitment and their organizational citizenship behaviors. Onthe other hand, according to regression analysis findings,affective and normative commitment, the dimensions of theorganizational commitment, are effective on the organizationalcitizenship behavior. Also, it was found that organizationalcitizenship behavior varies by age and organizationalcommitment varies by schools.

  19. Еще раз о тайне иконы "Литургия Господня" / Елена Погосян, Мария Сморжевских-Смирнова

    Index Scriptorium Estoniae

    Погосян, Елена

    2009-01-01

    Tallinna Nikolai kiriku ikonostaasi juurde kuuluvast ikoonist. Ikooni valmimisajaks on pakutud detsembrit 1711, mil Peeter I külastas Tallinna. Tellis selle kohalikult ikoonimaalijalt Aleksandr Menšikov. Ikooni tõlgendatakse 1711. a. toimunud sündmuste põhjal Peeter I elus ja Põhjasõja käigus: lahing Pruti jõel, rahuleping Türgiga, Jakov Dolgorukovi põgenemine Rootsi sõjavangist jne.

  20. Soome-ugri IV maailmakongressi kunstiprogramm

    Index Scriptorium Estoniae

    2004-01-01

    Soome-ugri IV maailmakongressi kultuuriprogrammi raames toimub Sagadis Tiiu Kirsipuu kureeritud puuskulptuuri sümpoosion "Ilmapuu". 8. augustist on soome-ugri kunstnikud Anatoli Stepanov, Nikolai Bõkov, Marja-Liisa Mäki-Penttilä, Jakov Jakovlev, Reino Saijets, Jozsef Lukacs, Anatoli Punegov, Pjotr Rjabov, Elo Liiv ja Urmas Rauba teinud puuskulptuure, mida eksponeeritakse kongressi toimumise ajal Tallinnas. Urmas Sisaski kontsert mõisapargis

  1. Еще раз о тайне иконы "Литургия Господня" / Елена Погосян, Мария Сморжевских-Смирнова

    Index Scriptorium Estoniae

    Погосян, Елена

    2009-01-01

    Tallinna Nikolai kiriku ikonostaasi juurde kuuluvast ikoonist. Ikooni valmimisajaks on pakutud detsembrit 1711, mil Peeter I külastas Tallinna. Tellis selle kohalikult ikoonimaalijalt Aleksandr Menšikov. Ikooni tõlgendatakse 1711. a. toimunud sündmuste põhjal Peeter I elus ja Põhjasõja käigus: lahing Pruti jõel, rahuleping Türgiga, Jakov Dolgorukovi põgenemine Rootsi sõjavangist jne.

  2. Jõgeva maakonda toob traadita raadionetiühenduse Tartu firma / Madis Aesma

    Index Scriptorium Estoniae

    Aesma, Madis

    2006-01-01

    Külatee 3 programmi maapiirkondade internetivõrguga katmise hanke Jõgevamaa osas võitnud Tartu firma Kernel hakkab Jõgevamaal sellest suvest pakkuma ülikõrgsagedusliku raadioside teel levivat internetiühendust

  3. Dicty_cDB: SSC551 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAA sequence update 1999. 4. 2 Translated Amino Acid sequence ickfvcvylly*kny*kikikikiknpiet*ishisnlyalffi*q...i*lik tktktktkqkkikinlvwkewcskwiivlfknkknmm**mnhxftikkkk Frame B: ickfvcvylly*kny*kikikikiknpiet*ishisnlyalf

  4. Jõgeva maakonda toob traadita raadionetiühenduse Tartu firma / Madis Aesma

    Index Scriptorium Estoniae

    Aesma, Madis

    2006-01-01

    Külatee 3 programmi maapiirkondade internetivõrguga katmise hanke Jõgevamaa osas võitnud Tartu firma Kernel hakkab Jõgevamaal sellest suvest pakkuma ülikõrgsagedusliku raadioside teel levivat internetiühendust

  5. Prilog tumačenju postojanja toponima Kolovare

    OpenAIRE

    Sejdiu, Shefki

    1994-01-01

    Razmatrajući podrijetlo zadarskoga toponima Kolovare autor zaključuje, nastavljajući se na Skokovo tumačenje, da to ime potječe od latinske riječi CABALLARIA . Preko dalmatskoga oblika Caualara, zabilježenog u 14e stoljeću, u dodiru s hrvatskim jezikom nastao je lik *Kalavara. Današnji lik Kolovare konačno su vjerojatno oblikovali zadarski Arbanasi.

  6. Muhasebe Meslek Mensuplarının Mesleki Tükenmişlik Düzeyleri ile İşe Bağlılık Arasındaki İlişkiyi Belirlemeye Yönelik Bir Araştırma: Ankara İli Örneği = A Study into the Relation between the Level of Job Burnout and Job İnvolvement of the Practitioners of Accountancy: Ankara Case

    Directory of Open Access Journals (Sweden)

    Emine Çına BAL

    2011-01-01

    Full Text Available The study sets out to find out the level of job burnout and job involvement and examines the relation between the sub-dimensions of job burnout and job involvement. Maslach burnout inventory was used to measure the level of job burnout. To find out the level of job involvement for the practitioners of accountancy “job involvement scale” by Kanungo (1982 was employed. Opinions of the participants for each statement for job involvement and job burnout were analyzed through frequency, percentage, arithmetic average and standard deviation. The relation between job involvement and job burnout for the practitioners of accountancy was determined using Pearson correlation coefficient. The results suggest that there is a negative-direction relation between job involvement and job burnout of the practitioners of accountancy.

  7. Desire To Be Or Not To Be: Desire Of Being And Nothingness In Angela Carter’s The Infernal Desire Machines Of Doctor Hoffmann And Elif Şafak’s Mahrem Olmak Ya Da Olmamak Arzusu: Angela Carter’ın Doktor Hoffmann’ın Şeytani Arzu Makineleri Ve Elif Şafak’ın Mahrem Adlı Romanlarında Varlik Ve Hiçlik Arzusu

    Directory of Open Access Journals (Sweden)

    Banu AKÇEŞME

    2013-09-01

    Full Text Available This paper aims to study a highly acclaimed English novelist Angela Carter`s The Infernal Desire Machines of Doctor Hoffmann (1972(it will be referred to as Desire Machines from here on and Elif Şafak`s Mahrem (titled The Gaze in English (2000 comparatively by focusing on the similarities between these two novels in terms of themes, motifs and characters. Desire Machines and The Gaze are the novels of desire. These novels yield several feminist and psychoanalytical readings clustered around gender, sexuality, repression and body politics because of their explicitly sexually-laden contents. Differently from the previous approaches applied to the analyses of these novels, this paper aims to explore how desire, as imaged by consciousness in a Sartrian term, has been problematized in both novels by delving into the relationship between desire, consciousness, being, existence and imagination. Sartre explains that imagination or image function establishes an important dimension of consciousness. Sartre’s account of the constitution of the imaginary by consciousness in an attempt to satisfy desire provides insight into the nature of desire through the lens of phenomenological and existential psychology. Desire initiates ontological journeys to explore different possibilities of being. From this perspective, Desire Machines and The Gaze can be read as the texts of the externalized consciousnesses of the two desiring male characters Desiderio and Be-ce as they imagine the possibilities of their beings to bring into existence their desired being through negation, nihilation and re/constitution. Bu çalışma oldukça beğenilen İngiliz romancı Angela Carter’ınDr Hoffmann’ın Şeytani Arzu Makineleri (1972 (Buradan sonra ArzuMakineleri olarak söz edilecektir ve Elif Şafak’ın Mahrem (İngilizce adıThe Gaze (2000 adlı romanlarını karakter, motif ve tema açısındanbu iki eser arasındaki benzerliklere odaklanarak karşılaştırmalıolarak incelemeyi amaçlamaktadır. Arzu Makineleri ve Mahrem arzuhakkında, arzuya dair romanlardır. Açık şekilde cinsel içerikliolmalarından dolayı bu romanlar, toplumsal cinsiyet, cinsellik,bastırma, iteleme ve beden siyaseti gibi konular ekseninde bir çokfeminist ve psikoanalitik okumalara yol açmıştır. Romanlarınanalizlerinde daha önce uygulanan yaklaşımlardan farklı olarak, buçalışma, Sartre’ın ifadesiyle bilinç tarafından oluşturulan arzu, bilinç,varoluş, benlik ve hayal arasındaki ilişkiyi irdeleyerek, buromanlardaki arzu sorunsalını ele almayı amaçlamaktadır. Sartrehayalin ya da imge funksiyonunun, bilincin önemli bir boyutunuoluşturduğunu ifade eder. Sartre’ın, arzuyu tatmin etmek içinbilincin hayali olanı oluşturma teorisi, fenomenolojik ve varoluşsalpsikoloji açısından arzunun doğasına dair derinlemesine bir bakışaçısı sunar. Arzu, farklı, olası benliklerin ve varoluşların keşfi içinçıkılması gereken ontolojik seyahatleri tetikler. Bu bağlamda, ArzuMakineleri ve Mahrem romanları, olumsuzlama, hiçleme vetekrar/yapılandırma yolu ile arzu edilen benliklerini var etmek için,muhtemel var oluşlarını hayal edip, arzulayan iki erkek karakterDesiderio ve Be-ce’nin dışa vurulmuş bilinçlerinin metinleri olarakokunabilir.

  8. BİR EDEBİYAT DERSİNDE BİR ŞİİRİ ÇEVİRİLERİYLE OKUMAK: WALT WHITMAN’IN O CAPTAIN! MY CAPTAIN! BAŞLIKLI ŞİİRİ İLE FRANSIZCA VE TÜRKÇE ÇEVİRİLERİ / READING A POEM WITH ITS TRANSLATIONS IN THE LITERATURE CLASS: WALT WHITMAN’S O CAPTAIN! MY CAPTAIN! AND ITS F

    Directory of Open Access Journals (Sweden)

    Didem TUNA

    2016-12-01

    Full Text Available 1819-1892 yılları arasında yaşamış olan Walt Whitman,  Amerika’nın en etkili  şairlerinden biri olarak kabul edilmektedir.  Hiç yüz yüze gelmemesine rağmen büyük hayranlık duyduğu  Başkan Abraham Lincoln’un Amerikan İç Savaşı sonrasında öldürülmesi üzerine  duyduğu derin üzüntüyü, onu anmak ve onurlandırmak için yazdığı  O Captain! My Captain! başlıklı şiiri ile ifade etmiştir. Serbest şiirleriyle tanınan Whitman, bu şiirinde de sabit bir ölçü kullanmamıştır. Ancak muhtemelen şiirin bir ağıt olmasından dolayı bir istisna olarak  dört uzun dizeyi dört kısa dizenin izlediği bölümlere yer vermek suretiyle belli bir kalıp kullanmış ve bu da şiirini diğerlerinden farklı ve özel kılmıştır.  Whitman’ın bu şiiri,  Memet Fuat tarafından yapılan Ey Kaptan! Canım Kaptanım! ve Can Yücel tarafından yapılan Oy Reis! Koca Reis! başlıklı Türkçe çevirileri ve  Léon Bazalgette tarafından yapılan Ô Capitaine! Mon Capitaine! başlıklı Fransızca çevirisi ile  birlikte bu çalışmanın bütüncesini oluşturmaktadır. Bu dört şiir,  ortaöğretim 10.  sınıfta bir Edebiyat dersi kapsamında  bir arada okunmuş  ve  şiirlerin  anlam evreni ile  biçimsel özellikleri karşılaştırmalı olarak irdelenmiştir. Bu çalışmada, bir şiirin çevirileri ile birlikte okunup çözümlenmesinin öğrencilerin derse katılımına, dersin verimliliğine ve kültürlerarası farkındalığın gelişimine sunabileceği katkılardan söz edilmekte ve ayrıca  Fransız göstergebilimci Jean Claude Coquet’nin “Söyleyenler Kuramı” temel alınarak,  şiirin çeviri ile yeniden üretilmesi sürecinde çevirmenin söylem alıcısı ve söylem üreticisi olarak üstlendiği rolün erek metne yansımaları üzerinde durulmaktadır.

  9. Объявлены финалисты русского "Букера"

    Index Scriptorium Estoniae

    2003-01-01

    Vene Bookeri ("Букер - Открытая Россия") finalistid: Natalja Galkina (romaan "Вилла Рено"), Ruben Gonzalez ("Белое на черном"), Leonid Zorin ("Юпитер"), Afanassi Mamedov ("Фрау Шрам"), Jelena Tšižova ("Лавра") ja Leonid Juzefovitš ("Казароза"). Ka intervjuust žürii esimehega Jakov Gordiniga

  10. Объявлены финалисты русского "Букера"

    Index Scriptorium Estoniae

    2003-01-01

    Vene Bookeri ("Букер - Открытая Россия") finalistid: Natalja Galkina (romaan "Вилла Рено"), Ruben Gonzalez ("Белое на черном"), Leonid Zorin ("Юпитер"), Afanassi Mamedov ("Фрау Шрам"), Jelena Tšižova ("Лавра") ja Leonid Juzefovitš ("Казароза"). Ka intervjuust žürii esimehega Jakov Gordiniga

  11. Fate of nano- and microplastic in freshwater systems: A modeling study

    NARCIS (Netherlands)

    Besseling, Ellen; Quik, Joris T.K.; Sun, Muzhi; Koelmans, Bart

    2017-01-01

    Riverine transport to the marine environment is an important pathway for microplastic. However, information on fate and transport of nano- and microplastic in freshwater systems is lacking. Here we present scenario studies on the fate and transport of nano-to millimetre sized spherical particles lik

  12. Dicty_cDB: SSG485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Epinephelus coioides scinderin-lik... 39 0.13 AY052178_1( AY052178 |pid:none) Drosophila simulans isolate ...AY052174_1( AY052174 |pid:none) Drosophila simulans isolate sim1 g... 39 0.13 FJ438495_1( FJ438495 |pid:none

  13. Dicty_cDB: CFG770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone PP_LEa0014A23f, mRNA sequence. 74 8e-12 2 AF333116 |AF333116.1 Sterkiella histriomuscorum turgor-lik...ipic semialdehyde dehydrogen... 221 7e-58 AY883858_1( AY883858 |pid:none) Sterkiella histriomuscorum turgo

  14. AcEST: DK957236 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 946|MT_ARIAR Metallothionein OS=Arianta arbustorum PE=1 SV=1 35 0.21 sp|P20238|MT1_MIMGU Metallothionein-lik...IAR Metallothionein OS=Arianta arbustorum PE=1 SV=1 Length = 66 Score = 34.7 bits

  15. Dicty_cDB: Contig-U13537-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 5e-20 EU128750_1( EU128750 |pid:none) Ixodes ricinus cathepsin C precurs... 75 8e-20 AB117976_1( AB117976 ...stegopteryx spinocephala catB mRN... 70 3e-19 EF428206_1( EF428206 |pid:none) Ixodes ricinus cathepsin B-lik

  16. NCBI nr-aa BLAST: CBRC-ETEL-01-0956 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0956 ref|NP_001039193.1| Novel protein similar to stomatin (EPB72)-lik...e 1 [Xenopus tropicalis] emb|CAJ81666.1| Novel protein similar to stomatin (EPB72)-like 1 [Xenopus tropicalis] NP_001039193.1 1.1 26% ...

  17. Ugala ja Nukuteater jagasid kiitust

    Index Scriptorium Estoniae

    2003-01-01

    Ugala kuulutas välja hooaja publikulemmikud. Kuldõuna said lavastaja P. Tammearu, kunstnik J. Vaus, näitlejad L. Säälik ja P. Võigemast. Nukuteatri töötajad valisid hooaja parimateks R. Rosbergi ja E. Püssa

  18. Catalytic Enhancement of Solid Carbon Oxidation in HDCFCs

    DEFF Research Database (Denmark)

    Deleebeeck, Lisa; Ippolito, Davide; Kammer Hansen, Kent

    2014-01-01

    Hybrid direct carbon fuel cells consisting of a solid carbon (carbon black)-molten carbonate ((62-38 wt% Li-K)(2)CO3) mixtures in the anode chamber of an anode-supported solid oxide fuel cell type full-cell are tested for their electrochemical performance between 700 and 800 degrees C. Performance...

  19. Maalähedane "Tuuline rand" / Kristiina Davidjants

    Index Scriptorium Estoniae

    Davidjants, Kristiina, 1974-

    2011-01-01

    Režissööride Kaljo Kiisa ja Viktor Sõmeri filmist "Tuuline rand" (1971), kriitikute hinnangust filmile. Osades Heino Raudsik, Antanas Barcas, Leila Säälik, Katrin Välbe, Hugo Laur, Enn Kraam, Rein Aren, Jüri Järvet jt.

  20. AcEST: DK949163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 36 2.3 tr|A8P3K7|A8P3K7_BRUMA Retinitis pigmentosa GTPase regulator-lik... 35 3.... 92 FGGGGN 97 >tr|A8P3K7|A8P3K7_BRUMA Retinitis pigmentosa GTPase regulator-like protein OS=Brugia malayi GN

  1. AcEST: DK953447 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3 1e-05 tr|Q9DGL1|Q9DGL1_FUGRU Retinitis pigmentosa GTPase regulator-lik... 46 0.002 tr|Q9STS8|Q9STS8_ARATH ...RKREEAPPIEAKK 199 >tr|Q9DGL1|Q9DGL1_FUGRU Retinitis pigmentosa GTPase regulator-like protein (Fragment) OS=F

  2. AcEST: BP919319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 037 tr|A2FW49|A2FW49_TRIVA Retinitis pigmentosa GTPase regulator-lik... 41 0.037 ...bjct: 370 EKRIQIQKTMSEKEKSKLEKVTIARQKVIEQRN 402 >tr|A2FW49|A2FW49_TRIVA Retinitis pigmentosa GTPase regulato

  3. Hamiltonian ABC

    NARCIS (Netherlands)

    Meeds, E.; Leenders, R.; Welling, M.; Meila, M.; Heskes, T.

    2015-01-01

    Approximate Bayesian computation (ABC) is a powerful and elegant framework for performing inference in simulation-based models. However, due to the difficulty in scaling likelihood estimates, ABC remains useful for relatively lowdimensional problems. We introduce Hamiltonian ABC (HABC), a set of lik

  4. Dicty_cDB: CHR853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lik... 39 0.48 DQ453500_1( DQ453500 |pid:none) Heliocidaris tuberculata advillin ... 38 0.63 DQ453501_1( DQ453501 |pid:none) Heliocid...aris erythrogramma advilli... 38 0.63 AY052174_1( AY0521

  5. Sisekujunduse parimad / Mart Kalm

    Index Scriptorium Estoniae

    Kalm, Mart, 1961-

    1999-01-01

    Eesti Sisearhitektide Liidu interjööripreemiale ja vormipreemiale kandideerinud ning preemia pälvinud töödest. Interjööripreemia ئ Taso Mähar (restoran "Exit" Sauna t.), vormipreemia ئ Edina Dufala-Pärn ja Martin Pärn (tool "Lib-lik").

  6. Raamaturappija / Karl Martin Sinijärv

    Index Scriptorium Estoniae

    Sinijärv, Karl Martin, 1971-

    1996-01-01

    Kivisildnik, Sven. Nagu härjale punane kärbseseen; Lovecraft, Howard Phillips. Pimeduses sosistaja; Eisen, Matthias Johann. Kratiraamat; Rae, Alexander C. Pisiblufi käsiraamat : Astroloogia; Kirs, Ernst. Kord olin ma röövlite päälik...; Vahtre, Lauri. Vabanemine

  7. Electrochemical and Spectroscopic Investigation of Molten Chloroaluminates and Related Solvents

    Science.gov (United States)

    1988-11-07

    produce WOC14 (14); since the melts were most lik’ely contaminated with oxide (2,13), it was assumed that Fig. 3. UVvisible absorption spectra of (a...ride complexes. cm; f=5C UVvisible absorption spectra of gaseous WCIO and WOC14 [known to exist as monomers (14)] are presented in Fig. 4. The

  8. Catalytic Enhancement of Carbon Black and Coal-Fueled Hybrid Direct Carbon Fuel Cells

    DEFF Research Database (Denmark)

    Deleebeeck, Lisa; Ippolito, Davide; Kammer Hansen, Kent

    2015-01-01

    Hybrid direct carbon fuel cells (HDCFCs) consisting of a solid carbon (carbon black)-molten carbonate ((62–38 wt% Li-K)2CO3) mixtures in the anode chamber of an anode-supported solid oxide fuel cell type full-cell are tested for their electrochemical performance between 700 and 800°C. Performance...

  9. Catalytic Enhancement of Solid Carbon Oxidation in HDCFCs

    DEFF Research Database (Denmark)

    Deleebeeck, Lisa; Ippolito, Davide; Kammer Hansen, Kent

    2014-01-01

    Hybrid direct carbon fuel cells (HDCFCs) consisting of a solid carbon (carbon black)-molten carbonate ((62-38 wt% Li-K)2CO3) mixtures in the anode chamber of an anode-supported solid oxide fuel cell (SOFC)-type full-cell (NiO-yttria-stablized zirconia (YSZ)|YSZ|lanthanum strontium manganite (LSM...

  10. AcEST: BP913515 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rotein OS=Medic... 228 1e-58 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizip... 228 1e-58 t...N ECGAGTFMANH DRHYCG+ Sbjct: 121 CPNAECGAGTFMANHFDRHYCGK 143 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-lik

  11. AcEST: DK959090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _MEDTR Putative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-lik...KCGLTYVYQKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  12. How hyperthermophiles adapt to change their lives : DNA exchange in extreme conditions

    NARCIS (Netherlands)

    van Wolferen, Marleen; Ajon, Malgorzata; Driessen, Arnold J. M.; Albers, Sonja-Verena; Ajon, Małgorzata; Huang, L.

    2013-01-01

    Transfer of DNA has been shown to be involved in genome evolution. In particular with respect to the adaptation of bacterial species to high temperatures, DNA transfer between the domains of bacteria and archaea seems to have played a major role. In addition, DNA exchange between similar species lik

  13. Raamaturappija / Karl Martin Sinijärv

    Index Scriptorium Estoniae

    Sinijärv, Karl Martin, 1971-

    1996-01-01

    Kivisildnik, Sven. Nagu härjale punane kärbseseen; Lovecraft, Howard Phillips. Pimeduses sosistaja; Eisen, Matthias Johann. Kratiraamat; Rae, Alexander C. Pisiblufi käsiraamat : Astroloogia; Kirs, Ernst. Kord olin ma röövlite päälik...; Vahtre, Lauri. Vabanemine

  14. 108aastase Liviko tooted koguvad tunnustust nii kodus kui välismaal / Tiit Reinart

    Index Scriptorium Estoniae

    Reinart, Tiit, 1964-

    2006-01-01

    Tänavu tunnustati AS-i Liviko tooteid Vana Tallinna Liköör, Üx Vodka ja Vana Tallinn Cream ühel mainekamal rahvusvahelisel konkursil International Wine & Spirit Competition (IWSC), ühtlasi tegeleb ettevõte jätkuvalt tootearenduse ja kvaliteetveinide importimisega. Vt. samas: Maksumärgita alkohol on illegaalne

  15. Organization Still Matters: Parties' Characteristics, Posting and Followers' Reactions on Facebook

    NARCIS (Netherlands)

    Borge, Rosa; Esteve Del Valle, Marc

    2017-01-01

    Use of social media by political parties has become a part of their communication strategies. In Catalonia, where around 20% of Internet users obtain political information through Facebook and Twitter, parties use these channels widely. This article has examined 814 posts, 5,772 comments, 52,470 lik

  16. The House as a Product

    NARCIS (Netherlands)

    Vogler, A.

    2016-01-01

    Industrialized housing has been a common phenomenon in the building industry since the industrial revolution; the casting of iron components enabled Victorian iron casters to prefabricate entire buildings and to export them to all British colonies. It got a second boost from Modernist architects lik

  17. Vahur Kraft soovitab elektritootmise erastada / Vahur Kraft ; interv. Vallo Toomet

    Index Scriptorium Estoniae

    Kraft, Vahur, 1961-

    2003-01-01

    Eesti Panga president Vahur Kraft soovitab seoses Iraagi sõja ja ebakindlusega maailmas suhtuda ettevaatlikult majanduskasvu prognoosi ning näeb maksureformi läbiviimiseks vajaliku kokkuhoiu võimalusi hariduse, tervishoiu ja sotsiaalkindlustuse reformimisel. Diagramm. Tabel. Vt. samas: Andrus Säälik. Tulude alla jõuavad ka toetused

  18. Kolm aastat hiljem : ühisrinnet pole / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Autori hinnangul pole kolm aastat tagasi suurriikide juhtide poolt avaldatud soov koostööks rahvusvahelise terrorismi vastu võitlemisel tänaseks teostunud. Samuti pole suudetud kõrvale tõrjuda riikide omavahelisi huvisid ning ajaloolisi tüliküsimusi

  19. Optimal allocation of diversification benefits

    NARCIS (Netherlands)

    Janssen, M.J.J.

    2011-01-01

    In recent years within Insurance companies measures like RAROC (Risk Adjusted Return on Capital) have become more popular for Balance Sheet Management purposes. RAROC is a performance measure that quantifies the amount of return per unit of risk that can be obtained by a certain entity. Measures lik

  20. The TIPS Liquidity Premium

    DEFF Research Database (Denmark)

    Andreasen, Martin Møller; Christensen, Jens H.E.; Simon Riddell, Simon

    We introduce an arbitrage-free term structure model of nominal and real yields that accounts for liquidity risk in Treasury inflation-protected securities (TIPS). The novel feature of our model is to identify liquidity risk from individual TIPS prices by accounting for the tendency that TIPS, lik...

  1. Gclust Server: 68684 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 68684 Ava_Ava_4151 Cluster Sequences Related Sequences(508) 275 ABC transporter-lik...e 1 9.98e-01 0.0 0.0 4.0 0.0 0.0 0.0 Show 68684 Cluster ID 68684 Sequence ID Ava_Ava_4151 Link to cluster se

  2. Genetic linkage between melanism and winglessness in the ladybird beetle Adalia bipunctata

    NARCIS (Netherlands)

    Lommen, S.T.E.; Jong, de P.W.; Koops, K.G.; Brakefield, P.M.

    2012-01-01

    We report a case of genetic linkage between the two major loci underlying different wing traits in the two-spot ladybird beetle, Adalia bipunctata (L.) (Coleoptera: Coccinellidae): melanism and winglessness. The loci are estimated to be 38.8 cM apart on one of the nine autosomes. This linkage is lik

  3. Gruusia lahendas tüli Adžaariaga / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2004-01-01

    Gruusia president Mihhail Saakashvili ja Adžaaria president Aslan Abashidze jõudsid kokkuleppele kõigis tüliküsimustes, Gruusia lõpetas Adžaaria blokaadi. Gruusia esitatud tingimused Adžaariale. Vt. samas: Katsed lagunenud riiki taastada. Kaart: Gruusia

  4. Neivelt : Soome lama oli tunduvalt hullem / Indrek Neivelt ; interv. Jüri Aarma

    Index Scriptorium Estoniae

    Neivelt, Indrek, 1967-

    2008-01-01

    Intervjuu Hansapanga endise juhiga, kes vastab küsimustele Eesti majanduse hetkeseisust, pannes praegusele olukorrale hindeks kolm pluss. Vt. samas: Mis hinde panete tänasele majandusseisule ja miks? Vastavad: Juhan Parts, Andres Lipstok, Aivar Sõerd, Andrus Säälik, Urmas, Klaas ja Ester Tuiksoo

  5. Nafta hinnatõus sunnib ettevõtteid lahendusi otsima / Anne Oja

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti 11. aug lk. 4. Ettevõtete juhid kommenteerivad nafta hinnatõusu mõju nende äritegevusele. Diagramm: Nafta hind tõusnud aastaga kolmandiku võrra. Vt. samas: Tõnis Arnover. Nafta ülikõrge hinna langust pole ette näha; Nafta hinna kasv lööb tarbimist

  6. Lentivirus Vaccine Development: Antigen presentation by Salmonella and iscom

    NARCIS (Netherlands)

    E.J. Tijhaar (Edwin)

    1997-01-01

    textabstractHuman immunodeficiency virus types 1 and 2 (HIV-I and HIV-2), the causative agents of acquired immune deficiency syndrome (AIDS) in humans, are members of the Lentivirinae subfamily of the Retroviridae family. The lentivirus subfamily also includes related members from other species, lik

  7. Aspects of self differ among physically active and inactive youths

    NARCIS (Netherlands)

    Veselska, Zuzana; Geckova, Andrea Madarasova; Reijneveld, Sijmen A.; van Dijk, Jitse P.

    2011-01-01

    The aim of this paper was to explore connection between aspects of self and levels of physical activity among adolescents. An international sample of 501 elementary school students (mean age 14.7 +/- A 0.9 years, 48.5% males) from the Slovak and Czech Republics completed the Self-competence/Self-lik

  8. The rate of living in mice : Impacts of activity and temperature on energy metabolism and longevity

    NARCIS (Netherlands)

    Vaanholt, Lobke Maria

    2007-01-01

    In evolutionary biology, ageing is usually defined as a persistent decline in the age-specific fitness components of an organism due to internal physiological deterioration. This definition integrates effects on reproduction and survival. Gerontologists simply define ageing as an increase in the lik

  9. AcEST: BP913659 [AcEST

    Lifescience Database Archive (English)

    Full Text Available acterized protein OS=Oryza... 50 4e-05 tr|Q5Z6M5|Q5Z6M5_ORYSJ Aluminum-activated malate transporter-lik... 5...RLDHLVEAAERLATMARFK 519 >tr|Q5Z6M5|Q5Z6M5_ORYSJ Aluminum-activated malate transporter-like OS=Oryza sativa s

  10. The Solubility of metal oxides in molten carbonates - why the acid-basic chemistry fails?

    DEFF Research Database (Denmark)

    Bjerrum, Niels; Qingfeng, Li; Borup, Flemming

    1999-01-01

    Solubilities of various metal oxides in molten Li/K carbonates have been measured at 650°C under carbon dioxide atmosphere. It is found that the solubility of NiO and PbO decreases with increasing lithium mole fraction and decreasing CO2 partial pressure. On the other hand, the emf measurement...

  11. How hyperthermophiles adapt to change their lives : DNA exchange in extreme conditions

    NARCIS (Netherlands)

    van Wolferen, Marleen; Ajon, Malgorzata; Driessen, Arnold J. M.; Albers, Sonja-Verena; Ajon, Małgorzata; Huang, L.

    2013-01-01

    Transfer of DNA has been shown to be involved in genome evolution. In particular with respect to the adaptation of bacterial species to high temperatures, DNA transfer between the domains of bacteria and archaea seems to have played a major role. In addition, DNA exchange between similar species lik

  12. Bidirectional cross-kingdom RNAi and fungal uptake of external RNAs confer plant protection

    NARCIS (Netherlands)

    Wang, Ming; Weiberg, Arne; Lin, Feng Mao; Thomma, Bart P.H.J.; Huang, Hsien Da; Jin, Hailing

    2016-01-01

    Aggressive fungal pathogens such as Botrytis and Verticillium spp. cause severe crop losses worldwide. We recently discovered that Botrytis cinerea delivers small RNAs (Bc-sRNAs) into plant cells to silence host immunity genes. Such sRNA effectors are mostly produced by Botrytis cinerea Dicer-lik

  13. 108aastase Liviko tooted koguvad tunnustust nii kodus kui välismaal / Tiit Reinart

    Index Scriptorium Estoniae

    Reinart, Tiit, 1964-

    2006-01-01

    Tänavu tunnustati AS-i Liviko tooteid Vana Tallinna Liköör, Üx Vodka ja Vana Tallinn Cream ühel mainekamal rahvusvahelisel konkursil International Wine & Spirit Competition (IWSC), ühtlasi tegeleb ettevõte jätkuvalt tootearenduse ja kvaliteetveinide importimisega. Vt. samas: Maksumärgita alkohol on illegaalne

  14. Fate of nano- and microplastic in freshwater systems: A modeling study

    NARCIS (Netherlands)

    Besseling, Ellen; Quik, Joris T.K.; Sun, Muzhi; Koelmans, Bart

    2017-01-01

    Riverine transport to the marine environment is an important pathway for microplastic. However, information on fate and transport of nano- and microplastic in freshwater systems is lacking. Here we present scenario studies on the fate and transport of nano-to millimetre sized spherical particles lik

  15. Meremaa võluriga päeva kallastele / Helle Leppik

    Index Scriptorium Estoniae

    Leppik, Helle

    1999-01-01

    29. apr. esietendub Ugalas "Meremaa võlur. Päeva kaldad", lavalugu Ursula K. Le Guini Meremaa-lugude alusel, lavastaja Andres Noormets, kunstnikud Silver Vahtre ja Airi Eras, peaosades Margus Vaher, Martin Algus, Aarne Soro, Leila Säälik, Gert Raudsepp, Silvia Sarrap

  16. Digesting the role of specific pre- and synbiotics in the prevention of house dust mite asthma : Thinking out of the lung

    NARCIS (Netherlands)

    Verheijden, K.A.T.

    2015-01-01

    According to the World Health Organization (WHO) asthma is a chronic disease affecting 235 million people worldwide. The disease is characterized by airway inflammation, airway hyperresponsiveness and airway narrowing. House dust mites (HDM) are common allergens that can induce allergic diseases lik

  17. Aspects of self differ among physically active and inactive youths

    NARCIS (Netherlands)

    Veselska, Zuzana; Geckova, Andrea Madarasova; Reijneveld, Sijmen A.; van Dijk, Jitse P.

    2011-01-01

    The aim of this paper was to explore connection between aspects of self and levels of physical activity among adolescents. An international sample of 501 elementary school students (mean age 14.7 +/- A 0.9 years, 48.5% males) from the Slovak and Czech Republics completed the Self-competence/Self-lik

  18. Organization Still Matters: Parties' Characteristics, Posting and Followers' Reactions on Facebook

    NARCIS (Netherlands)

    Borge, Rosa; Esteve Del Valle, Marc

    2017-01-01

    Use of social media by political parties has become a part of their communication strategies. In Catalonia, where around 20% of Internet users obtain political information through Facebook and Twitter, parties use these channels widely. This article has examined 814 posts, 5,772 comments, 52,470 lik

  19. Facilitating food-related planning : Applying metacognition, cue-monitoring, and implementation intentions

    NARCIS (Netherlands)

    Verhoeven, A.A.C.

    2015-01-01

    Implementation intentions are specific if-then plans that can successfully change unwanted habits by linking the critical cue triggering the unwanted behavior to a healthier alternative. For example, in order to consume fewer unhealthy snacks while watching television, a plan could be formulated lik

  20. DMPD: The role of Toll-like receptors and Nod proteins in bacterial infection. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 15476921 The role of Toll-like receptors and Nod proteins in bacterial infection. P...hilpott DJ, Girardin SE. Mol Immunol. 2004 Nov;41(11):1099-108. (.png) (.svg) (.html) (.csml) Show The role ...of Toll-like receptors and Nod proteins in bacterial infection. PubmedID 15476921 Title The role of Toll-lik

  1. EST Table: FS916416 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0228802|DvirGJ14385-PA 10/08/29 40 %/130 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  2. EST Table: FS898838 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/29 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  3. EST Table: FY762652 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 11/11/04 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  4. EST Table: FS738184 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/28 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  5. EST Table: FS778402 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/28 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  6. EST Table: FS912858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/29 39 %/141 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  7. EST Table: FS864290 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/29 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  8. EST Table: FS782623 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/28 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  9. EST Table: FS897270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available domain containing family member (bath-43) [Caenorhabditis elegans] sp|P34568.2|BAT43_CAEEL RecName: Full=BTB...a FBpp0226491|DvirGJ12074-PA 10/08/29 36 %/175 aa T16H12.5b#CE00510#WBGene00011815#locus:bath-43#Kruppel-lik

  10. The rate of living in mice : Impacts of activity and temperature on energy metabolism and longevity

    NARCIS (Netherlands)

    Vaanholt, Lobke Maria

    2007-01-01

    In evolutionary biology, ageing is usually defined as a persistent decline in the age-specific fitness components of an organism due to internal physiological deterioration. This definition integrates effects on reproduction and survival. Gerontologists simply define ageing as an increase in the lik

  11. Vaikne juubel kuraditosina kinopildiga / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2008-01-01

    Theodor Lutsu 13. filmipäevad ja 10. lahtine lühifilmide konkurss Palamusel 15. augustil. Auhinnatud filmidest (anima-, dokumentaal-, mängu- ja ekperimentaalfilmid). Žüriisse kuulusid Helle Karis, Jaak Lõhmus, Erika Laansalu ja Tiina Säälik. Varasematest filmipäevadest, mis olid viimastest filmi- ja publikurohkemad

  12. Environmental magnetic studies on some Quaternary sediments of varied depositional settings in the Indian sub-continent

    Digital Repository Service at National Institute of Oceanography (India)

    Sangode, S.J.; Sinha, R.; Phartiyal, B.; Chauhan, O.S.; Mazari, R.K.; Bagati, T.N.; Suresh, N.; Mishra, S.; Kumar, R.; Bhattacharjee, P.

    Depo sitional settin g D e positional en vironmen t, me an annu al precip itation and tempe rature Siwa lik (Sf) C24 18–0.5 Ma (Sam pling done for C24 2–0.5 Ma inte rval) 32 1 N77 1 E App rox. 3800 m thick comb ination of Chann el sandsto ne, overb ank... a 32 1 N77 1 E App rox. 50 m thic kness of friable sand-silt and mud sequen ce Siwa liks, Lower Tertiarie s and Lesse r Himalayan sediments and met asedimen ts Inte rmonta ne bas in w ith allu vial fan sedimentation (100– 600) msl Fresh wat er flu...

  13. 新一代Vane-Cam凸轮轴相位调节器

    Institute of Scientific and Technical Information of China (English)

    Knecht A; Pohl D; Hannibal W; 金敏

    2008-01-01

    未来,几乎所有批量生产的汽油机都将装用无级凸轮轴相位调节器.介绍了德国Hydrau-lik-Ring公司新一代按可逆转液压马达原理工作的无级凸轮轴相位调节器及其系统技术概况.

  14. Parenting styles and emotional intelligence of HIV-affected children in Thailand

    OpenAIRE

    Lee, SJ; Li, L; Thammawijaya, P

    2013-01-01

    The purpose of this study was to examine the impact of parenting styles on emotional intelligence of HIV-affected children in Thailand. This study uses data from 205 HIV-affected children in northern and northeastern Thailand. Correlation and regression analyses were used to examine the predictors of emotional intelligence. Children reporting higher levels of stress reported less caring parenting style (standardized beta [B]=-0.18, p=0.050). Children with higher self-esteem were also more lik...

  15. The private sector and the fight against poverty

    Directory of Open Access Journals (Sweden)

    Cecile Renouard

    2012-06-01

    Full Text Available The fight against poverty is inextricably bound up with ecological issues. There is no shortage of global threats, from the environmental and social effects of climate warming to the decline in available freshwater per person or the growing scarcity of natural resources (fossil energy reserves, of course, but also rare earths and metals. Not everybody on this planet can, or will ever be able to, live their lives according to the American or European model. For example, strategic minerals lik...

  16. Dicty_cDB: FC-AN03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence nrhif*nn*lnk*lnk*iinnfkf*ikk***l***l*xxxxxxxxxxxxxxxa*fxxxxi k*kknnikii*IMNKDEEFLEEHHYKDDDAIEGEEEQGEEEE...SD--- ---KKKKKKKKKKKTYSNKIIV*yykk Translated Amino Acid sequence (All Frames) Frame A: nrhif*nn*lnk*lnk*iinnfkf*ikk***l***l*xxxxxxxxx...xxxxxxa*fxxxxi k*kknnikii*IMNKDEEFLEEHHYKDDDAIEGEEEQGEEEESD--- ---KKKKKKKKKKKTYSNKI...IV*yykk Frame B: tdtffkiin*inn*ink**iilnfk*ksnnnynnnynxxxxxxxxxxxxxxxxnlxxxk* nkk...kti*k*fk**ikmknf*kniiikmmmqlkekrnkekkksli--- ---kkkkkkkkkkkhiqik*lyniik Frame C: qthflk*lik*iik*innk*f*ilnkkviiiiiiiixxxxxixxxxxxxxxx

  17. Military Standard Transportation and Movement Procedures. Volume 1. Change 5

    Science.gov (United States)

    1994-08-12

    DLH FORT LEONARD WOOD, MO, FORNEY AAF TBN DURANGO, CO, ANIMNS AIRPARK ANK FORT MYERS, FL, PAGE FIELD FMY DURANGO, CO, DURANGO-LA PLATA AP DRO FORT ORD...USA ITK ITOKAMA, PAPUA NEW GUINEA INC YINCHUAN, P. R. CHINA ITO HILO , HARAII, HAWAII, USA IND INDIANAPOLIS, INDIANA, USA IME NIUE ISLAND, NIUE IA7 IN...LPG LA PLATA , BA, ARGENTINA LII MULIA, INDOSIA LPI LINKOPING, SWEDEN LIJ LONG ISLAND, ALASKA, USA LPL LIVERPOOL, ENGLAND UK LIK LIKIEP, MARSHALL ISLAND

  18. USAF Warrior Studies: Air Superiority in World War 2 and Korea,

    Science.gov (United States)

    1983-01-01

    53 North African Theater: 4. 6. 8. Sandys, Duncan Edwin: 56 31-37 Selassie , Haile : 38f Y-Service: 57 Sherman, Forrest P.: 67 Yamamoto. Isoroku: 60 116 ...w.ioin tit lik \\%u lieui %klfk it~i 11 began in [-i-ripe. foirnmer tEthiopian Emtperor Haile Selaxxie irepaniii:11 naitiutitlix to~,And itr1’ tieC

  19. Fotokaameraga Sotšis, Adleris ja Eesti Aiakeses / Riina Mägi

    Index Scriptorium Estoniae

    Mägi, Riina, 1957-

    2009-01-01

    Ants Paju, kunstnik Tiina Sääliku ja Tartus tegutseva Tarbatu segakoori osalemisest 13. septembril Anton-Hansen Tammsaare majamuuseumi taasavamisel Sotši lähedal külas Eesti Aiake (kohtuti ka kohalike eestlaste kooriga Sügis), kontsertidest Sotši sanatooriumides ja orelisaalis. Tiina Säälik avas Jõgeva Kultuurikeskuse galeriis reisipiltidega fotonäituse

  20. NCBI nr-aa BLAST: CBRC-STRI-01-2303 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2303 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-166 92% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-1367 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1367 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-132 93% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-1594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1594 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-152 84% ...

  3. NCBI nr-aa BLAST: CBRC-OPRI-01-0317 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0317 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-155 86% ...

  4. NCBI nr-aa BLAST: CBRC-MDOM-02-0173 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0173 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-150 83% ...

