WorldWideScience

Sample records for alloy-ehi 868

  1. 21 CFR 868.2377 - Apnea monitor.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Apnea monitor. 868.2377 Section 868.2377 Food and... ANESTHESIOLOGY DEVICES Monitoring Devices § 868.2377 Apnea monitor. (a) Identification. An apnea monitor is a... breath. The apnea monitor also includes indirect methods of apnea detection such as monitoring of heart...

  2. 21 CFR 868.6700 - Anesthesia stool.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthesia stool. 868.6700 Section 868.6700 Food... DEVICES ANESTHESIOLOGY DEVICES Miscellaneous § 868.6700 Anesthesia stool. (a) Identification. An anesthesia stool is a device intended for use as a stool for the anesthesiologist in the operating room. (b...

  3. 21 CFR 868.5620 - Breathing mouthpiece.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Breathing mouthpiece. 868.5620 Section 868.5620...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5620 Breathing mouthpiece. (a) Identification. A breathing mouthpiece is a rigid device that is inserted into a patient's mouth and that...

  4. 7 CFR 868.307 - Moisture.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.307 Section 868.307 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Application of Standards § 868.307 Moisture. Water content in milled rice as determined by an FGIS approved...

  5. 7 CFR 868.207 - Moisture.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.207 Section 868.207 Agriculture... Application of Standards § 868.207 Moisture. Water content in rough rice as determined by an approved device..., “approved device” shall include the Motomco Moisture Meter and any other equipment that is approved by the...

  6. 7 CFR 868.258 - Moisture.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.258 Section 868.258 Agriculture... Governing Application of Standards § 868.258 Moisture. Water content in brown rice for processing as... purpose of this paragraph, “approved device” shall include the Motomco Moisture Meter and any other...

  7. 21 CFR 868.5895 - Continuous ventilator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Continuous ventilator. 868.5895 Section 868.5895...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5895 Continuous ventilator. (a) Identification. A continuous ventilator (respirator) is a device intended to mechanically control or assist...

  8. 7 CFR 868.209 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.209 Section 868.209 Agriculture... Application of Standards § 868.209 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved devices, and...

  9. 7 CFR 868.260 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.260 Section 868.260 Agriculture... Governing Application of Standards § 868.260 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved...

  10. 7 CFR 868.309 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.309 Section 868.309 Agriculture... Application of Standards § 868.309 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved devices, and...

  11. 7 CFR 868.5 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Administrator. 868.5 Section 868.5 Agriculture... FOR CERTAIN AGRICULTURAL COMMODITIES Regulations Administration § 868.5 Administrator. The Administrator, under the authority delegated by the Secretary, is charged with administering the programs and...

  12. 21 CFR 868.5220 - Blow bottle.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Blow bottle. 868.5220 Section 868.5220 Food and... ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5220 Blow bottle. (a) Identification. A blow bottle is a device that is intended for medical purposes to induce a forced expiration from a patient. The patient blows...

  13. 21 CFR 868.5570 - Nonrebreathing mask.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Nonrebreathing mask. 868.5570 Section 868.5570...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5570 Nonrebreathing mask. (a) Identification. A nonrebreathing mask is a device fitting over a patient's face to administer oxygen. It utilizes...

  14. 21 CFR 868.5600 - Venturi mask.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Venturi mask. 868.5600 Section 868.5600 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5600 Venturi mask. (a) Identification. A venturi mask is a...

  15. 21 CFR 868.5580 - Oxygen mask.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Oxygen mask. 868.5580 Section 868.5580 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5580 Oxygen mask. (a) Identification. An oxygen mask is a device...

  16. 21 CFR 868.5590 - Scavenging mask.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Scavenging mask. 868.5590 Section 868.5590 Food... DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5590 Scavenging mask. (a) Identification. A scavenging mask is a device positioned over a patient's nose to deliver anesthetic or analgesic gases to the...

  17. 21 CFR 868.6400 - Calibration gas.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Calibration gas. 868.6400 Section 868.6400 Food... DEVICES ANESTHESIOLOGY DEVICES Miscellaneous § 868.6400 Calibration gas. (a) Identification. A calibration gas is a device consisting of a container of gas of known concentration intended to calibrate medical...

  18. 21 CFR 172.868 - Ethyl cellulose.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ethyl cellulose. 172.868 Section 172.868 Food and... Multipurpose Additives § 172.868 Ethyl cellulose. The food additive ethyl cellulose may be safely used in food in accordance with the following prescribed conditions: (a) The food additive is a cellulose ether...

  19. 21 CFR 868.1040 - Powered algesimeter.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1040 Powered algesimeter. (a... sensitivity to pain after administration of an anesthetic agent. (b) Classification. Class II (performance...

  20. 7 CFR 868.81 - Licensing procedures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Licensing procedures. 868.81 Section 868.81 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND STANDARDS FOR CERTAIN AGRICULTURAL COMMODITIES...

  1. 21 CFR 868.1030 - Manual algesimeter.

    Science.gov (United States)

    2010-04-01

    ... DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1030 Manual algesimeter. (a) Identification. A manual algesimeter is a mechanical device intended to determine a patient's sensitivity to pain after...

  2. 21 CFR 868.5995 - Tee drain (water trap).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Tee drain (water trap). 868.5995 Section 868.5995...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5995 Tee drain (water trap). (a) Identification. A tee drain (water trap) is a device intended to trap and drain water that collects in ventilator...

  3. 21 CFR 868.2450 - Lung water monitor.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Lung water monitor. 868.2450 Section 868.2450 Food... DEVICES ANESTHESIOLOGY DEVICES Monitoring Devices § 868.2450 Lung water monitor. (a) Identification. A lung water monitor is a device used to monitor the trend of fluid volume changes in a patient's lung by...

  4. 21 CFR 868.1700 - Nitrous oxide gas analyzer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Nitrous oxide gas analyzer. 868.1700 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1700 Nitrous oxide gas analyzer. (a) Identification. A nitrous oxide gas analyzer is a device intended to measure the concentration of nitrous oxide...

  5. 7 CFR 868.74 - Divided-lot certificates.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Divided-lot certificates. 868.74 Section 868.74... FOR CERTAIN AGRICULTURAL COMMODITIES Regulations Official Certificates § 868.74 Divided-lot certificates. (a) General. When commodities are offered for inspection and are certificated as a single lot...

  6. 21 CFR 868.1730 - Oxygen uptake computer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Oxygen uptake computer. 868.1730 Section 868.1730...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1730 Oxygen uptake computer. (a) Identification. An oxygen uptake computer is a device intended to compute the amount of oxygen consumed by a...

  7. 7 CFR 868.301 - Definition of milled rice.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of milled rice. 868.301 Section 868.301... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Milled Rice Terms Defined § 868.301 Definition of milled rice. Whole or broken kernels of rice (Oryza sativa L.) from which the hulls and at...

  8. 7 CFR 868.201 - Definition of rough rice.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of rough rice. 868.201 Section 868.201... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Rough Rice Terms Defined § 868.201 Definition of rough rice. Rice (Oryza sativa L.) which consists of 50 percent or more of paddy kernels (see...

  9. 21 CFR 868.5240 - Anesthesia breathing circuit.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthesia breathing circuit. 868.5240 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5240 Anesthesia breathing circuit. (a) Identification. An anesthesia breathing circuit is a device that is intended to administer medical gases to a...

  10. 21 CFR 868.5130 - Anesthesia conduction filter.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthesia conduction filter. 868.5130 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5130 Anesthesia conduction filter. (a) Identification. An anesthesia conduction filter is a microporous filter used while administering to a patient...

  11. 21 CFR 868.5140 - Anesthesia conduction kit.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthesia conduction kit. 868.5140 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5140 Anesthesia conduction kit. (a) Identification. An anesthesia conduction kit is a device used to administer to a patient conduction, regional, or...

  12. 21 CFR 868.5150 - Anesthesia conduction needle.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthesia conduction needle. 868.5150 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5150 Anesthesia conduction needle. (a) Identification. An anesthesia conduction needle is a device used to inject local anesthetics into a patient to...

  13. 21 CFR 868.5310 - Carbon dioxide absorber.

    Science.gov (United States)

    2010-04-01

    ... breathing circuit as a container for carbon dioxide absorbent. It may include a canister and water drain. (b... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Carbon dioxide absorber. 868.5310 Section 868.5310...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5310 Carbon dioxide absorber. (a...

  14. 21 CFR 868.5330 - Breathing gas mixer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Breathing gas mixer. 868.5330 Section 868.5330...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5330 Breathing gas mixer. (a) Identification. A breathing gas mixer is a device intended for use in conjunction with a respiratory support...

  15. 21 CFR 868.2375 - Breathing frequency monitor.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Breathing frequency monitor. 868.2375 Section 868.2375 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Monitoring Devices § 868.2375 Breathing frequency monitor. (a...

  16. 21 CFR 868.2300 - Bourdon gauge flowmeter.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Bourdon gauge flowmeter. 868.2300 Section 868.2300...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Monitoring Devices § 868.2300 Bourdon gauge flowmeter. (a) Identification. A bourdon gauge flowmeter is a device intended for medical purposes that is used in conjunction...

  17. 21 CFR 868.5915 - Manual emergency ventilator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Manual emergency ventilator. 868.5915 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5915 Manual emergency ventilator. (a) Identification. A manual emergency ventilator is a device, usually incorporating a bag and valve, intended to...

  18. 21 CFR 868.5925 - Powered emergency ventilator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Powered emergency ventilator. 868.5925 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5925 Powered emergency ventilator. (a) Identification. A powered emergency ventilator is a demand valve or inhalator intended to provide emergency...

  19. 21 CFR 868.5270 - Breathing system heater.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Breathing system heater. 868.5270 Section 868.5270...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5270 Breathing system heater. (a) Identification. A breathing system heater is a device that is intended to warm breathing gases before they enter...

  20. 21 CFR 868.1975 - Water vapor analyzer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Water vapor analyzer. 868.1975 Section 868.1975...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1975 Water vapor analyzer. (a) Identification. A water vapor analyzer is a device intended to measure the concentration of water vapor in a...

  1. 21 CFR 868.5550 - Anesthetic gas mask.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthetic gas mask. 868.5550 Section 868.5550...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5550 Anesthetic gas mask. (a) Identification. An anesthetic gas mask is a device, usually made of conductive rubber, that is positioned over a...

  2. 21 CFR 868.5560 - Gas mask head strap.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Gas mask head strap. 868.5560 Section 868.5560...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5560 Gas mask head strap. (a) Identification. A gas mask head strap is a device used to hold an anesthetic gas mask in position on a patient's...

  3. 21 CFR 868.5440 - Portable oxygen generator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Portable oxygen generator. 868.5440 Section 868...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5440 Portable oxygen generator. (a) Identification. A portable oxygen generator is a device that is intended to release oxygen for respiratory...

  4. 21 CFR 868.1100 - Arterial blood sampling kit.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1100 Arterial blood sampling kit. (a) Identification. An arterial blood sampling kit is a device, in kit form, used to obtain arterial blood samples... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Arterial blood sampling kit. 868.1100 Section 868...

  5. 21 CFR 868.5795 - Tracheal tube cleaning brush.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Tracheal tube cleaning brush. 868.5795 Section 868.5795 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5795 Tracheal tube cleaning brush. (a...

  6. 21 CFR 868.5955 - Intermittent mandatory ventilation attachment.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Intermittent mandatory ventilation attachment. 868.5955 Section 868.5955 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5955 Intermittent mandatory ventilation attachment. (a)...

  7. 7 CFR 868.32 - Who shall inspect commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Who shall inspect commodities. 868.32 Section 868.32... FOR CERTAIN AGRICULTURAL COMMODITIES Regulations Inspection Methods and Procedures § 868.32 Who shall inspect commodities. Official commodity inspections shall be performed only by official personnel. ...

  8. 7 CFR 868.261 - Grade and grade requirements for the classes of brown rice for processing. (See also § 868.263.)

    Science.gov (United States)

    2010-01-01

    ... rice for processing. (See also § 868.263.) 868.261 Section 868.261 Agriculture Regulations of the... Standards § 868.261 Grade and grade requirements for the classes of brown rice for processing. (See also... brown rice for processing, see § 868.263(a). 2 For the special grade Glutinous brown rice for processing...

  9. 7 CFR 868.312 - Grade and grade requirements for the class Screenings Milled Rice. (See also § 868.315.)

    Science.gov (United States)

    2010-01-01

    ... Milled Rice. (See also § 868.315.) 868.312 Section 868.312 Agriculture Regulations of the Department of... grade requirements for the class Screenings Milled Rice. (See also § 868.315.) Grades, Grade... For the special grade Parboiled milled rice, see § 868.315(c). 2 For the special grade Undermilled...

  10. 7 CFR 868.313 - Grades and grade requirements for the class Brewers Milled Rice. (See also § 868.315.)

    Science.gov (United States)

    2010-01-01

    ... Milled Rice. (See also § 868.315.) 868.313 Section 868.313 Agriculture Regulations of the Department of... and grade requirements for the class Brewers Milled Rice. (See also § 868.315.) Grades, Grade... distinctly low quality. 1 For the special grade Parboiled milled rice, see § 868.315(c). 2 For the special...

  11. 7 CFR 868.210 - Grades and grade requirements for the classes of Rough Rice. (See also § 868.212.)

    Science.gov (United States)

    2010-01-01

    ... Rice. (See also § 868.212.) 868.210 Section 868.210 Agriculture Regulations of the Department of... grade requirements for the classes of Rough Rice. (See also § 868.212.) Grade Maximum limits of— Seeds... Parboiled rough rice, see § 868.212(b). 2 For the special grade Glutinous rough rice, see § 868.212(d). 3...

  12. 7 CFR 868.311 - Grades and grade requirements for the class Second Head Milled Rice. (See also § 868.315.)

    Science.gov (United States)

    2010-01-01

    ... Head Milled Rice. (See also § 868.315.) 868.311 Section 868.311 Agriculture Regulations of the... Grades and grade requirements for the class Second Head Milled Rice. (See also § 868.315.) Grades, Grade...; or (g) is otherwise of distinctly low quality. 1 For the special grade Parboiled milled rice, see...

  13. 21 CFR 868.5800 - Tracheostomy tube and tube cuff.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Tracheostomy tube and tube cuff. 868.5800 Section... (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5800 Tracheostomy tube and tube cuff. (a) Identification. A tracheostomy tube and tube cuff is a device intended to be placed into a...

  14. 21 CFR 868.2610 - Gas pressure gauge.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Gas pressure gauge. 868.2610 Section 868.2610 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL... to measure gas pressure in a medical gas delivery system. (b) Classification. Class I (general...

  15. 21 CFR 868.5120 - Anesthesia conduction catheter.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Anesthesia conduction catheter. 868.5120 Section... (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5120 Anesthesia conduction catheter. (a) Identification. An anesthesia conduction catheter is a flexible tubular device used to inject...

  16. 7 CFR 868.36 - Loss of identity.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Loss of identity. 868.36 Section 868.36 Agriculture... identity. (a) Lots. The identity of a packaged lot, bulk lot, or sublot of a commodity shall be considered... or location after the time of original inspection, unless the identity is preserved; or (2) More...

  17. 21 CFR 868.5935 - External negative pressure ventilator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false External negative pressure ventilator. 868.5935 Section 868.5935 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... ventilator. (a) Identification. An external negative pressure ventilator (e.g., iron lung, cuirass) is a...

  18. 21 CFR 868.1720 - Oxygen gas analyzer.

    Science.gov (United States)

    2010-04-01

    ... gases by techniques such as mass spectrometry, polarography, thermal conductivity, or gas chromatography... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Oxygen gas analyzer. 868.1720 Section 868.1720 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...

  19. 21 CFR 868.1075 - Argon gas analyzer.

    Science.gov (United States)

    2010-04-01

    ... thermal conductivity. (b) Classification. Class II (performance standards). ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Argon gas analyzer. 868.1075 Section 868.1075 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL...

  20. 21 CFR 868.1670 - Neon gas analyzer.

    Science.gov (United States)

    2010-04-01

    ... patient. The device may use techniques such as mass spectrometry or thermal conductivity. (b... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Neon gas analyzer. 868.1670 Section 868.1670 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL...

  1. 21 CFR 868.1640 - Helium gas analyzer.

    Science.gov (United States)

    2010-04-01

    ... mixture during pulmonary function testing. The device may use techniques such as thermal conductivity, gas... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Helium gas analyzer. 868.1640 Section 868.1640 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...

  2. 21 CFR 868.2775 - Electrical peripheral nerve stimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Electrical peripheral nerve stimulator. 868.2775... (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Monitoring Devices § 868.2775 Electrical peripheral nerve stimulator. (a) Identification. An electrical peripheral nerve stimulator (neuromuscular blockade monitor) is...

  3. 21 CFR 868.1880 - Pulmonary-function data calculator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Pulmonary-function data calculator. 868.1880 Section 868.1880 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... calculator. (a) Identification. A pulmonary-function data calculator is a device used to calculate pulmonary...