  5. Why qualified prospects decline timeshare sales presentations: a qualitative study

    OpenAIRE

    Johannsen, Ana Mafalda Gonçalves

    2013-01-01

    Mestrado em Gestão Hoteleira e Turismo/ JEL codes: L83; M31 This dissertation is a qualitative study about why qualified prospects decline timeshare sales presentation even though they earn a small incentive for doing so. The Hoffman and Bateson’s decision process model is used as a broad theoretical framework. On this basis and the inputs of managers and off-premise contact (OPC) representatives of a Marketing company located in Orlando, Florida, USA, five main lik...

  6. Konstruktywne konteksty wykorzystania gier komputerowych w edukacji – studium przypadku

    Directory of Open Access Journals (Sweden)

    Sylwia Polcyn-Matuszewska

    2015-11-01

    Full Text Available The article presents the constructive use of some computer games in the education of children. As an example, the author presents American educational game series which was adapted for Polish kids – Królik Bystrzak. The series includes informations about Polish language, maths, nature and art. The game is recommended by the Polish Ministry of Education and The Polish Dyslexia Association.

  7. Validity of threshold-crossing analysis of symbolic dynamics from chaotic time series

    OpenAIRE

    Bollt, Erik M.; Stanford, Theodore; Lai, Ying-Cheng; Zyczkowski, Karol

    2000-01-01

    A practical and popular technique to extract the symbolic dynamics from experimentally measured chaotic time series is the threshold-crossing method, by which an arbitrary partition is utilized for determining the symbols. We address to what extent the symbolic dynamics so obtained can faithfully represent the phase-space dynamics. Our principal result is that such practice leads to a severe misrepresentation of the dynamical system. The measured topological entropy is a Devil's staircase-lik...

  8. Modelling Framework of a Neural Object Recognition

    OpenAIRE

    Aswathy K S; Prof. (Dr.) Gnana Sheela K

    2016-01-01

    In many industrial, medical and scientific image processing applications, various feature and pattern recognition techniques are used to match specific features in an image with a known template. Despite the capabilities of these techniques, some applications require simultaneous analysis of multiple, complex, and irregular features within an image as in semiconductor wafer inspection. In wafer inspection discovered defects are often complex and irregular and demand more human-lik...

  9. Gender issues of financial analysts

    OpenAIRE

    Jingwen Ge

    2013-01-01

    Increased attention has been drawn to the gender disparity in workplace. This dissertation is dedicated to provide sight to the gender issues in financial analysts. Profound literature reviews are conducted about gender issues and financial analysts, respectively in order to comprehend the existing gender concerns in the business world, and role and functions of financial analysts. Research proposals are described to answer the following question: whether women financial analysts are more lik...

  10. Group Size and Conformity

    OpenAIRE

    Bond, Rod

    2005-01-01

    Abstract This paper reviews theory and research on the relationship between group size and conformity and presents a meta-analysis of 125 Asch-type conformity studies. It questions the assumption of a single function made in formal models of social influence and proposes instead that the function will vary depending on which social influence process predominates. It is argued that normative influence is lik...

  11. Towards increased reliability by objectification of Hazard Analysis and Risk Assessment (HARA) of automated automotive systems

    OpenAIRE

    Khastgir, Siddartha; Birrell, Stewart A.; Dhadyalla, Gunwant; Sivencrona, Håkan; Jennings, P. A. (Paul A.)

    2017-01-01

    Hazard Analysis and Risk Assessment (HARA) in various domains like automotive, aviation, process industry etc. suffer from the issues of validity and reliability. While there has been an increasing appreciation of this subject, there have been limited approaches to overcome these issues. In the automotive domain, HARA is influenced by the ISO 26262 international standard which details functional safety of road vehicles. While ISO 26262 was a major step towards analysing hazards and risks, lik...

  12. 20. X avati arhitektuuri- ja disainigaleriis...

    Index Scriptorium Estoniae

    2004-01-01

    Väljapanek "Vaateaken Eesti ekspositsioonile Veneetsia arhitektuuribiennaalil". Eestit esindab 9. Veneetsia arhitektuuribiennaalil Eesti Arhitektide Liidu projekt "Aeg-maha-arhitektuur", idee autor Kristjan Holm, kaasautorid Liina Jänes ja Pille Epner. Kabli rannast Veneetsiasse teisaldatud puust hobusekujulise välikäimla on loonud Agu Külm ja Jukka-Pekka Jalovaara. Ku-Ku klubis esilinastus Marianne Kõrveri, Rain Tolgi ja Andres Maimiku dokumentaalfilm "Surm Veneetsias"

  13. VALUES LEARNING UNLEARNING VIOLENCE, A STUDY WITH CHILDREN FROM ELEMENTARY SCHOOLS IN THE STATE OF HIDALGO

    OpenAIRE

    María Elza Eugenia Carrasco-Lozano; Aly Veloz-Méndez

    2014-01-01

    Violence in schools is a concern for educational policy, with negative physical, psychological and socio-economic effects. In this context, teaching values in children in basic education aims to be an option to claim the ideals of a better society. The objective of this research was to identify how girls and boys in public and private elementary schools learn values. The methodology is cuantitative with a sample of one hundred students who answered a questionnaire with "open" questions in Lik...

  14. Career Concerns, Inaction, and Market Inefficiency: Evidence from Utility Regulation

    OpenAIRE

    Borenstein, Severin; Busse, Meghan; Kellogg, Ryan

    2010-01-01

    This paper examines how career concerns can generate inefficiencies not only within firms but also in market outcomes. Career concerns may lead agents to avoid actions that, while value-increasing in expectation, could potentially be directly associated with a bad outcome. We apply this theory to natural gas procurement by regulated public utilities and show that career concerns may lead to a reduction in surplus-increasing market transactions during periods when the benefits of trade are lik...

  15. Association of Huntington's disease and schizophrenia-like psychosis in a Huntington's disease pedigree

    OpenAIRE

    Guimarães João; Xavier Miguel; Corrêa Bernardo

    2006-01-01

    Abstract Background Huntington's disease (HD) is a dominantly inherited, neurodegenerative disorder due to expansion of a polymorphic trinucleotide repeat in the short arm of chromosome 4. Clinical manifestations consist of a triad of choreic movements, cognitive decline and psychiatric syndromes starting in the fourth to fifth decade. Psychiatric manifestations vary and may precede motor and cognitive changes. Personality changes and depression occur most commonly. Paranoid schizophrenia-lik...

  16. Sliding Mode Control for a Class of Uncertain MIMO Nonlinear Systems with Application to Near-Space Vehicles

    OpenAIRE

    Mou Chen; Rong Mei; Bin Jiang

    2013-01-01

    We propose a robust sliding mode control (SMC) scheme for a class of uncertain multi-input and multi-output (MIMO) nonlinear systems with the unknown external disturbance, the system uncertainty, and the backlash-like hysteresis. To tackle the continuous system uncertainty, the radial basis function (RBF) neural network is employed to approximate it. And then, combine the unknown external disturbance, and the unknown neural network approximation error with the affection caused by backlash-lik...

  17. Yiyecek-İçecek Bölümü Çalışanlarının Mesleki Tükenmişlikleri ve İş Doyumları Üzerine Bir Araştırma

    OpenAIRE

    İÇİGEN, Ebru TARCAN; UZUT, İsmail

    2012-01-01

    Tükenmişlik, hizmet sektöründe sıklıkla görülebilen bir sendromdur Bu çalışma da yiyecek ve içecek bölümü çalışanlarının tükenmişlik düzeylerinin ve iş doyumlarının bazı değişkenlere göre anlamlı düzeyde farklılaşıp farklılaşmadığını belirlemek ve aralarındaki ilişkiyi ortaya koymak amacıyla gerçekleştirilmiştir. Araştırmaya 114 yiyecek ve içecek personeli katılmıştır. Yiyecek ve içecek personelinin iş doyumları, İş Doyumu Ölçeği (Hackman ve Oldham, 1975), tükenmişlikleri Maslach Tükenmişlik ...

  18. Environmental geochemistry of shale-hosted Ag-Pb-Zn massive sulfide deposits in northwest Alaska: Natural background concentrations of metals in water from mineralized areas

    Science.gov (United States)

    Kelley, K.D.; Taylor, C.D.

    1997-01-01

    Red Dog, Lik and Drenchwater are shale-hosted stratiform Ag-Pb-Zn massive sulfide deposits in the northwestern Brooks Range. Natural background concentrations of metals in waters from the undisturbed (unmined) Drenchwater prospect and Lik deposit were compared to pre-mining baseline studies conducted at Red Dog. The primary factors affecting water chemistry are the extent of exposure of the deposits, the grade of mineralization, the presence of carbonate reeks in the section, and the proportion of Fe-sulfide in the ore. Surface water samples from the Drenchwater prospect, which has pyrite-dominant mineralization exposed in outcrop, have pH values as low as 2.8 and high dissolved concentrations of metals including as much as 95 mg 1-1 Al, 270 mg 1-1 Fe, 8 ??1-1 Cd, 10 ??1-1 Pb, and 2600 ??1-1 Zn, with As up to 26 ??g1-1. Surface waters from the Red Dog deposit prior to mining were also acidic and metal-rich, however, dissolved metal concentrations in Red Dog waters were many times greater. The higher metal concentrations in Red Dog waters reflect the high Zn grades and the abundant sphalerite, pyrite, and galena that were present in outcrop prior to mining. In contrast, despite significant mineralization at the Lik deposit, carbonate rocks in the section buffer the system, resulting in less acidic, mostly near-neutral pH values with low concentrations of most metals except Zn.

  19. Haematococcus pluvialis Flotow (Chlorophyceae'un Farklı Işık Şiddetlerinde Vejetatif Büyüme Özellikleri.

    Directory of Open Access Journals (Sweden)

    Tolga Göksan

    2015-12-01

    Full Text Available Haematococcus pluvialis’in vejetatif kültürlerinde, optimal ışık şiddeti aralığı ve büyüme performanslarının tespiti için 50, 100, 200, 400 ve 600 µmol foton m-2 sn-1’lik beş farklı ışık şiddeti uygulandı. Deneme gruplarında kuru ağırlık ve toplam karoten miktarları artan ışık şiddetleri ile doğru orantılı olarak artarken, toplam klorofil miktarı 200 µmol foton m-2 sn-1’lik aydınlatmaya kadar arttı (2.21 mg L-1ve bunun üzerindeki aydınlatma şiddetlerinde herhangi bir değişim görülmedi (ortalama 2.35 mg L-1. Hücre sayısı tüm gruplarda karanlık periyoda denk gelen 15. saatte ortalama 3.45 x 104 hücre ml-1’den 18. saatte 5.66 x 104 hücre ml-1’ye arttı. Sonuç olarak, 200 µmol foton m-2 sn-1’lik ışık şiddetinin üzerindeki aydınlatmalarda astaksantin birikiminin tetiklendiği ve hücre sayısının azaldığı görüldü (50, 100, 200, 400 ve 600 µmol foton m-2 sn-1’lik ışık şiddetleri için sırasıyla 12.73 x 104, 16.10 x 104, 19.73 x 104, 15.90 x 104 ve 12,89 x 104 hücre ml-1. Beş farklı ışık şiddetinin uygulandığı denemede hücrelerin vejetatif safhada kültür edilebilmesi için optimal ışık şiddeti aralığı 50 - 200 µmol foton m-2 sn-1 olarak bulundu ve en iyi büyüme 200 µmol foton m-2sn-1’lik ışık şiddetinde gerçekleşti

  20. TÜKENMİŞLİK SENDROMU VE ÖRGÜTSEL BAĞLILIK: SU ÜRÜNLERİ İŞLETMELERİ ÜZERİNDE BİR ARAŞTIRMA (BURNOUT SYNDROME AND ORGANIZATIONAL COMMITMENT AN INVESTIGATION ON FISHERIES AND AQUACULTURE ENTERPRISES

    Directory of Open Access Journals (Sweden)

    Ömer Akgün TEKİN

    2014-01-01

    Full Text Available ÖZ: Tükenmişlik ve örgütsel bağlılık son yıllarda sosyal bilimler alanında en çok araştırılan konular arasında yer almaktadır. Bu çalışmanın amacı, su ürünleri işletmeleri çalışanlarının tükenmişlik düzeylerini ve örgütsel bağlılık seviyelerini tespit etmek, tükenmişlik, örgütsel bağlılık ve çalışanların demografik özellikleri arasındaki olası ilişkileri sorgulamaktır. Bu amacı gerçekleştirmek için Akdeniz Bölgesinde faaliyette bulunan üç ayrı su ürünleri işletmesinden 125 çalışan üzerinde araştırma yapılmıştır. Analizler sonucunda çalışanların tükenmişlik ve örgütsel bağlılık durumları arasında anlamlı ilişkiler tespit edilmiştir. Ayrıca çalışanların demografik özellikleri ile tükenmişlik düzeyleri ve örgütsel bağlılık seviyeleri arasında anlamlı ilişkiler bulgulanmıştır. Anahtar Kelimeler: Tükenmişlik, Örgütsel Bağlılık, Su Ürünleri İşletmeleri. ABSTRACT: Burnout syndrome and organizational commitment are among one of the most searched topics in social sciences in recent years. The aim of this study is to specify levels of burnout syndrome and organizational commitment and; the employees of fisheries and aqauculture enterprises. To realize this aim, this investigation is applied on 125 employee from three different fisheries and aquaculture enterprises in Akdeniz Region. Results of analysis, siginificant relationships found between burnout and organizational commitment levels of employees. Furthermore, siginificant relationships are found between demographic characteristics, burnout and organizational commitment levels of employees. Keywords: Burnout Syndrome, Organizational Commitment, Fisheries and Aquaculture Enterprises.

  1. From a reading devoted monk to an idealist prompter: the Serbian Quixotes across the centuries

    Directory of Open Access Journals (Sweden)

    Jasna Stojanović

    2012-12-01

    Full Text Available In this paper we analyze the characters of several Serbian novels published from the Enlightenment to the present day, whose main characters show obvious resemblances with Cervantes’ Don Quixote: Dositej Obradović´s Život i priključenija (1783, Jovan Sterija Popović´s Roman bez romana (1838, various novels of Jakov Ignjatović (Večiti mladoženja, 1878; Vasa Rešpekt, 1875; Milan Narandžić, 1860-1862, and Sančova verzija by Ratomir Damjanović (1999. We analyze their personalities, pointing out the similarities with their model and then exploring the differences or particularities emanating from either the author’s style, the period of its creation and/or the poetics of the Serbian literature. Our goal is to investigate the manner and the level in which the Cervantine legacy has been creatively transformed and what constant characteristics of the personality of Don Quixote have resisted the passage of time.

  2. [Development of health care services in Bosnia-Herzegovina during the Ottoman empire].

    Science.gov (United States)

    Masić, I

    1991-01-01

    Organized health service in Bosnia and Herzegovina practically started by the treatment of the sick in the Hadji Sinan's Tekke that was founded in 1768. Before that, the civilian population had been mainly treated in their homes, while the army were treated in barracks or hired hans (inns). As late as the nineteenth century, health care was provided by quack doctors, treating physicians or surgeons and barbers, who were trained, beside the circumcision of male children, for tooth extraction, broken bone setting, and sometimes even for performing minor surgical operations (a specially trained barber called djerah). The first trained medical personnel were the Franciscans and Jews, who studied at the Universities of Italy, Austria, Hungary etc. The first Muslim trained physicians studied at the Medical Faculty in Istanbul. The first ones were: Dr. Mehmed Serbić and Dr. Zarif Skender, while the first Bosnian graduate in pharmacy was Jakov Sumbul. In Sarajevo and Bosnia and Herzegovina worked many a doctor who came from abroad. The majority of them converted to Islam and worked in the barracks, and later on in the Turkish Military Hospital when it was founded in Sarajevo. All of them played an important role in the prevention and treatment of the most frequent mass infectious and non-infectious diseases that were raging among the population--plague, cholera, syphilis, leprosy, tuberculosis, fungoid diseases etc.

  3. Writers and chanters in the nineteenth century as keepers of the tradition of Serbian church music

    Directory of Open Access Journals (Sweden)

    Marjanović Nataša

    2014-01-01

    Full Text Available In this paper, parts of the memoir literary works from the second half of the nineteenth century are presented as important sources for the research of Serbian traditional church chant. The testimonies on church music from diaries, memoirs and autobiographical notes by famous Serbian writers, statesmen and politicians, namely Jovan Subotić, Jakov Ignjatović, Milan Savić, Milica Stojadinović Srpkinja, Todor Stefanović Vilovski, Vladimir Jovanović and Kosta Hristić, were analyzed. Those writings bring to light a time when church chant was appreciated as an important part of the spiritual, folk heritage and had an important role in everyday culture of Serbian people both in the Habsburg Monarchy and in the Principality and Kingdom of Serbia. The authors wrote about musical skills of chanters from clerical, church circles and about the practice of chanting among school teachers. They also described different kinds of musical performances of church chant among laymen and children. These sources testify to writers’ general and musical education and experiences, to their environment and its relation to the aesthetics of spiritual folk tradition. This paper also analyzes sources in the context of the history and theory of literature, having in mind the authors’ commentary techniques and narrative style. Those issues are discussed in relation to the poetics of romanticism, Biedermeier and realism in Serbian literature. [Projekat Ministarstva nauke Republike Srbije, br. 177004: Identiteti srpske muzike od lokalnih do globalnih okvira: tradicije, promene, izazovi

  4. Effect of emotion and articulation of speech on the Uncanny Valley in virtual characters

    DEFF Research Database (Denmark)

    Tinwell, Angela; Grimshaw, Mark Nicholas; Abdel Nabi, Debbie

    2011-01-01

    This paper presents a study of how exaggerated facial expression in the lower face region affects perception of emotion and the Uncanny Valley phenomenon in realistic, human-like, virtual characters. Characters communicated the six basic emotions, anger, disgust, fear, sadness and surprise...... with normal and exaggerated mouth movements. Measures were taken for perceived familiarity and human-likness. the results showed that: an increased intensity of articulation significantly reduced the uncanny for anger, yet increased perception of the uncanny for characters expressing happiness...

  5. Moskva mängis end naabritega tülitsedes nurka / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA välisministri Condoleezza Rice'i Venemaa-visiidi eesmärk oli vähendada Venemaa vastuseisu Tšehhi ja Poola laiendatavale raketitõrjekilbile ja Kosovo iseseisvusele, kuid lepiti kokku vaid selles, et retoorikat tuleb pehmendada. Moskvas viibis ka Saksa välisminister Frank-Walter Steinmeier, EL-i ja Venemaa tippkohtumise eel jäävad peaaegu kõik poliitilised tüliküsimused püsima. Lisa: Usaldamatuse saareke

  6. AcEST: DK958647 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s-Prot sp_hit_id Q9VCR6 Definition sp|Q9VCR6|SAV_DROME Scaffold protein salvador OS=Drosophila melanogaster ...ucing significant alignments: (bits) Value sp|Q9VCR6|SAV_DROME Scaffold protein salvador... 6.5 sp|A2A5X5|KR10D_MOUSE Putative keratin-associated protein 10-lik... 31 6.5 >sp|Q9VCR6|SAV_DROME Scaffold protein salvador

  7. Non-Destructive Inspection Practices. Volume II

    Science.gov (United States)

    1975-10-01

    the change in tempserature and or is fth thermal expmntion cefficient rut the material. Strictly speaking , *T should be the expnson coetficient fro the...always possible to obtain the desired result by alteting only one of them. Generally speaking it is true that the so-called "cold welding" causes...tilke sallec IN tor double siis % itý1 oiii\\ lik’ oitter skiil ,, are to be llleasirLd .icciiratel SltOkild "IVe sktl further fiolll the probe hiaie to

  8. Enhancing hybrid direct carbon fuel cell anode performance using Ag2O

    DEFF Research Database (Denmark)

    Deleebeeck, Lisa; Ippolito, Davide; Kammer Hansen, Kent

    2015-01-01

    A hybrid-direct carbon fuel cell (HDCFC), consisting of a molten slurry of solid carbon black and (Li-K)2CO3 added to the anode chamber of a solid oxide fuel cell, was characterized using current-potential-power density curves, electrochemical impedance spectroscopy, and cyclic voltammetry. Two...... types of experimental setups were employed in this study, an anode-supported full cell configuration (two electrodes, two atmospheres setup) and a 3-electrode electrolyte-supported half-cell setup (single atmosphere). Anode processes with and without catalysts were investigated as a function...

  9. Moskva mängis end naabritega tülitsedes nurka / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA välisministri Condoleezza Rice'i Venemaa-visiidi eesmärk oli vähendada Venemaa vastuseisu Tšehhi ja Poola laiendatavale raketitõrjekilbile ja Kosovo iseseisvusele, kuid lepiti kokku vaid selles, et retoorikat tuleb pehmendada. Moskvas viibis ka Saksa välisminister Frank-Walter Steinmeier, EL-i ja Venemaa tippkohtumise eel jäävad peaaegu kõik poliitilised tüliküsimused püsima. Lisa: Usaldamatuse saareke

  10. JPRS Report, Near East & South Asia

    Science.gov (United States)

    2007-11-02

    reanyhing ta is likEgypianCenralBankhastakn sme masues hat their perils, and ought to reject anything that is likely toEgyptian Central Bank has taken some...that Moroccan authorities "were not enacted by Ministerial Decree No. 110 dated 14/7/1409 willing for him" to go to Western Sahara where a Hijra [21...by the concerned minister, and the Almost a year ago, when French- Moroccan relations committees may call on the police for help when neces- were

  11. Mida huvitavat saab ülikoolis peale õppimise veel teha?

    Index Scriptorium Estoniae

    2007-01-01

    Küsimusele vastavad geograafia 3. a. üliõpilane, Tartu üliõpilaste looduskaitseringi juhatuse liige Brit Peensoo, semiootika ja kulturoloogia 1. a. magistrant, tudengipäevade sõber Kristin Vaik, molekulaar- ja rakubioloogia 4. a. doktorant, TÜ Akadeemilise Naiskoori president 2007/2008 õa-l Pille Säälik, ajakirjanduse ja suhtekorralduse 1. a. üliõpilane, Eesti Üliõpilaste Seltsi esimees Kristo Mäe ja filosoofia 3. a. üliõpilane, Tartu Üliõpilasteatri liige Kaarel Vaidla

  12. Impact Damage Tolerance of Carbon Fibre and Hybrid Laminates.

    Science.gov (United States)

    1987-10-01

    o’ rc’ltSI ilicIit e itcit tile static propertiui of fibr hr& i-c in U r,- s it icinti’y Zit1’tecd by localised stress concentriti,’as lik Otiile r...T300/5214 [-5 2Q 4 l Fig 20 Utaoi .cn o (4 ),0 1scrbnfir amin u s da aedh 3*’ wigi im ato3aiu eege O E A Fig 21 IJ 0. 5 J 0.75 J 1 j i. i T300!914

  13. Il paese dei balocchi: Pinocchio tra Paradiso e Inferno

    OpenAIRE

    Maila Pentucci

    2012-01-01

    "What a wonderful, beautiful, marvelous country! Oh--h--h!!",says Pinocchio at the end of the Chapter XXX of “The Adventures”, after Lamp-Wick explained him the amazing features of the "real country--the best in the world--a wonderful place!": the Land of Toys, also named “blessed place” and portrayed as a sort of heaven on heart for lazy boys. In reality, the approaching road to the Land of Toys, before as a mental process, - a persuasion of himself – and then as real journey, it’s lik...

  14. Temperature-Sensitive Microemulsion Gel: An Effective Topical Delivery System for Simultaneous Delivery of Vitamins C and E

    OpenAIRE

    2009-01-01

    Microemulsions (ME)—nanostructured systems composed of water, oil, and surfactants—have frequently been used in attempts to increase cutaneous drug delivery. The primary objective addressed in this work has been the development of temperature-sensitive microemulsion gel (called gel-like ME), as an effective and safe delivery system suitable for simultaneous topical application of a hydrophilic vitamin C and a lipophilic vitamin E. By changing water content of liquid o/w ME (o/w ME), a gel-lik...

  15. Cosmic numbers the numbers that define our universe

    CERN Document Server

    Stein, James D

    2011-01-01

    Our fascination with numbers begins when we are children and continues throughout our lives. We start counting our fingers and toes and end up balancing checkbooks and calculating risk. So powerful is the appeal of numbers that many people ascribe to them a mystical significance. Other numbers go beyond the supernatural, working to explain our universe and how it behaves. In Cosmic Numbers , mathematics professor James D. Stein traces the discovery, evolution, and interrelationships of the numbers that define our world. Everyone knows about the speed of light and absolute zero, but numbers lik

  16. Aktsiakapitali vähendajad leiavad üha uusi põhjuseid / Liis Kängsepp, Julia Vlasova

    Index Scriptorium Estoniae

    Kängsepp, Liis, 1981-

    2008-01-01

    AS-i Printall juht Andrus Takkin, OÜ Kantauro juht Anatoli Kanajev ja AS-i Volkerrail RTE juht Kaupo Sirk põhjendavad ettevõtte aktsiakapitali vähendamist. Riigikogu liikmete Jürgen Ligi ja Eiki Nestori ning endise rahandusministri Aivar Sõerdi kommentaarid. Tabel: Aktsiakapitali kärpijate esikümme. Diagramm: Kapitali vähendanuid seitse korda rohkem kui kümne aasta eest. Kommenteerib rahandusministeeriumi majandusanalüüsi osakonna juhataja Andrus Säälik

  17. Bayesian Model Selection and Statistical Modeling

    CERN Document Server

    Ando, Tomohiro

    2010-01-01

    Bayesian model selection is a fundamental part of the Bayesian statistical modeling process. The quality of these solutions usually depends on the goodness of the constructed Bayesian model. Realizing how crucial this issue is, many researchers and practitioners have been extensively investigating the Bayesian model selection problem. This book provides comprehensive explanations of the concepts and derivations of the Bayesian approach for model selection and related criteria, including the Bayes factor, the Bayesian information criterion (BIC), the generalized BIC, and the pseudo marginal lik

  18. Neobehaviorism and Second Language Acquisition

    OpenAIRE

    Laleh Fakhraee Faruj

    2015-01-01

    Behaviorism dominated the field of SLA until the end of the 1960s and found its most visible application in contrastive analysis and the audiolingual method (Johnson, 2004, p. 10). In this tradition, the focus was on the learner’s external environment. By now it is consensus that a mature psychology will contain a level of intermediate theory which bridges the divide between physiology and behavior, but there is disagreement over the best way to do that (Reisman, 2003). Now behaviorism is lik...

  19. Eesti teatri aastaauhinnad 2002

    Index Scriptorium Estoniae

    2003-01-01

    A. Shapiro - lavastajaauhind, L. Peterson - meesnäitleja auhind, L. Säälik - naisnäitleja auhind, J. Rekkor - meeskõrvalosa auhind, K. Mihkelson - naiskõrvalosa auhind, E.-L. Semper - kunstnikuauhind, K. Raid - žürii eriauhind, K. Kõrb, J. Karpova - balleti- ja tantsuteatri auhind, J. Nael balleti- ja tantsuteatri eriauhind, M. Malmsten, G. Raudsep - Ants Lauteri preemia, L. Epner - Priit Põldroosi preemia, A. Lamp - Aleksander Kurtna preemia, R. Raud - Salme Reegi preemia, E. Tamm, M. Soomets - Kristallkingakese preemia

  20. IMPACT OF ALTERED EXPRESSION OF MATRIX METALLOPROTE INASES (MMPs ON THE DEVELOPMENT AND SEVERITY OF DIABETIC RETINOPATHY.

    Directory of Open Access Journals (Sweden)

    Lakshmi K.

    2013-05-01

    Full Text Available . INTRODUCTION: The primary cause of visual loss in the country lik e India are cataract, glaucoma, malnutrition, age related macular degeneration and diabetic retinopathy (DR 1 .DR is the most common microvascular complication of both type 1 an d type 2 diabetes mellitus (DM and is the most frequent single cause of newly reported cases of blindness among the adults in the age group of 20 – 75 years 2 . Visual loss due to diabetes either develops from increased permeability of retinal vessels (diabetic macular edema or by proliferatio n of new retinal vessels 2 .

  1. Meckel Gruber Sendromu: Olgu Sunumu

    OpenAIRE

    Ilıkkan, Barbaros; Tüysüz, Beyhan; Aksoy, Figen; Beker, Dildar Bahar; ULUDAĞ, Seyfettin; Vural, Mehmet; Özbek, Sibel; Perk, Yıldız

    1997-01-01

    Ansefalosel dudak damak yarığı böbrek kisti hepatik fibroz mikropenis elde ulnar deviasyon ve pes ekinovarusu olan bir yenidoğanda Meckel Gruber sendromu tanısı kondu Meckel Gruber sendromu ansefalosel polikistik böbrek ve polidaktili triadı ile karakterize otozomal resesif geçişli bir sendromdur Ancak hastamızda olduğu gibi triadın iki bulgusu ve eşlik eden diğer anomalileri içeren Meckel Gruber sendromlu olgular tanımlanmaktadır Anahtar kelimeler: Meckel Gruber Sendromu Dandy Walker Malform...

  2. Meckel Gruber Sendromu: Olgu Sunumu

    OpenAIRE

    Ilıkkan, Barbaros; Tüysüz, Beyhan; Aksoy, Figen; Beker, Dildar Bahar; ULUDAĞ, Seyfettin; Vural, Mehmet; Özbek, Sibel; Perk, Yıldız

    2014-01-01

    Ansefalosel dudak damak yarığı böbrek kisti hepatik fibroz mikropenis elde ulnar deviasyon ve pes ekinovarusu olan bir yenidoğanda Meckel Gruber sendromu tanısı kondu Meckel Gruber sendromu ansefalosel polikistik böbrek ve polidaktili triadı ile karakterize otozomal resesif geçişli bir sendromdur Ancak hastamızda olduğu gibi triadın iki bulgusu ve eşlik eden diğer anomalileri içeren Meckel Gruber sendromlu olgular tanımlanmaktadır Anahtar kelimeler: Meckel Gruber Sendromu Dandy Walker Malform...

  3. 街霸版Xbox手柄

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Lik-Sang公司最近发表了他们为Xbox主机开发的手柄,主题是我们大家再熟悉不过的Street Fighter(街头霸王)主题。相信街霸对于我们《数码精品世界》读者这个年龄段的人来说,一定不会陌生,它陪我们走过一个个即兴奋又紧张(怕教师和家发现)的青春岁月。

  4. Tipologias de comunidades participativas na América Latina : o caso dos conselhos de saúde de Montevidéu (Uruguai) e Porto Alegre (Brasil)

    OpenAIRE

    Gonçalves, Andréa de Oliveira; Gonçalves, Rodrigo de Souza; Weffort,Elionor Farah Jreige

    2008-01-01

    O artigo examina a relação existente entre comunidades ditas participativas – por meio de conselhos de saúde – e sua influência na deliberação da política pública municipal de saúde, nas cidades de Porto Alegre (Brasil) e Montevidéu (Uruguai), sob o ponto de vista de seus conselheiros. Para consecução deste objetivo foi conduzida uma pesquisa comparativa qualitativa (SARTORI, MORLINO, 1994) em um estudo de casos múltiplos (YIN, 2005), tendo como principais referências teóricas Lik...

  5. Od djevojčice s ulice do rimske božice: stvaranje višestrukih vizualnih Alica od 1858. do 1872.

    OpenAIRE

    Heller, Erga

    2016-01-01

    Viktorijanske prikaze djetinjstva nalazimo u raznolikim kulturnim tekstovima, i to u različitim verbalnim i vizualnim oblicima – od književnih opisa do samostalnih slika. Aličine pustolovine u Čudozemskoj Lewisa Carrolla (1865.) u tome smislu ne predstavljaju iznimku. Međutim, Aličin lik jedan je od prvih koji se prometnuo u intermedijsku figuru, pri čemu je Alica postala junakinjom fantastične književnosti kao i ikonom popularne kulture. Ovaj se rad usmjerava na tri oblika Aličina umjetničko...

  6. Deviations from Born-Oppenheimer mass scaling in spectroscopy and ultracold molecular physics

    CERN Document Server

    Lutz, Jesse J

    2016-01-01

    We investigate Born-Oppenheimer breakdown (BOB) effects (beyond the usual mass scaling) for the electronic ground states of a series of homonuclear and heteronuclear alkali-metal diatoms, together with the Sr$_2$ and Yb$_2$ diatomics. Several widely available electronic structure software packages are used to calculate the leading contributions to the total isotope shift for commonly occurring isotopologs of each species. Computed quantities include diagonal Born-Oppenheimer corrections (mass shifts) and isotopic field shifts. Mass shifts dominate for light nuclei up to and including K, but field shifts contribute significantly for Rb and Sr and are dominant for Yb. We compare the {\\em ab initio} mass-shift functions for Li$_2$, LiK and LiRb with spectroscopically derived ground-state BOB functions from the literature. We find good agreement in the values of the functions for LiK and LiRb at their equilibrium geometries, but significant disagreement with the shapes of the functions for all 3 systems. The diff...

  7. YÜZEYSEL FLUOR UYGULAMASINDAN SONRA OLUŞAN CaFz'ÜN MİNE YÜZEYİNDE TUTUNMASININ İN VİVO İNCELENMESİ-THE DURATION OF CaFi FORMED BY TOPICAL APPLICATION IN VIVO

    OpenAIRE

    Doğan, Ferda; Oktay, İnci; Aras, Yasemin

    2013-01-01

    ÖZETAraştırmamızda APF uygulamasından O, 24 ve 96 saat sonra mine yapısına katılan sıkı bağlı fluor ve mine yüzeyinde olu§an gevşek bağlı fluor değerleri in vivo olarak İncelendi.Uygulamadan 0, 24, 96 saat sonraki sıkı bağlı fluor değerlerinde kontrol ve deney yüzeyleri arasında anlamlı farklılıklar bulunamadı. CaF2 şeklindeki gevşek bağlı fluor değeri ise başlangıç uygulamaya kıyasla 24 saat sonra % 80, 96 saat soma % 85'lik bir kayıp gösterdi. Ancak 2. ve 3. değerler arasındaki % 5'lik kayı...

  8. Endurance testing with Li/Na electrolyte

    Energy Technology Data Exchange (ETDEWEB)

    Ong, E.T.; Remick, R.J.; Sishtla, C.I. [Institute of Gas Technology, Des Plaines, IL (United States)

    1996-12-31

    The Institute of Gas Technology (IGT), under subcontract to M-C Power Corporation under DOE funding, has been operating bench-scale fuel cells to investigate the performance and endurance issues of the Li/Na electrolyte because it offers higher ionic conductivity, higher exchange current densities, lower vapor pressures, and lower cathode dissolution rates than the Li/K electrolyte. These cells have continued to show higher performance and lower decay rates than the Li/K cells since the publication of our two previous papers in 1994. In this paper, test results of two long-term 100-cm{sup 2} bench scale cells are discussed. One cell operated continuously at 160 mA/cm{sup 2} for 17,000 hours with reference gases (60H{sub 2}/20CO{sub 2}/20H{sub 2}O fuel at 75% utilization and 30CO{sub 2}/70 air oxidant humidified at room temperature at 50% utilization). The other cell operated at 160 mA/cm{sup 2} for 6900 hours at 3 atm with system gases (64H{sub 2}/16CO{sub 2}/20H{sub 2}O at 75% utilization and an M-C Power system-defined oxidant at 40% utilization). Both cells have shown the highest performance and longest endurance among IGT cells operated to date.

  9. POPÜLER ÇEVİRİ ÇOCUK ROMANLARININ İÇERİK BAKIMINDAN İNCELENMESİ / AN EXAMINATION OF POPULAR TRANSLATED NOVELS FOR CHILDREN IN TERMS OF CONTENT

    OpenAIRE

    Derya YILDIZ

    2016-01-01

    Çocuk ve gençlik edebiyatı, dil gelişimi ve anlama düzeyine uygun olarak hedef kitlenin duygu ve düşünce dünyalarını zenginleştiren ürünleri kapsamaktadır. Bir geçiş sürecinde olan çocuk ya da genç, çocuk ve gençlik yazını ürünlerinden yararlanarak okuma alışkanlığı kazanır, yazınsal duyarlığını geliştirir ve kimlik gelişimine katkı sağlar. Çeviri kitaplar sayesinde de farklı kültürlerdeki karakterlerle karşılaşarak yeni yaşantılar kazanır ve bu sayede duygu ve düşünce zenginliği edinir. Bu ç...

  10. Ameliyat sonrası gelişen karın içi yapışıklıkların önlenmesinde metilen mavisinin etkinliğinin değerlendirilmesi (deneysel çalışma

    Directory of Open Access Journals (Sweden)

    Erkan Hazar

    2013-09-01

    Full Text Available Amaç. İntestinal tıkanıklıkların önemli bir nedeni ameliyat sonrası yapışıklıklardır. Bu çalışmanın amacı, metilen mavisinin ameliyat sonrası yapışıklıkları önleyici etkilerini araştırmaktır. Yöntem. Matür 40 adet sıçan kullanılıp, ameliyat öncesi sıçanlar rastgele olarak her biri 10 sıçandan oluşan 4 gruba ayrıldı; 1’inci gruba çekum ön duvarında 0,5cm’lik alan 15 no lu bistüri ile travmatize edilerek, 2’nci gruba çekum ön duvarda 1cm’lik alana bistüri ile tam kat kesildi ve kapatıldı. Bu iki gruba karın içerisine 2mL SF konuldu; 3’üncü gruba çekum ön duvarında 0,5cm’lik alan 15no’lu bistüri ile travmatize edilerek, IV. Grup’a çekum ön duvarda 1cm’lik alana bistüri ile tam kat kesildi ve kapatıldı. Bu iki gruba da karın içerisine %1’lik metilen mavisinden 2mL konuldu. Ameliyat sonrası 14’üncü günde çekumdan histopatolojik inceleme için biyopsi alınarak fıbrozis, neovaskülarizasyon, ve inflamasyon dereceleri incelendi. Bulgular. Fibrozis bakımından; 2 ve 4’üncü gruplar tamamen pozitif (+, 1’inci grubun %80’i negatif (- olarak değerlendirildi. İnflamatuar cevap için hastaların %25’i negatif (-, %75’i pozitif (+’tir. İkinci grup için tamamı %100’ü pozitiftir (+. Neovaskülarizasyon bakımından, tüm hastaların %35’i negatif (- %65’i pozitif (+’tir. Her gruptan en az bir hasta negatifken en çok 1’inci grupta %70 negatif (- hasta vardır. Mezotel hücre proliferasyonu bakımından, hastaların %27,5’i negatif,%62,5’i pozitif(+’tir. Grup 1’de negatiflik(- oranı %80, Grup 3’te pozitiflik oranı %90, Grup 4 için deneklerin tamamı pozitiftir. Sonuç. Metilen mavisinin fıbrozisi, neovaskülarizasyonu ve inflamasyonu azaltmadığı, mezotel hücre proliferasyonunu azalttığı görüldü. Bu bulgular, metilen mavisinin mezotel hücre proliferasyonunu azaltarak ameliyat sonrası yapışıklıkları

  11. Determining The Factors That Affect Burnout And Job Satisfaction Among Academicians: A Sample Application On The Hitit University Determining The Factors That Affect Burnout And Job Satisfaction Among Academicians: A Sample Application On The Hitit University

    Directory of Open Access Journals (Sweden)

    Sibel YOLERİ

    2012-12-01

    Full Text Available Academicians are the most important components of the universities. Therefore, aim of this study is to identify the burnout and job satisfaction levels of academic personnel in Hitit University, and to evaluate the relationship between some variables of academic personnel’s job satisfaction and burnout level. For this reason, 81 questionnaires were applied to academicians from the faculties of Engineering, Theology, Science and Letters, Economic and Administrative Sciences, School of Physical Education and Sports and School of Health and the finally Vocational Higher Schools in Hitit University in 2011-2012 educational year. Data collection instruments implemented are The Maslach Burnout Inventory (MBI (Maslach and Jackson, 1981 and The Job Satisfaction Survey (Hackman and Oldham, 1975. The Personal Information Form was used to get some information about university academicians. Results indicate that, among the demographic variables, gender was significantly related to depersonalization burnout subscales. Found that these study male academicians have significantly higher mean scores on depersonalization than females. It is observed that academics job satisfaction and burnout sub dimensions are not varied with the variables of age, marital status, and weekly lesson load. This research indicates that job satisfaction level of middle revenue level is significantly higher than that of lower level. The results indicated that lecturer reported a higher level of depersonalization than professors/associate professor and assistant professor. Also, job satisfaction was found that inversely meaningful correlated with emotional exhaustion. According to this study result while emotional exhaustion is increasing job satisfaction decreases, while emotional exhaustion is decreasing job satisfaction increases. Akademisyenler üniversitelerin en önemli bileşenleridir. Bunedenle çalışmanın amacı, Hitit Üniversitesi akademik personelinintükenmişlik ve i

  12. Tradeoffs Between Synchronization, Communication, and Work in Parallel Linear Algebra Computations

    Science.gov (United States)

    2014-01-25

    uppercase boldface letters (A,T), with elements Aij , Tijk. • Functions and maps will be defined as Greek letters (σ(n)). • Open/closed intervals in R...Tiskin [23]). 11 Algorithm 3 Cholesky factorization algorithm L = CHOLESKY(A, n) 1 for j = 1 to n 2 Ljj = √ Aij − ∑j−1 k=1 Ljk · Ljk 3 for i = j + 1 to n...4 for k = 1 to j − 1 5 Zijk = Lik · Ljk 6 Lij = ( Aij − ∑j−1 k=1 Zijk)/Ljj 6.2.2 LU factorization The LU factorization of a square matrix A is A = L

  13. Models of Polarized Light from Oceans and Atmospheres of Earth-like Extrasolar Planets

    CERN Document Server

    McCullough, P R

    2006-01-01

    Specularly reflected light, or glint, from an ocean surface may provide a useful observational tool for studying extrasolar terrestrial planets. Detection of sea-surface glints would differentiate ocean-bearing terrestrial planets, i.e. those similar to Earth, from other terrestrial extrasolar planets. The brightness and degree of polarization of both sea-surface glints and atmospheric Rayleigh scattering are strong functions of the phase angle of the extrasolar planet. We modify analytic expressions for the bi-directional reflectances previously validated by satellite imagery of the Earth to account for the fractional linear polarization of sea-surface reflections and of Rayleigh scattering in the atmosphere. We compare our models with Earth's total visual light and degree of linear polarization as observed in the ashen light of the Moon, or Earthshine. We predict the spatially-integrated reflected light and its degree of polarization as functions of the diurnal cycle and orbital phase of Earth and Earth-lik...