  4. 21 CFR 868.5170 - Laryngotracheal topical anesthesia applicator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Laryngotracheal topical anesthesia applicator. 868... topical anesthesia applicator. (a) Identification. A laryngotracheal topical anesthesia applicator is a device used to apply topical anesthetics to a patient's laryngotracheal area. (b) Classification. Class...

  5. 7 CFR 868.203 - Basis of determination.

    Science.gov (United States)

    2010-01-01

    ... Application of Standards § 868.203 Basis of determination. The determination of seeds, objectionable seeds, heat-damaged kernels, red rice and damaged kernels, chalky kernels, other types, color, and the special...) types of rice shall be determined on the basis of the whole and large broken kernels of milled rice that...

  6. 21 CFR 868.5160 - Gas machine for anesthesia or analgesia.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Gas machine for anesthesia or analgesia. 868.5160... (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5160 Gas machine for anesthesia or analgesia. (a) Gas machine for anesthesia—(1) Identification. A gas machine for anesthesia is a...

  7. 21 CFR 868.5610 - Membrane lung for long-term pulmonary support.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Membrane lung for long-term pulmonary support. 868.5610 Section 868.5610 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... for long-term pulmonary support. (a) Identification. A membrane lung for long-term pulmonary support...

  8. 21 CFR 868.1860 - Peak-flow meter for spirometry.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Peak-flow meter for spirometry. 868.1860 Section 868.1860 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... spirometry. (a) Identification. A peak-flow meter for spirometry is a device used to measure a patient's...

  9. 21 CFR 868.1900 - Diagnostic pulmonary-function interpretation calculator.

    Science.gov (United States)

    2010-04-01

    ... calculator. 868.1900 Section 868.1900 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Diagnostic pulmonary-function interpretation calculator. (a) Identification. A diagnostic pulmonary-function interpretation calculator is a device that interprets pulmonary study data to determine clinical significance of...

  10. 21 CFR 868.1890 - Predictive pulmonary-function value calculator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Predictive pulmonary-function value calculator. 868.1890 Section 868.1890 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... pulmonary-function value calculator. (a) Identification. A predictive pulmonary-function value calculator is...

  11. Activity of the Type II JAK2 Inhibitor CHZ868 in B Cell Acute Lymphoblastic Leukemia.

    Science.gov (United States)

    Wu, Shuo-Chieh; Li, Loretta S; Kopp, Nadja; Montero, Joan; Chapuy, Bjoern; Yoda, Akinori; Christie, Amanda L; Liu, Huiyun; Christodoulou, Alexandra; van Bodegom, Diederik; van der Zwet, Jordy; Layer, Jacob V; Tivey, Trevor; Lane, Andrew A; Ryan, Jeremy A; Ng, Samuel Y; DeAngelo, Daniel J; Stone, Richard M; Steensma, David; Wadleigh, Martha; Harris, Marian; Mandon, Emeline; Ebel, Nicolas; Andraos, Rita; Romanet, Vincent; Dölemeyer, Arno; Sterker, Dario; Zender, Michael; Rodig, Scott J; Murakami, Masato; Hofmann, Francesco; Kuo, Frank; Eck, Michael J; Silverman, Lewis B; Sallan, Stephen E; Letai, Anthony; Baffert, Fabienne; Vangrevelinghe, Eric; Radimerski, Thomas; Gaul, Christoph; Weinstock, David M

    2015-07-13

    A variety of cancers depend on JAK2 signaling, including the high-risk subset of B cell acute lymphoblastic leukemias (B-ALLs) with CRLF2 rearrangements. Type I JAK2 inhibitors induce paradoxical JAK2 hyperphosphorylation in these leukemias and have limited activity. To improve the efficacy of JAK2 inhibition in B-ALL, we developed the type II inhibitor CHZ868, which stabilizes JAK2 in an inactive conformation. CHZ868 potently suppressed the growth of CRLF2-rearranged human B-ALL cells, abrogated JAK2 signaling, and improved survival in mice with human or murine B-ALL. CHZ868 and dexamethasone synergistically induced apoptosis in JAK2-dependent B-ALLs and further improved in vivo survival compared to CHZ868 alone. These data support the testing of type II JAK2 inhibition in patients with JAK2-dependent leukemias and other disorders. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. 21 CFR 868.5365 - Posture chair for cardiac or pulmonary treatment.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Posture chair for cardiac or pulmonary treatment... SERVICES (CONTINUED) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Therapeutic Devices § 868.5365 Posture chair for cardiac or pulmonary treatment. (a) Identification. A posture chair for cardiac or pulmonary...

  13. Activity of the type II JAK2 inhibitor CHZ868 in B-cell acute lymphoblastic leukemia

    Science.gov (United States)

    Wu, Shuo-Chieh; Li, Loretta S.; Kopp, Nadja; Montero, Joan; Chapuy, Bjoern; Yoda, Akinori; Christie, Amanda L.; Liu, Huiyun; Christodoulou, Alexandra; van Bodegom, Diederik; van der Zwet, Jordy; Layer, Jacob V.; Tivey, Trevor; Lane, Andrew A.; Ryan, Jeremy A.; Ng, Samuel Y.; DeAngelo, Daniel J.; Stone, Richard M.; Steensma, David; Wadleigh, Martha; Harris, Marian; Mandon, Emeline; Ebel, Nicolas; Andraos, Rita; Romanet, Vincent; Dölemeyer, Arno; Sterker, Dario; Zender, Michael; Rodig, Scott J.; Murakami, Masato; Hofmann, Francesco; Kuo, Frank; Eck, Michael J.; Silverman, Lewis B.; Sallan, Stephen E.; Letai, Anthony; Baffert, Fabienne; Vangrevelinghe, Eric; Radimerski, Thomas; Gaul, Christoph; Weinstock, David M.

    2015-01-01

    Summary A variety of cancers depend on JAK2 signaling, including the high-risk subset of B-cell acute lymphoblastic leukemias (B-ALLs) with CRLF2 rearrangements. Type I JAK2 inhibitors induce paradoxical JAK2 hyperphosphorylation in these leukemias and have limited activity. To improve the efficacy of JAK2 inhibition in B-ALL, we developed the type II inhibitor CHZ868, which stabilizes JAK2 in an inactive conformation. CHZ868 potently suppressed the growth of CRLF2-rearranged human B-ALL cells, abrogated JAK2 signaling, and improved survival in mice with human or murine B-ALL. CHZ868 and dexamethasone synergistically induced apoptosis in JAK2-dependent B-ALLs and further improved in vivo survival compared to CHZ868 alone. These data support the testing of type II JAK2 inhibition in patients with JAK2-dependent leukemias and other disorders. PMID:26175414

  14. Safety, pharmacokinetic, and efficacy studies of oral DB868 in a first stage vervet monkey model of human African trypanosomiasis.

    Directory of Open Access Journals (Sweden)

    John K Thuita

    Full Text Available There are no oral drugs for human African trypanosomiasis (HAT, sleeping sickness. A successful oral drug would have the potential to reduce or eliminate the need for patient hospitalization, thus reducing healthcare costs of HAT. The development of oral medications is a key objective of the Consortium for Parasitic Drug Development (CPDD. In this study, we investigated the safety, pharmacokinetics, and efficacy of a new orally administered CPDD diamidine prodrug, 2,5-bis[5-(N-methoxyamidino-2-pyridyl]furan (DB868; CPD-007-10, in the vervet monkey model of first stage HAT. DB868 was well tolerated at a dose up to 30 mg/kg/day for 10 days, a cumulative dose of 300 mg/kg. Mean plasma levels of biomarkers indicative of liver injury (alanine aminotransferase, aspartate aminotransferase were not significantly altered by drug administration. In addition, no kidney-mediated alterations in creatinine and urea concentrations were detected. Pharmacokinetic analysis of plasma confirmed that DB868 was orally available and was converted to the active compound DB829 in both uninfected and infected monkeys. Treatment of infected monkeys with DB868 began 7 days post-infection. In the infected monkeys, DB829 attained a median C(max (dosing regimen that was 12-fold (3 mg/kg/day for 7 days, 15-fold (10 mg/kg/day for 7 days, and 31-fold (20 mg/kg/day for 5 days greater than the IC50 (14 nmol/L against T. b. rhodesiense STIB900. DB868 cured all infected monkeys, even at the lowest dose tested. In conclusion, oral DB868 cured monkeys with first stage HAT at a cumulative dose 14-fold lower than the maximum tolerated dose and should be considered a lead preclinical candidate in efforts to develop a safe, short course (5-7 days, oral regimen for first stage HAT.