  14. AcEST: BP911872 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Definition sp|P98193|DMP1_RAT Dentin matrix acidic phosphoprotein 1 OS=Rattus norvegicus Align length 179 Sc...nments: (bits) Value sp|P98193|DMP1_RAT Dentin matrix acidic phosphoprotein 1 OS=Ratt... 44 5e-04 sp|O55188|DMP1_MOUSE Denti... 1 OS=M... 35 0.24 sp|Q13316|DMP1_HUMAN Dentin matrix acidic phosphoprotein 1 OS=... 33 0.90 sp|Q5ZKW8|HDX_CHICK Highly divergent homeobox OS=Gallus gallus G... 33 0.90 >sp|P98193|DMP1_RAT Denti... Retinitis pigmentosa GTPase regulator-lik... 44 0.005 tr|A2VD06|A2VD06_RAT Dentin matrix protein 1 OS=Rattu

  15. "Kas võib tõesti tulla Hommik?..." : [luuletused] / Emily Dickinson ; tõlk. Doris Kareva, Jüri Talvet

    Index Scriptorium Estoniae

    Dickinson, Emily

    2008-01-01

    Sisu: "Kas võib tõesti tulla Hommik?..." ; "Ta suri - nii ta surigi..." ; "On kuskil surematud Mäed..." ; "Likööri rüüpan võrratut..." ; "See linnuke on Lootus..." ; "Olen Eikeegi. Ja sina?..." ; "Ma tean, on piirat Aeg..." ; "Ma räägin kuidas tõusis Päev..." ; "On Kuudel lõpp - on Aastail - sõlm..." ; "Suur Hullus pühim mõistus on..." ; "Kui saabuksid sa Sügisel..." ; "Hing valib Seltsi ainuomase..." ; "Ma surin Ilu eest - just siis..." ; "Et mina ei saand peatuda..." ; "Surm, see on kahekõne vaid..." ; "Suur Lootus langes..." ; "Üht kaotust igavesti kandsin..." ; "Need kes on hauas viibinud kaua..." ; "See lõplikkusetunne..." ; "Jah - nende tabamatus..." ; "Lõid Maja ümber laksu vood..." ; "Ei pälvi kuigivõrd...". Elu- ja loomeloolisi andmeid autori kohta lk. 507-508

  16. A factorization approach to next-to-leading-power threshold logarithms

    CERN Document Server

    Bonocore, D; Magnea, L; Melville, S; Vernazza, L; White, C D

    2015-01-01

    Threshold logarithms become dominant in partonic cross sections when the selected final state forces gluon radiation to be soft or collinear. Such radiation factorizes at the level of scattering amplitudes, and this leads to the resummation of threshold logarithms which appear at leading power in the threshold variable. In this paper, we consider the extension of this factorization to include effects suppressed by a single power of the threshold variable. Building upon the Low-Burnett-Kroll-Del Duca (LBKD) theorem, we propose a decomposition of radiative amplitudes into universal building blocks, which contain all effects ultimately responsible for next-to-leading power (NLP) threshold logarithms in hadronic cross sections for electroweak annihilation processes. In particular, we provide a NLO evaluation of the "radiative jet function", responsible for the interference of next-to-soft and collinear effects in these cross sections. As a test, using our expression for the amplitude, we reproduce all abelian-lik...

  17. KOMPILASI HUKUM ISLAM SEBAGAI FIQH LINTAS MADZHAB DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Moh. Asy’ari

    2014-10-01

    Full Text Available Kebekuan perkembangan hukum Islam daripertengahan abad IV H – XII H menimbulkan‘kegelisahan intelektual’ sekaligus memancarkansemangat ijtihâd di kalangan kaum Muslim. Dalamsemangat ijtihâd inilah, Indonesia berhasil menyusunKHI, yang tema utamanya adalah mempositifkanhukum Islam di Indonesia. Kitab-kitab yang digunakandalam merumuskan KHI tersebut berjumlah 38 kitab.Dari hasil penelusuran terhadap kitab-kitab yangdigunakan tersebut dapat diketahui bahwa kebanyakandari mereka adalah kitab-kitab fiqh madzhab Syâfi’î.Sedangkan sebagian lainnya merupakan kitab-kitab fiqhmadzhab Hanafî, Mâlikî, Hanbalî, Dzahirî, dan Syî’ah.Di samping itu, juga terdapat kitab-kitab perbandingandan tanpa madzhab. Penggunaan kitab-kitab dariberbagai madzhab tersebut dapat dipahami sebagaikeinginan untuk mempercepat proses taqrîb bayn alummahsehingga pertentangan antar madzhab dapatdihindari dan diarahkan kepada perpaduan dankesatuan kaidah dan nilai.

  18. AcEST: DK962346 [AcEST

    Lifescience Database Archive (English)

    Full Text Available significant alignments: (bits) Value tr|A9SQS6|A9SQS6_PHYPA Ferric reductase-like transmembrane compo... 66...09 tr|Q2HST1|Q2HST1_MEDTR Ferric reductase-like transmembrane compo... 63 1e-08 tr|A9RKK9|A9RKK9_PHYPA Ferri...c reductase like transmembrane compo... 61 5e-08 tr|Q9LTA0|Q9LTA0_ARATH FRO2-like protein; NADPH oxidase-lik...idopsis thaliana... 58 5e-07 tr|A9S7N1|A9S7N1_PHYPA Ferric reductase-like transmembrane compo... 57 7e-07 tr...|A9S0A4|A9S0A4_PHYPA Ferric reductase like transmembrane compo... 53 1e-05 tr|Q7X

  19. Dual-Conformal Regularization of Infrared Loop Divergences and the Chiral Box Expansion

    CERN Document Server

    Bourjaily, Jacob L; Trnka, Jaroslav

    2013-01-01

    We revisit the familiar construction of one-loop scattering amplitudes via generalized unitarity in light of the recently understood properties of loop integrands prior to their integration. We show how in any four-dimensional quantum field theory, the integrand-level factorization of infrared divergences leads to twice as many constraints on integral coefficients than are visible from the integrated expressions. In the case of planar, maximally supersymmetric Yang-Mills amplitudes, we demonstrate that these constraints are both sufficient and necessary to imply the finiteness and dual-conformal invariance of the ratios of scattering amplitudes. We present a novel regularization of the scalar box integrals which makes dual-conformal invariance of finite observables manifest term by term, and describe how this procedure can be generalized to higher loop-orders. Finally, we describe how the familiar scalar boxes at one-loop can be upgraded to `chiral boxes' resulting in a manifestly infrared-factorized, box-lik...

  20. Dicty_cDB: Contig-U16389-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3_1( M33753 |pid:none) D.melanogaster crumbs protein mRNA, co... 49 9e-04 AE01429...6_2190( AE014296 |pid:none) Drosophila melanogaster chromos... 49 9e-04 ( P10040 ) RecName: Full=Protein crumb...18 BC162451_1( BC162451 |pid:none) Danio rerio crumbs homolog 2, mRNA... 41 0.18 ...12, mRNA (cDNA... 40 0.40 AY720432_1( AY720432 |pid:none) Homo sapiens crumbs-like protein 2... 40 0.40 AL77...id:none) Leishmania major strain Friedlin, ... 37 2.6 DQ314735_1( DQ314735 |pid:none) Danio rerio crumbs-lik

  1. Dicty_cDB: Contig-U16120-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F374376_24( AF374376 |pid:none) Oikopleura dioica clone BAC clone... 52 9e-05 M33753_1( M33753 |pid:none) D.melanogaster crumb...none) Homo sapiens cDNA FLJ56535 complet... 46 0.007 AF406641_1( AF406641 |pid:none) Mus musculus crumbs-lik...|pid:none) Xenopus laevis proprotein converta... 40 0.36 BC162451_1( BC162451 |pid:none) Danio rerio crumb...|pid:none) Danio rerio crumbs-like protein 1 ... 39 1.0 BC163555_1( BC163555 |pid:none) Danio rerio crumbs h...e, pa... 52 9e-05 AB218869_1( AB218869 |pid:none) Rhyparobia maderae LpR mRNA for Li... 52 9e-05 ( P10040 ) RecName: Full=Protein cru

  2. Yayın Kuralları

    OpenAIRE

    Editör, Editör

    2014-01-01

    SAĞLIK BİLİMLERİ VE MESLEKLERİ DERGİSİ'nde daha önce başka bir yerde yayınlanmamış, hakem değerlendirmesinde olmayan ve Dergi Yazı Kurulu (Editorial Board) ve Yayın Danışma (Hakem) Kurulu tarafından değerlendirilerek uygun bulunan yazılar basılır. Basılması uygun görülmeyen yazılar geri iade edilmez. Yayınlanan yazı ve resimlerin tüm hakları dergiye aittir. Dergiden alıntı yapıldığı takdirde dergi kaynak olarak belirtilmelidir.YAYIN KURALLARIBİLİMSEL SORUMLULUKMakalelerin bilimsel kurall...

  3. Treacher Collins Sendromu ve Üç Boyutlu Bilgisayarlı Tomografi: Olgu Sunumu

    OpenAIRE

    2012-01-01

    Treacher Collins sendromu özellikle yüzü ve kafayı etkileyen otozomal dominant geçişli genetik bir hastalıktır. Bu yazıda malar hipoplazi, dış kulak anomalileri, antimongoloid göz yerleşimi ve alt göz kapağında kirpiklerin kısmi yokluğu ile Treacher Collins sendromu tanısı konan 3 aylık bir kız çocuk olgusu tarafımızdan sunulmaktadır. Bu yazının amacı 3 boyutlu BT‘nin Treacher Collins sendromuna eşlik edebilen kraniyosinostozun saptanmasında yararlı bir tetkik olduğunun vurgulanması...

  4. NCBI nr-aa BLAST: CBRC-CFAM-25-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-25-0003 ref|NP_113554.1| preferentially expressed antigen in melanoma-lik...e 1 [Mus musculus] gb|AAK31957.1|AF285578_1 preferentially expressed antigen in melanoma-like protein [Mus m...usculus] emb|CAM26241.1| preferentially expressed antigen in melanoma-like 1 [Mus musculus] gb|AAI31996.1| P...referentially expressed antigen in melanoma-like 1 [Mus musculus] gb|AAI32400.1| ...Preferentially expressed antigen in melanoma-like 1 [Mus musculus] gb|EDL13429.1| preferentially expressed antigen in melanoma-like 1 [Mus musculus] NP_113554.1 1.7 22% ...

  5. Travmatik Diafragma Rüptürü Olan Bir Vakada Rastlantısal Tespit Edilen Perikardial Rüptür ve Kalp Herniasyonu

    OpenAIRE

    2016-01-01

    Perikard ve kalp yaralanmaları travmatik diafragma rüptürüne nadir olarak eşlik eder. Trafik kazası geçiren 42 yaşındaki erkek hastaya diafragma rüptürü teşhisi kondu. Öncelikle laparatomi yapılan hastada, diafragma abdominal yaklaşımla tamir edilmeye çalışıldı. Ancak daha güvenli tamir için yapılan torakotomide perikardın rüptüre olduğu görüldü. Kalp herniye olmuştu. Kalp yerine itildikten sonra perikard ve diafragma primer olarak tamir edildi. Akut diafragma rüptürlerinde ilk yaklaşım genel...

  6. Dicty_cDB: Contig-U08887-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4977 |pid:none) Schmidtea mediterranea bruno-like ... 61 1e-07 FN392319_1058( FN392319 |pid:none) Pichia pas...:none) Gallus gallus CUG-BP and ETR-3-lik... 59 4e-07 BC163416_1( BC163416 |pid:none) Danio rerio bruno-like...BC114331 |pid:none) Danio rerio DAZ associated protein... 58 1e-06 BC048405_1( BC048405 |pid:none) Mus musculus bruno...58 1e-06 AF515450_1( AF515450 |pid:none) Mus musculus bruno-like 4 protein ... 58...ength cDNA clone ZM... 57 2e-06 BC030835_1( BC030835 |pid:none) Homo sapiens bruno-like 6, RNA bin... 57 2e-

  7. "Kas võib tõesti tulla Hommik?..." : [luuletused] / Emily Dickinson ; tõlk. Doris Kareva, Jüri Talvet

    Index Scriptorium Estoniae

    Dickinson, Emily

    2008-01-01

    Sisu: "Kas võib tõesti tulla Hommik?..." ; "Ta suri - nii ta surigi..." ; "On kuskil surematud Mäed..." ; "Likööri rüüpan võrratut..." ; "See linnuke on Lootus..." ; "Olen Eikeegi. Ja sina?..." ; "Ma tean, on piirat Aeg..." ; "Ma räägin kuidas tõusis Päev..." ; "On Kuudel lõpp - on Aastail - sõlm..." ; "Suur Hullus pühim mõistus on..." ; "Kui saabuksid sa Sügisel..." ; "Hing valib Seltsi ainuomase..." ; "Ma surin Ilu eest - just siis..." ; "Et mina ei saand peatuda..." ; "Surm, see on kahekõne vaid..." ; "Suur Lootus langes..." ; "Üht kaotust igavesti kandsin..." ; "Need kes on hauas viibinud kaua..." ; "See lõplikkusetunne..." ; "Jah - nende tabamatus..." ; "Lõid Maja ümber laksu vood..." ; "Ei pälvi kuigivõrd...". Elu- ja loomeloolisi andmeid autori kohta lk. 507-508

  8. KONYA'DA YETİŞEN CENTAUREA PTEROCAULA TRUATV. 'IN FENOLİK YAPISI VE ANTİOKSİDAN ETKİSİ

    OpenAIRE

    TEKELİ, Yener

    2009-01-01

    antioksidan aktivitesinin belirlenmesi amaçlanmıştır. Centaurea Pterocaula 'u yağından uzaklaştırılmak için sokslet apareyi ile petrol eterinde ekstrakte edildi. Sonra materyal %70 lik metanolde tekrar ekstraksiyona tabi tutuldu ve çözücüsünden uzaklaştırıldı. Toplam fenolik madde konsantrasyonu Folin-Ciocalteu metoduna, serbest radikal süpürme etkisi DPPH metoduna göre ve indirgeme gücü ise Oyaizu metoduna göre yapıldı. Bitkinin fenolik yapısı HPLC ile belirlendi. Sonuçlar sen...

  9. Límites legales del concubinato: normas y tabúes en la esclavitud sexual según la Bidāya de Ibn Rušd

    Directory of Open Access Journals (Sweden)

    de la Puente, Cristina

    2007-12-01

    Full Text Available Concubinage is a kind of relationship between a man and a woman whose legal implications have been discussed and regulated by all Islamic legal schools. Norms of both religious and juridical nature regulate the relationship between a man and his concubine, in relation to several factors: sexual and family taboos, the slave condition of the concubine, the man’s obligations in regard to the individuals under his surveillance, etc. The goal of this paper is to investigate which are the limits of concubinage according to Mālikī legal doctrine, with special focus on cases in which marriage and concubinage show parallels. The basis for this study is the treatise on comparative law Bidāyat al-mujtahid, by Ibn Rushd (Averroes.

    El concubinato es una relación con consecuencias legales discutidas y reguladas por todas las escuelas jurídicas islámicas. Las relaciones entre un hombre y su concubina están limitadas por distintas normas de carácter jurídico-religioso, que tienen que ver con diferentes factores: tabúes sexuales y familiares, el estatus de esclava de la concubina, las obligaciones del hombre respecto a los individuos que hay bajo su guarda, etc. El objetivo de este artículo es estudiar cuáles son los límites del concubinato según los establece la doctrina legal mālikí, prestando especial atención a los casos en que las relaciones de matrimonio o concubinato se asemejan o difuminan. El estudio se lleva a cabo a través del tratado de derecho comparado de Ibn Rušd (Averroes, Bidāyat al-muŷtahid.

  10. Ekonomik gerikalmışlık ve ekonomik dengesizlik kavramları üzerine bir deneme

    Directory of Open Access Journals (Sweden)

    Ahmet Ali KARACA

    2010-01-01

    Full Text Available Bu makalede öncelikle azgelişmişlik kavramı üzerinde durulmuş bu konuda en önde gelen yerli ve yabancı kaynaklar belirlenmiştir. Ardından da bu kaynaklarda yer alan çalışmalar incelenmiş ve özellikle daha güncel tarihli çalışmalarda ele alınan ana ve alt konular üzerinde durulmuştur. Ayrıca azgelişmişlik düzeyini ölçen kriterler ayrıntılı olarak incelenmiştir. Özellikle; Dünya ekonomisine entegrasyon kriterleri, endüstrileşme kriterleri, sosyo-ekonomik kriterler, jeo-politik kriterler başlıklarında detaylı bilgiler verilmiştir. Literatürde ekonomik gerikalmışlık kriterlerini inceleyen çok çeşitli makaleler vardır. Bu makaleler genelde geri kalmışlık yaklaşımlarını genel değerlendirme perspektifinden aktarmaktadırlar. Bu makalede ise ekonomik geri kalmışlık kavramı ekonomik kalkınma iktisadı açısından incelenmiş ve ekonomik dengesizlikler ve kriterleri detaylı bir şekilde verilmiştir.

  11. Trace elements in Zn Pb Ag deposits and related stream sediments, Brooks Range Alaska, with implications for Tl as a pathfinder element

    Science.gov (United States)

    Graham, G.E.; Kelley, K.D.; Slack, J.F.; Koenig, A.E.

    2009-01-01

    The Zn-Pb-Ag metallogenic province of the western and central Brooks Range, Alaska, contains two distinct but mineralogically similar deposit types: shale-hosted massive sulphide (SHMS) and smaller vein-breccia occurrences. Recent investigations of the Red Dog and Anarraaq SHMS deposits demonstrated that these deposits are characterized by high trace-element concentrations of As, Ge, Sb and Tl. This paper examines geochemistry of additional SHMS deposits (Drenchwater and Su-Lik) to determine which trace elements are ubiquitously elevated in all SHMS deposits. Data from several vein-breccia occurrences are also presented to see if trace-element concentrations can distinguish SHMS deposits from vein-breccia occurrences. Whole-rock geochemical data indicate that Tl is the most consistently and highly concentrated characteristic trace element in SHMS deposits relative to regional unmineralized rock samples. Laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) analyses of pyrite and sphalerite indicate that Tl is concentrated in pyrite in SHMS. Stream sediment data from the Drenchwater and Su-Lik SHMS show that high Tl concentrations are more broadly distributed proximal to known or suspected mineralization than As, Sb, Zn and Pb anomalies. This broader distribution of Tl in whole-rock and particularly stream sediment samples increases the footprint of exposed and shallowly buried SHMS mineralization. High Tl concentrations also distinguish SHMS mineralization from the vein-breccia deposits, as the latter lack high concentrations of Tl but can otherwise have similar trace-element signatures to SHMS deposits. ?? 2009 AAG/Geological Society of London.

  12. Political Martyrdom and Religious Censorship in Islamic Sicily: a Case Study During the Age of Ibrāhīm II (261-289/875-902

    Directory of Open Access Journals (Sweden)

    Mandalà, Giuseppe

    2014-06-01

    Full Text Available At the end of Sicily’s Islamic period, the Mālikī juridical school was firmly rooted and documented in the island; but like many aspects of the cultural life of the island during the Islamic Age, the historical process that led to this situation is yet to be clarified. The present study aims to contribute by providing a historical context for a passage of the Kitāb al-miḥan, a book of Islamic martyrology written by Abūl-‘Arab Muḥammad al-Tamīmī (d. 333/945, which until now has been overlooked by every study – both old and new – on Islamic Sicily. The works relates how a judge living and working in Sicily, Aḥmad b. Muḥammad al-Ṭā’ī, known as Ibn al-Majjānī, was imprisoned and tortured at the behest of Ibrāhīm II (261-289/875-902, the Aghlabid sovereign who has been of most interest to historians. Other than establishing a plausible date for the event (275/888-889, the article analyses the historical role of places and people, placing the ‘martyrdom’ of Ibn al-Majjānī in the context of the political repression exerted by Ibrāhīm II following the episode of Ibn Ṭālib (d. 275/888-889 and the subsequent religious censorship imposed by the Aghlabid at the expense of the Mālikī élites in Ifrīqiya and, perhaps also, in the nearby wilāya of Sicily.Al final del periodo islámico en Sicilia, la escuela jurídica mālikí estaba firmemente arraigada y documentada en la isla, pero, como ocurre con otros muchos aspectos de su vida cultural en época islámica, el proceso histórico que había llevado a esa situación todavía necesita ser aclarado. Este estudio tiene como objetivo proporcionar a suministrar un contexto histórico para entender un pasaje del Kitāb al-miḥan, obra de martirología islámica compuesta por Abūl-‘Arab Muḥammad al-Tamīmī (m. 333/945, pasaje al que hasta ahora no se ha prestado atención en los estudios antiguos y modernos sobre la Sicilia islámica. En él se relata cómo un

  13. Strong and Electroweak Matter 2004

    Science.gov (United States)

    Eskola, Kari J.; Kainulainen, Kimmo; Kajantie, Keijo; Rummukainen, Kari

    RHIC experimental summary: the message from pp, d+Au and Au+Au collisions / M. Calderón de la Barca Sánchez -- Hydrodynamic aspects of relativistic heavy ion collisions at RHIC / P. F. Kolb -- Photon emission in a hot QCD plasma / P. Aurenche -- In search of the saturation scale: intrinsic features of the CGC / H. Weigert -- From leading hadron suppression to jet quenching at RHIC and LHC / U. A. Wiedemann -- Lattice simulations with chemical potential / C. Schmidt -- Mesonic correlators in hot QCD / M. Laine -- Thermalization and plasma instabilities / P. Arnold -- Transport coefficients in hot QCD / G. D. Moore -- Classical fields and heavy ion collisions / T. Lappi -- Progress in nonequilibrium quantum field theory II / J. Berges and J. Serreau -- A general effective theory for dense quark matter / P. T. Reuter, Q. Wang and D. H. Rischke -- Thermal leptogenesis / M. Plümacher -- Cold electroweak Baryogenesis / J. Smit -- Proton-nucleus collisions in the color glass condensate framework / J.-P. Blaizot, F. Gelis and R. Venugopalan -- From classical to quantum saturation in the nuclear wavefunction / D. N. Triantafyllopoulos -- Charge correlations in heavy ion collisions / A. Rajantie -- Whitening of the quark-gluon plasma / S. Mrówczyński -- Progress in anisotropic plasma physics / P. Romatschke and M. Strickland -- Deconfinement and chiral symmetry: competing orders / K. Tuominen -- Relation between the chiral and deconfinement phase transitions / Y. Hatta -- Renormalized Polyakov loops, matrix models and the Gross-Witten point / A. Dumitru and J. T. Lenaghan -- The nature of the soft excitation at the critical end point of QCD / A. Jakovác ... [et al.] -- Thermodynamics of the 1+1-dimensional nonlinear sigma model through next-to-leading order in 1/N / H. J. Warringa -- Light quark meson correlations at high temperature / E. Laemann ... [et al.] -- Charmonia at finite momenta in a deconfined plasma / S. Datta ... [et al.] -- QCD thermodynamics: lattice

  14. Individuals World in Hüsn ü Aşk Masnavi / Hüsn ü Aşk Mesnevisinde Şahısların Dünyası

    Directory of Open Access Journals (Sweden)

    Ulaş BİNGÖL

    2013-12-01

    Full Text Available Hüsn ü Aşk masnavi, considered as the most important work of Şeyh Galib, is fertile in terms of individuals. This work referring to people of sufism the process to porfect man in terms of subject matter, although it is allegorical the effects in the plot, change and transformation of the heroes is similar to individuals in novel type. Indıvıduals in novel type, generally examines under the names protagonist, antagonist, norms, fon, intrigue, center, flat, round according their features. It is played sâlik, mürşit, God and ego allegorically in Hüsn ü Aşk that a sufistic masnavi. The purpose of this study is to investigate and assay individuals in Hüsn ü Aşk. Şeyh Galib’in en önemli eseri olarak kabul edilen Hüsn ü Aşk mesnevisi, şahıslar açısından zengindir. İşlediği konu itibariyle tasavvuf ehlinin İnsan-ı Kâmil mertebesine ulaşma sürecine değinen bu eser, alegorik olmasına karşın kahramanların olay örgüsü içerisinde etkileri, değişim ve dönüşümleri roman türündeki şahıslarla benzerlik gösterir. Roman türünde şahıslar, özelliklerine göre genellikle protagonist, antagonist, norm, fon, entrik, eksen, düz, yuvarlak gibi adlar altında incelenir. Tasavvufi bir mesnevi olan Hüsn ü Aşk’ta sâlik, mürşit, Allah ve nefis alegorik olarak şahıslar üzerinde canlandırılır. Bu çalışmanın amacı, Hüsn ü Aşk mesnevisindeki şahısları tahlil edip incelemektir.

  15. Inner-shell promotions in low-energy Li+-Al collisions at clean and alkali-covered Al(100) surfaces

    Science.gov (United States)

    German, K. A. H.; Weare, C. B.; Yarmoff, J. A.

    1994-11-01

    Spectra of scattered ions and ion-induced electron emissions are used to investigate the electronic processes that occur during 0.4-5.0-keV Li+ bombardment of clean and alkali-atom-covered Al(100). The results show that Li 1s electrons are promoted during hard Li-Al collisions, but not during Li-K or Li-Na collisions. Consequences of the inner-shell electron promotions are evident in the inelastic loss, neutralization behavior, and electron emissions of the scattered Li particles. Spectra of scattered Li+ ions exhibit discrete-loss features, which are resistant to the usual increase in resonant neutralization that accompanies the deposition of alkali atoms on the surface. The loss features are due to Li 1s excitation via electron promotion, while the production of ions away from the surface via autoionization is responsible for their lack of response to alkali-atom adsorption. Spectra of ion-induced electron emissions confirm that Li*(1s2s2) is produced and that it undergoes autoionization.

  16. Past and future sea-level rise along the coast of North Carolina, United States

    CERN Document Server

    Kopp, Robert E; Kemp, Andrew C; Tebaldi, Claudia

    2014-01-01

    Focusing on factors that cause relative sea-level (RSL) rise to differ from the global mean, we evaluate RSL trajectories for North Carolina, United States, in the context of tide gauge and geological sea-level proxy records spanning the last $\\mathord{\\sim}$11,000 years. RSL rise was fastest ($\\mathord{\\sim}$7 mm/yr) during the early Holocene and decreased over time. During the Common Era before the 19th century, RSL rise ($\\mathord{\\sim}$0.7 to 1.1 mm/yr) was driven primarily by glacio-isostatic adjustment, dampened by tectonic uplift along the Cape Fear Arch. Ocean/atmosphere dynamics caused centennial variability of up to $\\mathord{\\sim}$0.6 mm/yr around the long-term rate. It is extremely likely (probability $P = 0.95$) that 20th century RSL rise at Sand Point, NC, (2.8 $\\pm$ 0.5 mm/yr) was faster than during any other century in $\\geq2,900$ years. Projections based on a fusion of process models, statistical models, expert elicitation and expert assessment indicate that RSL at Wilmington, NC, is very lik...

  17. 7039 ALÜMİNYUM ALAŞIMININ KAYNAK ÖNCESİ VE SONRASI MEKANİK VE BALİSTİK ÖZELLİKLERİNİN ARAŞTIRILMASI

    OpenAIRE

    2013-01-01

    Bu çalışmada, kalınlıkları farklı (12,7 ve 38 mm) 7039 Al-Zn zırh levhalarına özel kaynak ağzı açılarak MIG kaynak yöntemiyle çoklu paso kaynak yapıldı. Bu kaynaklı levhaların balistik ve mekanik özellikleri araştırıldı. 38 mm kalınlığındaki kaynaklı levhanın ana metal, geçiş bölgesi ve kaynak metali kısımlarına 12,7 mm’lik zırh delici mermilerle atış yapılarak bu bölgelerin V50 balistik sınır değerleri tespit edildi. Mekanik özelliklerin belirlenmesinde ise 12.7 mm kalınlığındaki kaynaklı le...

  18. BALİSTİK ÇARPMA ETKİSİNİN SONLU ELEMANLAR YÖNTEMİYLE İNCELENMESİ

    OpenAIRE

    2013-01-01

    Bu çalışmada yüksek hızlı darbeye maruz Titanyum, TI 6%AL4%V ve Çelik 4340 levhalarının artan levha kalınlığı ve değişen vurucu geometrisine bağlı olarak dinamik cevabı sonlu elemanlar yöntemi kullanılarak araştırılmıştır. Darbe uygulanacak levhalar 200×200 mm ebatlarında ve 1 mm, 2 mm, 3 mm, 4 mm, 5 mm, 6 mm ve 7 mm kalınlık değerlerine sahip olacak şekilde modellenmiştir. Vurucu malzemesi olarak Çelik 4340 seçilmiş olup bütün analizler 350 m/s’lik çarpma hızlarında gerçekleştirilmiştir. Kul...

  19. Zone Based Routing Protocol for Homogeneous Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    S. Taruna

    2011-09-01

    Full Text Available Wireless Sensor Networks, are made of low-cost, low -power, small in size, and multifunctional sensor nodes. The efficient energy utilization is one of t he important performance factors for wireless senso r networks survivability be-cause nodes operate with limited battery power. In this paper we propose and analyze a new approach of zone based clustering hea d selection algorithm for wireless sensor network o f homogeneous nodes. Nodes in the network are uniform ly distributed. In this clustering algorithm, netwo rk performance is improved by selecting cluster heads on the basis of the residual energy of existing clu ster heads, and nearest hop distance of the node. In thi s paper we evaluate various performance metrics lik e energy consumption, network life time, number of ch annel heads metrics in each round and compare these with respect to random algorithm i.e. LEACH. We con clude that proposed protocol effectively extends th e network lifetime without degrading the other critic al overheads and perform-ance metrics.

  20. A peculiar object in M51: fuzzy star cluster or a background galaxy?

    CERN Document Server

    Scheepmaker, R A; Larsen, S S; Anders, P

    2007-01-01

    Aims: We study a peculiar object with a projected position close to the nucleus of M51. It is unusually large for a star cluster in M51 and we therefore investigate the three most likely options to explain this object: (a) a background galaxy, (b) a cluster in the disk of M51 and (c) a cluster in M51, but in front of the disk. Methods: We use HST/ACS and HST/NICMOS broad-band photometry to study the properties of this object. Assuming the object is a star cluster, we fit the metallicity, age, mass and extinction using simple stellar population models. Assuming the object is a background galaxy, we estimate the extinction from the colour of the background around the object. We study the structural parameters of the object by fitting the spatial profile with analytical models. Results: We find de-reddened colours of the object which are bluer than expected for a typical elliptical galaxy, and the central surface brightness is brighter than the typical surface brightness of a disc galaxy. It is therefore not lik...

  1. Atomic structure of a single large biomolecule from diffraction patterns of random orientations

    CERN Document Server

    Tegze, Miklós

    2012-01-01

    The short and intense pulses of the new X-ray free electron lasers, now operational or under construction, may make possible diffraction experiments on single molecule-sized objects with high resolution, before radiation damage destroys the sample. In a single molecule imaging (SMI) experiment thousands of diffraction patterns of single molecules with random orientations are recorded. One of the most challenging problems of SMI is how to assemble these noisy patterns of unknown orientations into a consistent single set of diffraction data. Here we present a new method which can solve the orientation problem of SMI efficiently even for large biological molecules and in the presence of noise. We show on simulated diffraction patterns of a large protein molecule, how the orientations of the patterns can be found and the structure to atomic resolution can be solved. The concept of our algorithm could be also applied to experiments where images of an object are recorded in unknown orientations and/or positions lik...

  2. Ultrasonography, Doppler Ultrasonography and Magnetic Resonance Imaging of a Acute Lymphoblastic Leukemia Case Presented vvith Orbital Mass at the Time of Diagnosis

    OpenAIRE

    Arda, Kemal; ÇİLEDAĞ, Nazan; GÜMÜŞDAĞ, Pelin DEMİR; AKTAŞ, ELIF

    2009-01-01

    Sağ orbital kitle ile prezente olan B-hücreli akut lenfoblastik lösemili 21 yaşında kadın olgunun ultrasonografi, Doppler ultrasonografi ve manyetik rezonans görüntüleme bulgularını literatür eşliğinde sunmayı amaçladık. Yirmi bir yaşında kadın olgu yaklaşık iki aydır görme kaybı ve gözde kızarıklık yakınması ile hastanemize başvurdu. Yapılan fizik muayenede sağ göz kapağında şişlik, sağda proptozis saptandı. Orbital ultrasonografi, orbital Doppler ultrasonografi yapıldı, sağ orbitayı doldura...

  3. The Young Binary DQ Tau: A Hunt For X-ray Emission From Colliding Magnetospheres

    CERN Document Server

    Getman, Konstantin V; Salter, Demerese M; Garmire, Gordon P; Hogerheijde, Michiel R

    2011-01-01

    The young high-eccentricity binary DQ Tau exhibits powerful recurring millimeter-band (mm) flaring attributed to collisions between the two stellar magnetospheres near periastron, when the stars are separated by only ~8Rstar. These magnetospheric interactions are expected to have scales and magnetic field strengths comparable to those of large X-ray flares from single pre-main-sequence (PMS) stars observed in the Chandra Orion Ultradeep Project (COUP). To search for X-rays arising from processes associated with colliding magnetospheres, we performed simultaneous X-ray and mm observations of DQ Tau near periastron phase. We report here several results. 1) As anticipated, DQ Tau was caught in a flare state in both mm and X-rays. A single long X-ray flare spanned the entire 16.5 hour Chandra exposure. 2) The inferred morphology, duration, and plasma temperature of the X-ray flare are typical of those of large flares from COUP stars. 3) However, our study provides three lines of evidence that this X-ray flare lik...

  4. Computer programs for the concordance correlation coefficient.

    Science.gov (United States)

    Crawford, Sara B; Kosinski, Andrzej S; Lin, Hung-Mo; Williamson, John M; Barnhart, Huiman X

    2007-10-01

    The CCC macro is presented for computation of the concordance correlation coefficient (CCC), a common measure of reproducibility. The macro has been produced in both SAS and R, and a detailed presentation of the macro input and output for the SAS program is included. The macro provides estimation of three versions of the CCC, as presented by Lin [L.I.-K. Lin, A concordance correlation coefficient to evaluate reproducibility, Biometrics 45 (1989) 255-268], Barnhart et al. [H.X. Barnhart, J.L. Haber, J.L. Song, Overall concordance correlation coefficient for evaluating agreement among multiple observers, Biometrics 58 (2002) 1020-1027], and Williamson et al. [J.M. Williamson, S.B. Crawford, H.M. Lin, Resampling dependent concordance correlation coefficients, J. Biopharm. Stat. 17 (2007) 685-696]. It also provides bootstrap confidence intervals for the CCC, as well as for the difference in CCCs for both independent and dependent samples. The macro is designed for balanced data only. Detailed explanation of the involved computations and macro variable definitions are provided in the text. Two biomedical examples are included to illustrate that the macro can be easily implemented.

  5. Metode Penafsiran Ibn al-‘Arabî dalam Ahkâm al-Qur’ân

    Directory of Open Access Journals (Sweden)

    Saiful Fahmi

    2015-09-01

    Full Text Available This paper will explain the concept of ontological Ibn al-‘Arabi of interpretation, the general idea of the book Ahkâm al-Qur’ân that includes methods, patterns, sources of interpretation, interpretation elements and characteristics that distinguish it from the interpreters other. Ontological view regarding the interpretation that was never a logical consequence of the importance of the final carry was critical of the existing interpretation of the results so far, so it is legitimate to question whether Ahkâm al-Qur’ân is still relevant to the demands of his time or not? Whether in it there is coercion-coercion and preconceptions-ideological Ibn al-‘Arabî or not? Given, Ahkâm al-Qur’ân is reproduced in the 5th century AH, where the fight discourse between the schools of thought Islam was at its height. While Ibn al-‘Arabi is an intellectual who embrace genuine Mâlikî School, so it brought the prejudice that he is stuck in an ideological reason

  6. Correlation of magnetic moments and angular momenta for stars and planets

    CERN Document Server

    Dolginov, A

    2016-01-01

    The observed correlation of the angular momenta $L^{ik}$ and magnetic moments $\\mu_{lm}$ of celestial bodies (the Sun, planets and stars) was discussed by many authors but without any explanation. In this paper a possible explanation of this phenomenon is suggested. It is shown that the function $\\Phi_{lm} =(\\eta/r_g)L^{ik}R_{iklm}$ satisfy Maxwell equations and can be considered as a function which determine the electro-magnetic properties of rotating heavy bodies. The $R_{iklm}$ is the Riemann tensor, which determines the gravitational field of the body, $r_g$ is the gravitational radius of the body, and $\\eta$ is the constant which has to be determined by observations. The field $\\Phi_{lm}$ describe the observed $\\mu \\leftrightarrow L$ correlation. In particular the function $\\Phi_{l0}$ describe the electric field created by rotating heavy bodies. It is possible that the observed electric field of the Earth is created by the Earth rotation

  7. Dzimumu atšķirības otrās valodas apguvē

    OpenAIRE

    Brūdere, Kristīne

    2012-01-01

    Bakalaura darbs pēta dzimumu atšķirības otrās valodas apguvē un dzimuma ietekmi valodas apgūšanā, kas arī tika pārbaudīts praktiskajā daļā. Pētnieciskā darba mērķis ir noskaidrot kādā veidā izpaužas dzimumu atšķirības otrās valodas apguvē un kā tas ietekmē valodas apguvi. Praktiskās daļas rezultāti liecina, ka dzimumu atšķirības pastāv. Galvenās atšķirības tiek novērotas mutiskajā komunikācijā, aktivitātes ziņā, vēlmē apgūt valodu un uzsvara likšanā uz valodas apguvi. Lai arī atšķirības starp...

  8. Passive Control of an Impulsive Wave Using a Cavity/Helical Vane System

    Institute of Scientific and Technical Information of China (English)

    ToshiakiSetoguchi; Heuy-DongKim; 等

    1999-01-01

    In many engineering practices,frequently an impulsive wave is a consequence of discharge of a shock wave from the exit of a tube leading to an annoying noise lik a sonic boom.The impulsive noise has often been a major factor to limit the performance of flow devices as well as to affect hazardous influences on human being.The corrent paper describes a new control method for the reduction of impulsive wave.An experiment using a simple shock tube was carried out to examine the effect of a cavity/helical vane system on the impulsive wave strength.The resulting impulsive wave was influenced by the detailed configuration of the helical vane inside the cavity which is located at the vicinity of the exit of a tube.The effect of the helical vane was compared with no helical vane tests to ensure validation of this kind of control strategy,The results showed that the strength of the impulsive wave could be significantly reduced by the current passive control using the cavity/helical vane system.

  9. BEŞ SEVİYELİ İZO.LE DC KAYNAKLI KASKAT İNVERTERİN SPWM TEKNiGi İLE KONTROLÜ

    Directory of Open Access Journals (Sweden)

    Erkan Deniz

    2007-01-01

    Full Text Available Bu ınakalede genel olarak çok seviyeli inverterler, çok seviyeli inverterlerde kullanılan taşıyı ct temelli Sinüzoidal DarbeGenişlik Modülasyonu (SPW11 ve ç ok seviyeli kaskat inverter hakkında bilgi verilmektedir. Bununla birlikteMatlab\\SimPower Systems'de kaskat inverterin 3-fazlı, IGBT yarıiletken anahtarl ı beş seviyeli devresinin 3 -fazlı bir RLyükünü beslernesi durumunda SPWM tekniği kullanılarak sin1ülasyonu yapılmıştır. Simülasyon sonuçları yükindüktans ının ve anahtarlaına frekansının farklı değerleri için a lınmışt ır.

  10. X-ray time delays from the Seyfert 2 galaxy IRAS 18325-5926

    CERN Document Server

    Lobban, Andrew; Vaughan, Simon

    2014-01-01

    Using new XMM-Newton observations we detect hard X-ray time lags in the rapid variability of the Compton-thin Seyfert 2 galaxy IRAS 18325-5926. The higher-energy X-ray variations lag behind correlated lower-energy variations by up to ~3ks and the magnitude of the lag increases clearly with energy separation between the energy bands. We find that the lag-energy spectrum has a relatively simple log(E) shape. This is quite different in both shape and magnitude from the lags predicted by simple reflection models, but very similar to the hard X-ray lags often seen in black hole X-ray binaries. We apply several spectral models to the lag-energy spectrum and rule out simple reflection as an origin for the hard lags. We find that both propagating fluctuations embedded in the accretion flow and electron scattering from material embedded in or behind a cold absorbing medium offer equally good fits to the observed low-frequency hard X-ray lags and are both consistent with the time-averaged spectrum. Such models will lik...

  11. AISI 304 ÖSTENİTİK PASLANMAZ ÇELİKLERİN TİTANYUM KARBÜR KAPLAMALI KESİCİ TAKIM İLE TORNALAMA İŞLEMİNDE KESME KUVVETLERİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Özgür TEKASLAN

    2007-02-01

    Full Text Available Bu araştırmada, AISI 304 östenitik paslanmaz çeliklerin titaniyum karbür kaplı kesici takımlarla tornalama işleminde oluşan kesme kuvvetleri deneysel olarak incelenmiş ve elde edilen sonuçlar teorik sonuçlarla karşılaştırılmıştır. Deneysel çalışmada, farklı kesme hızları, ilerleme değerleri ve kesme derinlikleri dikkate alınmıştır. Kesme kuvvetleri üç boyutlu kistler dinanometre ile ölçülmüştür. Teorik çalışmada ise; Kienzle formülasyonuna göre kesme kuvvetleri belirlenmiştir. Çalışma sonucunda teorik olarak hesaplanan kesme kuvvetlerinin çeşitli etkenler nedeni ile tam sonucu vermediği, deneysel sonuçlara göre; ortalama % 25'lik fark olduğu tespit edilmiştir. Bu nedenle kesme kuvvetlerinin belirlenmesinde deneysel yöntemin daha kesin sonuçlar verdiği değerlendirilmektedir.

  12. A Natural Adsorbent&&The Recent Study of Chritosan%天然吸附剂——壳聚糖的最新研究

    Institute of Scientific and Technical Information of China (English)

    张利平

    2001-01-01

    Resorce,preparation of Chitosan,a natural polysaccharide high polymer as an adsorbent,and its applications in waste water treatment,biol ogical medicine,food antiseptic and chemical industry.As a result,Chitosan can h e used in mineral separation as a catching substance to collect noble metals lik e gold,silver,niobium,ect.and develope the medicines of biological polysacchari de to supplement the shortage of trace elements for human body,perhaps,there wi ll be new and important breakthrough on these.%本文介绍了天然多糖高分子吸附剂——壳聚糖的来源、制备及其在废水处理、生物医药、食品防腐和化工方面的最新研究.在此基础上, 提出了将壳聚糖应用于选矿工业中作捕收剂、回收金、银、铌等贵重金属和以壳聚糖作原料 ,开发研制补充人体微量元素缺乏的生物多糖药剂的观点.在这些方面作进一步的研究,希望有新的突破.