  15. Safety, Pharmacokinetic, and Efficacy Studies of Oral DB868 in a First Stage Vervet Monkey Model of Human African Trypanosomiasis

    Science.gov (United States)

    Thuita, John K.; Wolf, Kristina K.; Murilla, Grace A.; Liu, Qiang; Mutuku, James N.; Chen, Yao; Bridges, Arlene S.; Mdachi, Raymond E.; Ismail, Mohamed A.; Ching, Shelley; Boykin, David W.; Hall, James Edwin; Tidwell, Richard R.; Paine, Mary F.; Brun, Reto; Wang, Michael Zhuo

    2013-01-01

    There are no oral drugs for human African trypanosomiasis (HAT, sleeping sickness). A successful oral drug would have the potential to reduce or eliminate the need for patient hospitalization, thus reducing healthcare costs of HAT. The development of oral medications is a key objective of the Consortium for Parasitic Drug Development (CPDD). In this study, we investigated the safety, pharmacokinetics, and efficacy of a new orally administered CPDD diamidine prodrug, 2,5-bis[5-(N-methoxyamidino)-2-pyridyl]furan (DB868; CPD-007-10), in the vervet monkey model of first stage HAT. DB868 was well tolerated at a dose up to 30 mg/kg/day for 10 days, a cumulative dose of 300 mg/kg. Mean plasma levels of biomarkers indicative of liver injury (alanine aminotransferase, aspartate aminotransferase) were not significantly altered by drug administration. In addition, no kidney-mediated alterations in creatinine and urea concentrations were detected. Pharmacokinetic analysis of plasma confirmed that DB868 was orally available and was converted to the active compound DB829 in both uninfected and infected monkeys. Treatment of infected monkeys with DB868 began 7 days post-infection. In the infected monkeys, DB829 attained a median Cmax (dosing regimen) that was 12-fold (3 mg/kg/day for 7 days), 15-fold (10 mg/kg/day for 7 days), and 31-fold (20 mg/kg/day for 5 days) greater than the IC50 (14 nmol/L) against T. b. rhodesiense STIB900. DB868 cured all infected monkeys, even at the lowest dose tested. In conclusion, oral DB868 cured monkeys with first stage HAT at a cumulative dose 14-fold lower than the maximum tolerated dose and should be considered a lead preclinical candidate in efforts to develop a safe, short course (5–7 days), oral regimen for first stage HAT. PMID:23755309

  16. 7 CFR 868.310 - Grades and grade requirements for the classes Long Grain Milled Rice, Medium Grain Milled Rice...

    Science.gov (United States)

    2010-01-01

    ... Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice. (See also Â... Milled Rice Principles Governing Application of Standards § 868.310 Grades and grade requirements for the classes Long Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice...

  17. Association between cotinine-verified smoking status and hypertension in 167,868 Korean adults.

    Science.gov (United States)

    Kim, Byung Jin; Han, Ji Min; Kang, Jung Gyu; Kim, Bum Soo; Kang, Jin Ho

    2017-10-01

    Previous studies showed inconsistent results concerning the relationship between chronic smoking and blood pressure. Most of the studies involved self-reported smoking status. This study was performed to evaluate the association of urinary cotinine or self-reported smoking status with hypertension and blood pressure in Korean adults. Among individuals enrolled in the Kangbuk Samsung Health Study and Kangbuk Samsung Cohort Study, 167,868 participants (men, 55.7%; age, 37.5 ± 6.9 years) between 2011 and 2013 who had urinary cotinine measurements were included. Individuals with urinary cotinine levels ≥50 ng/mL were defined as cotinine-verified current smokers. The prevalence of hypertension and cotinine-verified current smokers in the overall population was 6.8% and 22.7%, respectively (10.0% in men and 2.8% in women for hypertension: 37.7% in men and 3.9% in women for cotinine-verified current smokers). In a multivariate regression analysis adjusted for age, sex, body mass index, waist circumference, alcohol drinking, vigorous exercise, and diabetes, cotinine-verified current smoking was associated with lower prevalence of hypertension compared with cotinine-verified never smoking (OR[95% CI], 0.79 [0.75, 0.84]). Log-transformed cotinine levels and unobserved smoking were negatively associated with hypertension, respectively (0.96 [0.96, 0.97] and 0.55 [0.39, 0.79]). In a multivariate linear regression analysis, the cotinine-verified current smoking was inversely associated with systolic and diastolic blood pressure (BP) (regression coefficient[95% CI], -1.23[-1.39, -1.07] for systolic BP and -0.71 [-0.84, -0.58] for diastolic BP). In subgroup analyses according to sex, the inverse associations between cotinine-verified current smoking and hypertension were observed only in men. This large observational study showed that cotinine-verified current smoking and unobserved smoking were inversely associated with hypertension in Korean adults, especially only in

  18. Réflexions sur un critère de classification des animaux chez le savant al-Djâhiz (776-868 )

    DEFF Research Database (Denmark)

    Ben Saad, Meyssa; Katouzian-Safadi, Mehrnaz; Provencal, Philippe

    2013-01-01

    Al-Djâhiz (776-868) var en arabisk sproget naturhistoriker og litterat, som levede i Iraq i det 9. århundrede. Han skrev et zoologisk værk, som er baseret på Aristoteles' zoologi men i hvilket han også indføjer sine egne observationer og overvejelser. I denne artikel bliver hans overvejelser over...

  19. Chemotherapy of second stage human African trypanosomiasis: comparison between the parenteral diamidine DB829 and its oral prodrug DB868 in vervet monkeys.

    Directory of Open Access Journals (Sweden)

    John K Thuita

    2015-02-01

    Full Text Available Human African trypanosomiasis (HAT, sleeping sickness ranks among the most neglected tropical diseases based on limited availability of drugs that are safe and efficacious, particularly against the second stage (central nervous system [CNS] of infection. In response to this largely unmet need for new treatments, the Consortium for Parasitic Drug Development developed novel parenteral diamidines and corresponding oral prodrugs that have shown cure of a murine model of second stage HAT. As a rationale for selection of one of these compounds for further development, the pharmacokinetics and efficacy of intramuscular (IM active diamidine 2,5-bis(5-amidino-2-pyridylfuran (DB829; CPD-0802 and oral prodrug2,5-bis[5-(N-methoxyamidino-2-pyridyl]furan (DB868 were compared in the vervet monkey model of second stage HAT. Treatment was initiated 28 days post-infection of monkeys with T. b. rhodesiense KETRI 2537. Results showed that IM DB829 at 5 mg/kg/day for 5 consecutive days, 5 mg/kg/day every other day for 5 doses, or 2.5 mg/kg/day for 5 consecutive days cured all monkeys (5/5. Oral DB868 was less successful, with no cures (0/2 at 3 mg/kg/day for 10 days and cure rates of 1/4 at 10 mg/kg/day for 10 days and 20 mg/kg/day for 10 days; in total, only 2/10 monkeys were cured with DB868 dose regimens. The geometric mean plasma Cmax of IM DB829 at 5 mg/kg following the last of 5 doses was 25-fold greater than that after 10 daily oral doses of DB868 at 20 mg/kg. These data suggest that the active diamidine DB829, administered IM, should be considered for further development as a potential new treatment for second stage HAT.

  20. Chemotherapy of Second Stage Human African Trypanosomiasis: Comparison between the Parenteral Diamidine DB829 and Its Oral Prodrug DB868 in Vervet Monkeys

    Science.gov (United States)

    Thuita, John K.; Wolf, Kristina K.; Murilla, Grace A.; Bridges, Arlene S.; Boykin, David W.; Mutuku, James N.; Liu, Qiang; Jones, Susan K.; Gem, Charles O.; Ching, Shelley; Tidwell, Richard R.; Wang, Michael Z.; Paine, Mary F.; Brun, Reto

    2015-01-01

    Human African trypanosomiasis (HAT, sleeping sickness) ranks among the most neglected tropical diseases based on limited availability of drugs that are safe and efficacious, particularly against the second stage (central nervous system [CNS]) of infection. In response to this largely unmet need for new treatments, the Consortium for Parasitic Drug Development developed novel parenteral diamidines and corresponding oral prodrugs that have shown cure of a murine model of second stage HAT. As a rationale for selection of one of these compounds for further development, the pharmacokinetics and efficacy of intramuscular (IM) active diamidine 2,5-bis(5-amidino-2-pyridyl)furan (DB829; CPD-0802) and oral prodrug2,5-bis[5-(N-methoxyamidino)-2-pyridyl]furan (DB868) were compared in the vervet monkey model of second stage HAT. Treatment was initiated 28 days post-infection of monkeys with T. b. rhodesiense KETRI 2537. Results showed that IM DB829 at 5 mg/kg/day for 5 consecutive days, 5 mg/kg/day every other day for 5 doses, or 2.5 mg/kg/day for 5 consecutive days cured all monkeys (5/5). Oral DB868 was less successful, with no cures (0/2) at 3 mg/kg/day for 10 days and cure rates of 1/4 at 10 mg/kg/day for 10 days and 20 mg/kg/day for 10 days; in total, only 2/10 monkeys were cured with DB868 dose regimens. The geometric mean plasma Cmax of IM DB829 at 5 mg/kg following the last of 5 doses was 25-fold greater than that after 10 daily oral doses of DB868 at 20 mg/kg. These data suggest that the active diamidine DB829, administered IM, should be considered for further development as a potential new treatment for second stage HAT. PMID:25654243

  1. Overvejelser over systematikkriterier på dyr hos videnskabsmanden al-Djâhiz (776-868): Formeringsmåder hos fugle og krybdyr.