  13. COMMITTEES: SQM 2007 - International Conference On Strangeness In Quark Matter SQM 2007 - International Conference On Strangeness In Quark Matter

    Science.gov (United States)

    2008-04-01

    Local Organising Committee Ivan Králik (IEP SAS, Košice) Vojtěch Petráček (Czechoslovakia Technical University, Prague) Ján Pišút (Comenius University, Bratislava) Emanuele Quercigh (CERN) Karel Šafařík (CERN), Co-chair Ladislav v Sándor (IEP SAS, Košice), Co-chair Boris Tomášik (Mateja Bela University, Banská Bystrica) Jozef Urbán (UPJŠ Košice) International Advisory Committee Jörg Aichelin, Nantes Federico Antinori, Padova Tamás Biró, Budapest Peter Braun-Munzinger, GSI Jean Cleymans, Cape Town László Csernai, Bergen Timothy Hallman, BNL Huan Zhong Huang, UCLA Sonja Kabana, Nantes Roy A Lacey, Stony Brook Carlos Lourenço, CERN Yu-Gang Ma, Shanghai Jes Masden, Aarhus Yasuo Miake, Tsukuba Berndt Müller, Duke Grazyna Odyniec, LBNL Helmut Oeschler, Darmstadt Jan Rafelski, Arizona Hans Georg Ritter, LBNL Jack Sandweiss, Yale George S F Stephans, MIT Horst Stöcker, Frankfurt Thomas Ullrich, BNL Orlando Villalobos-Baillie, Birmingham William A Zajc, Columbia

  14. 文化元素在城市公共空间设计中的表达研究%Study on the Expression of Cultural Elements in City Public Space Design

    Institute of Scientific and Technical Information of China (English)

    耿云杉; 张月婵

    2013-01-01

    城市公共空间是市民日常交往、举行参与公共活动、休闲旅游的开放性的场所,如城市广场,公园、街道等,在公民日常生活中扮演着重要的角色。城市公共空间就像是城市一面镜子,其文化元素对于展现城市的精神风貌、提升城市次形象起着至关重要的作用。%City public space is the public place where people do daily communication, engage in public activities, have leis-ure travel, such as city square, park and street, plays an import-ant role in the daily life of citizens. The city public space is lik-e a mirror of city, and its cultural elements play a vital role in showing the city spirit, promoting the city image.

  15. Constraining Dark Matter-Baryon Scattering with Linear Cosmology

    CERN Document Server

    Dvorkin, Cora; Kamionkowski, Marc

    2013-01-01

    We derive constraints on elastic scattering between baryons and dark matter using the cosmic microwave background (CMB) data from the Planck satellite and the Lyman-alpha forest data from the Sloan Digital Sky Survey. Elastic scattering allows baryons and dark matter to exchange momentum, affecting the dynamics of linear density perturbations in the early Universe. We derive constraints to scattering cross sections of the form sigma \\propto v^n, allowing for a wide range of velocity dependencies with n between -4 and 2. We improve and correct previous estimates where they exist, including velocity-independent cross section as well as dark matter millicharge and electromagnetic dipole moments. Lyman-alpha forest data dominates the constraints for n>-3, where the improvement over CMB data alone can be several orders of magnitude. Dark matter-baryon scattering cannot affect the halo mass function on mass scales M>10^{12} M_{solar}. Our results imply, model-independently, that a baryon in the halo of a galaxy lik...

  16. Properties of dust in the Galactic center region probed by AKARI far-infrared spectral mapping - detection of a dust feature

    CERN Document Server

    Kaneda, H; Onaka, T; Kawada, M; Murakami, N; Nakagawa, T; Okada, Y; Takahashi, H

    2012-01-01

    We investigate the properties of interstellar dust in the Galactic center region toward the Arches and Quintuplet clusters. With the Fourier Transform Spectrometer of the AKARI/Far-Infrared Surveyor, we performed the far-infrared (60 - 140 cm^-1) spectral mapping of an area of about 10' x 10' which includes the two clusters to obtain a low-resolution (R = 1.2 cm^-1) spectrum at every spatial bin of 30" x 30". We derive the spatial variations of dust continuum emission at different wavenumbers, which are compared with those of the [O III] 88 micron (113 cm^-1) emission and the OH 119 micron (84 cm^-1) absorption. The spectral fitting shows that two dust modified blackbody components with temperatures of ~20 K and ~50 K can reproduce most of the continuum spectra. For some spectra, however, we find that there exists a significant excess on top of a modified blackbody continuum around 80 - 90 cm^-1 (110 - 130 microns). The warmer dust component is spatially correlated well with the [O III] emission and hence lik...

  17. TEKSTiL FABRİKASI ATIGININ Cyprinion macrostomus, KARACİGE BÖBREK VE KAN DOKUSUNA OL.AN BİYOKİMYASAL, HiSTOPATOLOJiK VE GENOTOKSİK ETKİSİ1

    Directory of Open Access Journals (Sweden)

    yılmaz çiğnemiş

    2003-04-01

    Full Text Available Bu araştırmada; 3 yaşındaki Cyprinion macrostomus' lar 10 ve 35 gün boyunca o/o2,5' lik tekstil fabrikası atığı içinde yaşatıldılar. Sonuçta; 35 günlük grupta karaciğer ve böbrek glutatyon (GSH konsantrasyonları kontrole göre anlamlı şekilde azalırken 35 günliik grubun karaciğer ve böbrek malondialdehit (MDA konsantrasyonlan kontrole göre anlaml ı şekilde artmıştı. 35 günlük grubun karaciğer dokusunda vakuolcr dejcnerasyon şeldinde nekrozların oluşması gibi histopatolojik değişimler gözlendi. Mikronukleus sayısında anlamlı bir artış aynı grupta da gözl endi

  18. Thermal and optical properties of Nd3+ doped lead zinc borate glasses—Influence of alkali metal ions

    Science.gov (United States)

    Sasi Kumar, M. V.; Rajesh, D.; Balakrishna, A.; Ratnakaram, Y. C.

    2013-04-01

    In the present investigation a new series of six different Nd3+ doped alkali and mixed alkali (Li, Na, K, Li-Na, Li-K and Na-K) heavy metal (PbO and ZnO) borate glasses were prepared using the melt quenching technique. The amorphous nature of the glass systems has been identified based on the X-ray diffraction analysis. The glass transition studies were carried out using differential scanning calorimetry (DSC). Optical properties were studied by measuring the optical absorption and near infrared luminescence spectra. The Judd-Ofelt (J-O) theory has been applied to calculate J-O intensity parameters, Ωλ (λ=2, 4 and 6) and in turn used to estimate radiative properties of certain transitions. Spectroscopic parameters such as transition probabilities (AT), branching ratios (β), radiative lifetimes (τR) and integrated absorption cross-sections (Σ) were calculated using J-O intensity parameters for all transitions. Using emission spectra, experimental branching ratios and stimulated emission cross-sections (σP) are obtained for all the observed emission transitions.

  19. The Next Generation Virgo Cluster Survey (NGVS). XXIV. The Red Sequence to $\\sim$10$^6$ L$_{\\odot}$ and Comparisons with Galaxy Formation Models

    CERN Document Server

    Roediger, Joel C; Côté, Patrick; MacArthur, Lauren A; Sánchez-Janssen, Rúben; Blakeslee, John P; Peng, Eric W; Liu, Chengze; Munoz, Roberto; Cuillandre, Jean-Charles; Gwyn, Stephen; Mei, Simona; Boissier, Samuel; Boselli, Alessandro; Cantiello, Michele; Courteau, Stéphane; Duc, Pierre-Alain; Lançon, Ariane; Mihos, J Christopher; Puzia, Thomas H; Taylor, James E; Durrell, Patrick R; Toloba, Elisa; Guhathakurta, Puragra; Zhang, Hongxin

    2016-01-01

    We use deep optical photometry from the Next Generation Virgo Cluster Survey [NGVS] to investigate the color-magnitude diagram for the galaxies inhabiting the core of this cluster. The sensitivity of the NGVS imaging allows us to continuously probe galaxy colors over a factor of $\\sim 2 \\times 10^5$ in luminosity, from brightest cluster galaxies to scales overlapping classical satellites of the Milky Way [$M_{g^{\\prime}}$ $\\sim$ $-$9; $M_{*}$ $\\sim 10^6$ M$_{\\odot}$], within a single environment. Remarkably, we find the first evidence that the RS flattens in all colors at the faint-magnitude end [starting between $-$14 $\\le$ $M_{g^{\\prime}}$ $\\le$ $-$13, around $M_{*}$ $\\sim 4 \\times 10^7$ M$_{\\odot}$], with the slope decreasing to $\\sim$60% or less of its value at brighter magnitudes. This could indicate that the stellar populations of faint dwarfs in Virgo's core share similar characteristics [e.g. constant mean age] over $\\sim$3 mags in luminosity, suggesting that these galaxies were quenched coevally, lik...

  20. Clues to the nature of ultra diffuse galaxies from estimated galaxy velocity dispersions

    CERN Document Server

    Zaritsky, Dennis

    2016-01-01

    We describe how to estimate the velocity dispersions of ultra diffuse galaxies, UDGs, using a previously defined galaxy scaling relationship. The method is accurate for the two UDGs with spectroscopically measured dispersions, as well as for ultra compact galaxies, ultra faint galaxies, and stellar systems with little or no dark matter. This universality means that the relationship can be applied without further knowledge or prejudice regarding the structure of a galaxy. We then estimate the velocity dispersions of UDGs drawn from two published samples and examine the distribution of total masses. We find, in agreement with the previous studies of two individual UDGs, that these systems are dark matter dominated systems, and that they span a range of at least $10^{10} < M_{200}/M_\\odot < 10^{12} $. These galaxies are not, as an entire class, either all dwarfs or all failed $L_*$ galaxies. Estimates of the velocity dispersions can also help identify interesting subsets of UDGs, such as those that are lik...

  1. The hospital of The Holy Spirit at Rabat, Malta, and its Latin inscriptions: a review | Lotyniški įrašai Rabato Šv. Dvasios ligoninėje: naujas žvilgsnis

    Directory of Open Access Journals (Sweden)

    Horatio Caesar Roger Vella

    2007-01-01

    Full Text Available Šv. Dvasios ligoninė (taip pavadinta 15 a. Rabate buvo pastatyta 13 amžiuje ir funkcionavo iki 20 amžiaus pradžios. Dabar šiose restauruotose patalpose įsikūręs Maltos Nacionalinis archyvas. Darbų metu buvo atidengti ir restauruoti lotyniški 1613–1737 metų įrašai (6 yra pastate, 2 jau yra išnykę ir išlikę tik nuorašuose, kuriuose įamžinti ligoninės mecenatai, administratoriai, ligoninėje atliekami statybos darbai, Maltos ordino Didieji magistrai ir šalies valdytojai. Vienas iš įrašų sukurtas eleginiais distichais. 2002 m., minint ankstesnio Archyvo kuratoriaus John Azzopardi jubiliejų, šie įrašai buvo publikuoti Josepho Ammodio: pateikta jų transkripcija, vertimas į italų kalbą ir komentarai. Spausdinamo straipsnio autoriaus nuomone, tiek J. Ammodio atlikta transkripcija, tiek vertimas turėtų būti tikslinami. Tai ir yra šio straipsnio tikslas.

  2. Description of execution time dynamics for a set of concurrent real-time tasks

    Directory of Open Access Journals (Sweden)

    Pedro Guevara López

    2011-01-01

    Full Text Available Un Sistema en Tiempo Real (STR implantado en una computadora digital, interactúa con el mundo físico a través del acondicionamiento de variables (sensores, actuadores convertidores Analógico/Digital A/D y Digital/ Analógico D/A y procesa sus peticiones mediante tareas en tiempo real (Ji: i¿Z+. Cada Ji está formada por un conjunto de instancias {ji,k: i, k¿Z+, i es el índice de la tarea, k es el índice de la instancia} con al menos tres restricciones temporales: tiempo de arribo, tiempo de ejecución y plazo (Li,k, Ci,k, Di,k. En este sentido, es importante proponer un modelo para reconstruir el comportamiento de los tiempos de ejecución Ci,k. El modelo propuesto es un ARMA con un estimador de parámetros basado en la variable instrumental. Los tiempos de ejecución fueron medidos experimentalmente en QNX Neutrino 6.5 utilizando un procesador Intel Core i7 de 2.66 GHz. Se presentan los antecedentes teóricos del modelado de tareas en tiempo real, las mediciones de tiempo de ejecución, el modelo de tiempos de ejecución, el estimador de parámetros con variable instrumental, la experimentación y los resultados.

  3. Ritual Pengikut Tarekat Shâdhilîyah di Tambak Beras, Jombang-Jawa Timur

    Directory of Open Access Journals (Sweden)

    Abdullah Safik

    2015-10-01

    Full Text Available This article tries to phenomenologically examines the existence of the Shâdhilîyah tarekat supervised by KH. Djamaluddin in Tambak Beras, Jombang. The Shâdhîlîyah tarekat, that had been initiated by Abû Hasan al-Shâdhilî, is an exceptional and consistent in holding and practicing its tawhid principle as well as dhikr rituals. In Indonesia, this tarekat has rapidly evolved. One of its murshid is KH. Abdul Jalil Mustaqim in Tulungagung, the murshid to KH. Djamaluddin. The tarekat has two main doctrines, are: firstly, ‘ubûdîyah realm where its followers are obliged to phisically and mentally obey Allah swt and His messenger, i.e. the prophet Muhammad, in all their sayings and deeds. Secondly, mu‘âmalah aspect where each follower is taught to interact with other people and creatures only for the sake of Allah. It means that the tarekat is a medium of self approaching to Allah. One of special rites (khusûsîyah conducted by this tarekat is an every-Tuesday agenda where dhikr, tawassul, tahlîl, and tahmîd activities are held. Technically, a sâlik when s/he recites dhikr should be followed by breathing in which is concentrated in the navel and going on top through thoracic cavity and coming out through the mouth then retracting it back to tongue.

  4. Complex formation during dissolution of metal oxides in molten alkali carbonates

    DEFF Research Database (Denmark)

    Li, Qingfeng; Borup, Flemming; Petrushina, Irina

    1999-01-01

    Dissolution of metal oxides in molten carbonates relates directly to the stability of materials for electrodes and construction of molten carbonate fuel cells. In the present work the solubilities of PbO, NiO, Fe2O3,and Bi2O3 in molten Li/K carbonates have been measured at 650 degrees C under...... carbon dioxide atmosphere. It is found that the solubilities of NiO and PbO decrease while those of Fe2O3 and Bi2O3 remain approximately constant as the lithium mole fraction increases from 0.43 to 0.62 in the melt. At a fixed composition of the melt, NiO and PbO display both acidic and basic dissolution...... as the partial pressure of carbon dioxide varies. By combination of solubility and electromotive force measurements, a model is constructed assuming the dissolution involves complex formation. The possible species for lead are proposed to be [Pb(CO3)(2)](-2) and/or [Pb(CO3)(3)](-4). A similar complex chemistry...

  5. CFD Applications in Energy and Environment Sectors: Volume 1

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi and Hashim R. Abdol Hamid

    2012-01-01

    Full Text Available Chapter 1: Simulation and Modelling of Oxygen Coal Combustion with Flue Gas Recirculation. Chaouki Ghenai Chapter 2: The Choice of the Best Air Distribution Concept in Air-Conditioned Auditorium by Means of CFD Numerical Prediction. Barbara Lipska, Piotr Koper Chapter 3: CFD Applications in Natural Ventilation of Buildings and Air Quality Dispersion. N. Nikolopoulos, A. Nikolopoulos, I. Papadakis, K.-S. P. Nikas Chapter 4: CFD Modeling of Air Pollutant Transport and Dispersion. Labovský Juraj, Jelemenský Ľudovít Chapter 5: CFD Modeling of Multiphase Flow in Environmental Engineering. Masroor Mohajerani, Mehrab Mehrvar, Farhad Ein-Mozaffari Chapter 6: CFD Study on the Roles of Trees on Airflow and Pollutant Dispersion within Urban Street Canyons. Salim Mohamed Salim, Andrew Chan, Riccardo Buccolieri, Silvana Di Sabatino Chapter 7: Energy Efficiency and Air Quality in Hospitals Design. Essam E. Khalil Chapter 8: Application of CFD in Pulverized Fuel Combustion. M. Tayyeb Javed, Tahira Sultana Chapter 9: A Heat Transfer Model For Fluids Based on Cellular Automaton Application to an Air Conditioning of A Building. Andrés Saiz Martínez Chapter 10: CFD Application in Power Plants. Essam E. Khalil Chapter 11: Analysis and Computation of the Heat Charge/Discharge Behavior in Packed Bed Thermal Storage Systems. Pei-Wen Li, Jon Van Lew, Wafaa Karaki, Cho Lik Chan, Jake Stephens

  6. Theoretical points of view on the notion of cause (consideration of contracts in the Serbian doctrine of civil law till the adoption of the law on obligations

    Directory of Open Access Journals (Sweden)

    Dudaš Atila

    2011-01-01

    contract in the Serbian literature. In contrast to the period before the adoption of the Law on Obligations, after its adoption a tendency of abandonment of points of view disavowing any legal relevance of cause of contract can be recognized and the majority of contemporary authorities argue that the cause of contract is a necessary legal institution, although they may differ in the conceptual determination of this notion. In the period after the adoption of the Law on Obligations in the Serbian literature of law of contract many authorities analyzed various aspects of cause of contract, especially Professors Stojan Cigoj, Ljubiša Milošević, Živomir Đorđević, Boris Vizner, Martin Vedriš, Želimir Šmalcelj, Jakov Radišić, Slobodan Perović, Jožef Salma, Oliver Antić and others. The author in this paper gives an overview of the points of view of authorities in the Serbian literature of law contract on the notion of cause of contract who marked the period until the adoption of the Law on Obligations, namely the works of Professors Dragoljub Aranđelović, Živojin Perić, Lazar Marković, Andrija Gams, Stevan Jakšić, Vladimir Kapor and Mihajlo Konstantinović.

  7. POPÜLER ÇEVİRİ ÇOCUK ROMANLARININ İÇERİK BAKIMINDAN İNCELENMESİ / AN EXAMINATION OF POPULAR TRANSLATED NOVELS FOR CHILDREN IN TERMS OF CONTENT

    Directory of Open Access Journals (Sweden)

    Derya YILDIZ

    2016-12-01

    Full Text Available Çocuk ve gençlik edebiyatı, dil gelişimi ve anlama düzeyine uygun olarak hedef kitlenin duygu ve düşünce dünyalarını zenginleştiren ürünleri kapsamaktadır. Bir geçiş sürecinde olan çocuk ya da genç, çocuk ve gençlik yazını ürünlerinden yararlanarak okuma alışkanlığı kazanır, yazınsal duyarlığını geliştirir ve kimlik gelişimine katkı sağlar. Çeviri kitaplar sayesinde de farklı kültürlerdeki karakterlerle karşılaşarak yeni yaşantılar kazanır ve bu sayede duygu ve düşünce zenginliği edinir. Bu çalışmada Konya’nın merkez ilçeleri olan Karatay, Meram ve Selçuklu’da üç okul belirlenmiş ve her bir okuldan kırk olmak üzere toplamda yüz yirmi 8. sınıf öğrencisine en son okudukları çeviri kitaplar sorulmuştur. Klasik kitaplar çıkarıldığında en fazla okunan ilk iki kitabın “Percy Jackson ve Olimposlular: Şimşek Hırsızı” ile “Gölgelerin Efendisi: Gorlan Harabeleri” olduğu belirlenmiştir. Araştırmada bu kitaplar içerik unsurları olan; konu, tema, kahramanlar, plan, dil ve üslup bakımından incelenmiştir. Veriler nitel araştırma yöntemlerinden doküman incelemesi tekniği kullanılarak elde edilmiş ve içerik analizi tekniğiyle çözümlenmiştir. Bulgulara göre popüler çeviri çocuk romanlarının, macera ve fantastik türde seri kitaplar olduğu ve bölümlerden oluştuğu belirlenmiştir. Ayrıca kitaplarda ana kahramanın çocuk olduğu ancak olağanüstü varlıkların da yer aldığı, kötülerle mücadelenin işlendiği ve çocukların hayatlarından unsurlara yer verildiği tespit edilmiştir.

  8. KÜÇÜLMEYE GİDEN İŞLETMELERDE GERİ KALANLARIN YAŞADIKLARI TÜKENME SENDROMUNUN ÖRGÜTE BAĞLILIK ÜZERİNDEKİ ETKİSİ-THE BURN OUT SYNDROME EXPERIENCED BY THE REMAINING EMPLOYEES IN DOWNSIZING COMPANIES AND ITS EFFECT ON ORGANIZATIONAL COMMITMENT

    Directory of Open Access Journals (Sweden)

    Nevzat DEMİR

    2010-01-01

    Full Text Available Ekonomik krizin şiddetini arttırdığı günümüz koşullarında işletmeler küçülmeye giderken, hızla işçi çıkarımına gitmektedirler. Bu halen işini kaybetmemiş çalışanlar üzerinde bir yandan aynı olayın kendi başlarına da gelebileceği korkusu yaşatırken bir yandan da gidenlerin işlerini yapmaktan dolayı bir iş yükünün artması sebebiyle bir sıkıntı, tükenmişlik yaşamaktadırlar. Bu çalışmada işten atılmayan ancak geri kalanlar sendromu yaşan çalışanların içinde bulundukları koşullardaki tükenmişlik düzeyleri ile örgüte olan bağlılıkları arasındaki etki inceleme konusu yapılmıştır. Bu amaçla bir anket çalışması yapılmıştır. Otomotiv sektöründe küçülmeye giden beş işletmedeki beyaz yakalı çalışanlar üzerinde yapılan analizlerde, tükenmişliğin örgüte bağlılık üzerinde açıklayıcı katkısı olduğu ve geri kalanlar sendromunun yaşanmasının bu ilişkiyi güçlendirdiği ortaya çıkmıştır.-Nowadays, as the economic recession gains momentum, establishments rapidly lay off employees in order to downsize. This creates a fear among the remaining employees who think the same thing might happen to them along with the distress of increasing workload due to the decreasing number of employees. This study investigates the correlation between the levels of the burn out syndrome experienced by the remaining employees and its effects on their commitment to the organization. A survey has been carried out with this goal. According to the results of the analyses performed on the white collar employees of five downsizing establishments in the automotive industry, being a remaining employee has revealing input on commitment to the organization and that this input is reinforced with the level of the burn out syndrome experience

  9. Towards {sup 6}Li-{sup 40}K ground state molecules

    Energy Technology Data Exchange (ETDEWEB)

    Brachmann, Johannes Felix Simon

    2013-02-08

    The production of a quantum gas with strong long - range dipolar interactions is a major scientific goal in the research field of ultracold gases. In their ro - vibrational ground state Li-K dimers possess a large permanent dipole moment, which could possibly be exploited for the realization of such a quantum gas. A production of these molecules can be achieved by the association of Li and K at a Feshbach resonance, followed by a coherent state transfer. In this thesis, detailed theoretical an experimental preparations to achieve state transfer by means of Stimulated Raman Adiabatic Passage (STIRAP) are described. The theoretical preparations focus on the selection of an electronically excited molecular state that is suitable for STIRAP transfer. In this context, molecular transition dipole moments for both transitions involved in STIRAP transfer are predicted for the first time. This is achieved by the calculation of Franck-Condon factors and a determination of the state in which the {sup 6}Li-{sup 40}K Feshbach molecules are produced. The calculations show that state transfer by use of a single STIRAP sequence is experimentally very well feasible. Further, the optical wavelengths that are needed to address the selected states are calculated. The high accuracy of the data will allow to carry out the molecular spectroscopy in a fast and efficient manner. Further, only a comparatively narrow wavelength tuneability of the spectroscopy lasers is needed. The most suitable Feshbach resonance for the production of {sup 6}Li-{sup 40}K molecules at experimentally manageable magnetic field strengths is occurring at 155 G. Experimentally, this resonance is investigated by means of cross-dimensional relaxation. The application of the technique at various magnetic field strengths in the vicinity of the 155 G Feshbach resonance allows a determination of the resonance position and width with so far unreached precision. This reveals the production of molecules on the atomic side

  10. Cardioprotective effects of glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 inhibitors%GLP-1受体激动剂和DPP-4抑制剂对心血管系统的保护作用

    Institute of Scientific and Technical Information of China (English)

    张雪松; 秦明照

    2013-01-01

      胰高糖素样肽1(GLP-1)受体激动剂和二肽基肽酶-4( DPP-4)抑制剂是近年上市的治疗2型糖尿病的新型药物。GLP-1主要通过抑制心肌细胞凋亡、改善内皮细胞功能、减轻体重、降低血糖、降低血压、改善心肌收缩力、舒张血管等直接或间接发挥其心脏保护作用,GLP-1受体激动剂和DPP-4抑制剂对体重、血压和血脂等心血管危险因素有改善作用。GLP-1受体激动剂和DPP-4抑制剂作用于新靶点,具有其独特的优点,将会是一类抗糖尿病新药。%Glucagon-like Peptide-1 (GLP-1) receptor agonists and dipeptidyl peptidase-4 (DPP-4) inhibitors are new kinds of drugs to treat type 2 diabetes mel itus. It was demonstrated that GLP-1 has an obvious cardioprotective effect mainly achieved by relaxing vascular vessels, improving endothelial function, improving endothelial function and promoting the functional recovery of pathological ventricle, which can directly or indirectly protect the heart. GLP-1 receptor agonists and DPP4 inhibitors also showed important effects on the body weight, blood pressure, lipids, and other cardiovascular risk factors. GLP-1 receptor agonists and DPP4 inhibitors have more advantages than other anti-diabetes drugs because they act on a new target. They wil be a useful new class of anti-diabetes drugs.

  11. Financiamiento del servicio de educación al turista en áreas protegidas: concesión u operación estatal

    Directory of Open Access Journals (Sweden)

    Aguirre G., Juan A.

    2008-10-01

    Full Text Available The conflicts between public and private consumption are as old as mankind itself and can be observed in the permanent fight between the private individual and the collective its belongs. Specially in the use of certain goods and services, that by its nature has solely private consumption, with characteristics of purely collective consumption lik education. The study was conducted n August 2006, between 315 domestic and foreigners visitors to Volcán Poas National Park, in order to identify the preferred option and the essential conditions to reopen according to desire, and the visitors interests, the auditorium facilities of the park. The results would suggest that the sociodemographic characteristics of the visitors do not seem to have much influence in their desire of using the service or his willingness to pay an additional amount for the services. The preferred time of duration for the conferences was around 15 minutes. The presence and the audience's use must be negotiated with the tour operators. The way of collection of payment preferred was Internet, followed by tour operator. The additional average amounts to be pay for the service was three dollars. The reopening must contemplate four things: clear objectives, transparent procedures, separating the rent for the premises from the one to cover maintenance, since the auditorium is a public good product of a donation's product, and a periodic supervision mechanism for service's being provided. The data collected indicates that base on the additional amount to be pay by the service and the potential volume of visitors is possible to concession the auditorium to a private supplier or for the park to supply the service by itself if they so desire.

  12. Türklerde Zenginlik ve Bereket Algısı ‘Tört Tülük’e Teorik Yaklaşım ve Divanu Lugati’t-Türk’ten Örnekler A theoratical apporach to ‘tört tülük’ which means abundance and wealth at Turks and its examples from Diwanu Lugati’t-Turk

    Directory of Open Access Journals (Sweden)

    Miras KOSIBAYEV

    2013-07-01

    Full Text Available Each nation has its own unique way of thinking and way of life,language, customs and traditions, values and rules of social features.World view of nations and their own particular characteristics wereimportant in the past and they continue today too. And it is importantto analyse concepts language and world view like an one event notseparately.On the basis of the relationship between language and human, inthis article we will try to explain concept tört tülük which meansabundance and wealth. Tört tülük is a phrase which includes horse,cow, camel and sheep-goat in it. Having all of these four kind of animalssymbolize abudance and richness. These animals for Turks areeverything because of their meet, milk, wool; also Turks used power ofthem, especially camel could pull all house (kiyiz-keçe otağı ‘nomad’stent’ with its materials.Using ‘four’ kinds of animals to symbolize abudance and richnessrelates with world view of Turks. In Türkish (Turkey there are somephrases with ‘four’ like ‘dört başı mamur’, ‘dört dötlük’ which representperfection and completeness.In Divanu Lugati’t-Türk tört tülik did not given as a concept, butwe found many examples with those four animals and products whichthey give.

  13. Bioinformatics Analysis of Cysteine Protease TUBAIN-like Gene in Pinus radiata%辐射松半胱氨酸蛋白酶 OTUBAIN-like 基因生物信息分析

    Institute of Scientific and Technical Information of China (English)

    吴建忠

    2015-01-01

    利用生物基因组学数据库,对辐射松半胱氨酸OTUBAIN-like基因进行生物信息学分析,预测该基因编码蛋白的理化性质、序列特征、蛋白质结构与生物学功能。结果表明,辐射松半胱氨酸OTUBAIN-like基因编码的蛋白质含294个氨基酸,具有非跨膜结构,含保守的Peptidase_C65结构域,预测其可能在蛋白质的翻译、合成及代谢中对胁迫应答和免疫应答等功能起关键性作用,本研究为辐射松半胱氨酸蛋白酶的OTUBAIN-like基因功能深入研究奠定基础。%To forecast the physical and chemical properties, sequence characteristics, structure and biological function of the gene encoding protein, bioinformatics analysis of Cysteine Protease OTUBAIN-like gene in Pinus ra-diata with genomics database was conducted.The results showed that the protein encoded by the Pinus radiata Cysteine Protease OTUBAIN-like gene contains 294 amino acids, and it has the conservative Peptidase_C65 do-main but no cross membrane structure.This study may play a critical role in protein synthesis and metabolism on stress response and immune response function.

  14. Solubility of LiCoO{sub 2} in molten carbonates

    Energy Technology Data Exchange (ETDEWEB)

    Higashino, Masae; Yanagida, Masahiro; Tanimoto, Kazumi; Kojima, Toshikatsu; Tamiya, Yukiko; Matsumoto, Hajime; Asai, Takashi; Miyazaki, Yoshinori [Osaka National Research Inst., Ikeda, Osaka (Japan); Takigawa, Yasuo [Osaka Electro-Communication Univ., Neyagawa, Osaka (Japan)

    1997-12-31

    The molten carbonate fuel cell (MCFC) has been widely researched and developed from the viewpoints of the high efficiency for electric power generation and low impact for environment. NiO is used for the cathode of MCFC but the dissolution of NiO into the carbonate electrolyte melt followed by deposition as Ni metal brings about short circuit between cathode and anode. LiCoO{sub 2} is expected to be an alternative cathode material. The solubility is a key factor for the evaluation of the stability of cathode materials. The solubility of LiCoO{sub 2} was proportional to P{sub CO{sub 2}}{sup 3/2} and P{sub O{sub 2}}{sup {minus}1/4} in (Li{sub 0.52}Na{sub 0.48}){sub 2}CO{sub 3}. It obeys the acidic dissolution mechanism. This result was the same dependence as that in (Li{sub 0.62}K{sub 0.38}){sub 2}CO{sub 3}. The solubility of LiCoO{sub 2} in (Li{sub 0.52}Na{sub 0.48}){sub 2}CO{sub 3} was about a half of that in (Li{sub 0.62}K{sub 0.38}){sub 2}CO{sub 3}. The solubility of LiCoO{sub 2} decreased with Li content in Li-K carbonate system. Their solubility of LiCoO{sub 2} was lower than that of NiO even under the pressurized cathode condition of MCFC.

  15. GSM SiNYALLERİNİN .IP OMURGASI İİZERiNI>E TAŞINMASI (SS7 OVER IP- NettcSS7

    Directory of Open Access Journals (Sweden)

    Çağatay Neftali Tülü

    2003-08-01

    Full Text Available Bu çalışmada günümüzün en popüler nıobilhaberleşme sistemi olan GSM [1 l sisteminin, kendiöğeleri aras1ndaki en temel sinyalleşme sistemi olannumara 7 (SS7 [2 sinyallerinin, günümüzün enyaygın iletim omurgast olan ve tüm dünyadakibilgisayarları birbirine bağlayan IP (3] omurgasıüzerinden taşınabilmesi için gerekli si stemin tasar11n1ve gerçeklenınesi üzerinde çahş1lmtştır. Klasil\\ SS7iletimine göre en büyüllt; faydası çok düşül{ maliyetiolan bu sistem sayesinde, dünyadaki b i r çok GSMşebekesi ara bağlanti harcanıalarıııda büyükmiktarda tasarrufa gideceklerdir. Aralarındakiklasik 64 KB/sn 'lik ara bağlantı yerine, bununüzerinde bir bağlantı hızı ile iki şebeke haberleşmişolacaktır. Bu değişimierin etkisi abonelere fiyatlardadüşüş ve servis kalitesinde yükseliş olarakyansıyacaktır.

  16. YAPAY SİNİR AGI (YSA KULLANARAK TİTREŞİM TABANLI MAKİNA DURUM iZLEMESi VE HATA TEŞHİSİ

    Directory of Open Access Journals (Sweden)

    Hüseyin dal

    2006-12-01

    Full Text Available Bu çalışmada titreşim analizi için "Orta Ölçekli Makinaların Titreşim Değerlendirme Standatiları IS0-10816" tablosukullanılarak oluşturulan eğitim seti, Yapay Sinir Ağını (YSA eğitmek için kullanılmıştır. Üç katmanlı oluşturulanYSA ağını eğitmek için IS0-10816 tablosundan 720x9'luk veri matrisi, test için 200x5'lik veriye sahip bir matriskullanılınıştır. Eğitim, gizli katman hücre sayısı 5, 10, 15, 25, 50 ve 75 olan ağların her biri için ayrı ayrıgerçekleştirilmiştir. Birbirleriyle karşılaştırılarak en iyi sonucu veren ağ yapısı bulunn1uştur. Eğitim için geri yayılımalgoritması kullanılmıştır. Eğitimden sonra elde edilen çıkış değerleri gerçek tablo değerleriyle karşılaştınlarak, titreşimanalizinde kullanılabilirliği saptanmıştır.

  17. Theoretical study of the electronic structure of KLi molecule: Adiabatic and diabatic potential energy curves and dipole moments

    Energy Technology Data Exchange (ETDEWEB)

    Dardouri, Riadh, E-mail: dardouririad@yahoo.fr [Laboratoire de Physique Quantique, Faculte des Sciences de Monastir, Avenue de l' Environnement, 5019 Monastir (Tunisia); Habli, Hela [Laboratoire de Physique Quantique, Faculte des Sciences de Monastir, Avenue de l' Environnement, 5019 Monastir (Tunisia); Oujia, Brahim; Gadea, Florent Xavier [Laboratoire de Chimie et Physique Quantique, UMR 5626 du CNRS, Universite de Toulouse, UPS, 118 route de Narbonne, 31062 Toulouse Cedex 4 (France)

    2012-05-03

    Graphical abstract: We present the resulting 12 {sup 1}{Sigma}{sup +} diabatic potential energy curves where they are labeled D{sub 1} for the ionic Li{sup -}K{sup +} and D{sub 2} to D{sub 12} for other. Highlights: Black-Right-Pointing-Pointer Our ab initio study has been conducted for 48 electronic states of LiK molecule. Black-Right-Pointing-Pointer We use pseudo-potential for the core and large basis sets for the Rydberg states. Black-Right-Pointing-Pointer The calculations rely on ab initio pseudo-potential and full valence CI approaches. Black-Right-Pointing-Pointer Diabatic potentials are analyzed, revealing the strong imprint of the ionic {sup 1}{Sigma}{sup +} state. - Abstract: For all states dissociating below the ionic limit Li{sup -}K{sup +}, we perform an adiabatic and diabatic study for {sup 1}{Sigma}{sup +} electronic states dissociating into K (4s, 4p, 4d, 5s, 5p, 5d, 6s) + Li (2s, 2p, 3s). Furthermore, we present the adiabatic results for the 1-11 {sup 3}{Sigma}, 1-8 {sup 1,3}{Pi} and 1-4 {sup 1,3}{Delta} states. The present calculations on the KLi molecule are complementary to previous theoretical work on this system, including recently observed electronic states that had not been calculated previously. The calculations rely on an ab initio pseudo-potential, Core Polarization Potential operators for the core-valence correlation and full valence CI approaches, combined to an efficient diabatization procedure. For the low-lying states, our spectroscopic constants and vibrational level spacing are in good agreement with the available experimental data. Diabatic potentials and permanent dipole moments are analyzed, revealing the strong imprint of the ionic state in the {sup 1}{Sigma}{sup +} adiabatic states.

  18. cDNA-AFLP analysis reveals differential gene expression in incompatible interaction between infected non-heading Chinese cabbage and Hyaloperonospora parasitica.

    Science.gov (United States)

    Xiao, Dong; Liu, Shi-Tuo; Wei, Yan-Ping; Zhou, Dao-Yun; Hou, Xi-Lin; Li, Ying; Hu, Chun-Mei

    2016-01-01

    Non-heading Chinese cabbage (Brassica rapa ssp. chinensis) is one of the main green leafy vegetables in the world, especially in China, with significant economic value. Hyaloperonospora parasitica is a fungal pathogen responsible for causing downy mildew disease in Chinese cabbage, which greatly affects its production. The objective of this study was to identify transcriptionally regulated genes during incompatible interactions between non-heading Chinese cabbage and H. parasitica using complementary DNA-amplified fragment length polymorphism (cDNA-AFLP). We obtained 129 reliable differential transcript-derived fragments (TDFs) in a resistant line 'Suzhou Qing'. Among them, 121 upregulated TDFs displayed an expression peak at 24-48 h post inoculation (h.p.i.). Fifteen genes were further selected for validation of cDNA-AFLP expression patterns using quantitative reverse transcription PCR. Results confirmed the altered expression patterns of 13 genes (86.7%) revealed by the cDNA-AFLP. We identified four TDFs related to fungal resistance among the 15 TDFs. Furthermore, comparative analysis of four TDFs between resistant line 'Suzhou Qing' and susceptible line 'Aijiao Huang' showed that transcript levels of TDF14 (BcLIK1_A01) peaked at 48 h.p.i. and 25.1-fold increased in the resistant line compared with the susceptible line. Similarly, transcript levels of the other three genes, TDF42 (BcCAT3_A07), TDF75 (BcAAE3_A06) and TDF88 (BcAMT2_A05) peaked at 24, 48 and 24 h.p.i. with 25.1-, 100- and 15.8-fold increases, respectively. The results suggested that the resistance genes tended to transcribe at higher levels in the resistance line than in the susceptible line, which may provide resistance against pathogen infections. The present study might facilitate elucidating the molecular basis of the infection process and identifying candidate genes for resistance improvement of susceptible cultivars.

  19. Expanding the crystal chemistry of uranyl peroxides: four hybrid uranyl-peroxide structures containing EDTA.

    Science.gov (United States)

    Qiu, Jie; Ling, Jie; Sieradzki, Claire; Nguyen, Kevin; Wylie, Ernest M; Szymanowski, Jennifer E S; Burns, Peter C

    2014-11-17

    The first four uranyl peroxide compounds containing ethylenediaminetetra-acetate (EDTA) were synthesized and characterized from aqueous uranyl peroxide nitrate solutions with a pH range of 5-7. Raman spectra demonstrated that reaction solutions that crystallized [NaK15[(UO2)8(O2)8(C10H12O10N2)2(C2O4)4]·(H2O)14] (1) and [Li4K6[(UO2)8(O2)6(C10H12O10N2)2(NO3)6]·(H2O)26] (2) contained excess peroxide, and their structures contained oxidized ethylenediaminetetraacetate, EDTAO2(4-). The solutions from which [K4[(UO2)4(O2)2(C10H13O8N2)2(IO3)2]·(H2O)16] (3) and LiK3[(UO2)4(O2)2(C10H12O8N2)2(H2O)2]·(H2O)18 (4) crystallized contained no free peroxide, and the structures incorporated intact EDTA(4-). In contrast to the large family of uranyl peroxide cage clusters, coordination of uranyl peroxide units in 1-4 by EDTA(4-) or EDTAO2(4-) results in isolated tetramers or dimers of uranyl ions that are bridged by bidentate peroxide groups. Two tetramers are bridged by EDTAO2(4-) to form octamers in 1 and 2, and dimers of uranyl polyhedra are linked through iodate groups in 3 and EDTA(4-) in 4, forming chains in both cases. In each structure the U-O2-U dihedral angle is strongly bent, at ∼140°, consistent with the configuration of this linkage in cage clusters and other recently reported uranyl peroxides.

  20. Nanoscale controlled Li-insertion reaction induced by scanning electron-beam irradiation in a Li4Ti5O12 electrode material for lithium-ion batteries.

    Science.gov (United States)

    Kitta, Mitsunori; Kohyama, Masanori

    2017-05-10

    The development of a nanoscale battery reaction in an electrode material associated with in situ microscopic observation is significant to an understanding of the solid-state mechanism of a battery reaction. With a Li4Ti5O12 (LTO) crystal as the negative electrode of a Li-ion battery (LIB), we show that a nanoscale-controlled Li-insertion reaction can be produced by electron beam irradiation with scanning transmission electron microscopy (STEM). A selected area in a Li2O-coated thin LTO crystal was irradiated by the electron probe of STEM with a high beam intensity of 2.5 × 10(7) (electrons per nm(2)). Electron energy-loss spectroscopy (EELS) revealed that significant changes in the chemical feature occurred only in the high-dose irradiation area in the LTO specimen. The features of Li-K, Ti-L and O-K spectra in that area were completely equal to those of a Li7Ti5O12 (Li-LTO) phase, as an electrochemically Li-inserted LTO phase, in contrast to usual LTO-like spectra in the region surrounding the specimen. For a pristine LTO specimen without Li2O coating, no Li-insertion reaction was observed under the same irradiation conditions. The high-dose electron beam seems to induce the dissociation of Li2O, providing Li ions and electrons, and the rapid and directional growth of a Li-LTO phase along the electron beam in the LTO specimen, forming a nanoscale steep interface with the surrounding LTO phase. The present phenomenon is a new type of electron beam assisted chemical reaction in a solid state, and could have a large impact on the science and technology of battery materials.

  1. Sexual dysfunction, mood, anxiety, and personality disorders in female patients with fibromyalgia

    Directory of Open Access Journals (Sweden)

    Kayhan F

    2016-02-01

    Full Text Available Fatih Kayhan,1 Adem Küçük,2 Yılmaz Satan,3 Erdem İlgün,4 Şevket Arslan,5 Faik İlik6 1Department of Psychiatry, Faculty of Medicine, Selçuk University, 2Department of Rheumatology, Faculty of Medicine, Necmettin Erbakan University, 3Department of Psychiatry, Konya Numune State Hospital, 4Department of Physical Therapy and Rehabilitation, Faculty of Medicine, Mevlana University, 5Department of Internal Medicine, Faculty of Medicine, Necmettin Erbakan University, 6Department of Neurology, Faculty of Medicine, Başkent University, Konya, Turkey Background: We aimed to investigate the current prevalence of sexual dysfunction (SD, mood, anxiety, and personality disorders in female patients with fibromyalgia (FM.  Methods: This case–control study involved 96 patients with FM and 94 healthy women. The SD diagnosis was based on a psychiatric interview in accordance with the Diagnostic and Statistical Manual of Mental Disorders, fourth edition criteria. Mood and anxiety disorders were diagnosed using the Structured Clinical Interview. Personality disorders were diagnosed according to the Structured Clinical Interview for DSM, Revised Third Edition Personality Disorders.  Results: Fifty of the 96 patients (52.1% suffered from SD. The most common SD was lack of sexual desire (n=36, 37.5% and arousal disorder (n=10, 10.4%. Of the 96 patients, 45 (46.9% had a mood or anxiety disorder and 13 (13.5% had a personality disorder. The most common mood, anxiety, and personality disorders were major depression (26%, generalized anxiety disorder (8.3%, and histrionic personality disorder (10.4%.  Conclusion: SD, mood, and anxiety disorders are frequently observed in female patients with FM. Pain plays a greater role in the development of SD in female patients with FM. Keywords: anxiety, depression, fibromyalgia, sexual dysfunction

  2. Güneş Enerjisi Kaynaklı Bir Stirling Motorunun Matlab-Simulink ile Modellenmesi

    Directory of Open Access Journals (Sweden)

    Ş. Melih AKYOL

    2012-06-01

    Full Text Available Sürdürülebilir bir kalkınma için yerli ve yenilenebilir enerji kaynaklarının kullanılması gereklidir.Yenilenebilir Enerji Genel Müdürlüğü (YEGM’nin ölçümlerine göre, ülkemiz günde yeryüzüne düşen ortalama 3600 Wh/m2 ‘lik güneş ışınımı ile önemli bir güneş enerjisi kullanım potansiyeline sahiptir. Bu çalışmada ısı kaynağı olarak güneş enerjisini kullanan beta tipi krank hareket mekanizmalı bir Stirling motoru teorik olarak Matlab-Simulink ortamında modellenmiştir. Hazırlanan model, ülkemizdeki farklı bölgeler için, yılın herhangi bir gününde, yatay veya açılı yüzeylere düşen güneş ışınımı değerlerini tahminleyen bir alt model ile desteklenmiştir. Geliştirilen model ile, Stirling motorunun farklı boyutlandırmaları için güç, çalışma frekansı, verim gibi performans özellikleri hesaplanabilmekte, iş gazının da sıcaklık basınç gibi termodinamik özelliklerinin çevrim boyunca değişimi izlenebilmektedir.

  3. HSI2 Repressor Recruits MED13 and HDA6 to Down-Regulate Seed Maturation Gene Expression Directly During Arabidopsis Early Seedling Growth.

    Science.gov (United States)

    Chhun, Tory; Chong, Suet Yen; Park, Bong Soo; Wong, Eriko Chi Cheng; Yin, Jun-Lin; Kim, Mijung; Chua, Nam-Hai

    2016-08-01

    Arabidopsis HSI2 (HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE GENE 2) which carries a EAR (ERF-associated amphiphilic repression) motif acts as a repressor of seed maturation genes and lipid biosynthesis, whereas MEDIATOR (MED) is a conserved multiprotein complex linking DNA-bound transcription factors to RNA polymerase II transcription machinery. How HSI2 executes its repressive function through MED is hitherto unknown. Here, we show that HSI2 and its homolog, HSI2-lik (HSL1), are able to form homo- and heterocomplexes. Both factors bind to the TRAP240 domain of MED13, a subunit of the MED CDK8 module. Mutant alleles of the med13 mutant show elevated seed maturation gene expression and increased lipid accumulation in cotyledons; in contrast, HSI2- or MED13-overexpressing plants display the opposite phenotypes. The overexpression phenotypes of HSI2 and MED13 are abolished in med13 and hsi2 hsl1, respectively, indicating that HSI2 and MED13 together are required for these functions. The HSI2 C-terminal region interacts with HDA6, whose overexpression also reduces seed maturation gene expression and lipid accumulation. Moreover, HSI2, MED13 and HDA6 bind to the proximal promoter and 5'-coding regions of seed maturation genes. Taken together, our results suggest that HSI2 recruits MED13 and HDA6 to suppress directly a subset of seed maturation genes post-germination. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  4. ALUNiT -Zn O KARlŞIMLARI ÜZERİNE SULU ÇÖZELTiLERDEN ASİDİK BOY ALARIN ADSORPSİYONU

    Directory of Open Access Journals (Sweden)

    Mahmut ÖZACAR

    2001-06-01

    Full Text Available Alunit-ZnO karışımı üzerine Asit Mavi 40 ve AsitSarı 17 nin adsorpsiyonları araştırıln1ış ve Alunit-ZnOnun perforınansı granül aktif karbona karşıdeğerlendirilmiştir. Alunit-ZnO oranları, pH, temas süresive başlangıç boya konsantrasyonunun etkisi incelenmiştir.Maksimum boya giderme alunit-ZnO için pH 6 da ve aktifkarbon için pH 1 de olmuştur. 45 dakikadan az bir sürede%95 lik denge değerine ulaşılmıştır. Asit Mavi 40 ve AsitSan 17 nin alunit-ZnO ile adsorpsiyonu için sırasıyla 99ve 95.7 mg boya/g adsorban gibi oldukça yüksekadsorpsiyon kapasiteleri gözlenmiştir. Asit Mavi 40 veAsü Sarı 17 nin aktif karbon ile adsorpsiyonu içinadsorpsiyon kapasiteleri sırasıyla 33 ve 95.5 mg boya!gadsorbandır. Adsorpsiyon kapasitesi temelindekarşılaştırıldığında alunit-ZnO nun daha etkili olduğugörülmüştür. Langmuir ve Freundlich izotermleri içinadsorpsiyon parametreleri belirlenmiş ve tartışılmıştır.

  5. Aslı Erdoğan'ın Anlatılarında Ontolojik Sorunlar Ontological Problems in Aslı Erdoğan's Narratives

    Directory of Open Access Journals (Sweden)

    Mehmet ÖZGER

    2012-12-01

    üvenlerine bir de iç dünyalar��ndaki serüvenleri eşlik eder. Başkişi konumundaki anlatı kahramanların hemen hemen hepsinin yalnız, tutunamayan, geçmişleri ve kendileriyle çatışan, sürekli bir boşluk ve hiçlik duygusu yaşayan, hayatlarındaki eksikliğe yahut parçalanmışlığa karşı bir anlam arayışı içinde olan kahramanlar oldukları görülmektedir. Bu bağlamda anlatılarda iç konuşmalar ve sorgulamaların yoğunluk kazandığı olay örgüsünden ziyade varoluşçu izlek ve kavramların ön plana çıktığı görülür. İnsanoğlunun varlığı ve hayat karşısındaki tavrını belirginleştiren durum ve ayrıntıların yoğunlukta olduğu eserlerde varoluşa ilişkin pek çok sorun dikkati çekmektedir. Anlatı kahramanlarının yaşadıkları en temel sorun yabancılaşmadır ve anlatılarda varlığını gördüğümüz diğer varoluşsal sorunlar da yabancılaşmayla birlikte görünür hale gelen durumlardır. Anlatı kahramanların başta kendilerine olmak üzere çevrelerine, topluma karşı büyük bir yabancılaşma yaşadıkları görülmektedir. Bu doğrultuda anlatılarda yabancılaşma, yabancılaşmanın bir türü olarak bireysel anomi ve buna bağlı olarak yalnızlık, hiçlik/boşluk, kaçış/sürgünlük, ölüm ve intihar vb. izlekler öne çıkmaktadır. Bu izlekler anlatı kahramanlarının psikolojik dünyalarını ortaya koymak bakımından önemli olduğu gibi yazarın da sahip olduğu psikolojiyi ortaya koymaları bakımından önemlidir.

  6. Alevi Yapısallaşması, Talepler ve Din Kültürü ve Ahlak Bilgisi Ders Kitaplarında Alevilik-Bektaşilik Alewi Scructuralism, Demands and Alevism-Bektashism on the Books of Religion Culture and Knowledge of Ethic

    Directory of Open Access Journals (Sweden)

    Eyup ŞİMŞEK

    2013-03-01

    such as“performing cem”, “semah”, “the month of Muharram and ashura” inthe 12th grade level RCKE textbook in the teaching of the religion. Kültürel, sosyolojik, düşünsel ve tasavvufi özellikleriyle dikkatçeken Alevilik-Bektaşilik, özellikle 1990‟lardan itibaren toplumgündemine daha sık gelmeye başlamıştır. Bu gündeme geliş, daha çokAleviliği yeni bir dini kimlik olarak keşfetme yolunu açtığı gibi, bukimliğin pekişmesi için de devletten bir takım dinsel talepleriberaberinde getirmiştir. Bu taleplerden biri genelde Din Kültürü veAhlak Bilgisi (DKAB derslerine özelde ise DKAB ders kitaplarına ilişkinolandır. Ancak yapısallaşma sürecinde dile getirilen bu talepkonusunda Alevi-Bektaşi grup ve önderler birleşmiş ise de, Alevi-Bektaşi grup ve önderlerin talebin DKAB kitaplarına nasıl yansıtılmasıgerektiği ve DKAB dersinin geleceği konusunda farklı yaklaşımlarasahip oldukları ileri sürülmektedir. Diğer taraftan MEB‟in, Aleviçalıştaylarıyla daha belirgin hale gelen talepleri dikkate aldığı ve sonyıllarda DKAB ders kitaplarına yansıttığı ifade edilmektedir. Bubağlamda Türkiye‟nin bir gerçeği olan Alevîlik-Bektaşiliğin DKAB derskitaplarına nasıl yansıtıldığını tespit edilmesi önemlidir. Bu durumdanhareketle konunun araştırılması, bu çalışmanın amacınıoluşturmuştur. Bu doğrultuda ilk ve ortaöğretim okullarında okutulanDKAB ders kitapları, Alevîlik-Bektaşilik ile ilgili içerik açısındandeğerlendirilmiş, Alevilik-Bektaşilik konularının düzeyi ve ele alınışınıntespitinde betimsel bir yaklaşım kullanılmıştır.Araştırmanın kapsamını Millî Eğitim Bakanlığı tarafından 2012yılında basılan 2012-2013 eğitim-öğretim yılında ilk ve ortaöğretimokullarına dağıtılan ders kitapları oluşturmaktadır. Taranan 4-12 sınıfDKAB ders kitaplarının tamamında Alevîlik-Bektaşilik ile ilgili konularaveya kişilere yer verildi

  7. Isparta İlinde Coleoptera Takımına ait Türler Üzerinde Faunistik Çalışmalar(*

    Directory of Open Access Journals (Sweden)

    İ. KARACA

    2009-04-01

    Full Text Available Isparta ve İlçelerinin Coleoptera faunasıyla ilgili biyolojik zenginliği ortaya koymak amacıyla 2002-2004 yılları arasında çalışmalar sürdürülmüştür. Bölgede özellikle Eğirdir, Beyşehir ve Kovada Gölleri arasındaki değişik habitatlarda, tarım ve tarım dışı alanlarda örneklemeler yapılarak bu araştırma yürütülmüştür. Çalışma konusunu oluşturan Coleoptera takımına ait örnekler değişik bitkiler üzerinden toplanıldığı gibi toprak yüzeyi, taş altı ve bitki döküntüleri altı gibi değişik ortamlardan da toplanmıştır. Çalışma süresince Carabidae, Histeridae, Lucanidae, Geotrupidae, Scarabeidae, Melolonthidae, Cetoniidae, Buprestidae, Elateridae, Coccinellidae, Cerambycidae, Chrysomelidae, Curculionidae ve Scolytidae familyalarına ait toplam 90 tür saptanmıştır. Carabidae ve Coccinellidae familyalarına ait olduğu belirlenen toplam 16 farklı avcı böcek türü saptanmış ve toplam tür sayısının % 14,4' ünü temsil ettikleri belirlenmiştir. Geriye kalan % 75,6' lik dilimi oluşturan böceklerin ise fitofag türler olduğu belirlenmiştir.

  8. Okul müdürlerine yönelik motivasyonel dil ölçeği: Türk kültürüne uyarlama, dil geçerliği ve faktör yapısının incelenmesi / Motivational language scale for school principals: Adaptation for Turkish culture, language validity, and examination of factor structure

    Directory of Open Access Journals (Sweden)

    Hamit Özen

    2013-04-01

    Full Text Available ÖZETAraştırmanın amacı, Motivasyonel Dil Ölçeği’nin Türk kültürüne uyarlanmasıdır. Araştırmanın çalışma grubunu 219 ilkokul ve ortaokul öğretmeni oluşturmaktadır. Ölçeğin uyarlaması İngilizce dilinden Türkçe’ye çeviri ile başlamış sonra geri çeviri ile İngilizceye dönüştürülmüştür. Çeviri geçerliği amacıyla İngilizce uzmanlarına test-tekrar test uygulaması yapılmış, her iki testin maddeleri arasında korelâsyon yoluyla Pearson Momentler Çarpımı Katsayısı belirlenmiştir. Yapı geçerliği için Açımlayıcı Faktör Analizi (AFA yapılmıştır. AFA sonucunda ölçeğin üç boyutta oluştuğu görülmüş ve yönlendirici dil, cesaret verici dil ve aitlik yaratıcı dil olarak adlandırılmıştır. Ölçeğin güvenirlik düzeyi ve maddelerin ayrışıklığı Cronbach Alfa Katsayısı, Düzeltilmiş Madde-Toplam Korelâsyon ve % 27’lik alt-üst grup farkına ilişkin t- değerleri hesaplanarak sağlanmıştır. Ayrıca ölçeğin alt faktörlerinin ortalama ve standart sapma değerleri ile alt ölçekleri arasındaki ilişkinin tespitinde Pearson Momentler Çarpımı korelâsyon analizi uygulanmıştır. Bu işlemlerden sonra ölçeğin geçerli ve güvenilir olduğu görülmüştür.

  9. A new numerical method to calculate inhomogeneous and time-dependent large deformation of two-dimensional geodynamic flows with application to diapirism

    Science.gov (United States)

    Fuchs, L.; Schmeling, H.

    2013-08-01

    A key to understand many geodynamic processes is studying the associated large deformation fields. Finite deformation can be measured in the field by using geological strain markers giving the logarithmic strain f = log 10(R), where R is the ellipticity of the strain ellipse. It has been challenging to accurately quantify finite deformation of geodynamic models for inhomogeneous and time-dependent large deformation cases. We present a new formulation invoking a 2-D marker-in-cell approach. Mathematically, one can describe finite deformation by a coordinate transformation to a Lagrangian reference frame. For a known velocity field the deformation gradient tensor, F, can be calculated by integrating the differential equation DtFij = LikFkj, where L is the velocity gradient tensor and Dt the Lagrangian derivative. The tensor F contains all information about the minor and major semi-half axes and orientation of the strain ellipse and the rotation. To integrate the equation centrally in time and space along a particle's path, we use the numerical 2-D finite difference code FDCON in combination with a marker-in-cell approach. For a sufficiently high marker density we can accurately calculate F for any 2-D inhomogeneous and time-dependent creeping flow at any point for a deformation f up to 4. Comparison between the analytical and numerical solution for the finite deformation within a Poiseuille-Couette flow shows an error of less than 2 per cent for a deformation up to f = 1.7. Moreover, we determine the finite deformation and strain partitioning within Rayleigh-Taylor instabilities (RTIs) of different viscosity and layer thickness ratios. These models provide a finite strain complement to the RTI benchmark of van Keken et al. Large finite deformation of up to f = 4 accumulates in RTIs within the stem and near the compositional boundaries. Distinction between different stages of diapirism shows a strong correlation between a maximum occurring deformation of f = 1, 3 and

  10. Valores profesionales de enfermería: Una mirada hacia la formación en la Educación Superior Nursing professional values in Higher Education

    Directory of Open Access Journals (Sweden)

    Martha Díaz Flores

    2012-08-01

    : under a quantitative approach, a transversal, descriptive and exploratory study was conducted, through a survey based on the values proposed by the American Association of Colleges of Nursing, and from Likér scales, measured professional values directed toward patients, the patients family and medical equipment. Results: Obtained the following system of values; dignity human, equality, truth, freedom, justice, altruism and aesthetics, noting that most values were considered indispensable towards the patient, showing smaller percentages to the family of the patient and medical equipment in the values of beauty, altruism and freedom.

  11. ROLE OF MULTIDETECTO R ROW COMPUTED TOMOG RAPHY IN EVALUATION OF BILIAR Y TRACT OBSTRUCTIVE JAUNDICE

    Directory of Open Access Journals (Sweden)

    Akshaya Reddy

    2015-03-01

    Full Text Available INTRODUCTION: Obstructive jaundice is a type of jaundice in which there is blockage of flow of bile from the liver to the intestine resulting in redirection of excess bile and it’s by - products like bilirubin into the blood. It can lead to complications lik e ascending cholangitis, hepatorenal syndrome and malabsorption, hence requiring urgent surgical intervention. The role of a radiologist therefore is important in early diagnosis and in accurately delineating the level and the cause of obstruction, thus he lping in staging as well as preoperative assessment of tumor resectability. The search for noninvasive diagnostic tools is an emerging medical need, in order to avoid invasive, costly and physician - intensive procedures such as endoscopic retrograde cholang iopancreatography (ERCP . (1 Ultrasound is a non - invasive and cost effective imaging technique available for evaluating biliary tract obstruction. Ultrasound demonstrates the presence of biliary tract obstruction by identifying dilated bile ducts but has a sensitivity of 55% - 95% and specificity of 71% - 96 % . (2 The role of magnetic resonance cholangiography (MRCP is well established in this field as the most reliable noninvasive technique . (3 However, some drawbacks, such as contraindication in patients with pacemakers and ferromagnetic implants, for claustrophobic patients, long examination times exceeding 30 minutes and limited availability of scanners still limit its use. MRCP is expensive and has limitations such as interference from intraluminal gas, pneumobilia and flow artifacts. (4 In the past, axial conventional CT could not provide adequate information of biliary abnormalities since the total depiction of these ducts was not suitable for evaluation in axial planes . (5 MDCT's ability to obtain volume dataset with sub - millimeter spatial resolution allows the optimal display of bile duct by using multiplanar reconstruction (MPR and minimal intensity projection (Min

  12. STUDY THE CAUSE OF DEATH & ITS SOME FACTORS AMONG HOSPITALIZED PAEDIATRIC CASES AT A TERTIARY CARE CENTRE OF RURAL DISTRICT OF MAHARASHTRA, INDIA.

    Directory of Open Access Journals (Sweden)

    Amol R

    2014-01-01

    Full Text Available BACKGROUND : Reaching the MDG on reducing child mortality will require universal coverage with key effective and affordable interventions. Records of vital events like death constitute an important component of publi c health information system. In - depth analysis of death of children provides valuable information. Aim of the study wa s to describe the causes of deaths among hospitalized pediatric patient and contributing factors associated with it. METHODS AND MATERIALS : This was a r etrospective re cord based study. Total pediatric deaths were identified & segregated through admission records from medical record section under PSM department of Government Medical College , during January 2010 to December 2010. Variables lik e age , sex , birth weight and cause of death were collected from death records. WHO Child Growth Standards (z score separate for boys & girls were used for comparing weight of child at the time of admission. Data was entered , cleaned and analyzed using MS excel. RESULTS : An overall 313 (13.1% death occurred among 2380 hospitalized pediatric cases.56.4% were male child and 43.8% female child. Maximum deaths (67.8% were among early neonates. 175(60% were severely underweight a t the time of admission. Time interval between admission and death i.e. hospital stay revealed that 134 (42.8% of deaths occurred within 24 h of ad mission. 180 (77% deaths were in low birth weight (less than 2.5 kg. Infection (35% was the leading cause of death among all pediatric age groups followed by birth asphyxia (29% , prematurity (22% nutritional (4% and congenital (6%.Viral encephalitis was found to be the most common cause of death in more than 5 yrs. age group. CONCLUSION : Monitoring the mo rtality pattern among hospitalized cases is important strategy to address public health issues at community level as well as to strengthen the hospital services. Strategies like antenatal care about nutrition to avoid LBW , timely treatment of

  13. Geochronology of the Palaeoproterozoic Kautokeino Greenstone Belt, Finnmark, Norway, in its Fennoscandian context

    Science.gov (United States)

    Bingen, Bernard; Solli, Arne; Viola, Giulio; Sverre Sandstad, Jan; Torgersen, Espen; Whitehouse, Martin J.; Skår, Øyvind; Nasuti, Aziz

    2016-04-01

    The northeastern part of the Fennoscandian Shield consists of Archaean cratonic blocks alternating with Palaeoproterozoic greenstone belts ranging in age from c. 2500 to 1950 Ma. Traditionally, the greenstones are interpeted as evidence for rifting of the Archaean continent(s) although it remains unclear whether modern-style oceanic lithosphere developed, followed by a Wilson-cycle-type closure during the Svecokarelian orogeny. Existing geological, isotopic and geochronological data show that the exposed basins hosting the greenstones have distinct lithostratigraphies and geological evolutions and are pericontinental rather than oceanic. A diversity of Palaeoproterozoic mafic mantle derived magmatic rocks show a secular increase of Nd value with time, from EpsilonNd =-2 at 2500 Ma (Shalskiy dikes, Onega, Russia) to EpsilonNd =+4.4 at 2090 Ma (Jouttiaapa basalts, Peräpohja, Finland), suggesting that the regional asthenospheric mantle was less depleted than the model MORB-producing depleted mantle before 2090 Ma. In this work, we report new zircon U-Pb geochronological data in 19 samples from Finnmarkvidda, Norway, to constrain the evolution of the Palaeoproterozoic high-strain Kautokeino Greenstone Belt and its relations with the neighbouring felsic Jergul and Ráiseatnu gneiss complexes. The Jergul complex is an Archaean, low heat flow, TTG cratonic bloc of Karelian affinity formed between 2975 ±10 and 2776 ±6 Ma. The Masi formation, at the base of the Kautokeino Greenstone Belt, is a typical Jatulian quartzite unconformably overlying the Archean basement. An albite-magnetite-rich mafic sill, similar to the Haaskalehto intrusion in Finland, provides a minimum age of 2220 ±7 Ma for the deposition of the quartzite. The Likčá and Čáskejas formations represent the main basaltic volcanism. Direct evidence of an oceanic setting or oceanic suture is lacking. A probably synvolcanic gabbro sill gives an age of 2137 ±5 Ma. Published Sm-Nd whole-rock data on

  14. Structure of the Red Dog District, western Brooks Range, Alaska

    Science.gov (United States)

    de Vera, Jean-Pierre P.; McClay, K. R.

    2004-01-01

    The Red Dog district of the western Brooks Range of northern Alaska, which includes the sediment-hosted Zn-Pb-Ag ± Ba deposits at Red Dog, Su-Lik, and Anarraaq, contains one of the world's largest reserves of zinc. This paper presents a new model for the structural development of the area and shows that understanding the structure is crucial for future exploration efforts and new mineral discoveries in the district. In the Red Dog district, a telescoped Late Devonian through Jurassic continental passive margin is exposed in a series of subhorizontally stacked, internally imbricated, and regionally folded thrust sheets. These sheets were emplaced during the Middle Jurassic to Late Cretaceous Brookian orogeny and subsequently were uplifted by late tectonic activity in the Tertiary. The thrust sheet stack comprises seven tectonostratigraphically distinct allochthonous sheets, three of which have been subject to regional and detailed structural analysis. The lowermost of these is the Endicott Mountains allochthon, which is overlain by the structurally higher Picnic Creek and Kelly River allochthons. Each individual allochthon is itself internally imbricated into a series of tectonostratigraphically coherent and distinct thrust plates and subplates. This structural style gives rise to duplex development and imbrication at a range of scales, from a few meters to tens of kilometers. The variable mechanical properties of the lithologic units of the ancient passive margin resulted in changes in structural styles and scales of structures across allochthon boundaries. Structural mapping and analysis of the district indicate a dominant northwest to west-northwest direction of regional tectonic transport. Local north to north-northeast transport of thrust sheets is interpreted to reflect the influence of underlying lateral and/or oblique ramps, which may have been controlled by inherited basin margin structures. Some thrust-sheet stacking patterns suggest out

  15. Tüketim Mekanlarının Dönüşümünde Görsel İletişimin Rolü: Küresel Kahve Dükkanları

    Directory of Open Access Journals (Sweden)

    Özlen ÖZGEN

    2014-02-01

    Full Text Available Kapitalizmin varlığını sürdürmesinin önemli bir koşulu mekanın yeniden düzenlenmesidir. Mekanın  hem  iç ve hem de dış yapılanması bu düzenlemede ayırt edici olmakta, kapitalizmin tüketim mekanlarından küresel kahve dükkanları ise bu farklılaşmanın önemli örnekleri arasında yer almaktadır.Yüzyıllar içinde tüm kıtalara yayılarak küreselleşen kahve, günümüzde farklı markalar altında çağımız insanının gündelik yaşamının başat içeceklerinden biri haline gelmiştir. Çalışmada Starbucks, Gloria Jeans, Lavazza, Illy ve Kahve Dünyası gibi küresel kahve markalarının kahve dükkanlarından örneklere yer verilmektedir. Bu markaların kahve dükkanlarının tasarımlarında çoğunlukla  kahveye ilişkin görsellerin kullanıldığı,  Lavazza’nın ise mekan tasarımı açısından diğer markalardan farklılaştığı görülmektedir. Lavazza bu farklılaşmayı, dünyaca ünlü fotoğraf sanatçıları tarafından çekilen takvim fotoğraflarını kahve dükkanlarının tasarımında kullanarak yaratmaktadır. Markanın görsel iletişiminde kullanılan özel fotoğraflar ile Lavazza arasında kurulan özdeşlik mekan aracılığıyla da pekiştirilmektedir. 

  16. 己烷低耗喷雾热解法大规模制备多壁碳纳米管%Large-scale production of multi-walled carbon nanotubes by low-cost spray pyrolysis of hexane

    Institute of Scientific and Technical Information of China (English)

    Z.Sadeghian

    2009-01-01

    以己烷为碳源,二茂铁为催化剂前躯体,应用喷雾热解法,制备了多壁碳纳米管(MWCNTs).采用酸沥滤和空气氧化对MWCNTs进行纯化.利用SEM、TEM、XRD、EDS、TGA及Raman光谱分析等方法分别对原生和纯化MWCNTs进行表征.为制得优质、高产MWCNTs,对制备工艺参数作了优选,分别研讨了最佳制备参数,包括:二茂铁升华温度、己烷中二茂铁浓度、热解温度和时间,己烷与H2的流量比.MWCNTs具有典型的腊肠状(Sawsage-like)构型,长度大于数十微米,内、外管径分别为15nm~45nm及25nm~70nm,MWCNTs的纯度和产率的质量分数分别高于95%和70%.%Multi-walled carbon nanotubes (MWCNTs) were prepared by spray pyrolysis, using hexane as a carbon source and ferrocene as a catalyst precursor, followed by purification with acid leaching and air oxidation. The as-grown and purified MWCNTs were characterized by scanning electron microscopy, transmission electron microscopy, X-ray diffraction, energy dispersive spectroscopy, thermogravimetry, and Raman spectroscopy. The sublimation temperature of ferrocene, the ferrocene concentration in hexane, pyrolysis temperature and time, and the flow rate of hexane and H2 were optimized to obtain MWCNTs with a high quality and a high yield. The MWCNTs have a typical sausage-like structure and their lengths are more than several tens of micrometers. The inner and outer diameters of the MWCNTs were in the range of 15-45 and 25-70 nm, respectively. The purity and yield of the purified MWCNTs were more than 95% and 70% mass fraction, respectively.

  17. Conodont and Radiolarian Data from the De Long Mountains Quadrangle and Adjacent Areas, Northern Alaska

    Science.gov (United States)

    Dumoulin, Julie A.; Harris, Anita G.; Blome, Charles D.; Young, Lorne E.

    2006-01-01

    INTRODUCTION This report presents biostratigraphic data from 289 collections at 189 localities in the De Long Mountains, Misheguk Mountain, and Noatak quadrangles (fig. 1); most of these data have never been previously published. The collections were made during studies of the Red Dog massive sulfide deposit in 1998?2004 and in support of regional mapping projects in 1979, 1981, 1983, and 1997?98. The collections?mostly conodonts and some radiolarians?tightly constrain the age of many stratigraphic units of Devonian through Triassic age exposed within the study area, and provide additional data on the depositional environments and thermal history of these rocks. The data are presented in a series of tables, organized by fossil type, stratigraphic unit, and location. Tables 1?12 contain conodont data, mostly from the De Long Mountains quadrangle. All of these collections were initially examined, or were reevaluated, from 1997 through 2004, and complete faunal lists are given for all samples. Table 13 lists ages and conodont color alteration indices (CAIs) of 27 collections from 24 localities in the Noatak quadrangle; updated faunal lists were not prepared for these samples. Radiolarian data?all from the De Long Mountains quadrangle?are given in table 14; these collections were analyzed between 1998 and 2003. Collection localities are shown in four maps (sheets 1, 2). Map 1 (sheet 1) shows all outcrop samples from the De Long Mountains and western Misheguk Mountain quadrangle (locs. 1-121). Maps 2?4 (sheets 1, 2) show all drill hole sample localities; samples come from the Su-Lik deposit and in and around the Anarraaq deposit (map 2, locs. 122?135), in and adjacent to the Red Dog deposits (Paalaaq, Aqqaluk, Main, and Qanaiyaq) (map 3, locs. 136?158), and from drill holes along the Port Road in the Noatak quadrangle (map 4, locs. 159?160). Map 4 (sheet 2) also shows all outcrop samples from the Noatak quadrangle (locs. 161?189). The text summarizes the lithofacies

  18. İngilizce Öğrencilerinin Arka Koltuk TV Sistemleri ve Altyazılı Filmlere olan Tutumları English Language Learners’ Attitudes to Back-seat TV Systems and Subtitled Movies

    Directory of Open Access Journals (Sweden)

    Buğra ZENGİN

    2013-09-01

    çin filmlerden yararlanma imkânlarını örgün eğitim kurumları dışındaki ortamlarda aramayı gerektirmektedir. Bununla birlikte, sosyo-ekonomik açıdan durumu birbirinden farklı olan her insanın, filmleri bu yönde değerlendirmesinin imkânları dâhilinde olduğunu farz etsek dahi, sosyal bir eğlence olan film etkinliğinde bize eşlik eden kişilerin dil tercihlerinin etkisiyle filmi dublaj olarak izleyebilmemiz olası bir durum. Başka bir deyişle eşlik edenlerin dublaj tercihinin filmi orijinal dilinde izlemeye engel teşkil etme ihtimali hiç de düşük bir olasılık değildir.Öğrencilerin üniversitelerinin bulunduğu şehirden başka bir şehre gidiş gelişlerininin çok sık olduğu bir üniversiteye odaklanan bu çalışmada gidiş geliş yapan öğrencilerin arka-koltuk TV sistemleri ve altyazılı filmlere olan tutumları ele alınmaya çalışılmıştır. İngilizce hazırlık öğrencilerinin tutumlarını ölçmek için beş seçenekli Likert tipi anket kullanılan bu çalışmada bulgular böyle bir hizmetin başlatıldığı andan itibaren takdir toplayıp benimseneceğini gösterdi. Bu çalışmanın, Hükümet, eğitim kurumları, yayın ve seyahat şirketlerinin bir çözüm için işbirliği kurmalarına neden olması umulmaktadır.

  19. YEZÎDÎSM AND THE HARRÂNÎ TRACES IN YEZÎDÎSM ABSTRACT YEZÎDÎLİK VE YEZÎDÎLİKTE HARRÂNÎ İZLERİ

    Directory of Open Access Journals (Sweden)

    Sami KILIÇ

    2011-09-01

    Full Text Available According to many sources of Islam, Yezîdîsm was founded by the people who were follower of sufi Sheikh Adi b. Musafir who lived in the 12 th century and it is defined as an Islamic source syncretic sect or current that regards Yezid b. Muaviye as a superhuman being. Yezîdîsm has been discussed among one of the groups about the name of its source, process of its formation and ideas.Yezîdîsm that extends a syncretic content was affected by Harrânîs which occured with the effect of paganist, plotiest Mesopotamia, Iran religions, Judaism and Christianity. In many sources the religions written above are said to contribute Yezîdîsm but in which situations and how they contributed is not indicated. In some sources only some information is available about them. In this study as it is a detailed subject to determine which religions contributed to the Yezîdîsm, we restricted the subject only whith the Harrânîsm. We tried to interpret similiar things while determining the traces and effects of Yezîdîsm in Harrânîs. So, we aimed to illuminate some beliefs and practises in Yezîdîsm in the back plan of history. Yezîdîlik, İslam kaynaklarının çoğunda, XII. Yüzyılda yaşamış olan mutasavvıf şeyh Adî b. Müsâfir’i takip edenler tarafından kurulmuş ve Yezîd b. Muâviye’nin insanüstü bir varlık olduğu esasına dayanan İslam kaynaklı senkretik bir mezhep veya akım olarak tanımlanmaktadır. Bununla birlikte Yezîdîlik, isminin kaynağı, teşekkül süreci ve görüşlerinin menşei konusunda en çok tartışılan dini-sosyal gruplardan biridir. Senkretik bir yapı arz eden Yezîdîliğe, özellikle paganist ve politeist Mezopotamya dinlerinin etkisiyle oluşan Harrânîler, İran dinleri, Yahudilik, Hıristiyanlık ve İslam’ın tesir ettiği, kaynaklarda ifade edilmektedir. Birçok kaynakta bu dinlerin Yezîdîliğe tesir ettiği bildirilmekte, ancak bu dinlerin hangi noktalarda ve nasıl etki etti

  20. Ret ve İnkârın Kıskacındaki Nihilist Karakterler: Bazarov ve Suat The Nihilist Characters surrounded by Denial and Denegation: Bazarov and Suat

    Directory of Open Access Journals (Sweden)

    Mustafa AYDEMİR

    2013-09-01

    nsan ancak bu yolla Tanrı’dan, toplumun ahlâksal değerlerinden ve otoritelerden kurtulup özüne dönebilecektir. Anlamsızlık, boşluk ve hiçlik duygularının telkin edildiği bir düşünme biçimini ifade eden Nihilizm, insanların bağlı kaldıkları değer ve ideallerin işlevlerini yerine getirmediklerinde ortaya çıkan bir ruh durumuna eşlik eden bir yaşama biçimidir.İlk defa Almanya’da kullanılan Nihilizm; 19. yüzyıl ortalarında Rusya’da dikkat çekilmiş, Schopenhauer’la yaygınlaşmış ve son olarak Nietzsche’yle sistemleşmiş felsefî bir yaklaşımdır. Bu yüzyılda Pozitivizm’in etkisinde kalan yazarlar, dine karşı inançları sarsılınca kendilerini bir sığınak olarak gördükleri Nihilizm’in kucağına atarlar. Rus edebiyatında Turgenyev, Türk edebiyatında ise Tanpınar romanlarında bu türden karakterlere yer verirler.Bu çalışmada, toplum ile benzer problemler yaşayan bireylerin yaşadıkları üzerinde durulmuştur. Kişiliği, dünya görüşü ve davranışlarıyla romandaki diğer karakterlerden farklılık gösteren Bazarov ve Suat, Nihilizm’in etkisiyle hem kendilerine hem de başkalarına düşmandırlar. Tanrıtanımazlığı ve isyankârlığıyla romanı bir kâbusa dönüştürürler. Ruh yerine maddeyi, varlık yerine yokluğu tercih ederler. Önce Nihilizm’in tarifi, özellikleri ve ortaya çıkışından bahsedilmiş sonra Turgenyev’in Babalar ve Oğullar romanı ile Tanpınar’ın Huzur romanı ve dönemleri hakkında bilgiler verilmiştir. Bu romanlardaki Bazarov ve Suat’ın Nihilist özellikleri belli başlıklar altında toplanmış, bu karakterlerin benzer ve farklılıklarına dikkat çekilmiştir. Sonuç bölümünde ise çalışmanın genel bir değerlendirilmesi yapılmıştır.

  1. Varieeruva vältega sõnade hääldusuuringud kõnesünteesi teenistuses

    Directory of Open Access Journals (Sweden)

    Liisi Piits

    2017-05-01

    auditory assessment, this group increased to 17 words. The variable quantity degree group contained 15 words based on duration ratios, but only 5 words based on auditory assessment. The third quantity degree group contained 24 words by duration ratio and 25 words by auditory assessment. Finding trends in word structure among words in the same quantity degree groups would make it possible to draw inferences about other words of the same type as well, which would increase the applied value of the study. Generally, though words of the same syllable structure and part of speech did not exhibit the same pronunciation patterns. However, it can at least be stated that the third quantity degree dominated among both two- and three-syllable adjectives formed with the suffix -lik. Of the 15 such words analysed in the study, only two were pronounced predominantly with the second quantity degree. Artiklis tutvustame lugemiseksperimenti, mille põhjal uurime nn varieeruva vältega sõnade hääldust. Varieeruva vältega sõnade määratlemisel lähtume õigekeelsussõnaraamatu (ÕS 2013 normingutest – uurime sõnu, mida lubatakse hääldada nii teises kui kolmandas vältes. Analüüsime sõnade pearõhulise ja järgsilbi kestussuhteid ja võrdleme saadud andmeid kuuldelise hinnangu tulemustega. Uurime, kas sarnase silbistruktuuri ja sama sõnaliigilise kuuluvusega sõnade häälduses on sarnaseid jooni. Rakenduslikust aspektist kannus- tab uurimust vajadus leida lahendus probleemidele, mida varieeruvus tekitab tekst-kõne sünteesi protsessis. Uuringu tulemusel selgusid peamised trendid varieeruva vältega sõnade häälduseelistustes. Nii silpide kestussuhete kui kuuldelise hinnangu alusel moodustusid kindlad sõnarühmad, kus domineeris üks või teine välde. Sõnatüüpide kaupa analüüs võimaldas määrata ka välte varieerumise trende tüübiti, nt kõik kolmesilbilised lik-liitelised adjektiivid ühe erandiga hääldusid kolmandas vältes.

  2. Sodyum hipoklorit, klorheksidin ve propolis içerikli solüsyonların potasyum titanyum fosfat lazer ile birlikte kullanımlarının candida albicans üzerine etkinliklerinin incelenmesi

    Directory of Open Access Journals (Sweden)

    Zeynep Sumer

    2011-11-01

    ı konsantrasyonlarda hazırlanmış propolis solüsyonlarının (PS Candida albicans üzerine antimikrobiyal etkinliklerinin karşılaştırılmasıdır. Ayrıca Potasyum Titanyum Fosfat lazerin (KTP irrigasyon solüsyonlarından sonra uygulanmasının C. albicans üzerine antimikrobiyal etkinliğini değerlendirmektir.

    Gereç ve Yöntem: 42 adet yeni çekilmiş tek köklü insan dişi, her biri 7 dişten oluşan alt gruplara ayrıldı. Grup 1 NaOCl, Grup 2 KHG, Grup 3 %5’lik PS, Grup 4 %10’luk PS Grup 5 %20’lik PS, Grup 6 Serum fizyolojik (kontrol grubu. Çalışma boyutları hesaplanan dişler lastik kapaklı cam şişelere yerleştirildi. ProTaper kök kanal aletleri ile crowndown tekniği kullanılarak prepare edildi. Cam şişelerdeki steril dişler aminar air flow’da C. albicans’la kontamine edildi. Her diş için 2 ml irrigasyon solusyonu kullanıldı. 24 saat sonra bulanıklıklarına bakılarak sonuçlar değerlendirildi. Son aşama olarak kök kanallarına KTP lazer uygulandı ve mikrobiyal üreme olup olmadığı belirlendi. Veriler değerlendirilirken Kruskal Wallis testi, Mann Whitney-U testi, Chi square, Friedman testi ve Wilcoxon testi uygulanmıştır.

    Bulgular: Tüm test edilen irrigasyon solüsyonlarının (kontrol grubu hariç C. albicans’a karşı antimikotik etkinlik yönünden istatistiksel olarak önemli bulundu (p<0,05. Propolis %20, Propolis %10 ve SF (kontrol gurubu ile kök kanallarında irrigasyon yapıldıktan sonra KTP lazer uygulaması antimikotik etkinlik yönünden istatistiksel olarak önemli bulundu (p<0,05.

    Sonuç: Kök kanallarında, propolisin, antimikrobiyal etkisi olmasına rağmen istenilen yeterlilikte bulunamadı. Ayrıca irrigasyon solüsyonlarından sonra, KTP lazer uygulanmasının daha etkili antimikrobiyal etki gösterebileceği belirlendi.

  3. Maestro di Pico i iluminacije u inkunabuli De Civitate Dei (Nicolas Jenson, Venecija, 1475. u samostanu Sv. Duje u Kraju na Pašmanu

    Directory of Open Access Journals (Sweden)

    Bojan Goja

    2014-12-01

    . U prostoru donje margine simetrično su naslikana dva anđela koja kleče na tlu. Anđeli imaju slične fizionomijske osobine kao i lik Sv. Aurelija Augustina. Između sebe pridržavaju lovorov vijenac. U vijencu je kružno polje unutar kojega je naslikan renesansni grb. Polje štita u obliku konjske glave vodoravno je podijeljeno na gornju tamnoplavu i donju polovicu crvene boje. U njemu je prikazan uspravljeni zlatni lav razjapljenih čeljusti okrenut udesno koji se prednjim šapama drži za stablo. Drugi je stupac početne stranice ukrašen sa inicijalom „G“ kojim započinje prva knjiga (liber primus. Inicijal je sastavljen od fitomorfnih motiva plave, zelene, žute i boje ciklame s osjenčanjima izvedenim u različitim nijansama i žutoj boji. Osim opisanih iluminacija i dvaju inicijala na f. 17 inkunabula je na pojedinim idućim stranicama, tj. na početku svake od sljedeće dvadeset i jedne knjige ukrašena sa još isto toliko inicijala sastavljenih od fitomorfnih motiva plave, zelene i boje ciklame na zlatnoj pozadini unutar pravokutnog okvira obrubljenog tankom crnom linijom. To su inicijali „S“ na f. 27r; „I“ na f. 38v; „D“ na f. 49r; „Q“ na f. 60v; „Q“ na f. 72v; „D“ na f. 79r; „N“ na f. 91v; „E“ na f. 103v; „O“ na f. 110r; „C“ na f. 125v; „A“ na f. 137v; „E“ na f. 147r; „D“ na f. 158v; „D“ na f. 170v; „P“ na f. 185v; „P“ na f. 202r; „D“ na f. 216v; „Q“ na f. 236r; „D“ na f. 250r; „C“ na f. 269v i „S“ na f. 284v. Iluminacije inkunabule De Civitate Dei pripadaju sjevernotalijanskoj i venecijanskoj renesansnoj minijaturi a pokazuju brojne i izrazite sličnosti sa radovima koji se u literaturi povezuju sa znamenitim venecijanskim iluminatorom poznatim kao Maestro del Plinio di Giovanni Pico della Mirandola (Maestro del Plinio di Pico ili skraćeno Maestro di Pico. Atribuciju iluminacija inkunabule Maestru di Pico , uz moguću suradnju radionice i pomoćnika poglavito u

  4. Los dioses contra el azar versus el azar de los dioses: las catástrofes "naturales" y los pueblos indígenas

    Directory of Open Access Journals (Sweden)

    Antonio PÉREZ

    2009-11-01

    Full Text Available RESUMEN: ?Las catástrofes de la naturaleza y las de contenido político son similares en la medida en que pueden ser pre- visibles, también es el hecho de que las consecuencias de las primeras son directamente proporcionales a la mise- ria de la zona en que ocurran. Es cierto que las ayudas de emergencia y los planes de reconstrucción surgidos a raíz de una catástrofe pueden paliar los "sufrimientos" de los menos afectados. Algunos ejemplos recientes, como el terremoto en Tierradentro en 1994 que arrasó 12 resguardos y 9 cabildos indígenas Nasa Yuwe (Paeces, demues- tran las diferentes percepciones que se tienen del problema, sea visto desde la óptica blanca-mestiza o desde la per- cepción indígena. La primera no sólo es estatal sino también de la Iglesia católica. Otros casos de catástrofes natu- rales en zonas indígenas serían: a la avalancha de marzo del 87 en Chosica Perú, la cual podría ser prevenida si la arquitectura indígena y los recursos naturales fueran conservados. b Dos días antes la Amazonía ecuatoriana sufrió dos sismos que afectaron a la comunidad Quichua fueron más catastróficas las políticas de reconstrucción que los sismos. c Entre marzo y abril de 1982 en Chiapas hizo erupción el volcán Chichón con lo que los indígenas per- dieron hasta su miseria.La cultura indígena además de tener constancia mítica de la causalidad de las calamidades, tiene tecnología para hacerles frente, por lo que se evidencia lo nocivo de las prácticas de la ciencia occidental a dichas comunidades.ABSTRACT: Natural and political disasters disasters are similar in that they can be foreseen. Also in that the the consequences of the latter are directly proportional to the poverty of the area in which they take place. It is true that emergency help and reconstruction plans can limit the «sufferings» of some affected people. Some recent examples, lik the eartquake of Tierradentro in 1994, which destroyed 12

  5. Seismological Constraints on Geodynamics

    Science.gov (United States)

    Lomnitz, C.