    OpenAIRE

    Ben Saad, Meyssa; Katouzian-Safadi, Mehrnaz; Provencal, Philippe

    2013-01-01

    Al-Djâhiz (776-868) var en arabisk sproget naturhistoriker og litterat, som levede i Iraq i det 9. århundrede. Han skrev et zoologisk værk, som er baseret på Aristoteles' zoologi men i hvilket han også indføjer sine egne observationer og overvejelser. I denne artikel bliver hans overvejelser over formering som kriterium for en inddeling af dyrene diskuteret.

  2. Chemotherapy of second stage human African trypanosomiasis: comparison between the parenteral diamidine DB829 and its oral prodrug DB868 in vervet monkeys.

    Science.gov (United States)

    Thuita, John K; Wolf, Kristina K; Murilla, Grace A; Bridges, Arlene S; Boykin, David W; Mutuku, James N; Liu, Qiang; Jones, Susan K; Gem, Charles O; Ching, Shelley; Tidwell, Richard R; Wang, Michael Z; Paine, Mary F; Brun, Reto

    2015-02-01

    Human African trypanosomiasis (HAT, sleeping sickness) ranks among the most neglected tropical diseases based on limited availability of drugs that are safe and efficacious, particularly against the second stage (central nervous system [CNS]) of infection. In response to this largely unmet need for new treatments, the Consortium for Parasitic Drug Development developed novel parenteral diamidines and corresponding oral prodrugs that have shown cure of a murine model of second stage HAT. As a rationale for selection of one of these compounds for further development, the pharmacokinetics and efficacy of intramuscular (IM) active diamidine 2,5-bis(5-amidino-2-pyridyl)furan (DB829; CPD-0802) and oral prodrug2,5-bis[5-(N-methoxyamidino)-2-pyridyl]furan (DB868) were compared in the vervet monkey model of second stage HAT. Treatment was initiated 28 days post-infection of monkeys with T. b. rhodesiense KETRI 2537. Results showed that IM DB829 at 5 mg/kg/day for 5 consecutive days, 5 mg/kg/day every other day for 5 doses, or 2.5 mg/kg/day for 5 consecutive days cured all monkeys (5/5). Oral DB868 was less successful, with no cures (0/2) at 3 mg/kg/day for 10 days and cure rates of 1/4 at 10 mg/kg/day for 10 days and 20 mg/kg/day for 10 days; in total, only 2/10 monkeys were cured with DB868 dose regimens. The geometric mean plasma Cmax of IM DB829 at 5 mg/kg following the last of 5 doses was 25-fold greater than that after 10 daily oral doses of DB868 at 20 mg/kg. These data suggest that the active diamidine DB829, administered IM, should be considered for further development as a potential new treatment for second stage HAT.

  3. An 8.68% efficiency chemically-doped-free graphene-silicon solar cell using silver nanowires network buried contacts.

    Science.gov (United States)

    Yang, Lifei; Yu, Xuegong; Hu, Weidan; Wu, Xiaolei; Zhao, Yan; Yang, Deren

    2015-02-25

    Graphene-silicon (Gr-Si) heterojunction solar cells have been recognized as one of the most low-cost candidates in photovoltaics due to its simple fabrication process. However, the high sheet resistance of chemical vapor deposited (CVD) Gr films is still the most important limiting factor for the improvement of the power conversion efficiency of Gr-Si solar cells, especially in the case of large device-active area. In this work, we have fabricated a novel transparent conductive film by hybriding a monolayer Gr film with silver nanowires (AgNWs) network soldered by the graphene oxide (GO) flakes. This Gr-AgNWs hybrid film exhibits low sheet resistance and larger direct-current to optical conductivity ratio, quite suitable for solar cell fabrication. An efficiency of 8.68% has been achieved for the Gr-AgNWs-Si solar cell, in which the AgNWs network acts as buried contacts. Meanwhile, the Gr-AgNWs-Si solar cells have much better stability than the chemically doped Gr-Si solar cells. These results show a new route for the fabrication of high efficient and stable Gr-Si solar cells.

  4. Analyses and optimization of Lee propagation model for LoRa 868 MHz network deployments in urban areas

    Directory of Open Access Journals (Sweden)

    Dobrilović Dalibor

    2017-01-01

    Full Text Available In the recent period, fast ICT expansion and rapid appearance of new technologies raised the importance of fast and accurate planning and deployment of emerging communication technologies, especially wireless ones. In this paper is analyzed possible usage of Lee propagation model for planning, design and management of networks based on LoRa 868MHz technology. LoRa is wireless technology which can be deployed in various Internet of Things and Smart City scenarios in urban areas. The analyses are based on comparison of field measurements with model calculations. Besides the analyses of Lee propagation model usability, the possible optimization of the model is discussed as well. The research results can be used for accurate design, planning and for preparation of high-performance wireless resource management of various Internet of Things and Smart City applications in urban areas based on LoRa or similar wireless technology. The equipment used for measurements is based on open-source hardware.

  5. Indoor radio channel modeling and mitigation of fading effects using linear and circular polarized antennas in combination for smart home system at 868 MHz

    Science.gov (United States)

    Wunderlich, S.; Welpot, M.; Gaspard, I.

    2014-11-01

    The markets for smart home products and services are expected to grow over the next years, driven by the increasing demands of homeowners considering energy monitoring, management, environmental controls and security. Many of these new systems will be installed in existing homes and offices and therefore using radio based systems for cost reduction. A drawback of radio based systems in indoor environments are fading effects which lead to a high variance of the received signal strength and thereby to a difficult predictability of the encountered path loss of the various communication links. For that reason it is necessary to derive a statistical path loss model which can be used to plan a reliable and cost effective radio network. This paper presents the results of a measurement campaign, which was performed in six buildings to deduce realistic radio channel models for a high variety of indoor radio propagation scenarios in the short range devices (SRD) band at 868 MHz. Furthermore, a potential concept to reduce the variance of the received signal strength using a circular polarized (CP) patch antenna in combination with a linear polarized antenna in an one-to-one communication link is presented.

  6. A 868MHz-based wireless sensor network for ground truthing of soil moisture for a hyperspectral remote sensing campaign - design and preliminary results

    Science.gov (United States)

    Näthe, Paul; Becker, Rolf

    2014-05-01

    Soil moisture and plant available water are important environmental parameters that affect plant growth and crop yield. Hence, they are significant parameters for vegetation monitoring and precision agriculture. However, validation through ground-based soil moisture measurements is necessary for accessing soil moisture, plant canopy temperature, soil temperature and soil roughness with airborne hyperspectral imaging systems in a corresponding hyperspectral imaging campaign as a part of the INTERREG IV A-Project SMART INSPECTORS. At this point, commercially available sensors for matric potential, plant available water and volumetric water content are utilized for automated measurements with smart sensor nodes which are developed on the basis of open-source 868MHz radio modules, featuring a full-scale microcontroller unit that allows an autarkic operation of the sensor nodes on batteries in the field. The generated data from each of these sensor nodes is transferred wirelessly with an open-source protocol to a central node, the so-called "gateway". This gateway collects, interprets and buffers the sensor readings and, eventually, pushes the data-time series onto a server-based database. The entire data processing chain from the sensor reading to the final storage of data-time series on a server is realized with open-source hardware and software in such a way that the recorded data can be accessed from anywhere through the internet. It will be presented how this open-source based wireless sensor network is developed and specified for the application of ground truthing. In addition, the system's perspectives and potentials with respect to usability and applicability for vegetation monitoring and precision agriculture shall be pointed out. Regarding the corresponding hyperspectral imaging campaign, results from ground measurements will be discussed in terms of their contributing aspects to the remote sensing system. Finally, the significance of the wireless sensor

  7. 868-IJBCS-Article-Innocent Imosemi

    African Journals Online (AJOL)

    DR GATSING

    administered one hour prior to phenytoin treatment separately, while control animals received tap water only. .... Animals. Twenty sexually matured female rats weighing about 160 g of Wistar strain were obtained from the central animal house of the. Faculty of Basic Medical ..... such play a critical role in wellness and health.