    2004-12-01

    volume V: \\int${V}∑ {k}ν {k}2(gradΔ P)2dV where the Lik are Onsager coefficients and ν k} is the stoichiometric coefficient of phase k. This enables us to calibrate the process. Note that there are contributions to the excited state that include material flows Jkx (flows of water and electrons into the epicentral area), in addition to the excited heat flow values Jqx. A geodynamic model of the earthquake process would be essential for earthquake prediction. Kuiken, G.D.C., Thermodynamics of Irreversible Processes (John Wiley & Sons, New York, 1994). Lomnitz, C., On thermodynamics of planets, Geophys. J. Roy. Astr. Soc., 5, 157-161, 1961. Lomnitz, C., Search of a worldwide catalog for earthquakes triggered at intermediate distances, Bull. Seismol. Soc. Am., 86, 293-298, 1996.

  6. Thresholds, musics and liminality: professional Rom musicians and their liminal roles in nuptial rites of Bergama regionEşikler, müzikler ve liminalite: profesyonel Roman müzisyenler ve Bergama yöresi evlilik ritüellerindeki liminal rolleri

    Directory of Open Access Journals (Sweden)

    Hasan Devrim Kınlı

    2016-01-01

    ım atmaya hazırlandığı bir eşiksellik (liminality sürecidir. Yörede ‘dümbekçiler’ olarak adlandırılan Roman kadın müzisyenler bu süreçte, erkek müzisyenlerin damatla kurduğu ilişkiden farklı olarak hemen her aşamada gelinin yanında bulunarak ritüel içi eşikleri uygun bir biçimde geçmede ona rehberlik de ederler. Bu makale erkek ve kadın Roman müzisyenlerin ritüel süreci boyunca, başta gelin olmak üzere damada ve diğer tüm komünitas üyelerine eşlik ederken sergiledikleri ‘liminal’ rollerin anlaşılmasına katkı sunmayı amaçlar.

  7. Histerektomi endikasyonları ve histopatolojik tanıların dağılımı

    Directory of Open Access Journals (Sweden)

    Seda Keskin

    2013-09-01

    Full Text Available Amaç. Kliniğimizde gerçekleştirilen histerektomi operasyonlarının klinik endikasyonlarını incelemek ve histerektomi materyallerindeki histopatolojik tanıları ortaya koymaktır. Yöntem. Ocak 2010-Ocak 2013 tarihleri arasında gerçekleştirilen 223 total abdominal histerektomi olgusu retrospektif olarak incelendi. Yaş, menapozal durum, operasyon endikasyonu, yapılan operasyonun bilgileri ve elde edilen materyalin patolojik inceleme sonuçları analiz edildi. Bulgular. Çalışmaya alınan hastaların yaş ortalaması 49,3±5,4 olarak saptandı. Tüm vakalara total abdominal histerektomi uygulanmıştı. Hastaların %76,2’sine bilateral ooferektomi, %17,4’üne tek taraflı ooferektomi, %6,2’sine ise sadece histerektomi uygulanmıştı. Hastaların %19,2’si menapoz olarak değerlendirildi. Histerektomi endikasyonlarımız arasında en sık izlenen 138 hasta (%61,8 ile myoma uteri idi. Diğer endikasyonlar ise sırasıyla 38 hasta (%17 ile disfonksiyone uterin kanama, 37 hasta (%16,5 ile adneksiyel kitle, 10 hasta (%4,4 ile pelvik organ prolapsusu idi. Histerektomi materyallerinin histopatolojik incelemesi sonucunda, en yaygın tanımlanan patolojiler sırasıyla %68,1; %37,2; %18,8 oranlarıyla leiomyom, adenomyozis ve overyan/paraoveryan kist olarak belirlendi. En sık görülen kombinasyon %15,2 ile leiomyom ve adenomyozis kombinasyonuydu. Ayrıca 19 hastada (%8,5 endometrial polip, 15 hastada (%6,7 endometrial hiperplazi, 11 hastada (%4,9 atrofik endometrium, 4 hastada (%1,7 servikal intraepitelyal neoplazi, 3 hastada (%1,3 endometrium kanseri saptandı. Sonuç. Çalışmamızda en sık histerektomi endikasyonu literatürdeki gibi myoma uteri olarak saptandı. Histopatolojik inceleme sonucunda ise en sık leiomyom ve adenomyozis saptandı. Menometroraji/pelvik ağrı şikayeti ile başvuran ve özellikle myoma uterisi olan hastalarda eşlik eden adenomyozis olabileceği akılda tutulmalıdır. Fertilitesini tamamlam

  8. Dunaliella salina (Dunal Teodoresco (Chlorophyceae Büyümesi Üzerine Tuz Derişimlerinin Etkileri.

    Directory of Open Access Journals (Sweden)

    Yaşar Durmaz

    2015-12-01

    Full Text Available Dunaliella salina, yüksek tuzluluk, yüksek ışık şiddeti ve azot eksikliği gibi bazı stres koşulları altında kültüre edildiğinde hücre içinde β-karoten biriktirebilen Chlorophyceae sınıfına ait bir alg türüdür. Yüksek tuzlulukları tolere edebilen D. salina gibi türler belli bir bölgeye ve çevre koşullarına adapte olmuş halde yaşar. Bu araştırma kapsamında Konya Tuz Gölü’nde yapılan incelemelerde, tuz parsellerinde kırmızılıklar şeklinde görülen alanlardan alınan örneklerdeki alg hücrelerinin mikroskopta tür tanımı yapıldıktan sonra D. salina olarak tanımlanan hücreler seyreltme yöntemi ile izole edilerek kültüre alınmıştır. Laboratuvarda NaCl ilave edilerek, 0.62M, 0.85M, 1.28M ve 1.71M tuz derişimleri hazırlanmış, 500 ml’lik erlenlerde, AS100 ortamında, 100 µmol foton m-2s-1 ışık şiddetinde sürekli aydınlatma ile 20±1°C sıcaklıkta kültürleri yapıldı. D. salina’nın yüksek tuzluluk konsantrasyonlarında gelişimini sürdürebildikleri gözlendi. En yüksek hücre konsantrasyonu 1.71 M NaCl’de 5.87x106 hücre ml-1 ulaştı. 1.71M NaCl konsantrasyonında yapılan kültürlerden alınan örneklerde toplam karoten 9.80±0.25 mg g-1 kuru ağırlık tespit edildi. Bu araştırmada Tuz Gölünden izole edilen D.salina türünün yüksek tuzluluk konsantrasyonlarına dayanıklı olduğu ve hatta gelişimini sürdürebilği tespit edildi

  9. Sağlık İletişiminde Korku Öğesinin Kullanımı: Sigara Paketlerinde Kullanılan Sigara Karşıtı Görsellerin Göstergebilimsel Analizi

    Directory of Open Access Journals (Sweden)

    Aslıhan Ardıç Çobaner

    2014-02-01

    Full Text Available Sağlık iletişiminde sağlıkla ilgili kampanyalarda ve özellikle de riskli davranışın değiştirilmesi ve bireyleri sağlığa zararlı davranışlarından vazgeçirmek amacıyla hazırlanan içeriklerde korku öğesinin (fear appeal kullanımına sık rastlanmaktadır. Bu çalışmanın amacı, sigara içme davranışını azaltmak için sigara paketlerinin üzerinde yer alan sigara karşıtı görsellerde korku öğesinin kullanımını, iletilerin neler olduğunu ve anlamın nasıl oluştuğunu göstergebilimsel analiz yöntemini kullanarak ortaya koymaktır. Bu çalışma, Türkiye’de sigara paketleri üzerinde kullanılan on dört görseli kapsamaktadır. Çalışmanın sonucunda, sigara paketleri üzerinde yer alan görsellerde korku öğesinin farklı düzeylerde kullanıldığı ortaya konulmuş ve korku öğesinin tıbbi paradigma içerisinde “sağlık” ve “sağlıklı olma” mitleri ile sağlık-hastalık, hayat-ölüm, kadınlık-erkeklik, gençlik-yaşlılık gibi karşıtlıklarla pekiştirildiği tespit edilmiştir.Ayrıca analiz sonuçları, görsel metinlerde sigara içmenin “bireysel bir davranış” ve bir “bağımlılık” olarak çerçevelendiğini de ortaya koymuştur. Korku öğesinin kullanımında beklenen tutum ve davranış değişikliğini sağlamak için bireylerin toplumsal olarak da desteklenmeleri gerekmektedir. Dolayısıyla bu çalışma bireyin ve toplumun sağlığı için bireysel çabaların yanında; politika geliştirme süreçlerine katılımın ve insanların kendi sağlıklarına dair farkındalıklarını ve öz-yeterliliklerini arttıran sağlık iletişimi faaliyetlerinin önemini de vurgulamaktadır.

  10. Esnek ve Rijit Yol Üst Yapılarında Gürültü Seviyelerinin Eş Zamanlı Ölçümü ve Analizi

    Directory of Open Access Journals (Sweden)

    Hakan Yıldırım

    2014-06-01

    Full Text Available Beton yollar dünyada yaygın olarak kullanılmasına karşın ülkemizde gelişim gösterememiş, bu nedenle de genel olarak bitümlü sıcak karışım asfalt yollar tercih edilmiştir.Bu çalışmada, Türkiye'de yaygın olarak kullanılan bitümlü sıcak karışım asfalt yollar ve henüz yaygınlaşmamış olan beton yollar arasında gürültü seviyeleri yönünden bir karşılaştırma yapılmıştır. Bunun için Afyonkarahisar-Emirdağ arasında inşa edilmiş 2 km'lik beton yol ile bu yolun devamı olan bitümlü sıcak karışım asfalt yol arasındaki geçiş noktası çalışma koridoru olarak kullanılmıştır.Bu koridordaki beton yol ve bitümlü sıcak karışım asfalt yolun kenarlarına, ses girişimlerini en aza indirecek şekilde, ayrı ayrı gürültü ölçüm cihazı ve kamera düzenekleri yerleştirilmiş, yol yapım malzemesine bağlı olarak değişen gürültü seviyeleri eş zamanlı olarak kaydedilmiş, bulunan değerler analiz edilerek kaplama türleri ile gürültü seviyeleri arasındaki ilişki araştırılmıştır. Bu aşamada, kurulan düzenekler arasındaki mesafe trafik yoğunluğunun ve akış hızının değişimini engellemek için mümkün olduğunca kısa tutulmuştur.Yapılan ölçüm ve analizler sonunda beton yolların bitümlü sıcak karışım asfalt yollara göre ortalama gürültü seviyesinin aynı taşıt kompozisyonu ve trafik hacmi için yaklaşık 4 dB(A daha düşük olduğu ortaya konmuş ve ülkemizde de beton yolların gelişim göstermesi gerektiği vurgulanmıştır.

  11. Okul müdürünün öğretimsel denetim davranışları ölçeğinin geçerlik ve güvenirlik çalışması [A validity and reliability study of the principals’ instructional supervision behavior scale

    Directory of Open Access Journals (Sweden)

    Abdurrahman İLĞAN

    2014-04-01

    Full Text Available Bu araştırmanın amacı, okul müdürünün öğretimsel denetim davranışlarının sıklığını betimleyen geçerli ve güvenilir bir ölçme aracı geliştirmektir. Araştırmanın çalışma grubunu Manisa, Yozgat, Ankara, Adana, İzmir, Van ve Batman illerinde kamu ve özel okullarında çalışan 984 öğretmen oluşturmaktadır. Ölçme aracının geçerliği kapsamında açımlayıcı ve doğrulayıcı faktör analizleri; güvenirlik kapsamında ise Cronbach’s Alfa katsayısı, madde toplam korelasyonları, maddelerin alt ve üst % 27’lik gruplarda t-testi ile karşılaştırılması yapılmıştır. 23 ifadeden oluşan taslak ölçme aracı üzerinde yapılan açımlayıcı faktör analizinde ölçme aracının hem tek boyutlu hem de iki boyutlu olarak kullanılmasının mümkün olduğu ortaya çıkmıştır. Buna göre ölçme aracının iki boyutlu kullanılması durumunda, birinci boyuta “öğretimi ve öğretmeni geliştirme”, ikinci boyuta ise, “sınıf ziyaretleri ve geri bildirim sunma” isimleri verilmiştir. Açımlayıcı faktör analizinin ardından yapılan doğrulayıcı faktör analizi de kabul edilebilir düzeyde uyum indeksleri vermiştir. Yapılan analizler okul müdürü öğretimsel denetim davranışları ölçeğinin geçerli ve güvenilir olduğunu ortaya koymuştur.

  12. Growth and Reproduction of Female Brushtooth Lizardfish Saurida undosquamis (Richardson from the Gulf of Suez, Egypt.

    Directory of Open Access Journals (Sweden)

    Magdy M. El-Halfawy

    2015-12-01

    Full Text Available Süveyş Körfezi’nde (Mısır lokum balığı Saurida undosquamis (Richardson dişi bireylerinin büyüme ve üremesi. Ekim 2004’ten Mayıs 2005’e kadar Süveyş Körfezinden trol ile yakalanan ve Attaka balıkçı limanından çıkarılan 434 Lokum balığının (Saurida undosquamis ilk olgunluk boyu, yumurtlama dönemi, büyüme parametreleri ve yaş kompozisyonu ele alındı. Dişilerin total uzunluğu 13.2 ile 34 cm arasında değişim göstermiştir. Boy (L-Ağırlık (W arasındaki ilişki W=0.0038 L3.1666 olarak tespit edildi. FISAT programı ile analizi yapılan boy frekanslarından elde edilen yaş verileri von Bertalanffy denkleminin (1938 büyüme parametrelerinin tahmininde kullanıldı. Tahmin edilen parametreler L∞=35.56cm, K=0.26 ve t=-1.059 idi. Saurida undosquamis dişileri için maksimum yaş 6 olarak tespit edilmiştir. Yakalananlar içinde 3 yaş grubu dominant olarak gözlenmiştir. Ovaryum, gonadosomatik indeks ve oosit çapının makroskobik görüntülerinden Saurida undosquamis’in yumurtlama mevsiminin Aralık ve Mayıs’ta iki dönemlik artış göstermesiyle birlikte tüm yıl boyunca sürdüğü anlaşıldı. Gonadların, bakir, olgun bakir, gelişmekte olan, gelişmiş, yumurtlayan ve yumurtalarını dökmüş gibi dış görünüşe dayanan yedi aşaması belirlendi. Dişilerin 18.1cm’lik total boyda olgunluğa ulaşmığı tespit edilmiştir. Total, doğal ve avcılıktan kaynaklanan ölümlerinin yıllık değerleri sırasıyla 1.22, 0.99 ve 0.23 yıl-1 olarak hesaplandı. Tüketim oranı (E 0.81 olarak tahmin edildi. Her toplamadaki ilgili verim ve biomas analizleri Süveyş körfezindeki Saurida undosquamis dişi stoklarının tüketilmiş oldugu bulunmuştur. Bireylerin en azından %50’sinin toplanma ve yumurtlatma için korunmasını garantilemek amacıyla, şu anki kullanım oranının yaklaşık %53.1’e kadar azaltılması gerekmektedir

  13. Electronic Structure, Phonon Dynamical Properties, and CO2 Capture Capability of Na2-xMxZrO3 ( M=Li ,K): Density-Functional Calculations and Experimental Validations

    Energy Technology Data Exchange (ETDEWEB)

    Duan, Yuhua [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); Lekse, Jonathan [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); Wang, Xianfeng [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); West Virginia Univ., Morgantown, WV (United States). School of Medicine; Li, Bingyun [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); West Virginia Univ., Morgantown, WV (United States). School of Medicine; Alcántar-Vázquez, Brenda [Univ. Nacional Autonoma de Mexico (UNAM), Mexico City (Mexico). Inst. de Investigaciones en Materiales; Pfeiffer, Heriberto [Univ. Nacional Autonoma de Mexico (UNAM), Mexico City (Mexico). Inst. de Investigaciones en Materiales; Halley, J. W. [Univ. of Minnesota, Minneapolis, MN (United States). School of Physics and Astronomy

    2015-04-22

    The electronic structural and phonon properties of Na2-αMαZrO3 (M ¼ Li,K, α = ¼ 0.0,0.5,1.0,1.5,2.0) are investigated by first-principles density-functional theory and phonon dynamics. The thermodynamic properties of CO2 absorption and desorption in these materials are also analyzed. With increasing doping level α, the binding energies of Na2-αLiαZrO3 are increased while the binding energies of Na2-α KαZrO3 are decreased to destabilize the structures. The calculated band structures and density of states also show that, at the same doping level, the doping sites play a significant role in the electronic properties. The phonon dispersion results show that few soft modes are found in several doped configurations, which indicates that these structures are less stable than other configurations with different doping levels. From the calculated relationships among the chemical-potential change, the CO2 pressure, and the temperature of the CO2 capture reactions by Na2-αMαZrO3, and from thermogravimetric-analysis experimental measurements, the Li- and K-doped mixtures Na2-αMαZrO3 have lower turnover temperatures (Tt) and higher CO2 capture capacities, compared to pure Na2ZrO3. The Li-doped systems have a larger Tt decrease than the K-doped systems. When increasing the Li-doping level α, the Tt of the corresponding mixture Na2-αLiαZrO3 decreases further to a low-temperature range. However, in the case of K-doped systems Na2-αKαZrO3, although doping K into Na2ZrO3 initially shifts its Tt to lower temperatures, further increases of the K-doping level α causes Tt to increase. Therefore

  14. [Treatment of pregnancy-associated breast cancer].

    Science.gov (United States)

    Tajti, János; Pieler, József; Simonka, Zsolt; Paszt, Attila; Lázár, György

    2014-08-01

    Esetismertetés: A 25 éves primipara, terhességének 32. hetében, önvizsgálat során a bal emlő külső-felső negyedében csomót észlelt. A komplex emlővizsgálat 4 cm átmérőjű területen meszesedést írt le. A finomtű-biopsia malignus ductalis karakterű sejteket, „C5” kategóriát, a core-biopsia III-as gradusú, invasiv ductalis carcinomát véleményezett („B5b”), távoli disseminatio nem igazolódott. A terhesség terminálását követően az elváltozás széles excisióját végeztük sentinelnyirokcsomó-biopsiával, amelynek pozitivitása miatt axillaris blockdissectio történt. A sebészi kezelést adjuváns onkológiai kezelés követte. A későbbiekben a jobb inguinalis régióban lévő angiomyxoma jelent meg, amelyet in toto excindaltunk. Megbeszélés: A terhességgel összefüggő malignus betegségek incidenciája emelkedik, amelyek közül az emlődaganatok kitüntetett helyen állnak. Terhességasszociált emlődaganatról akkor beszélünk, amennyiben annak diagnózisa a graviditas alatt vagy az azt követő első évben történik. A terhességgel járó élettani változások miatt a betegség felismerése nehezebbé válik, s ennek következtében sokszor ezek a betegek elkésve kerülnek látókörünkbe. A betegség terápiája összetett, mivel az anya kezelése mellett a magzat biztonságára is nagy hangsúlyt kell fektetni – mindez a társszakmák fokozott együttműködését igényli. A kezelési stratégia az egyes trimeszterekben eltérő. Sebészi kezelés a terhesség bármely szakában végezhető. A sugárkezelésről, magzatkárosító hatása miatt, megoszlanak a vélemények. A kemoterápia a terhesség második és harmadik harmadában megengedett. Betegünk közel három évvel a műtétet követően panaszmentes, fiúgyermeke egészséges.

  15. Den norske matvaretabellen og beregningsdatabasen ved Institutt for ernæringsforskning

    Directory of Open Access Journals (Sweden)

    Arnhild Haga Rimestad

    2009-11-01

    Full Text Available  SAMMENDRAGOpplysninger om matvarers innhold av energi og næringsstoffer er nødvendig i mange sammenhenger –for overvåking av kostholdet i ulike befolkningsgrupper, for studier av sammenhenger mellom kosthold,livsstil og helse, ved veiledning, undervisning og opplysning om et helsemessig godt kosthold. De flestevestlige land har en trykt matvaretabell som viser næringsinnholdet per 100 g matvare for etrepresentativt utvalg av de vanligste matvarene. Ved næringsberegning av kostholdsundersøkelser brukessom regel spesialtilpassete beregningsdatabaser, disse har ofte ikke-publiserte data i tillegg. Kvaliteten påden beregningsdatabasen som benyttes ved bearbeiding av kostholdsundersøkelser kan ha avgjørendebetydning for resultatene. Det er viktig at den databasen som benyttes blir omtalt i metodeavsnittet nårarbeidet publiseres. Matvaremarkedet endres stadig, fokus rettes mot nye næringsstoffer og analysemetodeneforbedres. Matvaretabellene og databasene må derfor revideres kontinuerlig. Næringsstoffinnholdet imatvarer varierer med sort, rase, fôring, dyrkingsbetingelser, lagring, transport, bearbeiding, oppskrifterog tilberedningsmetode. Siden mange av disse faktorene er forskjellig i forskjellige land, er det nødvendigå ha egne nasjonale matvaretabeller og databaser. For importerte matvarer kan det være forsvarlig å låneutenlandske verdier gitt at varen er av samme type, at håndteringen er lik og at næringsstoffdefinisjonerog analysemetoder er sammenlignbare. Det er viktig å fortsette det internasjonale samarbeidet med ågjøre tabellverk i ulike land sammenlignbare. Dette er en av forutsetningene for at resultatene frakostholdsundersøkelser i ulike land kan sammenlignes.Rimestad AH, Løken EB, Nordbotten A. The Norwegian food composition table and the database fornutrient calculations at the Institute for Nutrition Research. Nor J Epidemiol 2000; 10 (1: 7-16.ENGLISH SUMMARYFood composition data are needed for diet

  16. [Knowledge and perception of medical students about infertility].

    Science.gov (United States)

    Erdei, Márta; Cserepes, Réka Eszter; Bugán, Antal

    2015-01-18

    Bevezetés: A termékenységi problémákkal küzdő páciensek kezelésében részt vevő egészségügyi szakemberek meddőséggel kapcsolatos tudása és kliensekkel szemben tanúsított érzékenysége alapvetően fontos meghatározója a kezelés minőségének. Célkitűzés: A vizsgálat célja orvostanhallgatók, azaz a jövőbeli meddőségi kezelésben potenciálisan részt vevő, véleményvezérlő szakemberek meddőséggel kapcsolatos tudásának felmérése, és a meddőség érzelmi, illetve testi és kognitív következményeire vonatkozó elképzelések vizsgálata. Módszer: A kérdőíves vizsgálatban 112 (76 nő, 36 férfi) orvostanhallgató vett részt önkéntes, kompenzációmentes közreműködéssel. Eredmények: Az orvostanhallgatók több területen hiányos tudással rendelkeznek a témában. A meddőséggel összefüggő testi és érzelmi tünetek jelenlétét meddő párok férfi tagjait illetően alulbecsülik a hallgatók, míg nők esetében fölülértékelnek érzelmi tüneteket, például a bánatosságot. Következtetések: Az orvosképzés során a hallgatóknak több témaspecifikus ismeretre és gyakorlati tapasztalatszerzési lehetőségre lenne igényük, szükségük. A hallgatók olyan sztereotípiákkal rendelkeznek, amelyek potenciálisan megnehezítik a páciensek torzításmentes percepcióját. E torzítás kockázata különösen hátrányosan érintheti a meddő férfi pácienseket. Orv. Hetil., 2015, 156(3), 105–112.

  17. Viktigheten av fysisk aktivitet og trening blant eldre

    Directory of Open Access Journals (Sweden)

    Hilde Lohne-Seiler

    2012-11-01

    Full Text Available Regelmessig fysisk aktivitet er viktig for eldres helse. Sammenhengen mellom en fysisk aktiv livsstil og helsegevinster som forebygging av sykdom, opprettholdelse av uavhengighet og økt livskvalitet er godt dokumentert (ACSM's Position Stand 1998; Spirduso & Cronin, 2001; Taylor et al., 2004. Hensikten med denne oversiktsartikkelen er derfor å redegjøre for viktigheten av regelmessig fysisk aktivitet og trening i aldringsprosessen, samt utdype sammenhengen mellom en fysisk aktiv livsstil og fysisk funksjon blant eldre. Basert på en nasjonal multisenterstudie (Anderssen et al., 2009, tilfredsstilte 20% voksne og eldre (20-85 år de nasjonale anbefalinger om 30 minutter med daglig fysisk aktivitet. Kun 12% i den eldste aldersgruppen (80-85 år tilfredsstilte anbefalingene. Totalt fysisk aktivitetsnivå, målt ved hjelp av akselerometer, ble redusert med økende alder, hvor de eldste (80-85 år hadde 50% lavere aktivitetsnivå sammenlignet med de yngste (65-69 år (Lohne-Seiler et al., 2012. Fra 25-års alder reduseres utholdenhet og muskelstyrke med 10% per 10 år dersom individet er inaktiv (Heath et al., 1981; Wilmore, 1991. Systematisk utholdenhets- og styrketrening ser derimot ut til å redusere tapet med inntil halvparten, det vil si en reduksjon tilsvarende 5% per 10 år hos fysisk aktive individer (Heath et al., 1981. Eldre individer ser ut til å ha de samme treningsinduserte effekter som yngre, det vil si at man får effekt av økt aktivitet uansett alder, og da også lik prosentvis fremgang (Hagberg et al., 1989. Studier har vist at det er mulig å øke maksimalt oksygenopptak og maksimal muskelstyrke med inntil 10-20% i løpet av en 12 ukers intervensjon (Hagberg et al., 1989; Reeves et al., 2003; Lohne-Seiler et al, in press. Da muskelstyrke ser ut til å ha en sterk sammenheng med individets funksjonsevne/mobilitet, er det viktig å kunne tilrettelegge for systematisk styrketrening for eldre for på den måten å oppnå

  18. PRINCESS KADRIA HUSSEIN, PAINTER VITTORIO PISANI AND TURKISH WAR OF INDEPENDENCE PRENSES KADRİYE HÜSEYİN, RESSAM VİTTORİA PİSANİ VE TÜRK MİLLİ MÜCADELESİ

    Directory of Open Access Journals (Sweden)

    Nesrin TAĞIZADE-KARACA

    2012-01-01

    eklinde düzenleyerek Fransızca olarak yayınlamıştır (1921. Bu kitap, Atatürk’ün isteğiyle 1922 yılında Cemile Necmeddin Sahir Sılan tarafından Türkçe’ye çevrilmiştir.Kadriye Hüseyin’in biyografisi, edebi kişiliği ve eserleri üzerinde durulduktan sonra onun Milli Mücadele’nin erken dönemini ve Cumhuriyet öncesi Ankara’sını işlediği İzmirli İtalyan ressam Vittorio Pisani’nin (1899-1974 tablolarıyla eşlik etmiş olduğu anı-mektup türü eseri, Mukaddes Ankara’dan Mektuplar çalışmanın konusunu oluşturacaktır.

  19. BUĞDAY SAPLARINDAN (Triticum aestivum L. VE SAMAN-ODUN KARIŞIMI LİFLERDEN ORTA YOĞUNLUKTA LİF LEVHA (MDF ÜRETİMİ

    Directory of Open Access Journals (Sweden)

    Hüdaverdi EROĞLU

    2001-02-01

    Full Text Available Bu çalışmada, hammadde olarak Ankara ilinden temin edilen buğday (Triticum aestivum L. sapları kullanılmıştır. Kuru yöntemle MDF üretiminde % 8, 10 ve 12 oranında üre formaldehit tutkalı yapıştırıcı, sulu amonyum klorürün % 30'luk çözeltisinden % 1 oranında sertleştirici olarak kullanılmıştır. Ayrıca, 5, 6 ve 7 dk'lık presleme süreleri denenmiştir. Buğday saplarının alkol-benzen, soğuk su, sıcak su ve % 1'lik NaOH çözünürlüğü sırasıyla; % 5.15, % 7.31, % 9.84 ve % 40.79 olarak bulunmuştur. Ayrıca, holoselüloz, selüloz, lignin ve kül miktarları sırasıyla; % 74.79, % 52.67, % 20.17 ve % 4.21 olarak belirlenmiştir. Yapılan lif morfolojisiyle ilgili çalışmalarda kullanılan buğday saplarının lif uzunluğu 1.2-1.5 mm, lif genişliği 12-16 µm, lümen çapı 4-6 µm ve çift çeper kalınlığı 7.5-11.5 µm bulunmuştur. Buğday saplarından MDF eldesi için en uygun lif üretim şartları; buhar basıncı 10.5 atm, buharlama süresi 4 dk ve liflendirme süresi 2 dk olarak belirlenmiş ve uygulanmıştır. Saman liflerinden 0.700 g/cm 3 ve 0.800 g/cm 3 , odun ve saman-odun karışımı (% 30 saman + % 70 odun, % 50 saman + % 50 odun, % 70 saman + % 30 odun liflerden ise 0.800 g/cm 3 özgül kütleli MDF levhaları üretilmiştir. Tüm levhaların elastikiyet modülü, eğilme direnci, yüzeye dik çekme direnci ile 24 saatteki su alma ve kalınlığına şişme değerleri belirlenmiştir. Laboratuar koşullarında elde edilen MDF levhaların fiziksel ve mekanik özellikleri üzerinde yapılan değerlendirmeler sonucunda buğday saplarından en uygun MDF üretim koşulları; tutkal miktarı % 12, pres süresi 6 dakika, pres sıcaklığı 150 °C, pres basıncı 200-220 kp/cm 2 , sertleştirici miktarı % 1 ve saman/odun oranı % 50 -% 50 şeklinde belirlenmiştir.

  20. KADIN TÜKETİCİLERİN ALIŞVERİŞ MERKEZİ TERCİHLERİNİN BELİRLENMESİ ve BİR PİLOT ARAŞTIRMA - DETERMINATION OF FEMALE CONSUMERS’ SHOPPING MALL CHOICES AND A PILOT RESEARCH

    Directory of Open Access Journals (Sweden)

    Ahmet ŞEKERKAYA

    2010-07-01

    Full Text Available Özet:İşletmelerin pazarlama stratejileri oluşturmasında,pazarı daha iyi tanımlayarak kendileri için en uygun pazarıhedef olarak seçmelerinin temeli pazarı bölümlendirmektengeçmektedir. Hedef pazarı oluşturan tüketicilerin çeşitliözelliklerini tanımayan ve buna uygun tanımlamalarıyapamayan işletmelerin doğru pazarlama stratejisiuygulayamamasının yanı sıra günümüz rekabet şartlarıiçerisinde kaynakları etkin ve verimli kullandığındanbahsetmek mümkün değildir.Ülkelerin gelişmişlik düzeylerindeki artış ile beraber kadıntüketicilerin satınalma kararları üzerindeki etkilerinin artışıpek çok çalışmada incelenmiştir. Bu gerçekten hareketlepazarlama profesyonelleri de pazarlama stratejilerinioluştururlarken kadın tüketicileri daha fazla etkileyebilmeninyollarını aramaya başlamıştır.Bu çalışmada kadın tüketicilerin AVM tercih nedenlerine görekümelenmesi ve AVM’lerin kadın tüketiciler tarafından tercihnedenleri belirlenmeye çalışılmıştır. Yapılan araştırmasonucunda kadınların AVM tercihlerine göre üç gruptakümelendikleri ortaya çıkarılarak bu kümeler sahip olduklarınitelikler itibariyle potansiyeller, aktifler ve duyarsızlar olarakadlandırılmıştır.Abstract:Market segmentation is one of the suitablemarketing tool for businesses to understand and target market.It is impossible to mention that the enterprises which have notacknowledged various features of consumers do not apply thecorrect marketing strategy and use the sources effectively andefficiently considering the competition circumstances of today.The increase in development levels of countries and its effecton female consumers’ decisions of purchase are analyzed inmany studies. By taking this reality into consideration,marketing professionals have started to search for the ways ofattracting the female consumers more as they decide theirmarketing strategies.In this study female consumers are

  1. Sosyal ve Ekonomik Açidan Fütüvvet İle İlgili Yazma Eserler Bibliyografyasi

    Directory of Open Access Journals (Sweden)

    Mahmut Esat Harmancı

    2016-09-01

    Full Text Available Fütüvvet, İslam tasavvufunun kurumsallaşma sürecinde bir zühd arayışı olarak ortaya çıkmış, melâmet meşrebi içerisinde sosyal ve ekonomik bir kurumsallaşmaya neden olmuş, zaman zaman tasavvuf şubeleri içerisinde zaman zaman da tasavvufa bir tepki hareketi olarak işlev görmüştür. Tasavvuf içerisinde melâmet ve kalenderîlik meşrebleri olarak varlığını sürdürürken, değerler bağlamında da bir öğretiyi yaşatmak üzere önemli bir işlev görmüştür. Bu kavram, Mısır’dan Anadolu’ya kadar yayılarak bir süre sonra sadece esnaf teşekkülünün âdâb ve erkânına ilişkin bir ahlâk öğretisine dönüşmüştür. Ahilik kurumu, esnaf sınıfının işleyişi açısından Anadolu’ya özgü bir uygulama modeli geliştirmiştir. Bu yapı, İslam ekonomisi çalışmaları için de bir başvuru kaynağı niteliği taşımaktadır. Bugüne kadar yapılan çalışmalarda, tür ve yazar eksenli bir dikkat gözetilmiş, kütüphanelerde bulunan yazmalar üzerinde kapsamlı bir kaynakça derlemesi yapılmamıştır. Bu çalışmada, en başından itibaren bir esnaf teşekkülü (lonca olarak da bilinen ahilik kurumuna kaynaklık edecek olan Arap harfli yazma eserlerin bibliyografyası ortaya çıkarılmaya çalışılmıştır. Bu çerçevede veri tabanları, “fütüvvet, uhuvvet, melamet ve ahilik” kavramları üzerinde araştırma yapan bilim insanlarının eserleri incelenmiştir. Eserler, “yazarı bilinenler” ve “yazarı belli olmayanlar” olarak iki grupta listelenmiştir. 

  2. İki Farklı Restoratif Materyalin Sınıf V Kavitelerdeki Mikrosızıntıya Etkisi

    Directory of Open Access Journals (Sweden)

    M Mustafa Hamidi

    2011-01-01

    Full Text Available Amaç: Bu çalışmanın amacı sınıf V kavitelerde bir
    kompozit rezin ile bir yüksek viskoziteli cam iyonomer
    simanın mikrosızıntılarının in vitro şartlarda
    değerlendirilmesidir.
    Gereç ve Yöntem: Bu çalışmada 30 adet çürüksüz insan
    üst premolar dişi kullanıldı. Her dişin bukkal yüzeylerine
    mine-sement sınırından 1 mm aşağıda olacak şekilde
    standardize edilmiş Sınıf V kaviteler hazırlandı. Dişler her
    biri 15 dişten oluşan rastgele 2 gruba ayrıldı. Hazırlanan
    kaviteler birinci grupta bir kompozit rezinle (S3 Bond /
    Clearfil Esthetic; Kuraray, Tokyo, Japonya, ikinci grupta bir
    yüksek viskoziteli cam ionomer (Fuji IX GP; GC, Tokyo,
    Japonya ile dolduruldu. Restoratif maddeler bir LED (Elipar
    Freelight; 3M ESPE, Seefeld, Germany ışık kaynağı
    kullanılarak polimerize edildi. Bütün örnekler 24 saat distile
    su içerisinde bekletildi ve 1 dakika kalacak şekilde 5 ve 55°C
    termal siklus işlemi 10000 kez uygulandı. Dişler
    restorasyonların 1 mm çevresi hariç tırnak cilası ile kaplandı.
    24 saat %1’lik metilen mavisi solüsyonunda bekletildi. Daha
    sonra dişler yıkanıp, bukkolingual yönde dikey olarak
    kesilerek x15 büyütmede stereomikroskop ile değerlendirildi.
    Elde edilen veriler Kruskal Wallis ve Whitney U testleriyle
    değerlendirildi.
    Bulgular: Deney grupları arasında istatistiksel bir
    farklılık bulunamadı (p>0.05. Grup 1’de servikal ve oklüzal
    mikrosızıntı değerleri arasında istatistiksel olarak anlamlılık
    bulundu ( p<0.05 . Grup 2’ de ise servikal ve oklüzal
    skorlarda fark bulunmadı. Sonuç: Kullanılan her iki
    restoratif materyal, sınıf V kavitelerde mikrosızıntı
    değerlendirmesinde başarılı bulunmuştur.

  3. Effects of pentoxifylline on proliferation of human umbilical vein endothelial cells (HUVEC

    Directory of Open Access Journals (Sweden)

    Eyup Çağatay Zengin

    2016-09-01

    Full Text Available SUMMARY Objective: The aim of this study was to investigate the effect of pentoxifylline (PNX with a pharmacological dose range on proliferation of human umblical venous endothelial cells (HUVEC. Method: The cells were maintained in M199 supplemented with 20% fetal bovine serum, penicillin, and streptomycin. The cultures were cultivated in an incubator at 37°C and with 5% CO2, until cell monolayers attained confluence which occurred after 7 days. The assays were performed in the exponential growth phase of the cells. The cell viability was assessed using the cleavage of tetrazolium salts added to the culture medium. Pentoxifylline with concentrations of 10-4M, 10-5M, 10-6M and 10-7M were used for the proliferation assay in which cells were incubated for 24, 48, and 72-hours with these drugs. The experiments were conducted in six replicates. Results: Only the 10-4M dose of PNX at 72 h significantly reduced the viability of HUVEC (p0.05. Conclusions: Overall, PTX with a pharmacological dose range has no cytotoxic effect on HUVEC. We think that this is also in accordance with the findings of several studies performed in animal models and clinical settings, indicating positive effects of PTX on tissues in normal and ischemic conditions. Keywords: Pentoxifylline, proliferation, human umbilical venous endothelial cells ÖZET Amaç: Bu çalışmanın amacı farmokolojik doz aralığında uygulanan pentoksifilinin insan umblikal ven endotel hücrelerinin (HUVEC proliferasyonu üzerine etkisini araştırmaktır. Yöntem: Hücreler içerisine %20 fetal bovine serum, penisilin ve streptomisin eklenen M199 besiyeri içinde, %5 CO2 içeren 37 ̊C ‘lik inkübatörde kültüre edildi. Deneyler hücreler gelişim fazında iken gerçekleştirildi. Hücrelerin canlılığı kültür ortamına tetrazolium tuzları eklenerek değerlendirildi. Pentoksifilinin 10-4M, 10-5M, 10-6M and 10-7M konsantrasyonları, 24, 48 ve 72. saatlerde değerlendirildi. Deneyler alt

  4. The effect of mobbing behaviors on burnout of women’s basketball playersMobbing davranışlarının kadın basketbolcuların tükenmişliği üzerine etkisi

    Directory of Open Access Journals (Sweden)

    Türkan Karık

    2015-08-01

    Full Text Available This research was conducted in order to examine the effect of mobbing behaviors on the occupational burnout of women’s basketball players. The research mainly looked into the effects of different dimensions of mobbing, namely as person-related mobbing, work-related mobbing and physically intimidating mobbing, on the emergence of emotional/physical exhaustion and devaluation as well as reduced sense of accomplishment among women’s basketball players.  The study used the NAQ-F (Negative Acts Questionnaire—Football scale developed by Yildiz (2015a to measure mobbing and the ABQ (Athlete Burnout Questionnaire scale developed by Raedeke and Smith (2001 to measure burnout. Data was gathered from a sample of basketball players (n=97 in the Turkish Women’s Premier Basketball League. Exploratory factor analysis, correlation analysis and regression analysis were utilized for the evaluation of data. The study indicated that person-related mobbing and work-related mobbing had a significant and positive effect on basketball players’ burnout. The emotional/physical exhaustion of basketball players and reduced sense of accomplishment were found to be affected by person-related mobbing while the development of devaluation was positively correlated only with work-related mobbing.   Özet Bu çalışma, mobbing davranışlarının kadın basketbolcuların mesleki tükenmişliği üzerine etkisinin incelenmesi amacıyla gerçekleştirilmiştir. Bu çalışmada temel olarak mobbing boyutlarından olan kişi ilişkili mobbing, iş ilişkili mobbing ve fiziksel korkutucu mobbingin kadın basketbolcuların duygusal tükenmesi, duyarsızlaşması ve başarıda düşüş hissine olan etkisi ele alınmıştır. Çalışmada veri toplama aracı olarak, mobbing için Yıldız (2015a tarafından geliştirilen NAQ-F ölçeği (Negative Acts Questionnaire—Football, tükenmişlik için Raedeke ve Smith (2001 tarafından geliştirilen ABQ ölçeği (Athlete

  5. Partial county development plans as a means for preserving wild reindeer habitats in Norway

    Directory of Open Access Journals (Sweden)

    Hans Olav Bråtå

    2008-06-01

    fylkesdelplanene for Rondane og Hardangervidda øst i forhold til teorier om forvaltning av fellesressurser. Analysen viser at planleggingen og det offentlige systemet som er bygget opp omkring planene, er i tråd med de fleste av Ostrom sine prinsipper. Det bør imidlertid etableres et planråd for Hardangervidda og fylkesdelplanen der bør utvides slik at den omfatter hele villreinområdet. Det bør etableres et system med regelmessig kartlegging av planleggingen og effektene av det. Det bør også etableres et system som gir grunnlag for å løse konflikter på en enkel måte, men dette er ikke enkelt fordi planleggingen er basert på det offentlige planleggingssystemet og forventninger om like behandling av saker. Lik og rettferdig behandling av saker er viktig for at aktører skal kunne godta restriksjoner på egen aktivitet.

  6. Ibn Ḥazm on Homosexuality. A case-study of Ẓāhirī legal Methodology

    Directory of Open Access Journals (Sweden)

    Adang, Camilla

    2003-06-01

    Full Text Available This article discusses the views of the teologian and legal scholar Ibn Ḥazm of Cordoba (d. 456/1064 on homosexuality. Although reference is made to his literary work Ṭawq al-ḥamāma, which is rich in anecdotes on homoerotic attraction, the article focuses on Ibn Ḥazm's multivolume legal tract Kitāb al-Muḥallā, a work written from a Ẓāhirī, or literalist perspective. A step-by-step analysis of Ibn Hazm's legal reasoning on homosexuality, both male (liwāṭ and female (siḥāq is provided, and comparisons with the views of other jurist, especially Mālikis, are made. Unlike his Mālikī contemporaries, Ibn Ḥazm holds that homosexuality is not to be equated with fomication (zinā, which incurs the death penalty. Instead, he advocates a relatively mild punishment of up to ten lashes for homosexual practices, based upon his idiosyncratic interpretation of the revealed sources which is illustrated here. Although Ibn Ḥazm is believed by some modem authors to have had homosexual leanings himself, he categorically condemns sexual contacts between members of the same sex as immoral and sinful, and believes that homosexuals should be reformed.

    Este artículo discute las opiniones de Ibn Ḥazm de Córdoba (m. 456/1064 jurista y teólogo, acerca de la homosexualidad. Aunque se hace referencia a su obra literaria Ṭawq al-ḥamāma, rica en anécdotas sobre atracción homoerótica, el artículo se centra en su voluminosa obra legal zahirí Kitāb al-Muḥallā y analiza el razonamiento legal de Ibn Ḥazm sobre la homosexualidad tanto masculina (liwāf como femenina (siḥāq comparándola con la de otros juristas, en particular, malikíes. A diferencia de sus contemporáneos malikíes, Ibn Hazm mantiene que la homosexualidad no debe equipararse a la fornicación (zinā que incurre en la pena de muerte. Por el contrario, aboga por el relativamente suave

  7. 40Ar/39Ar Dating of Zn-Pb-Ag Mineralization in the Northern Brooks Range, Alaska

    Science.gov (United States)

    Werdon, Melanie B.; Layer, Paul W.; Newberry, Rainer J.

    2004-01-01

    The 40Ar/39Ar laser step-heating method potentially can be used to provide absolute ages for a number of formerly undatable, low-temperature ore deposits. This study demonstrates the use of this method by determining absolute ages for Zn-Pb-Ag sediment-hosted massive sulfide deposits and vein-breccia occurrences found throughout a 300-km-long, east-west-trending belt in the northern Brooks Range, Alaska. Massive sulfide deposits are hosted by Mississippian to Pennsylvanian(?) black carbonaceous shale, siliceous mudstone, and lesser chert and carbonate turbidites of the Kuna Formation (e.g., Red Dog, Anarraaq, Lik (Su), and Drenchwater). The vein-breccia occurrences (e.g., Husky, Story Creek, West Kivliktort Mountain, Vidlee, and Kady) are hosted by a deformed but only weakly metamorphosed package of Upper Devonian to Lower Mississippian mixed continental and marine clastic rocks (the Endicott Group) that stratigraphically underlie the Kuna Formation. The vein-breccias are mineralogically similar to, but not spatially associated with, known massive sulfide deposits. The region's largest shale-hosted massive sulfide deposit is Red Dog; it has reserves of 148 Mt grading 16.6 percent zinc, 4.5 percent lead, and 77 g of silver per tonne. Hydrothermally produced white mica in a whole-rock sample from a sulfide-bearing igneous sill within the Red Dog deposit yielded a plateau age of 314.5 Ma. The plateau age of this whole-rock sample records the time at which temperatures cooled below the argon closure temperature of the white mica and is interpreted to represent the minimum age limit for massive sulfide-related hydrothermal activity in the Red Dog deposit. Sulfide-bearing quartz veins at Drenchwater crosscut a hypabyssal intrusion with a maximum biotite age of 337.0 Ma. Despite relatively low sulfide deposition temperatures in the vein-breccia occurrences (162°-251°C), detrital white mica in sandstone immediately adjacent to large vein-breccia zones was partially to

  8. ÜNİVERSİTELERİN YENİLİKÇİLİK, ÜNİVERSİTE-SANAYİ İŞBİRLİĞİ VE BÖLGESEL KALKINMA YÖNELİMLERİ ÜZERİNE BİR ARAŞTIRMA - INNOVATIVENESS, UNIVERSITY-INDUSTRY COLLABORATION AND REGIONAL DEVELOPMENT ORIENTATIONS OF TURKISH PUBLIC UNIVERSITIES

    Directory of Open Access Journals (Sweden)

    Nihan YILDIRIM

    2014-07-01

    Full Text Available ÖzetÜniversiteler, eğitim ve araştırma misyonları doğrultusunda bilgi üretip, bu bilgiyi topluma ve sanayikuruluşlarının kullanımına sunmanın yanısıra, artık bu misyonun ötesine geçerek, teknoloji üretim vetransferinde sanayi başta olmak üzere toplumun çeşitli kesimleriyle işbirliği ve ortaklık kurarak, doğrudankatma değer üreten mekanizmalar haline dönüşmektedir. Bu bağlamda, ülkemizde, üniversiteleringirişimcilik, yenilikçilik konusundaki eğitim faaliyetlerinin giderek yoğunlaşması ve derinleşmesininyanısıra, strateji ifadelerinde giderek daha sık ve yoğun olarak sanayi işbirliği, yenilikçilik, bölgeselkalkınma ifadelerine yer verilmekte; üniversitelerin organizasyonel yapılanmalarında da bu hedeflerigerçekleştirmeye odaklanmış birimlerin giderek artmakta olduğu gözlemlenmektedir. Özellikle gelişmehedefinin yüksek olduğu bölgelerde yenilikçilik ve üniversite-sanayi işbirliğini (ÜSİ desteklemek için iseüniversitelere önemli rol ve sorumluluklar düşmektedir. Bu çerçevede, bu çalışma, Türkiye’de 2011 yılı itibarıile faaliyet göstermekte olan 96 devlet üniversitesinin yenilikçilik, sanayi ile işbirliği ve bölgesel kalkınmayakatkı konusundaki yönelimlerini belirlemek üzere bu konulara ilişkin strateji ifadelerini ve kurduklarıorganizasyonel birimlerini incelemekte, bu stratejiler ve yapılanmaların, üniversitelerin kurulu bulunduklarıbölgelerin gelişmişlik seviyelerine göre farklılık gösterip göstermediğini araştırmak amacını taşımaktadır.Bu doğrultuda, öncelikle, üniversitelerin kamuya açık bilgi kaynaklarından üniversitelerin misyon,vizyon, stratejik hedefler, değerler/normlar gibi temel/üst düzey stratejik ifadelerinde ve organizasyonelyapılanmalarında, sanayi işbirliği, yenilikçilik/inovasyon, bölgesel kalkınma kavramları taranarak içerikanalizi yapılmıştır. Bu veriler esas alınarak,

  9. IMPORTANT CHANGE IN RELIGIO-LEGAL STANDARDIZATION OF OTTOMAN PRODUCTS: PASSAGE TO CERTIFICATE OF THE SEAL “IT IS CLEAN/TÂHİRDİR” OSMANLI’DA ÜRÜNLERİN DİNÎ/ŞER‘Î STANDARDİZASYONUNDA DÖNÜM NOKTASI: TÂHİRDİR DAMGALI SERTİFİKASYONA GEÇİŞ

    Directory of Open Access Journals (Sweden)

    Mehmet YILDIZ

    2010-01-01

    Full Text Available It is known that the Ottoman state implemented austere certification of products monitored by organizations such as ihtisab office/ office of the superintendent of guilds and markets and akhi office/ urban fraternity ruling over parts of Anatolia in late Seljuk and early Ottoman times. The monitoring process that was implemented based on religio-legal perspective or material quality aspect moved to an important phase with a critical decision made in modern times: The seal of “it is clean/tâhirdir” was introduced to include inedible products for the first time to be supervised by religio-legal standarts. This decision was made to protect Muslims from products that might contained harmful ingredients according to religio-legal norms. This move was made before the kosher certification that was formed within the Jewish community in America, which became a certain measure of food standart later in the world. This decision also can provide historical background for the practice of halal food certificates in the world. The notion of “it is clean” becomes more evident in the midst of today’s world where genetically modified organisms became so widespread to the level that threatens the health of human generation now. This article aims to study the relevant Ottoman official documents on this issue probably for the first time, and share them with the academic world. Osmanlı devleti ve toplumunda ürünlerin, standartları hisbe/ihtisap ve ahîlik teşkilatları gibi kurumlar vasıtasıyla denetlenen oldukça ciddi sertifikasyon uygulamasına tabi tutuldukları bilinmektedir. Gerek dinî/şer‛î boyutuyla gerekse maddi/nesnel kalite yönleriyle yürütülen bu denetleme işlemi, modern zamanlarda gerçekten çok çarpıcı bir kavşak noktasına ulaştırılmıştır: Özellikle dinî/şer‛î ölçütlerin gıda ürünleri dışındaki ürünlerde de gözetilerek Müslümanların kullanmalarında sakınca bulunmayan ürünlere t

  10. CULTUREL SYNTHESIS IN ADAPTATIONS OF AHMET VEFİK PASHA AND TRANSLATION OF LITERARY WORKS AHMET VEFİK PAŞA ADAPTASYONLARINDA KÜLTÜREL SENTEZ VE EDEBÎ ESER ÇEVİRİSİ

    Directory of Open Access Journals (Sweden)

    Hüseyin DOĞRAMACIOĞLU

    2009-12-01

    şarmıştır. Vefik Paşa’nın bu tutumu örnek alınarak günümüze uyarlanabilir. Son yıllarda yabancı dillerden edebî eser çevirisi yapılırken metinler, hiçbir kritere tabi tutulmamakta böylece kültürümüz ve gençlik psikolojisi üzerinde tahribat yapan bölümler eserle birlikte Türkçeye aktarılabilmektedir. Oysa edebî eser çevirisi bir sanattır. Ayrıca çevirmenin iyi bir eğitimci ve kültürel değerleri tanıyan biri olması gereklidir. Bu doğrultuda Ahmet Vefik Paşa’nın edebî eser çevirisinde takip ettiği yol, çeviri sorunlarına çözüm olarak teklif edilebilir. O, Fransızcadan dilimize aktardığı adaptasyonlarında kültürel sentez yaparak Türk – Fransız millî değerlerini ortak paydalarda birleştirmiştir.

  11. Öğretmen Adaylarının Yazılı Anlatım Öz Yeterliklerine İlişkin Ölçek Geliştirme Çalışması The Study Of Improving Scale On The Preservice Teachers’ Written Expression Self Efficacy

    Directory of Open Access Journals (Sweden)

    İ. Seçkin AYDIN -

    2013-09-01

    şır. Bu araştırmanın amacı öğretmen adaylarının yazılı anlatım öz yeterliklerini değerlendirecek bir ölçme aracı geliştirmektir. Araştırmalara göre bir konuya yönelik öz yeterlik inanışlarıyla o konuya yönelik başarı arasında anlamlı bir ilişki vardır.Araştırmanın evrenini Dokuz Eylül Üniversitesi Buca Eğitim Fakültesi öğretmen adayları, örneklemini ise aynı fakültedeki birinci ve sonuncu sınıfta öğrenim gören adaylar oluşturmaktadır. Örneklem seçiminde tabakalı tesadüfi örneklem yöntemi kullanılarak adaylara ulaşılmıştır. 67 maddeden oluşan ölçek; 418 kadın, 113 erkek toplam 601 birinci ve son sınıf düzeyindeki öğretmen adayına uygulanmıştır. Araştırmada verilerin analizi için SPSS 17.0 programı kullanılmıştır. Elde edilen verilerin çözümlenmesinde faktör analizi tekniklerinden temel bileşenler analizi kullanılmıştır. Faktör analizi sonucunda 54 maddeden oluşan ve toplam değişkenliğin %44.7’sini açıklayan üç faktör elde edilmiştir. Ölçeğin alt faktörlerde ve toplam puanda iç tutarlığa sahip olduğu saptanmıştır. Güvenirlik analizi; madde-toplam korelasyonu, alt ve üst %27'lik grupların farklarının ilişkisiz t-testi kullanılarak denenmesi, Spearman Brown iki yarı test korelasyonu ve Cronbach alfa iç tutarlılık katsayısı hesaplanması ile yapılmıştır. Ölçeğin geneli için alfa (α .96 bulunmuştur.Yazılı Anlatım Öz Yeterlik Ölçeği (YAÖYÖ olarak geliştirilen ölçeğin, öğretmen adaylarının öz yeterliklerini ölçmede kullanılabilecek, geçerli ve güvenilir bir araç olduğu belirlenmiştir.

  12. Le Prédicat Modo-Temporel À Valeur Épistémique En Turc (De L’intention À La Réalisation The Modo-Temporal Predicate With Epistemic Value In Turkish (From İntention To Realization

    Directory of Open Access Journals (Sweden)

    Selim YILMAZ

    2013-03-01

    şle, bu kipsellik olgusu, bir eylemin « gerçek(lik » ile ilişkisini ortaya koyar. Burada üzerinde durulacak olan epistemik yüklemler, Fransızcada « conditionnel » adı verilen ve “olasılık” bildiren yüklemlerin kipsel değer ve işlevleri bakımından Türkçe eşdeğerleridir. Bu bağlamda, sözceleme anında konuşan öznenin söylemsel niyetini bir varsayım kapsamında ifade ettiği sözceler ele alınacaktır. İki önermeli bileşik sözcelerde, epistemik yüklemlerin sözceleme ve olasılık değerleri, üretildikleri bağlamda yer alan kip/zaman eklerinin kullanımı açısından irdelenecektir. Türkçede epistemik yüklemlerin büyük bir bölümünde, birbiriyle uyumlu olmayan ama varsayımsal bir niyet ve ileti bildiren /-EcEk/ (gelecek zaman kipi veya /-Ir/ (geniş zaman kipi eklerinden birinin kullanıldığı görülecektir. Bunun için, dağılımsal ve işlevsel dilbilim yaklaşımı ile epistemik yüklemlerin bulunduğu sözceler biçimlerine göre sınıflandırılarak “varsayım/olasılık” ve “koşul” gibi kipsel değerler, biçim-anlam ilişkisi bakımından değerlendirilecektir. Çalışmanın temel amacı, epistemik yüklemlerin kip/zaman değerlerini belirlemekle birlikte, sözceleri yorumlarken morfoloji ve sözdizim açısından bu yüklemin Türkçede yapısal bir modelini araştırmaktır. Araştırma bütüncemiz, Türk Edebiyatının klasik eserleri arasında yer alan Yaşar Kemal’in bir romanı (Kuşlar da gitti, 1978 ile onun Münevver Andaç tarafından yapılan Fransızca çevirisidir (Alors, les oiseaux sont partis…1983.

  13. İzmir Millî Kütüphane’de Kayıtlı Bulunan (1467/14 Bir Mecmua-İ Eş’âr’ın Düşündürdükleri Thoughts On A Mecmua-i Eş’âr Registered In The İzmir National Library (1467/14

    Directory of Open Access Journals (Sweden)

    Yasemin ERTEK MORKOÇ

    2013-03-01

    ıkmaktadır. İlk bakışta çok küçük ama okunaklı ve temiz bir ta’lik yazı ve düzenli bir sayfa yapısı ile dikkati çeken bu yazma mecmuanın ilk sayfalarındaki çiçek tezyinatı da özenli bir elden çıktığı izlenimini uyandırmaktadır. Mecmuanın musannifinin adı ve tasnif tarihi belirtilmemiştir. Ancak mecmuaya seçilen şairler göz önüne alındığında bir dönem panoraması ile karşılaşılmaktadır. 15. yüzyılın ilk çeyreği ile 16. yüzyılın ilk çeyreği arasında aşağı yukarı bir asır içinde yetişmiş olan şairlerden bir seçki söz konusudur.Şiir mecmuasında merak uyandıran bir başka husus ise esere dahil edilen şairler arasındaki edebî etkileşim ağıdır. Birbirine nazire yazan veya aynı dönemde yaşayan, örnek aldığı şairle şiirleri arka arkaya sıralanan divan şairleri mecmuaya özellikle seçilmiş gibidir. Eser nazire mecmuası olmadığı halde birbirine nazire olan bir-iki şiirin bulunması seçme şiir mecmualarında da nazirelerin karşımıza çıkabileceği ihtimalini kuvvetlendirmektedir.Baştan eksik olan bu mecmuada toplam yirmi üç şiirden on dokuzunun kaside oluşu esere bir “mecmua-i kasaid” görüntüsü vermektedir. Seçme şiir mecmualarında sıklıkla rastladığımız gazel nazım biçimindeki şiirlerin bu seçkide tercih edilmemiş olması, eserin ayırıcı bir diğer özelliği olarak nitelendirilebilir.

  14. The Effect of Impurities on the Processing of Aluminum Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Zi-Kui Liu; Shengjun Zhang; Qingyou Han; Vinod Sikka

    2007-04-23

    For this Aluminum Industry of the Future (IOF) project, the effect of impurities on the processing of aluminum alloys was systematically investigated. The work was carried out as a collaborative effort between the Pennsylvania State University and Oak Ridge National Laboratory. Industrial support was provided by ALCOA and ThermoCalc, Inc. The achievements described below were made. A method that combines first-principles calculation and calculation of phase diagrams (CALPHAD) was used to develop the multicomponent database Al-Ca-K-Li-Mg-Na. This method was extensively used in this project for the development of a thermodynamic database. The first-principles approach provided some thermodynamic property data that are not available in the open literature. These calculated results were used in the thermodynamic modeling as experimental data. Some of the thermodynamic property data are difficult, if not impossible, to measure. The method developed and used in this project allows the estimation of these data for thermodynamic database development. The multicomponent database Al-Ca-K-Li-Mg-Na was developed. Elements such as Ca, Li, Na, and K are impurities that strongly affect the formability and corrosion behavior of aluminum alloys. However, these impurity elements are not included in the commercial aluminum alloy database. The process of thermodynamic modeling began from Al-Na, Ca-Li, Li-Na, K-Na, and Li-K sub-binary systems. Then ternary and higher systems were extrapolated because of the lack of experimental information. Databases for five binary alloy systems and two ternary systems were developed. Along with other existing binary and ternary databases, the full database of the multicomponent Al-Ca-K-Li-Mg-Na system was completed in this project. The methodology in integrating with commercial or other aluminum alloy databases can be developed. The mechanism of sodium-induced high-temperature embrittlement (HTE) of Al-Mg is now understood. Using the thermodynamic

  15. THE LOVE TEMA IN CAHİT SITKI’S POETRY AND ITS OBJECTS: ‘WOMEN’ CAHİT SITKI TARANCI’NIN ŞİİRLERİNDE AŞK/SEVGİ TEMİ VE BU TEMİN NESNESİ ‘KADINLAR’

    Directory of Open Access Journals (Sweden)

    Sema ÖZHER KOÇ

    2012-06-01

    karamsarlıklarından sıyrılarak ışıklı ve aydınlık bir duygu seline kapılır. Öyle ki onun bu coşkusuna tabiat bile baharın getirdiği dirilişle birlikte eşlik eder.Şairin ilk şiirlerinden itibaren bir sığınak olarak gördüğü aşk/sevgi temi, eşi Cavidan Hanım‟la tanışmasından itibaren durulur ki Cahit Sıtkı için sevgili, artık, ölümlü insani yanlarından sıyrılarak „melek‟leşir. Cahit Sıtkı, hiç beklenmeyen bir zamandaki ölümüyle bu „melek‟ sevgiliyi insanlığın soylu vicdanına armağan eder. Onun şiirleri okundukça insanoğlu, mutlak tükenişi karşısında sağlam bir dayanak bulacaktır.

  16. Muhammed Esed’de Dini Değişimin Psikolojik Analizi The Psychological Analysis Of Religious Conversion In Muhammad Asad

    Directory of Open Access Journals (Sweden)

    Saffet KARTOPU

    2013-07-01

    ğişimin incelendiği bu çalışmada öncelikle dini değişim kavramına, bu konuda yapılan çalışmalara ve dini değişim olgusunun Din Psikolojisindeki yerine değinilmiştir. Sonra Esed’in kısa yaşam öyküsüne yer verilmiş, Esed’deki dini değişim kuramsal bir yaklaşımla ele alınarak din değiştirmenin güdüleri, dini değişimde gelişimsel faktörler, dini değişimin evreleri ve din değiştirmenin motifleri incelenmiştir. Esed’deki dini değişim kendi eserleri temel alınarak Din Psikolojisinde kabul gören din değiştirme modelleri açısından analiz edilmiştir. Bu bağlamda Esed’de din değiştirmenin güdüleri Snow ve Phillips, Glock ve Gillespie’nin yaklaşımlarıyla değerlendirilirken dini değişimde gelişimsel faktörler Erikson’un düşünceleriyle ele alınmıştır. Dini değişimin evreleri ise Lofland ve Stark, Clark, Batson ve Ventis ve Köse’nin aşamalı sınıflamalarıyla değerlendirilmiştir. Din değiştirmenin motifleri analiz edilirken de Lofland ve Skonovd’un modelleri kullanılmıştır.Psikolojik faktörlerin, Esed’in dini değişimine etkisini değerlendirdiğimizde Esed’in ilk gençlik yıllarından itibaren anlama isteği ve zihinsel tatmin ihtiyacının belirgin olduğu görürüz. Esed içinde bulunduğu kültürün empoze ettiği temel noktaları yeniden gözden geçirme ihtiyacı içindedir. Toplumdaki ve kendi hayatındaki belirsizliklerden rahatsız olmuş hayatın evrensel anlamı ve neyin doğru, neyin yanlış olduğu sorularına cevaplar aramıştır. Bu arayışları neticesinde İslam’ı kabul ederek, bir aidiyet, kabul edilme duygusu ve kendisini köklü olarak yeniden düzenleme imkânı kazanmıştır. İslam’ı kabul etmekle bütün arayışlarının bittiğini, belli bir fikrî yörüngeye bağlı olmak ve bir kardeşler topluluğunun parçası olmak arzusuzunun gerçekleştiğini hissetmiştir.

  17. Attitude scale of individuals having mental disabilities towards sports activities (zebseytö: Validity and reliability studyZihinsel engelli bireylerin sportif etkinliklerine yönelik tutum ölçeği (zebseytö: Geçerlik ve güvenirlik çalışması

    Directory of Open Access Journals (Sweden)

    Ekrem Levent İlhan

    2016-02-01

    ıyla düzeltilmiş madde toplam test korelasyonu incelenmiş ve toplam puan üzerinden % 27’lik alt-üst grup karşılaştırmalarına yer verilmiştir. Ölçme aracının yapı geçerliğini sınamak için Açımlayıcı Faktör Analizi (AFA ve Doğrulayıcı Faktör Analizi (DFA uygulanmıştır. AFA sonucunda toplam varyansın % 60.988’ ini açıklayan, 28 madde ve iki alt boyuttan oluşan bir yapı elde edilmiştir. Ortaya çıkan bu yapının doğrulanması amacıyla gerçekleştirilen DFA sonucunda, yeterli uyum indekslerine ulaşılmıştır. Ölçme aracının güvenirliği, Cronbach Alfa iç tutarlık katsayısı ve test-tekrar test teknikleri ile incelenmiştir. Cronbach Alfa ve test-tekrar test analizleri, ölçme aracının yüksek düzeyde güvenilir olduğuna dair kanıt sağlamıştır. Bu bulgular ışığında, ZEBSEYTÖ’ nün geçerli ve güvenilir ölçümler yapabilen bir veri toplama aracı olduğu ve üniversite öğrencilerinin zihinsel engelli bireylerin sportif etkinliklerine yönelik tutumlarını ölçebilir nitelik taşıdığı söylenebilir.

  18. Abdülhak Şinasi Hisar’ın Tahkiyeli Eserlerinde “Tür” Meselesi “Genre” Problem In Abdülhak Şinasi Hisar’s Fictive Works

    Directory of Open Access Journals (Sweden)

    Özgür İLDEŞ

    2012-12-01

    şında (1941 yılında, kaleme almaya başlamıştır. Yaşadığı yıllardaki mutsuzluğunu çocukluk ve ilk gençlik yıllarında yaşadığı huzur dolu günleri yâd ederek telafi etmeye çalışan Hisar, tahkiyeli eserlerinin kurgusunu da o günlerdeki hayatına dayandırır. Hisar’ın tahkiyeli eserlerini vücuda getirirken başvurduğu bu yöneliş, onun eserlerinin türlerinin belirlenmesi problemini de beraberinde getirir. Hisar’ın kaleme aldığı Fahim Bey ve Biz (1941, Çamlıca’daki Eniştemiz (1944 ve Ali Nizami Beyin Alafrangalığı ve Şeyhliği (1952 adlı tahkiyeli eserleri, her ne kadar eleştirmenler tarafından roman olarak kabul edilse de, bu üç eserin isminin altında “hikâye” sözcüğü yer almaktadır. Ne var ki, eserleri okuduğumuzda, Hisar’ın aslında bu eserlerin olay örgüsünü geniş ölçüde “hatıra”larına dayanarak kurguladığını görmekteyiz. Bu makalenin yapısına baktığımızda, makalede önce Hisar’ın tahkiye anlayışı ele alınmaktadır. Daha sonra Hisar’ın söz konusu üç tahkiyeli eseri incelenerek, bu eserlerin “hatıra” türüne yakınlığını gösteren ifadeler dikkatlere sunulmakta ve bunlara dayanarak eserlerin türleri sorgulanmaktadır.

  19. Hayâlî Bey’in “Dünya” Algısı Hayâlî Bey’s “World” Perception

    Directory of Open Access Journals (Sweden)

    Nazmi ÖZEROL

    2012-12-01

    air, bazı sebeplerden dolayı o çevreden uzaklaşmışsa da şiirlerinde tasavvufî fikir ve heyecanları samimi bir edayla dile getirmeye devam etmiştir. Hayatı boyunca makam, mal mülk derdinde olmayan şair, tasavvufun da etkisiyle dünyaya karşı genellikle mesafeli bir duruş sergilemiştir.Bilindiği gibi tasavvufî düşüncede dünya, insanı Allah’tan uzaklaştıran ve gaflete düşüren her şey olarak ifade edilir. Tasavvufta dünya söz konusu edildiğinde onun ahirete nazaran daha az kıymet ifade ettiği söylenir. Bununla birlikte dünya, Allah’ın tecelli ettiği bir mekândır. Kâinat, sonsuz sayıda aynacıktan oluşan tek bir aynaya benzetilir ve her bir aynacıkta hepsi mutlak varlık olan Allah’tan yansıyan farklı görüntüler parlamaktadır.Hayâlî Bey Divanı’nda “dünya” göstergesinin ele alındığı bu çalışmada çeşitli düşüncelerle“dünya” ile ilgili benzetme ilgisi kurulan, ilişkilendirilen kavramlar tespit edilmiş ve şairin dünya algısı ortaya konmaya çalışılmıştır. Hayâlî Bey, şiirlerinde daha çok dünyanın alçaklık, kötülük ifade eden anlamları üzerine yoğunlaşmış, dünyaya bağlanmanın neden olacağı kötü sonuçlardan bahsetmiştir. Elbette ki bu olumsuz bakış açısının yanı sıra şairin, dünyayı Allah’ın varlığını ispat eden ve yaratılan her şeyi yaratıcının işareti olarak gördüğü, sevgilinin veya övülenin bazı hallerini anlatmak için genişlik ve güzellik bağlamında ele aldığı beyitler de mevcuttur.

  20. Ali Canip Yöntem’in Sanata ve Edebiyata Bakışı Ali Canip Yöntem’s Perspective to Art and Literature

    Directory of Open Access Journals (Sweden)

    Abdullah HARMANCI

    2012-09-01

    izgide geniş bir arayış içinde olan yazar, yazdığı çok sayıdaki makalesinde, gerek dönemindeki Türk edebiyatına, gerekse klasik edebiyatımıza ve Batı edebiyatına hakimiyetiyle, günümüz sanatçı ve araştırmacılarına ışık tutacak derinlikli düşüncelere sahiptir. Makalemizde; söz konusu yazılarından hareketle, Yöntem’in; sanat ve edebiyatın ne olduğu, ne için var olduğu, gücünün ve etkisinin ne olabileceği, sanat ve edebiyattan nasıl yararlanılabileceği, sanatta taklit, haz, güzellik, sezgi, deha kavramlarının yeri ve önemi, sanatın gayesi, sanatçı – sanat mektebi ilişkisi, sanat ve diyalektik, şiir ve bilgi, şiir ve duygu gibi meselelerdeki görüşleri taranarak, bu düşünceleri bütünlüklü bir biçimde değerlendirilmeye çalışılmıştır. Bunların dışında, milli edebiyat kavramının gerçekte ne olduğu ve nasıl anlaşılması gerektiği, bizde “milli”lik kavramı değerlendirilirken yapılan hatalar, milli edebiyat bağlamında değerlendirildiğinde sanatçı – halk ilişkisinin boyutları gibi başlıklarda toplanabilecek problemler de Ali Canip Yöntem’in makalelerine konu olmuş ve tarafımızdan, yazarın bu meselelerdeki görüşleri incelenmeye çalışılmıştır. Yöntem, ayrıca, edebi eleştirinin sınırları ve eleştirmenin sahip olması gereken nitelikleri sorunlarına da değinmiş, edebi eleştirinin edebi metinle olan ilişkisini önemsemiştir.

  1. Sezai Karakoç'un Şiirlerinde Halk Bilimi Unsurları Folklore Elements in Sezai Karakoç's Poetry

    Directory of Open Access Journals (Sweden)

    Ayşe A.DİNÇ

    2013-07-01

    niversite yıllarına kadar duru bir Anadolu kültürü içinde yetişmiştir. Çocukluk ve gençlik yıllarını Ergani, Maden, Dicle, Kahraman Maraş, Gaziantep gibi çeşitli şehir ve kasabalarda yaşarken buralarda halkın yaşayışını, gelenek ve göreneklerini yakından gözlemlemek imkanı bulur. Bu nedenle Karakoç’un şiirini halktan ve halk kültüründen ayrı düşünmek mümkün değildir. O, yaşadığı bu yerlerde şahitlik ettiği halka ait gelenek, görenek ve adetlere şiirinde yer verir. Ancak onun şiirinde yer alan dışa ait bu gerçeklikler realitede olduğu gibi yer almazlar, şairin dimağında başkalaşırlar yepyeni imajlar halinde şiire girerler. Dışa ait bir gerçekliği hiçbir değişikliğe giymeden aynen almak Karakoç’a göre sanatın ″sıfır noktası″dır. O dışa ait gerçekliği adeta suda haşlar, ölü hale getirir ve sonra onu ″dikkat edilmesi istenen noktaları belirtme, bazı noktaları gölgeleme, fona ebedilik levhası yerleştirme, modelin yüzünde tutkularımızın, kaderlerimizin soluğunu gezdirme″ gibi maksatlarla soyutlar. Soyutlama Karakoç’un şiirinin temel ilkelerinden biridir. Ancak şiire giren bu imajlar yalnızca Karakoç’un şiirinin halk kültürüyle iç içe oluşunu göstermez. Şüphesiz onun şiirinin matrisi ″diriliştir″ ve o geleneksel hayatın modern hayatla mücadelesini diriliş meselesi etrafında ele almıştır. Sezai Karakoç’un şiirlerini bu çerçevede okumak onun şiirinin anlaşılmasını kolaylaştıracaktır.Bu çalışmada Sezai Karakoç’un şiirlerinde tespit edilen halk bilimi unsurları sınıflandırılmış ve bu unsurlar şiirde yer alış biçimleri, şiirin iç realitesi etrafında oluşan anlam dünyası açısından incelenmiştir.

  2. “YOLDA CAFERİ” OLMANIN SOSYOLOJİK ANLAMI: ALEVİLİK CAFERİLİK İLİŞKİSİ SOCIOLOGICAL MEANING OF BEING “JAAFARİ ON THE PATH” RELATIONSHIP BETWEEN ALAWISM AND JAAFARISM

    Directory of Open Access Journals (Sweden)

    Özcan GÜNGÖR

    2012-12-01

    Full Text Available The existence of Alevism maintains new adopting and synthesis approaches since the beginning of Turkish Islamization process. Since Alevism is a syncretic religious group, it is influenced by the territory (living area in the historical process, culture, tradition and the beliefs of the cultural luggage. Alevism is affected by the Jaafarism which is one of the religious groups in the Islamic history. Anotolian Alevis have specific belief structures in their own roots. This embodiment includesthe differentiating features with Shiism and also Sunnism. Thesequalities evolved as a result of the historical and social conditions overan extensive period of time. When we look at the details of this process,there are several different points of view regarding the relationshipbetween Alevism and Jaafarism. In our study, we have discovered sixdifferent perspectives from sources of sociological studies, historicaldocuments and ideas from certain Alevi writers regarding therelationships between Alevism and Jaafarism. We will discuss the topicin our paper from these points; a traditional Sufi (mystical Alevism, burban/secularist Alevism, c Hanafi Bektashism/Alevism, d syncreticAlevism, e Jaafari Alevism and f objector Alevism. We determined thattraditional Sufi (mystical Alevi path, Hanafi Alevi line and syncreticAlevism will take on a serious role in the discussions of the nature ofAlevism in the future from these perspectives on the relationshipbetween Alevism and Jaafarism. Although other considerations willcontinue to arise within Alevism, they will remain marginal. Alevîlik, senkretik yapısı gereği tarihsel süreçte yaşadığı bölge, kültür ve gelenekler itibarıyla ortaya çıkmış ve Aleviliğin günümüzdeki yapısı bu coğrafya ve gelenekten elbette etkilenmiştir; bunun yanında kültürel bagajında saklı tuttuğu inançları yeni bir sentezle Türklerin İslâmlaşma sürecinden itibaren kendisine uyarlayarak varlığını devam

  3. The Effect of Impurities on the Processing of Aluminum Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Zi-Kui Liu; Shengjun Zhang; Qingyou Han; Vinod Sikka

    2007-04-23

    For this Aluminum Industry of the Future (IOF) project, the effect of impurities on the processing of aluminum alloys was systematically investigated. The work was carried out as a collaborative effort between the Pennsylvania State University and Oak Ridge National Laboratory. Industrial support was provided by ALCOA and ThermoCalc, Inc. The achievements described below were made. A method that combines first-principles calculation and calculation of phase diagrams (CALPHAD) was used to develop the multicomponent database Al-Ca-K-Li-Mg-Na. This method was extensively used in this project for the development of a thermodynamic database. The first-principles approach provided some thermodynamic property data that are not available in the open literature. These calculated results were used in the thermodynamic modeling as experimental data. Some of the thermodynamic property data are difficult, if not impossible, to measure. The method developed and used in this project allows the estimation of these data for thermodynamic database development. The multicomponent database Al-Ca-K-Li-Mg-Na was developed. Elements such as Ca, Li, Na, and K are impurities that strongly affect the formability and corrosion behavior of aluminum alloys. However, these impurity elements are not included in the commercial aluminum alloy database. The process of thermodynamic modeling began from Al-Na, Ca-Li, Li-Na, K-Na, and Li-K sub-binary systems. Then ternary and higher systems were extrapolated because of the lack of experimental information. Databases for five binary alloy systems and two ternary systems were developed. Along with other existing binary and ternary databases, the full database of the multicomponent Al-Ca-K-Li-Mg-Na system was completed in this project. The methodology in integrating with commercial or other aluminum alloy databases can be developed. The mechanism of sodium-induced high-temperature embrittlement (HTE) of Al-Mg is now understood. Using the thermodynamic

  4. Atatürk Dönemi’nde Türkiye Cumhuriyeti’nin Ulaşım Politikasına Genel Bir Bakış A General Overview Of The Transportation Polıcy Of The Turkish Republic In The Atatürk Era

    Directory of Open Access Journals (Sweden)

    Filiz ÇOLAK

    2013-03-01

    ştırma sistemi ve bu sisteminürettiği hizmetler ülkelerin gelişmişlik düzeylerini belirleyen önemli birgöstergedir. Çünkü ulaştırma sistemi insanların ihtiyaçlarınınkarşılanmasını sağladığı gibi, üretimden tüketime kadar diğer ekonomikfaaliyetlerin işleyişini, bazı hallerde vücut bulmasını büyük orandaetkilemektedir.Türkiye Cumhuriyeti kuruluşundan itibaren, en sıkıntılı ve yoklukdönemlerinde bile, ulaşım sistemini geliştirmeye özel bir önemvermiştir. Osmanlı Devleti’nden miktar bakımından çok yetersiz, kalitebakımından da çok geri bir ulaşım sistemi devralınmıştır. Ülkenin eksikve yetersiz olan ulaşım şebekesi, uzun süren savaşların getirdiğiyıpranma bozulmaya karşı koyamamıştır. Ayrıca, İmparatorluğun,büyük fedakarlıklara katlanarak inşa ettirdiği demiryolları vekarayollarının büyük bir kısmı, önce Balkan Savaşları sonra da I.Dünya Savaşı yenilgilerinde kaybedilen topraklarda kalmıştır.Türkiye Cumhuriyeti’nin ulaşım politikasında öncelik demiryolusiyasetinin olmuştur. Çünkü İmparatorluk döneminde Anadolu veRumeli’de bulunan demiryollarının yapım ve işletmesinde yabancıyatırımcılar etkili olmuştur. Bu nedenle milli bir devlet amaçlayanCumhuriyetin kurucularının öncelikli hedefi yabancı işletmelerinelindeki demiryolları devletleştirmek ve ardından yeni hatlar açmakolmuştur. Şüphesiz ki, Türkiye’nin ulaşım politikasını sadecedemiryolu oluşturmamaktadır. Elindeki kısıtlı imkânlarla öncelikledemiryolu politikası ile birlikte karayolları, denizyolları ve havayolları dageliştirilmeye çalışılmıştır. Bu çalışmada, Atatürk döneminde bualanlarda yapılan faaliyetler değerlendirilmiştir.

  5. Tanzimat Hareketleri Karşısında Aşık Seyrani Ashik Seyrânî Against Tanzimat (Reform Movements

    Directory of Open Access Journals (Sweden)

    Eyüp AKMAN

    2012-09-01

    ılları arasında yaşamıştır. Aslen Kayseri Develilidir. Hayatı boyunca üç padişah dönemi görmüştür. Bunlar III. Selim, II. Mahmut ve Abdülmecit dönemleridir. Özellikle son iki padişah dönemi, gençlik ve olgunluk dönemine rastlar. Seyrânî, II. Mahmut döneminde hız kazanan, Abdülmecit döneminde Tanzimat ve Islahat fermanlarıyla resmiyet kazanan yenileşme ve batılılaşama hareketlerine karşı halkın duygularına tercüman olmuş, toplumda gördüğü sosyal aksaklıkları ve çarpıklıkları padişahtan bile çekinmeden pervasızca dile getirmiştir. Seyrani, klasik edebiyatta hiciv, halk edebiyatında taşlama adını alan türde oldukça başarılıdır. Bu durum biraz da onun mizacıyla alakalıdır. İstanbul’a mesleğini icra etmek için gelen Seyrani, devrin her aşığı gibi saray aşıklarının arasına katılmayı arzu etmiştir. Fakat bu arzusu gerçekleşmemiştir. Bundan dolayı olsa gerek saray erkanını özellikle sadrazamları keskin bir dille hicvetmiştir. Seyrani’nin saraya karşı bu kadar sert tavır almasına başka bir sebep olarak da Yeniçeri teşkilatının kaldırılmasını gösterebiliriz. Bektaşiliğe meyilli olan Seyrani de diğer Bektaşi şairleri gibi bu teşkilatın kaldırılmasını kabullenememiş bundan dolayı saraya menfi tavır almıştır. Seyrani’nin şiirlerinde on dokuzuncu yüzyılın sosyal, ekonomik hayatını bulmak mümkündür. Özellikle Tanzimat ve Islahat hareketleri neticesinde ülkenin düştüğü durum, saray tarafından lüzumu olmaksızın yapılan sınırsız harcamalar, halkın yeniliklere ayak uyduramaması, bizzat padişahların bir batılı gibi davranması, kadıların rüşvet alarak adalet mekanizmasının çökmesi onun şiirlerinde hicvedilmiştir. Bu araştırmamızda Tanzimat hareketleri ve bunların halka nasıl yansıdığı Seyrânî’nin şiirlerinden hareketle anlatılacak ve dönem hakkında bazı değerlendirmelerde bulunulacaktır.

  6. Almaatada 1986 Aralık Olayları:Jeltoksan 1986 December Events In Almaty: Jeltoksan

    Directory of Open Access Journals (Sweden)

    Füsun KARA

    2012-12-01

    Türkleri, bağımsız yaşamak için çok büyük bedel ödemek zorunda kalmışlardır. Kazakların tarihinde Kalmuk ve Rusların saldırı ve işgalleri büyük yer tutmaktadır. Büyük güçlerin güdümüne giren ihtiraslı Kazak hanlarının isyan ve saldırıları da Kazakları çok uğraştırmıştır. Kazakların ordalara/cüzlere bölünmeleri veya diğer Türk tayfaları ile çekişmeye, didişmeye girmeleri her defasında hasım güçlerin istilasını getirmiştir.1986 Aralık ayaklanması ya da Jeltoksan, Mihail Gorbaçev’in Kazakistan Komünist Partisi Birinci Sekreteri Dinmuhamed Konayevi görevinden alarak onun yerine dışarıdan Rusya Sovyet Federatif Cumhuriyetinden Gennady Kolbin’i atamasıyla 17 Aralık 1986 sabahında ayaklanma başladı. Gösterilerin başlangıcında Merkezi Komite Binası önünde 200-300 öğrenci toplandı. 18 Aralıkta KGB orduları gösteriyi dağıttılar. 2000 den fazla insan yakalanarak tutuklandı, yüzlerce insan yaralandı ve en az 3 kişi öldürüldü. Almaata’da gerçekleşen gösteriler diğer Kazak şehirlerinde Sovyetlerin federal yapısını zayıflatacak ve sosyal yapıyı sarsacak ilk büyük patlama idi. Protestoların ardından Sovyetlerin kardeşlik ve birliktelik üzerine inşa edildiğine dair efsane birkaç yıl içinde paramparça olacaktı. 20. yüzyılın son çeyreğinde bütün Kazak halkının Sovyet hâkimiyetindeki diğer halklarla birlikte bağımsızlık mücadelesi başlatmaları ve başarıya ulaşmaları asırlardır ödenen bedellerin semeresidir denilebilir. Kazakların son yüzyıllık tarihi okunduğunda kahraman geçmişleri ortaya çıkacaktır. Bu makalede bu milli ve bölgesel ayaklanmanın neden ve sonucu anlatılmıştır.