  8. 7 CFR 868.80 - Who may be licensed.

    Science.gov (United States)

    2010-01-01

    ...; and (3) Has no interest, financial or otherwise, direct or indirect in merchandising, handling... indirect in merchandising, handling, storing, or processing the kind of commodities or related products to...

  9. 21 CFR 868.1120 - Indwelling blood oxyhemoglobin concentration analyzer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Indwelling blood oxyhemoglobin concentration... Indwelling blood oxyhemoglobin concentration analyzer. (a) Identification. An indwelling blood oxyhemoglobin concentration analyzer is a photoelectric device used to measure, in vivo, the oxygen-carrying capacity of...

  10. 7 CFR 868.1 - Meaning of terms.

    Science.gov (United States)

    2010-01-01

    ... following terms have the meanings given for them in this paragraph. (1) Act. The Agricultural Marketing Act... established scientific principles and laboratory procedures. [53 FR 3722, Feb. 9, 1988, as amended at 60 FR...

  11. 7 CFR 868.212 - Special grades and requirements.

    Science.gov (United States)

    2010-01-01

    .... Tolerances for live insects for infested rough rice are defined according to sampling designations as follows...) of this section will be considered infested if the representative sample contains two or more live weevils, or one live weevil and one or more other live insects injurious to stored rice or five or more...

  12. 7 CFR 868.302 - Definition of other terms.

    Science.gov (United States)

    2010-01-01

    ... red bran. (l) Seeds. Whole or broken seeds of any plant other than rice. (m) Types of rice. There are... types of rice: Long Grain Milled Rice. Medium Grain Milled Rice. Short Grain Milled Rice. Mixed Milled....0 percent of “other types” as defined in paragraph (i) of this section. U.S. No. 5 and U.S. No. 6...

  13. 7 CFR 868.252 - Definition of other terms.

    Science.gov (United States)

    2010-01-01

    .... Classes shall be based on the percentage of whole kernels, broken kernels, and types of rice. (1) “Long... and more than 10.0 percent of “other types” as defined in paragraph (i) of this section. (e) Damaged... of brown rice for processing to a well-milled degree. (h) Objectionable seeds. Whole or broken seeds...

  14. 7 CFR 868.202 - Definition of other terms.

    Science.gov (United States)

    2010-01-01

    ... Rice Classes shall be based on the percentage of whole kernels, large broken kernels, and types of rice... which, after milling to a well-milled degree, contains more than 10 percent of “other types” as defined...-milled degree. (g) Objectionable seeds. Seeds other than rice, except seeds of Echinochloa crusgalli...

  15. 40 CFR 63.868 - Delegation of authority.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS FOR SOURCE CATEGORIES (CONTINUED) National Emission Standards for Hazardous Air Pollutants for Chemical Recovery Combustion Sources at Kraft... transferred to a State. (b) The authorities which will not be delegated to States are listed in paragraphs (b...

  16. Deactivation of the Ground Launched Cruise Missile Training System, 868 Tactical Missile Training Group

    Science.gov (United States)

    1988-04-01

    101 1.5 ton Comm TIr 5 0 6--FAX 4x2 I ’ 5-Ton Tractor 1 0 15-Ton Forklift 3 0 25 ft Trailer 1 o 6-PAX 4x4 1 -, 1.5-ton Truck 1 0" Metro Van 1 0 &A...Capt 1835 8 Tech/Disp/Inst Comm TSgt 304XX 3 SSet 304XX 6 Sst 304XX 1 Tech/Disp/Inst Msl Tech MS9t 41170 3 TSt 411X1 3 TSgt 411X0 3 SSgt 411X0 1 Sct

  17. 7 CFR 868.61 - How to request appeal inspection service.

    Science.gov (United States)

    2010-01-01

    ... may be made with the Board of Appeals and Review or the field office that performed the appeal... application shall be made: (i) Before the rice has left the place where the inspection being appealed was... inspection be based on: (i) The file sample or (ii) a new sample. However, an appeal inspection shall be...

  18. 21 CFR 868.1170 - Indwelling blood hydrogen ion concentration (pH) analyzer.

    Science.gov (United States)

    2010-04-01

    ... Indwelling blood hydrogen ion concentration (pH) analyzer. (a) Identification. An indwelling blood hydrogen ion concentration (pH) analyzer is a device that consists of a catheter-tip pH electrode and that is... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Indwelling blood hydrogen ion concentration (pH...

  19. 21 CFR 868.1200 - Indwelling blood oxygen partial pressure (PO2) analyzer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Indwelling blood oxygen partial pressure (PO2... Indwelling blood oxygen partial pressure (PO2) analyzer. (a) Identification. An indwelling blood oxygen partial pressure (PO2) analyzer is a device that consists of a catheter-tip PO2 transducer (e.g., PO2...

  20. Characterization and modeling of on-body spatial diversity within indoor environments at 868 MHz

    NARCIS (Netherlands)

    Cotton, S.L.; Scanlon, W.G.

    For the first time in the open literature we present a full characterization of the performance of receiver diversity for the on-body channels found in body area networks. The study involved three commonly encountered diversity combining schemes: selection combination (SC), maximal ratio combining

  1. Interference Measurements in the European 868 MHz ISM Band with Focus on LoRa and SigFox

    DEFF Research Database (Denmark)

    Lauridsen, Mads; Vejlgaard, Benny; Kovács, István

    2017-01-01

    In this measurement study the signal activity and power levels are measured in the European Industrial, Scientific, and Medical band 863-870 MHz in the city of Aalborg, Denmark. The target is to determine if there is any interference, which may impact deployment of Internet of Things devices. The...

  2. Wayne Interim Storage Site environmental report for calendar year 1992, 868 Black Oak Ridge Road, Wayne, New Jersey

    International Nuclear Information System (INIS)

    1993-05-01

    This report describes the environmental surveillance program at the Wayne Interim Storage Site (WISS) and provides the results for 1992. The fenced, site, 32 km (20 mi) northwest of Newark, New Jersey, was used between 1948 and 1971 for commercial processing of monazite sand to separate natural radioisotopes - predominantly thorium. Environmental surveillance of WISS began in 1984 in accordance with Department of Energy (DOE) Order 5400.1 when Congress added the site to DOE's Formerly Utilized Sites Remedial Action Program (FUSRAP). The environmental surveillance program at WISS includes sampling networks for radon and thoron in air; external gamma radiation exposure; radium-226, radium-228, thorium-230, thorium-232, total uranium, and several chemicals in surface water and sediment; and total uranium, radium-226, radium-228, thorium-230, thorium-232, and organic and inorganic chemicals in groundwater. Monitoring results are compared with applicable Environmental Protection Agency (EPA) and state standards, DOE derived concentration guides (DCGs), dose limits, and other DOE requirements. This monitoring program assists in fulfilling the DOE policy of measuring and monitoring effluents from DOE activities and calculating hypothetical doses. Results for environmental surveillance in 1992 show that the concentrations of all radioactive and most chemical contaminants were below applicable standards

  3. 21 CFR 868.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... reasonably foreseeable characteristics of commercially distributed devices within that generic type or, in... device operates using a different fundamental scientific technology than a legally marketed device in... immunoglobulin G (IgG) or IgG assays when the results are not qualitative, or are used to determine immunity, or...