  7. Algılanan Genel Öğrenci Nitelikleri Ölçeğinin Geçerlilik Güvenirlilik Çalışması Validity And Reliability Study Of Perceived General Student Quality Scale

    Directory of Open Access Journals (Sweden)

    Durdağı AKAN

    2013-09-01

    dair genel algısını ortaya çıkaran bir ölçme aracı geliştirerek, konuyla ilgili yapılacak çalışmalara hem bir zemin hazırlamak, hem de ilgili literatüre katkı sağlamaktır. Ölçeğin geliştirilmesinde likert tipi ölçek geliştirme yöntemi kullanılmıştır. 40 maddeden oluşan ölçek deneme uygulamasında liselerde görev yapan 50 kişilik bir öğretmen gurubuna, asıl uygulamada ise yine liselerde görev yapan 300 kişilik bir öğretmen gurubuna uygulanmıştır. Psikometrik ölçümleri beklentileri karşılayan ve tek boyuttan oluşan ölçeğin toplam varyansa yaptığı katkı % 41.791’dir. Ölçeğin p<0.01 önem düzeyinde olmak üzere madde toplam puan korelasyonlarının ,387 ile ,742 arasında değiştiği, ölçeğin toplam puanlarına göre oluşturulan alt üst %27’lik grupların madde ortalama puanları arasındaki farkların p<0,001 önem düzeyinde anlamlı olduğu görülmüştür. Algılanan Genel Öğrenci Nitelikleri Ölçeği’nin cronbach-alfa güvenirlik katsayısı ,959 iki yarı test güvenirliği katsayısı ,916 olarak bulunmuştur.

  8. Sınıf II kavitelerdekiüç farklı adeziv sistemin mikrosızıntılarının sem ile in vitro olarak incelenmesi

    Directory of Open Access Journals (Sweden)

    Ertugrul Ercan

    2011-10-01

    zıntılarının karşılaştırmalı olarak incelemektir.

    Gereç ve yöntem: Bu çalışmada çürüksüz 45 adet insan üst çene küçük azı dişi kullanıldı. Dişlerin mezial yüzeylerinde birer adet standart Sınıf II kavite açıldı. Sonra dişler her grupta 15 diş olacak şekilde rastgele 3 gruba ayrıldı. Grup 1: Prime&Bond NT (Dentsply DeTrey, Konstanz, Germany ve Quixfill (Dentsply DeTrey, Konstanz, Germany, Grup 2: Xeno V (Dentsply DeTrey, Konstanz, Germany ve Quixfill ile restore edildi, Grup 3: G Bond ve Gradia Direct (GC-Fuji, Tokyo, Japan uygulandı. Tüm restorasyonlar üretici firmaların önerileri doğrultusunda tabakalama yöntemi ile yerleştirildi ve LED (Elipar Freelight II,3M-ESPE, Germany ışık kaynağı kullanılarak polimerize edildi. Örnekler etüvde 370C de 24 saat distile su içerisinde bekletildi. 30 saniye kalacak şekilde 5 ve 55°C termal siklus işlemi 10000 kez uygulandı. Bütün dişler 24 saat % 0.5’lik metilen mavisi içerisinde bekletildi. Dişler mesio-distal yönde kesildi, stereo mikroskop altında oklüzal ve gingival duvarlar 0 ile 4 arasındaki skorlar ile değerlendirildi. Elde edilen veriler Kruskal Wallis ve Mann Whitney testleri ile değerlendirildi.

    Bulgular: Oklüzal mikro sızıntının değerlendirilmesinde gruplar arasında istatistiksel anlamlılık bulundu (P<0.05. Grup 1 (Prime&Bond NT de daha düşük mikro sızıntı skorları tespit edildi. Grup 2 (Xeno V ve Grup 3 (G Bond birbirleriyle kıyaslandığında oklüzal ve gingival değerler arasında farklılık bulunmadı (p>0.05. Gingival de ise üç grup arasında istatistiksel anlamlılık bulunmadı (p>0.05.

    Sonuç: Uygulanan adezivlerin karşılaştırılmasında; oklüzal ve gingival de total etch (Prime&Bond NT adeziv sistem mikro sızıntıyı azaltmada diğer iki self etching (Xeno V, G Bond adeziv sistemden daha başarılı bulunmuştur.

  9. Erken Cumhuriyet Yılları Milli Kimlik Tartışmaları: Hasan Ali Yücel ve Türkiye’de Hümanizma Arayışları Discussions on National Identity in the Early Republican Years: Hasan Ali Yucel and Searching for Turkish Humanism

    Directory of Open Access Journals (Sweden)

    Emre YILDIRIM

    2013-09-01

    hümanizma arayışını ve bu arayış çerçevesinde Hasan Ali Yücel’in Milli Eğitim Bakanlığı (1938-1946 döneminde yaşanan hümanist reform girişimlerini incelemektedir. Avrupa’daki toplumsal-tarihsel değişimin ardından yaşanan Fransız İhtilali’nin yaydığı eşitlik, özgürlük ve kardeşlik fikirleri, kıtanın tamamını etkileyen milliyetçi hareketleri doğurmuştu. Bu hareketler, çok kültürlü, çok milletli imparatorluk yapılarının sonunu hazırlayarak ulus-devletleri ortaya çıkarmıştı. Avrupa’daki gelişmelere paralel olarak Osmanlı İmparatorluğu da benzer bir süreci yaşamış; imparatorluğun dağılmasının ardından ulus-devlet olarak Türkiye Cumhuriyeti kurulmuştu. Bu süreçte, Osmanlı’dan Türkiye Cumhuriyeti’ne yapısal dönüşümün milliyetçilik ve kimlik açısından tartışmalarında ise modernleşme süreciyle başlayarak Osmanlıcılık, İslamcılık ve Türkçülük olmak üzere üç temel ideoloji savunulmuş; ulus-devletin kurulmasıyla birlikte Batılı seküler modern kimlik bağlamında Türk milliyetçiliği resmi ideoloji olarak benimsenmişti. Fakat bu kimliğin içeriği konusunda tartışmalar sürdürülmekteydi. Bu süreçte düşüncelerini dile getiren küçük bir grup entelektüel, siyaset sahnesinden Hasan Ali Yücel ve arkadaşları, modern Türk kimliğini, hümanizmin gerçek kaynağı olarak gördükleri Anadolu hümanizmine bağlı olarak tanımlarken; bu kimliğin Türk Rönesansı ile gerçekleştirilebileceğini savunmuşlar ve Türkiye’ye özgü bir hümanizma anlayışı ile Anadolu’ya özgü bir kimliğin yaratılabileceğini savlayarak milli kimliğin içeriğine dair tartışmalara katkıda bulunmuşlardır.

  10. Acute effects of differing duration of static stretching on speed performance Farklı sürelerde uygulanan statik germenin sürat performansına akut etkisi

    Directory of Open Access Journals (Sweden)

    Suat Yıldız

    2013-04-01

    (kontrol-hiç germe olmadan yöntemlerinden oluşmaktaydı. Sporcular her protokolden sonra 20 m sürat testini gerçekleştirmişlerdir. Isınma yöntemleri tekrarlı ölçümlerde ANOVA ve post-hoc yöntemleri ile karşılaştırılmıştır. Bulgular: Sürat performansları açısından KU protokolü ile SG15 protokolü arasında % 5.1’ lik fark (p<0.001, KU protokolü ile SG30 protokolü arasında % 6.6’ lık fark (p<0.001 ve KU protokolü ile SG45 protokolü arasında % 10.9’ luk fark (p<0.001 anlamlı bulunmuştur. Ayrıca SG15 protokolü ile SG45 protokolü arasında anlamlı fark (p<0.032 bulunmuştur. Sonuç: Bu araştırmanın sonuçları, alt ekstremiteye yönelik uygulanan statik germe uygulamalarının sporcuların sürat performanslarını düşürdüğünü göstermektedir. Statik germenin süresi arttıkça sürat performansının düştüğü gözlenmiştir. Bu sonuçlar statik germe uygulamalarının, sporcuları yüksek güç üretimi gerektiren aktivitelere (sürat gibi hazırlamak için yetersiz kaldıklarını göstermektedir.  

  11. Building mixed effect models of stand biomass for Simao pine (Pinus kesiya var. langbianensis) natural forest%思茅松天然林林分生物量混合效应模型构建

    Institute of Scientific and Technical Information of China (English)

    欧光龙; 胥辉; 王俊峰; 肖义发; 陈科屹; 郑海妹

    2015-01-01

    using technology of mixed effects models, and analyzed the variance and covariance structures of the models. Finally, based on the basic mixed effects models of the components, We constructed the mixed effects models including fixed effects from three types of environmental factors (including stand, topographic and climate factors) respectively. The models were evaluated by fitting and independence test indices. The fitting indices include logLik, Akaike information criterion ( AIC ) and Bayesian information criterion ( BIC) , and the test indices include sum relative error ( SRE) , mean relative error ( MRE) , absolute mean relative error ( AMRE) and prediction precision ( p) . The results showed:(1) For the models fitting, the mixed model considering random effect of regional effect were significantly better than the ordinary models, and the mixed models including the fixed effect of environmental factors were better than the ordinary mixed models. Among the models including the fixed effects form three types of environmental factors, the models including topographic factors were the best models because of the lowest values for AIC and BIC. (2) For the independence test of models, except for the mixed models of stand root biomass including the fixed effects of topographic factors, the other mixed models were better than the ordinary models. Compared the mixed models including the fixed effect of environmental factors and the ordinary mixed models, the performance were different for three components, but for each component the differences among the models were small. (3) The best model for root biomass of stand was the mixed effects models only considering the random effect of regional effect, but for the other components ( including aboveground biomass and the total biomass of stand) , the best models were both the mixed effects models including the fixed effects of topographic factors and random effect of regional effect.

  12. Ekonomik Büyüme ve Çevresel Vergilerin Emisyon Miktarına Etkileri / The Effect of Economic Growth and Environmental Taxes On Quantity of Emissions

    Directory of Open Access Journals (Sweden)

    Hakan Akar

    2012-12-01

    Full Text Available Bu çalışmada, daha müreffeh bir hayat yaşama gayesiyle gerçekleştirilen sınırsız üretim ve tüketim faaliyetlerinin, çevre tahribatı yoluyla tam aksi yönde etki yapıp yapmadığı incelenmeye çalışılmıştır. Çalışmanın temel amacı, üretim ve tüketim faaliyetlerinin çevreye zarar vermesi durumunda, çevresel vergilerin bu tahribatı azaltmada etkili bir çözüm olup olamayacağı hakkında çıkarımda bulunmaktır. Çalışmanın problemi genelde çevresel bozulma, özelde de emisyondur. Öncelikle çevre ekonomisi başlığı altında çevre ile ekonomi arasındaki ilişki ortaya konulmaya çalışılmış, sonrasında analizimize hazırlık olması mahiyetinde emisyon, çevresel vergiler, GSYİH, kişi başına düşen milli gelir hakkında bilgi verilmiştir. İktisadi büyüme süreciyle çevresel bozulma arasındaki etkileşimi açıklarken Çevresel Kuznets Eğrisi (ÇKE ve Kirlilik Sığınağı Hipotezi veya Kirlilik Cenneti’nden faydalanılmıştır. Türkiye’nin de ÇKE ile uyumlu olduğu ve milli geliri reel olarak 4090 dolardan sonra çevreye verilen zararların azalacağı tespit edilmiştir. Ayrıca milli gelir hesaplamalarında da çevresel maliyetlerin hesaba katılması zaruretine değinilmiştir. Çevresel bozulmayla çevre vergileri arasındaki ilişki de çevresel vergi gelirlerinin toplam vergi gelirlerine oranlanarak ortaya konmaya çalışılmıştır. Nitel analizlerimize temel teşkil edecek veriler Avrupa Çevre Ajansı, Avrupa Komisyonu ve Dünya Bankası’nın internet sitelerinden elde edilmiş, AB ve OECD ülkelerinin iktisadi büyüme, çevresel vergi ve emisyon hacimlerine ilişkin veriler arasındaki ilişki gözlemlenmeye çalışılmıştır. Buna göre; iktisadi büyüme, farklı gelişmişlik düzeylerine göre ülkeden ülkeye farklı çevre tahribatı sonuçları vermektedir. Çevresel vergilerin etkin bir şekilde vergi sistemlerinde bulunan ülkelerde ise, emisyon

  13. Flavour alignment in physics beyond the standard model

    Energy Technology Data Exchange (ETDEWEB)

    Braeuninger, Carolin Barbara

    2012-11-21

    neutral processes. Since the wave function profiles are a function of the eigenvalues of the vector-lik

  14. STUDY OF DEVELOPING EFFECTIVE SPEECH SCALE ETKİLİ KONUŞMA ÖLÇEĞİ: BİR ÖLÇEK GELİŞTİRME ÇALIŞMASI

    Directory of Open Access Journals (Sweden)

    Derya ÇİNTAŞ YILDIZ

    2012-06-01

    rneklemini 2010-2011 eğitim-öğretim yılında Selçuk Üniversitesinde öğretmenlik formasyon eğitimi alan 342 öğrenci oluşturmaktadır. Örneklemde yer alan öğrencilerin 230’u kız, 112’si erkektir. Öğrencilerden bir önceki derslerine giren öğretim elemanının konuşmasını değerlendirmeleri istenmiştir. Ölçek maddeleri araştırmacılar tarafından ilgili alan yazını taranarak ve uzman görüşlerine başvurularak hazırlanmıştır. 111 maddeden oluşan ölçeğin ilk hali, uzman görüşleri ve gerçekleştirilen geçerlik-güvenirlik analizleri sonucunda 24 maddeye indirilmiştir. Maddelerin 20’si olumlu, 4’ü olumsuz yargı içermektedir. Ölçeğin olumsuz yargı içeren maddeleri ters puanlanmaktadır.Ölçeğin geçerliğini sağlamak amacıyla açımlayıcı ve doğrulayıcı faktör analizleri yapılmıştır. Ölçeğin güvenirliği ise Cronbach α, Spearman Brown, Gutmann Split- Half teknikleri, düzeltilmiş madde toplam korelasyonları ve %27'lik alt-üst grup farkına ilişkin t değerleri hesaplanarak sağlanmıştır. Bu işlemlerden sonra ölçeğin geçerli ve güvenilir olduğu sonucuna varılmıştır.

  15. Siirt Halk Kültürünün Şifa Dağıtıcıları: Kutsal Sular Healing Distributors of Siirt Folk Culture: Holy Waters

    Directory of Open Access Journals (Sweden)

    Rezan KARAKAŞ

    2012-12-01

    ınlarında yer almakta; bir şeyhe yahut din büyüğüne yönelik anlatılarla kutsiyet kazanmaktadır. “Yeşil su” adı verilen şifalı suyla ilgili anlatı, bir din âlimi olan İsmail Fakirullah’ın dinî kişiliği etrafında şekillenirken, Şeyh Arap Ziyareti’nde yararlanılan su ise “şeyh”lik mertebesindeki bir zatla anılmaktadır. “Tuzlu su” anlatısında ise suya kutsallık kazandıran bir kadın evliyadan bahsedilmektedir.Şeyhü’l Hazin, Şeyh Halef, Şeyhü’s Sibre, Şeyhü’l Horani, Şeyh Cerrah, Şeyh Termo ve Şeyh Münkedir türbelerindeki kuyuların suları, gerek içilerek gerekse banyo yapılarak, çeşitli hastalıkların tedavi edilmesinde kullanılmaktadır. Türbe veya camide bulunan kuyu suyu ile yıkanma ritüeli, ilk kozmik eylemin tekrarından başka bir şey değildir. Bu sularla banyo yapmak veya o sulara temas etmek, onları içmek insanoğlunun suyla buluşmasını sağlayacak ve insanoğlu adeta yeniden doğacak veya doğuracaktır. Siirt halk kültüründe tespit ettiğimiz “su”ya dayalı ritüeller, İslamî bir kisveye bürünmüş ve eren kültüyle birleşerek işlevselliğini sürdürmüştür.Birçok mitolojik sistemde evrenin yaratılışında başrolü üstlenen, doğuşun ve yaşamın simgesi olan su, Siirt yöresi halk kültüründe başta çocuk sahibi olmak ve hastalıklardan kurtulmak olmak üzere hemen her derdin devası olarak görülmekte, yukarıda adı geçen türbeler, şifa arayıcıların uğrak yeri olmaya devam etmektedir.

  16. Nef’i’nin Kasidelerinde Mübalağa Sanatındaki Ayrıntılar Details of the Hypperbolısm in the Odes of Nef’i

    Directory of Open Access Journals (Sweden)

    Ali BALALAN

    2012-09-01

    çık kapı bırakmıştır. Bu çalışmada Nef’î’nin kasidelerinde mübalağa sanatının olduğu beyitler taranmış, padişaha övgü bölümünde; padişahın kadrinin yüceliği, şan ve ihtişam sahibi olması dile getiriliyor. At sevgisi bölümünde, ata duyulan sevgi kuru bir sevda değildir. Onu imgesel boyutta kullanarak ata farklı çağrışımlar yükler. Hiciv de ise övdüğü kişileri nasıl göklere çıkarıyorsa eleştirdiği kişileri de yerin dibine batırıyor. Kozmik âlem şairde doğrudan söyleyemediklerini dolaylı yoldan söyleme fırsatı verir. Söz ve mana konusuna gelince Nef’i’nin kasidelerinde hakikatler katman katmandır. Sözlerinin tam anlaşılması için bu katmanların aralanması gerekir. Kendisi de sözlerini gizli saklı tutulan bir mecmuaya benzetmektedir. Bu da onun eserlerinin ne kadar değerli olduğunu göstermektedir. İncelediğimiz bu kasidelerdeki beyitlerde Nef’i, sözden ziyade mana üzerinde durmaktadır. Şair bazen kendini mana denizinde inci arayan bir dalgıç olarak görüyor. Büyüklük, genişlik, sonsuzluk anlamlarını taşıyan deniz aslında şairin gönlü ve şiir düşünme yeteneği olan zekâsıdır. Şair, mübalağa sanatını kullanırken, hayal dünyasının derinliklerinde gezinmiştir. Okuyucuyu taşkınlığa sürükleyerek, bu kadar da olmaz dedirttikten sonra beytin arka planındaki hakikatleri açıklamış en olmayacak şeyleri olağan gibi göstermiştir. Mübalağa sanatını kullanma becerisi de bundan kaynaklanmaktadır.

  17. /ı/ Türkçede Bir Anasesbirim midir? Is The Letter of /ı/ Archiphoneme In Turkish?

    Directory of Open Access Journals (Sweden)

    Fatih ÖZEK

    2013-03-01

    öre genel Türkçedeki sekiz ünlü, bu ünlülerden gelişmiştir. Ancak A.N. Baskakov, /ı/ ‘nın ana bir sesbirim olduğu, [i,u,ü] ünlerinin /ı/ sesbiriminin değişkenleri olduğu görüşündedir. Bu farklı görüş makalenin yazılmasında etkili olmuştur. Anasesbirimi, bünyesinde birden fazla sesin özelliklerini barındıran anases veya bir dilin bilinen ilk sesleri olarak tanımlamak mümkündür. Anasesbirimler, güçlü seslerdir. Çoğunlukla varlıklarını korurlar. Ancak bu özellikler /ı/ sesbiriminde görülmemektedir. Buna delil olarak aşağıdaki tespitleri sayılabilir:1. Codex Cumanicus’taki qlıç (~ qılıç [cliç, cliz/kiliç] yazılışları,2. /ı/ ünlüsünün söz başında ön damaksıllaşması (Uyg. biş- ~ bış- ‘pişmek, olgunlaşmak’; Hrzm. biş-; Kıp. biş- ~ piş-; Çağ.piş-; ETT piş-; Bşk., Tat., Türkm., Az. biş-; Kzk. pis-; Özb., Y.Uyg.,Gag., Trk. piş- < ET bış-; Uyg. til ~ tıl ‘dil’; Krh. dil ~ til; Hrzm. til; Kıp. til; Çağ. til; ETT dil; Tat., Bşk. tĕl; Kzk., Kklp., Nog.,Kmk., Krg., Özb., Y.Uyg. til; Az., Türkm., Gag., Trk. Dil< ET tıl vb.3. İlk hece /ı/ ünlüsünün zayıflaması ve kısa ı’ya (ĭ değişmesi (Hak. hĭs,Tat., Bşk., Özb. kĭş, Kaz., Kklp, Nog. ḳĭs lik etmesi Krh. yıraķ; Kıp. ıraķ ~ yıraķ; Çağ. ıraķ ~ yıraķ (LD; Tat., Bşk. yırak; Özb. yiràk; Y.Uyg., Gag. yirak; Türkm. yirāk < ETırak vb.5. /ı/ ünlüsünün ilk hecede varlığını daha çok /k/ art-damak ünsüzü gibi güçlü ünsüzler eşliğinde sürdürebilmesi. (Uyg. ķıl; Krh. ķıl; Hrzm. ķıl; Kıp. ķıl; Çağ. ķıl; ETT ķıl; Tuv., Hak. xıl; Az., Türkm. ġıl; Alt., Şor., Bşk., Kzk., Krg., Tat., Özb., Y.Uyg., Gag., Trk., Yak. kıl < ET ķıl vb.Bu noktadan hareketle makalede /ı/ sesbiriminin tarihsel seyri ve günümüz kullanımları dikkate alınarak ana sesbirim özelliği taşıyıp ta

  18. Reindeer husbandry and forestry in the reindeer herding district of Poikajärvi during the years 1963 — 1984

    Directory of Open Access Journals (Sweden)

    Katarina Kupiainen

    2010-06-01

    älttää. Laajat metsien avohakkuut ja aurakset ovat supistaneet erityisesti porojen talvilaitumia. Talvclla poro kaivaa jäkälää (Cladina sp.. lumen alta ja siirtyy hangen kovetessa syömään luppoa (Alectoria ja Bryoria spp.. Jäkäliköt ovat kuitenkin kovin kuluneita ja parhaat luppometsät on hakattu. Poikajärven paliskunnan (66°30' — 67°10'N pinta-ala on 2507 km2, josta valtionmaata 1 474.5 km2 (59%. Vuosien 1963 — 1984 keskimääräinen lukuporotiheys on ollut 1.5 poroa/km2. Viimeisen20 vuoden aikana on Poikajärven valtionmaan alasta käsitelty uudistushakkuilla, pääasiassa avohakkuilla, 9.8% ja kasvatushakkuilla 19.6%. Erilaisilla maanmuokkausmenetelmillä on käsitelty 8.7%, valtaosa auraamalla. Tuoreista kankaista on avohakattu ja aurattu noin 24%. Paliskunnan valtionmetsien arvioitu hakkuukertymä on vuodesta 1976, lähtien jatkuvasti kasvanut ja oli vuonna 1984 noin 140 600 m3. Vuodesta 1963 lähtien lukuporojen määrä on vähentynyt keskimäärin 60 porolla vuodessa. Määrä on vaihdellut 4939 ja 2866 poron välillä. Vuosina 1963 — 1984 on teurastettu keskimäärin 1 425 poroa vuodessa. Vasojen osuus teurastetuista on kasvanut ja viime vuosina se on ollut lähes 80%. Poronlihantuotanto on ollut keskimäärin 36 400 kg vuodessa. Porojen lis'äruokintaa on Poikajärven paliskunnassa harjoitettu vuodesta 1969 lähtien. Lisäruokintaan käytetyn heinän määrä on kasvanut noin 5.5 kg:sta lähes 20 kg:an lukuporoa kohti. Samanaikaisesti on lukuporojen ja teurastettujen määrä sekä lihantuotanto laskenut.

  19. The proactive usage of geographical information; Mobile geographyCoğrafi bilginin proaktif kullanımı; Mobil coğrafya

    Directory of Open Access Journals (Sweden)

    Muhammet Kaçmaz

    2013-12-01

    software and technology. In this way, in the correct use of geographic information, in marketing of products and services, based on the analysis of location, geographers may find themselves in a strong position. Özet En genel ve en basit tanımı ile insan ve mekân arasındaki ilişkiyi inceleyen bir bilim dalı olan coğrafya en eskilerden ama eskimeyen bir bilim dalı olarak insanın yeryüzündeki serüveninde ona her zaman eşlik ve yardım eden bir bilim dalı olarak önemini korumuştur. Bu önem kimi zaman coğrafyacılar sayesinde ortaya konulmuş ve coğrafyacıların önemi artmışsa da özellikle bilimde ve ekonomide teknolojinin ağırlığını hissettirdiği günümüzde, coğrafi bilginin proaktif kullanımı coğrafyacılardan çok iktisat, işletme, mühendislik gibi bilim dalları ile teknolojiyi efektif bir biçimde kullanan ticari işletmeler tarafından adeta sömürülmektedir. İnsanın mekân üzerindeki varlığının bile değerli bir veri olduğu günlük yaşam ve ekonomide ticari işletmelerinin bu veriye sahip olmak ve onlardan çıkarılacak analizlerle daha fazla kazanç elde etmek istemeleri coğrafi bilginin önemini giderek arttırmaktadır. Bireylerin “nerede”, “ne zaman”, “ne” yaptıklarına ilişkin verilerin toplanmasında ise mobil teknolojilerin önemi yadsınamaz. Özellikle internet ve akıllı telefonlar aracılığı ile veri toplamayı sağlayan yazılımların ve bu alanda hizmet veren teknoloji şirketlerinin son birkaç yılda hızla yaygınlaşması coğrafyacılar açısından da bu pazarın ne kadar önemli ve değerli olduğunun bir göstergesidir. Bu makalede coğrafi bilginin internet ve mobil teknoloji araçları ile nasıl pazarlanabilir ve yönetilebilir bir veriye dönüştüğü örnek uygulamalar ile gösterilecektir. Örnek uygulamalar android işletim sistemine sahip mobil bir cihaz ile elde edilmiş ve bu uygulamaların coğrafya ve coğrafyacılar için önemi ortaya konmaya çal

  20. Spomenik ninskom biskupu Francescu Grassiju u Chioggi: prilog najranijoj aktivnosti venecijanskog kipara Paola Callala

    Directory of Open Access Journals (Sweden)

    Damir Tulić

    2014-12-01

    Tagliapietre (Venecija, 1680. – 1747.. U Dalmaciji se relativno skroman opus dosada uočenih Callalovih sastoji od dva mramorna anđela postavljena uz glavni oltar u župnoj crkvi u Vodicama te četiri putta svirača smještena sa strane glavnog oltara, kao i onih na bočnom oltaru u župnoj crkvi u Sutivanu na otoku Braču. No, Callalovu ruku moguće je prepoznati i u jednoj skulpturi iz pozamašnog kiparskog programa na oltaru Presvetog Sakramenta u zadarskoj katedrali. Arhitekturu je 1719. izradio Antonio Viviani dok je bogatu kiparsku dekoraciju najvećim dijelom isklesao Francesco Cabianca (Venecija, 1666. - 1737.. U središnjoj niši oltara smješten je manji mramorni kip Žalosne Bogorodice s mrtvim Kristom u krilu. Mramorna zadarska Pietà teško se uklapa u katalog Francesca Cabiance, pogotovo ako se ima u vidu njegov kip istoimene tematike postavljen oko 1714. nad vrata u klaustru venecijanske crkve I Frari. Cabiancina venecijanska Pietà posjeduje oštrinu poteza dlijeta, određenu grubost izvedbe i robustnost tijela te drugačiju fizionomiju i draperiju od zadarskog djela. No, zadarska se Pietà može uključiti u katalog kipara Paola Callala. Pažljivo modelirani lik žalosne Majke te meko oblikovanu draperiju koja se oko stopala radijalno širi prema van možemo usporediti s kipovima Vjere i Nade na oltaru Sakramenta katedrale u Udine, nastalom nakon 1720. godine. Paralele u modeliranju Kristova tijela, a posebno lica suzdržane mimike, nalazimo na kipu Uskrslog na tabernakulu već spominjanog udineškog oltara, kao i u istovjetnom kipu na tabernakulu oltara župne crkve u Clauzettu, što ga također pripisujem Callalu, ali i na ranijim monumentalnijim primjerima, poput Krista s oltara Preobraženja nastalom 1708. za župnu crkvu u Labinu. Callalov spomenik ninskom biskupu Francescu Grassiju u Chioggi važan je pokazatelj razvoja osobnog stila majstora. Njegov se izričaj tako transformira iz ovog „mladenačkog djela“ punog siline i robusnosti u lirsku

  1. HAK ÂŞIĞI AMASYALI FEDÂÎ BABA VE TASAVVUF KÜLTÜRÜ [GOD-LOVER FEDÂÎ BABA FROM AMASYA AND SUFI CULTURE

    Directory of Open Access Journals (Sweden)

    Cafer Özdemir

    2017-09-01

    onlara doğru yolu göstermeye çalışmıştır. Seksen beş yıllık ömründe kendinden önceki geleneği başarılı bir şekilde devam ettirmiş ve Anadolu toplumu içerisinde kardeşlik bağı oluşturmaya çalışmıştır. Fedâî Baba was born in 1855 in Yassıçal, one of the central villages of Amasya, and he passed away in 1940. It is rumored that this Aşık who had a different personality stayed in tombs in his childhood. He studied madrasa in Amasya for a while. According to a widespread rumour, he left madrasa before he completed his education. In Erbaa, a town in Tokat province, he received the Sufi knowledge from Deruni Baba descended from entombed Sheikh Mahmut Veli. There are two hundred and fifty two known poems belonging to this Aşık whose miracles have been told. Fedâî Baba, known for his ingenuity in his dreams in accordance with the tradition of loveliest poetry, can not play the saz, but has the ability to sing poetic poem. He is a kind traveler as he frequently visits Amasya as a folk Aşık. He sang poems in accordance with both Ottoman and folk poetry styles. The poems which he composedin ottoman poetry style are more complex than his poems in folk poetry in terms of language. Fedâî Baba who seems to have the ability towards poetry has a lyrical style. It is seen that his poems reflect this tradition as he is a member of the Alevi Bektashi tradition, which expresses the essence of the Sufi tradition such as “İlmi ledün, mürşit, zikir, dört kapı, ilahi aşk, tevhit”. He masterfully blended the basic features of Sufism and Bektashi cultures in his poems. Amasya has an important place in Alevi Bektashi culture. Fedâî Baba has not been investigated much even though he had a strong influence in this area. In this work, his biography has been focused and in line with his poems his prominence and mysticism in Alevi Bektashi culture has been put forward. This Aşık, who should be considered as a value of Amasya, tried to educate

  2. The relationship between self-efficacy level and gender perception of university students: Beyşehir exampleÜniversite öğrencilerinin öz- yeterlilik düzeyi ile toplumsal cinsiyet algısı ilişkisi: Beyşehir örneği

    Directory of Open Access Journals (Sweden)

    Funda Özpulat

    2016-03-01

    through trainings, seminars, projects and various activities.   Özet Amaç: Bu çalışma, üniversite öğrencilerinin öz- yeterlilikleri ile toplumsal cinsiyet algıları arasındaki ilişkiyi saptamaya yönelik olarak planlanmış bir araştırmadır. Yöntem: Selçuk Üniversitesine Beyşehir Turizm Fakültesi öğrencileri çalışmanın örneklemini oluşturmuş, araştırmanın uygulaması 1 Aralık-28 Aralık 2015 tarihleri arasında yapılmıştır. Verilerin toplanmasında araştırmacılar tarafından geliştirilen anket formu, Genel Özyeterlilik Ölçeği ve Toplumsal Cinsiyet Algısı Ölçeği kullanılmıştır. Elde edilen veriler SPSS 17.0 paket programı kullanılarak değerlendirilmiş, elde edilen verilerin yüzdeler ve sayılar ile değerlendirilmesi yanı sıra, tanımlayıcı istatistik hesaplamaları, Bağımsız Gruplarda T Testi, One –Way Anova testi ve Korrelasyon analizi uygulanmıştır. Bulgular: Araştırmaya katılan öğrencilerin yaş ortalamaları 21.00±1.51’dir ve %52.2’lik bölümünü erkek öğrenciler oluşturmaktadır. Öğrencilerin %27.5’ini 2.sınıf, %27.1’ini 1.sınıf öğrencileri oluşturmaktadır. Çalışmaya katılan kız öğrencilerin Toplumsal Cinsiyet Algısı Ölçeği puan ortalaması 95.84±11.54, erkek öğrencilerin 72.09±14.18 olup, öğrenciler arasında toplumsal cinsiyet algısının cinsiyete göre değiştiği görülmüştür (<0.05. Ayrıca, öğrencilerin toplumsal cinsiyet algıları ile genel özyeterlilikleri arasında 0.01 yanılma düzeyinde istatistiksel olarak anlamlı bir ilişki bulunmaktadır. Sonuç: Yapılan çalışma sonucunda, öğrencilerin cinsiyetleri, okula başlamadan önce yaşadıkları bölge ve yerleşim yerleri ile ekonomik durumlarının öğrencilerin öz-yeterlilikleri ve toplumsal cinsiyet algıları üzerinde önemli etkilerinin bulunduğu, öz-yeterlilik düzeyleri ile toplumsal cinsiyet algıları arasında ise istatistiksel olarak anlamlı bir ili

  3. Farklı Hidrolik Bekletme Sürelerinin Anaerobik Perdeli Reaktörde Sülfat İndirgenmesi Üzerine Etkisi / Effect of Different Hydraulic Retention Time (HRT on Sulfate Reduction in Anaerobic Baffled Reactor

    Directory of Open Access Journals (Sweden)

    Şebnem ÖZDEMİR

    2012-12-01

    Full Text Available Amaç: Doğal sularda değişen yapılarda ve konsantrasyonlarda sülfat bileşikleri bulunmaktadır. Ayrıca bazı endüstriyel atıksuların sülfat miktarı yüksektir ve doğal sulara karıştıklarında alıcı ortamdaki sülfat miktarını arttırmaktadır. Mevcut aerobik sistemlerin artan enerji maliyetlerinin işletme giderimini önemli ölçüde yükseltmesi nedeniyle anaerobik sistemler ekonomik bir atıksu arıtma alternatifi olarak önem kazanmıştır. Bu yüzden son zamanlarda yapılan çalışmalar sülfat içeren atıksuların arıtımında anaerobik arıtımın üzerine yoğunlaşmıştır. Anaerobik arıtım sistemlerinden anaerobik perdeli reaktör (APR yapılan çalışmalar ışığında sülfat indirgenmesi için iyi bir stratejidir. Fakat sülfat içeren atıksuların anaerobik arıtım performansını etkileyen birçok parametre mevcuttur. Bu çalışmada farklı hidrolik bekleme sürelerinin (HBS anaerobik perdeli reaktörde yüksek sülfat konsantrasyonuna sahip atıksuların arıtılabilirlik çalışmasına etkisi araştırılmıştır. Tasarım ve Yöntem: APR yukarı akışlı anaerobik çamur yataklı reaktörün bir modifikasyonudur. Kullanılan APR’nin uzunluğu 80 cm, genişliği ve derinliği ise 20 cm’dir. Reaktör camdan imal edilmiş olup toplam su hacmi 19 L’dir. Reaktör perdeler ile 4,75 L’lik dört eşit bölmeye ayrılmıştır. Ayrıca, yönlendirme perdeleri kullanılarak reaktöre beslenen atıksuyun çamur yatağında aşağıdan yukarıya doğru bir yol izlemesi sağlanmıştır. Çalışmada sentetik atıksu kullanılıp elektron verici olarak etanol, elektron alıcı olarak ise sülfat kullanılmıştır. Reaktörün her bölmesinden pH, alkalinite, kimyasal oksijen ihtiyacı (KOİ, sülfat ve sülfür tayinleri için haftada 3 gün numune alınmıştır. Bulgular: APR 120 gün boyunca farklı HBS’lerde (2; 1,5; 1; 0,5 gün işletilerek arıtım performansı izlenmiştir. Bekleme s

  4. Farklı Hidrolik Bekletme Sürelerinin Anaerobik Perdeli Reaktörde Sülfat İndirgenmesi Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Şebnem Özdemir

    2012-12-01

    Full Text Available ÖzetAmaç: Doğal sularda değişen yapılarda ve konsantrasyonlarda sülfat bileşikleri bulunmaktadır. Ayrıca bazı endüstriyel atıksuların sülfat miktarı yüksektir ve doğal sulara karıştıklarında alıcı ortamdaki sülfat miktarını arttırmaktadır. Mevcut aerobik sistemlerin artan enerji maliyetlerinin işletme giderimini önemli ölçüde yükseltmesi nedeniyle anaerobik sistemler ekonomik bir atıksu arıtma alternatifi olarak önem kazanmıştır. Bu yüzden son zamanlarda yapılan çalışmalar sülfat içeren atıksuların arıtımında anaerobik arıtımın üzerine yoğunlaşmıştır. Anaerobik arıtım sistemlerinden anaerobik perdeli reaktör (APR yapılan çalışmalar ışığında sülfat indirgenmesi için iyi bir stratejidir. Fakat sülfat içeren atıksuların anaerobik arıtım performansını etkileyen birçok parametre mevcuttur. Bu çalışmada farklı hidrolik bekleme sürelerinin (HBS anaerobik perdeli reaktörde yüksek sülfat konsantrasyonuna sahip atıksuların arıtılabilirlik çalışmasına etkisi araştırılmıştır.Tasarım ve Yöntem: APR yukarı akışlı anaerobik çamur yataklı reaktörün bir modifikasyonudur. Kullanılan APR’nin uzunluğu 80 cm, genişliği ve derinliği ise 20 cm’dir. Reaktör camdan imal edilmiş olup toplam su hacmi 19 L’dir. Reaktör perdeler ile 4,75 L’lik dört eşit bölmeye ayrılmıştır. Ayrıca, yönlendirme perdeleri kullanılarak reaktöre beslenen atıksuyun çamur yatağında aşağıdan yukarıya doğru bir yol izlemesi sağlanmıştır. Çalışmada sentetik atıksu kullanılıp elektron verici olarak etanol, elektron alıcı olarak ise sülfat kullanılmıştır. Reaktörün her bölmesinden pH, alkalinite, kimyasal oksijen ihtiyacı (KOİ, sülfat ve sülfür tayinleri için haftada 3 gün numune alınmıştır.Bulgular: APR 120 gün boyunca farklı HBS’lerde (2; 1,5; 1; 0,5 gün işletilerek arıtım performansı izlenmiştir. Bekleme s

  5. FOREWORD: Some thoughts about Jürgen Hafner's work in computational materials science Some thoughts about Jürgen Hafner's work in computational materials science

    Science.gov (United States)

    Heine, Volker

    2011-10-01

    Jürgen Hafner started in the early 1970s with pseudopotential calculations on the structures and properties of sp-bonded metals, improving on work done elsewhere [1]. This expanded in four directions: transition metals, molten metals, magnetism and alloys, and combinations of these. As well as electronic structure calculations, he helped to advance the statistical mechanical classical theory of liquids for the molten metals [2]. In magnetism he was one of the pioneers of calculations with non-collinear spins [3, 4]. As well as simple (solid and molten) alloys, he also treated materials with strong chemical interaction such as sulphides and liquids such as arsenic and tellurium [5, 6]. All this fed into two directions which dominated much of his work for many years, namely the theory of glassy metals [7] and that of quasicrystals [8]. One notable result in the latter was to show that it was possible to construct hypothetical materials for which the quasicrystalline state is indeed the lowest energy structure. This displaced the established wisdom of the time that quasicrystals were necessarily metastable forms. In more recent years he has turned to calculations in surface science [9, 10], including catalysis of chemical reactions on surfaces [11, 12]. What really brought Jürgen first to my attention was that he had managed to do a better job than we had of calculations with the new approach of pseudopotentials, particularly regarding the screening part of the calculation. This is very important in alloys where there is a large difference in the electron density in the two types of atom due to their different volumes or valences such as in the phase diagram and structure of LiK or KPb [5, 13]. We have been in contact over many years including one close collaboration and I always learned something new in talking with Jürgen. In the late 1970s in Cambridge we performed phonon calculations on models of amorphous silicon [14], to see if these could distinguish between

  6. Adolescents’ opinions and thoughts about consanguineous marriages: A Turkey sample

    Directory of Open Access Journals (Sweden)

    Funda Özpulat

    2017-01-01

    belirlenirken, bu oran kentsel bölgelerde %18,80 yine aynı yılın verilerine göre gençlerde, akraba evliliği oranı %21,2, akraba evliliği yapanların birinci derece akraba evliliği oranı %51,9’dur. Türkiye’de yapılan diğer bazı çalışmalara bakıldığında ise, akraba evliliği oranlarının %11,5 ile %49, 6 arasında değiştiği, batı bölgelerde oran düşük olarak saptanırken, oranların doğu ve güneydoğu bölgelerinde yükseldiği görülmektedir. Bulunduğumuz toplumda gerekli sağlık hizmeti çalışmalarını etkin bir şekilde sürdürebilmek için gençler ve aileleri akraba evliliğinin oluşturabileceği sağlık problemleri konusunda bilinçlendirilmeleri akraba evliliği gelişti ise genetik danışmanlık hizmeti için sağlık kurumlarına yönlendirilmeleri son derece önemlidir. Bu araştırmanın amacı; geleceğin aile kurumunu oluşturacak adölesan nüfusun, akraba evliliklerine yönelik görüş ve yaklaşımlarının belirlenmesi ve gereksinimlerinin saptanması olup literature katkı sağlayacağı düşünülmektedir. Yöntem Araştırma Konya/Akşehir İlçesi ve Ankara/Yenimahalle ilçesi olarak iki merkezli bir çalışma şeklinde yürütülmüştür. Akşehir İlçesi 4 lisede n: 1116’dır. Yenimahalle ilçesi 3 lisede n: 957’dir. Toplam öğrenci sayısı ise 2073 kişidir. Bulgular Araştırmaya katılanların %53,8’lik bölümünü Akşehir İlçesindeki okullardan, %46,2’ sini Ankara’daki okullardan katılan öğrenciler oluşturmaktadır.  Akraba evliliği hakkında bilgi sahibi olanlar %91,2 iken cinsiyet arasında bir fark bulunmamıştır. Annesi ve babası arasında akraba evliliği bulunanların oranı %12,1’dir. Akrabası arasında akraba evliliği bulunanların oranı %50,8’dir. Ailesinde veya akrabasında akraba evliliği yapanlarda sağlık problemi oluşanların çoğunluğunu fiziksel engellilik oluşturmaktadır. Akraba evliliğine tamamen karşı olanlar %36,3’tür. Akraba evlili