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB868 (Link to dictyBase) - - - Contig-U15649-1 VFB868F (Link... to Original site) VFB868F 110 - - - - - - Show VFB868 Library VF (Link to library) Clone ID VFB868 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15649-1 Original site URL http://dict...c 4.0 %: cytoskeletal >> prediction for VFB868 is nuc 5' end seq. ID VFB868F 5' end seq. >VFB868F.Seq TATTAA

  5. Gene : CBRC-DRER-26-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3 /ug=Dr.90837 /len=868 2e-21 37% MSVLCDICLSIHSFIHSFIHSFIHSFIHSFIHSFIHSFILPSFPPLF...LFFLSSSILLSIHLSIHPSTHQCLSLSIHPSIHPSFLPSIIHPFIHPSSIHPSIHPSIHPSIHPSIHPSFLPSSIHPSIHPSIHPSILPSFLPSIYPFLPSFNPSIILLYNSSIHPFILSSIHPFIHLSFLPS...FLPSFLPSFLPSFLPSFLPSFLPSFLPSIHPSIHPSIHPFILSSFLPSFLPSFYISFLPSFLPSFPLLYSTHPSIHLFILPSNLTTICSSFHPSFLPS...FLPFILLFSFLPSFHHFTVQFLYRSICPSFLSSFLPSFLPSFLPSFLPSFLPSFLPSFHLFFFFPSFHPSIILL ...

  6. Electron-Transfer Acceleration Investigated by Time Resolved Infrared Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Vlček, Antonín; Kvapilová, Hana; Towrie, M.; Záliš, Stanislav

    2015-01-01

    Roč. 48, č. 3 (2015), s. 868-876 ISSN 0001-4842 Institutional support: RVO:61388955 Keywords : electron transfer * infrared spectroscopy Subject RIV: CG - Electrochemistry Impact factor: 22.003, year: 2015

  7. 2006 U.S. Geological Survey Topographic LiDAR: Alameda County

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Light Detection and Ranging (LiDAR) data set is a survey of Alameda County in Northern California. The entire survey covers approximately 868.382 square miles....

  8. Aulacoseira kruegeriana (Bacillariophyta, Coscinodiscophyceae): a new centric diatom from high-elevation Andean streams of Bolivia

    Czech Academy of Sciences Publication Activity Database

    Morales, E. A.; Rivera, S. F.; Rubin, S. D. C.; Vis, M. L.; Houk, Václav

    2015-01-01

    Roč. 30, č. 3 (2015), s. 269-277 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : centric diatoms * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.868, year: 2015

  9. Artificial cryopreserved embryo transfer cycle success depends on blastocyst developmental rate and progesterone timing

    DEFF Research Database (Denmark)

    Ozgur, Kemal; Bulut, Hasan; Berkkanoglu, Murat

    2018-01-01

    This retrospective cohort analysis compared the developmental competence of cryopreserved day-4 and 5 blastocysts, and investigated the effect of progesterone administration duration on the success of artificial frozen embryo transfers. Between October 2015 and March 2016, 868 intracytoplasmic sp...

  10. Membrane Binding of Recoverin: From Mechanistic Understanding to Biological Functionality

    Czech Academy of Sciences Publication Activity Database

    Timr, S.; Pleskot, Roman; Kadlec, J.; Kohagen, M.; Magarkar, A.; Jungwirth, P.

    2017-01-01

    Roč. 3, č. 8 (2017), s. 868-874 ISSN 2374-7943 Institutional support: RVO:61389030 Keywords : recoverin * membrane * myristoyl Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Cell biology Impact factor: 7.481, year: 2016

  11. Loading of Arabidopsis centromeric histone CENH3 occurs mainly during G2 and requires the presence of the histone fold domain

    Czech Academy of Sciences Publication Activity Database

    Lermontova, L.; Schubert, V.; Fuchs, J.; Klatte, J.; Macas, Jiří; Schubert, I.

    2006-01-01

    Roč. 18, - (2006), s. 2443-2451 ISSN 1040-4651 Institutional research plan: CEZ:AV0Z50510513 Keywords : histone CENH3 * Arabidopsis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.868, year: 2006

  12. A Reaction Sphere for High Performance Attitude Control, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Our innovative reaction sphere (Doty pending patent application serial number 61/164,868) has the potential to provide much higher performance than a conventional...

  13. South African Medical Journal - Vol 93, No 11 (2003)

    African Journals Online (AJOL)

    Visuospatial deficits in children 3 - 7 years old with shunted hydrocephalus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S.V. Frank, T Lazarus, N Nathoo, 865-868 ...

  14. Observations of interstellar silicon monoxide

    International Nuclear Information System (INIS)

    Dickinson, D.F.; Gottlieb, C.A.; Gottlieb, E.W.; Litvak, M.M.

    1976-01-01

    We report observations of rotational transitions of SiO in the ground vibrational state at 86.8 GHz (J=2→1) and 130.3 GHz (J=3→2). At 86.8 GHz, SiO emission in Orion A peaks in the direction of the Kleinmann-Low nebula. A possible secondary maximum occurs about 80'' southward. The 130.3 GHz line was also detected in Orion A. Mapping of the 86.8 GHz line in Sgr B2 shows the presence of two velocity components and a north-south extent of about 4'. Comparison of the data with radiative-transport calculations implies that if the hydrogen density is approximately 10 5 cm -3 then the SiO column density is approximately 10 15 cm -2 for Orion A at 60 K.Upper limits to the total HO 2 column density in Orion A and Sgr B2 are reported

  15. Dicty_cDB: SLF225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF225 (Link to dictyBase) - - - Contig-U16171-1 SLF225P (Link to Original site) SLF22...5F 132 SLF225Z 444 SLF225P 576 - - Show SLF225 Library SL (Link to library) Clone ID SLF22... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF2-B/SLF225Q.Seq.d/ Representative seq. ID SLF22...5P (Link to Original site) Representative DNA sequence >SLF225 (SLF225Q) /CSM/SL/SLF2-B/SLF22...icant alignments: (bits) Value VFA868 (VFA868Q) /CSM/VF/VFA8-C/VFA868Q.Seq.d/ 618 e-176 SLF225 (SLF225Q) /CSM/SL/SLF2-B/SLF22

  16. 32 CFR 256.3 - Criteria.

    Science.gov (United States)

    2010-07-01

    ... height standards defined in AFM 86-8, 1 NavFac P-272 and P-80, 1 and TM 5-803-4 1 will be used for... Assistant Secretary of Defense (Installations and Logistics)—ID, Washington, DC 20301. (c) Accident... for the purpose of defining accident potential areas. Class A runways are those restricted to light...

  17. Neuro-acanthocytosis a rare cause of chorea

    African Journals Online (AJOL)

    reflexes were depressed bilaterally. Sensory and cerebellar examinations were normal. Her gait was dystonic. Division of Neurology, Oepartment of .... Levine IM, Emerson CP_ A new heredItary acanmocyt05is syndrome. Am J Med 1967; 42: 868-881. 3. Hardie RJ. Pullon HWH, Harding AE, er al. Neuroacanlhocylo$Js. A ...

  18. 77 FR 15712 - Atlantic Highly Migratory Species; 2012 Atlantic Bluefin Tuna Quota Specifications

    Science.gov (United States)

    2012-03-16

    ... meeting, ICCAT recommended a TAC of 1,750 mt annually for 2011 and for 2012, inclusive of dead discards... Rebuilding Program). This amount is expected to allow for continued stock growth under the both the low and... 868.6 mt, which is 175 mt less than the amount of quota (inclusive of dead discards) allowed under...

  19. ADHD Is Associated with a "Western" Dietary Pattern in Adolescents

    Science.gov (United States)

    Howard, Amber L.; Robinson, Monique; Smith, Grant J.; Ambrosini, Gina L.; Piek, Jan P.; Oddy, Wendy H.

    2011-01-01

    Objective: To examine the relationship between dietary patterns and ADHD in a population-based cohort of adolescents. Method: The Raine Study is a prospective study following 2,868 live births. At the 14-year follow-up, the authors collected detailed adolescent dietary data, allowing for the determination of major dietary patterns using factor…

  20. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Sushil Kumar Jaiswal. Articles written in Journal of Genetics. Volume 93 Issue 3 December 2014 pp 865-868 Research Note. Overlap of Patau and Pierre Robin syndromes along with abnormal metabolism: an interesting case study · Sushil Kumar Jaiswal Krishna Kishore Sukla Vineeta ...

  1. anion dependence

    Indian Academy of Sciences (India)

    SUMAN Das

    Raven E 2007 Extraction of glycerol from biodiesel into a eutectic based ionic liquid Green Chem. 9 868. 9. Abbott A P, Bell T J, Handa S and Stoddart B 2006. Cationic functionalisation of cellulose using a choline based ionic liquid analogue Green Chem. 8 784. 10. ZhaoHandBakerGA2013Ionicliquidsanddeepeutec-.

  2. A note on boundedness of the Hardy–Littlewood maximal operator on Morrey spaces

    Czech Academy of Sciences Publication Activity Database

    Gogatishvili, Amiran; Mustafayev, R.

    2016-01-01

    Roč. 13, č. 4 (2016), s. 1885-1891 ISSN 1660-5446 R&D Projects: GA ČR GA13-14743S Institutional support: RVO:67985840 Keywords : Morrey spaces * maximal operator Subject RIV: BA - General Mathematics Impact factor: 0.868, year: 2016 http://link.springer.com/article/10.1007/s00009-015-0614-3

  3. Catching fly balls: a simulation study of the Chapman strategy

    NARCIS (Netherlands)

    Kistemaker, D.A.; Faber, H.; Beek, P.J.

    2009-01-01

    Chapman [Chapman, S. (1968). Catching a baseball. American Journal of Physics, 36, 868-870] showed that a catcher may be guided to the landing spot of a fly ball by zeroing out its optical acceleration. Subsequently, various studies have provided evidence for what is now known as the Chapman

  4. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  5. Bifurcation methods of dynamical systems for handling nonlinear ...

    Indian Academy of Sciences (India)

    physics pp. 863–868. Bifurcation methods of dynamical systems for handling nonlinear wave equations. DAHE FENG and JIBIN LI. Center for Nonlinear Science Studies, School of Science, Kunming University of Science and Technology .... (b) It can be shown from (15) and (18) that the balance between the weak nonlinear.

  6. Search for forced oscillations in binaries 3. Improved elements and the detection of line-profile variability of the B4V + A6V: system AR Cas

    Czech Academy of Sciences Publication Activity Database

    Holmgren, D. E.; Hadrava, Petr; Harmanec, Petr; Eenens, P.; Corral, L. J.; Yang, S.; Ak, H.; Božić, H.

    1999-01-01

    Roč. 345, č. 3 (1999), s. 855-868 ISSN 0004-6361 R&D Projects: GA ČR GA205/96/0162; GA AV ČR IAA3003805 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.252, year: 1999

  7. Influence of Adsorption of Foreign Gases on Mass Transfer in Fine (Nanoscale) Capillaries.

    Czech Academy of Sciences Publication Activity Database

    Levdansky, Valerij Vladimirovič; Pavlyukevich, N.V.; Izák, Pavel; Ždímal, Vladimír

    2016-01-01

    Roč. 47, č. 7 (2016), s. 691-699 ISSN 1064-2285 R&D Projects: GA ČR GA14-12695S Institutional support: RVO:67985858 Keywords : capillary * meniscus * evaporation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.868, year: 2016

  8. Morphometric alterations, steatosis, fibrosis and active caspase-3 detection in carbamate bendiocarb treated rabbit liver

    Czech Academy of Sciences Publication Activity Database

    Petrovová, E.; Purzyc, H.; Mazenský, D.; Luptáková, L.; Torma, N.; Sopoliga, I.; Sedmera, David

    2015-01-01

    Roč. 30, č. 2 (2015), s. 212-222 ISSN 1520-4081 Institutional research plan: CEZ:AV0Z50110509 Institutional support: RVO:67985823 Keywords : bendiocarb * caspase-3 activity * fibrosis * toxicity * rabbit * liver Subject RIV: EA - Cell Biology Impact factor: 2.868, year: 2015

  9. Chemical composition of essential oil from the seeds of Nigella arvensis L. and assessment of its actimicrobial activity

    Czech Academy of Sciences Publication Activity Database

    Havlík, J.; Kokoška, L.; Vašíčková, Soňa; Valterová, Irena

    2006-01-01

    Roč. 21, č. 4 (2006), s. 713-717 ISSN 0882-5734 R&D Projects: GA ČR(CZ) GA525/02/0257 Institutional research plan: CEZ:AV0Z40550506 Keywords : Nigella arvensis L. * essential oil composition * antimicrobial activity Subject RIV: CC - Organic Chemistry Impact factor: 0.868, year: 2006

  10. Identification and characterisation of an androgen receptor from zebrafish Danio rerio

    DEFF Research Database (Denmark)

    Jørgensen, Anne; Andersen, Ole; Bjerregaard, Poul

    2007-01-01

    zebrafish Danio rerio. The predicted protein of 868 residues has an estimated calculated molecular weight of 96 kDa. The amino acid sequence of the zebrafish AR (zfRA) shows high homology with other vertebrate ARs. The highest overall similarity was 82% to ARs from fathead minnow (Pimephales promelas...

  11. Comparison of various oxidative treatments for removal of reactive ...

    African Journals Online (AJOL)

    Activated User

    (COD) and total organic carbon (TOC) contents of treated wastewater decreased appreciably from 83.6 to 63.7 mg/L and 86.8 to 72.8 mg/L, respectively. Additionally, Fourier Transform ... ferric ammonium sulphate and dipotassium salt of oxalic acid in 1:3 proportionality. Recrystallization of resultant ppt was carried out,.

  12. Overlap of Patau and Pierre Robin syndromes along with abnormal ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 93; Issue 3. Overlap of Patau and Pierre Robin syndromes along with abnormal metabolism: an interesting case study. Sushil Kumar Jaiswal Krishna Kishore Sukla Vineeta Gupta Amit Kumar Rai. Research Note Volume 93 Issue 3 December 2014 pp 865-868 ...

  13. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Journal of Genetics. Volume 79 Issue 3 2000 pp ... Construction of genetic linkage map of the medicinal and ornamental plant Catharanthus roseus · Sarika Gupta Sashi ..... 865-868 Research Note. Overlap of Patau and Pierre Robin syndromes along with abnormal metabolism: an interesting case study.

  14. Explaining differences between hospitals in number of organ donors

    NARCIS (Netherlands)

    Friele, R. D.; Coppen, R.; Marquet, R. L.; Gevers, J. K. M.

    2006-01-01

    The shortage of donor organs calls for a careful examination of all improvement options. In this study, 80 Dutch hospitals were compared. They provided 868 donors in a 5-year period, constituting 91% of all donors in that period in The Netherlands. Multilevel regression analysis was used to explain

  15. MANIFESTATIONS OF AGGRESSIVE ATYPICAL KAPOSI'S ...

    African Journals Online (AJOL)

    ... weight loss (86.8%), skin nodules (86.4%) and diarrhoea (55.3%). Virtually, all occupational groups were affected, with students, civil servants and businessmen topping the list. Key Words: Atypical Aggressive Kaposi's sarcoma, HIV infection. African Journal Of Clinical And Experimental Microbiology Jan 2004 Vol.5 No.1 ...

  16. Potchefstroom Electronic Law Journal/Potchefstroomse Elektroniese ...

    African Journals Online (AJOL)

    Proselytism and the Right to Freedom from Improper Irreligious Influence: The Example of Public School Education · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SA de Freitas, 868-887. http://dx.doi.org/10.4314/pelj.v17i3.1 ...

  17. The inverse of the divergence operator on perforated domains with applications to homogenization problems for the compressible Navier–Stokes system

    Czech Academy of Sciences Publication Activity Database

    Diening, L.; Feireisl, Eduard; Lu, Y.

    2017-01-01

    Roč. 23, č. 3 (2017), s. 851-868 ISSN 1292-8119 Keywords : perforated domains * Bogovskii type operators * homogenization * compressible Navier–Stokes system Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.540, year: 2016 https://www.esaim-cocv.org/articles/cocv/abs/2017/03/cocv160016-s/cocv160016-s.html

  18. Asymmetry and Frequency Characteristics of Instabilities in a Thermal Plasma Jet

    Czech Academy of Sciences Publication Activity Database

    Hlína, Jan; Gruber, Jan; Šonský, Jiří

    2012-01-01

    Roč. 40, č. 11 (2012), s. 2795-2799 ISSN 0093-3813 Institutional research plan: CEZ:AV0Z20570509 Keywords : Fourier transform * optical tomography * oscillation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.868, year: 2012 http://ieeeexplore.ieee.org

  19. Belief elicitation in experiments: is there a hedging problem?

    Czech Academy of Sciences Publication Activity Database

    Blanco, M.; Engelmann, Dirk; Koch, A. K.; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 4 (2010), s. 412-438 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : belief elicitation * hedging * experimental methodology Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  20. Cherenkov detectors and a new effective-mass spectrometer method

    Czech Academy of Sciences Publication Activity Database

    Hladký, Jan

    2006-01-01

    Roč. 75, - (2006), s. 854-855 ISSN 0969-806X Institutional research plan: CEZ:AV0Z10100502 Keywords : Cherenkov radiation * spectrometer * effective mass method Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 0.868, year: 2006

  1. Coding Variation in ANGPTL4, LPL, and SVEP1 and the Risk of Coronary Disease

    DEFF Research Database (Denmark)

    Stitziel, Nathan O; Stirrups, Kathleen E; Masca, Nicholas G D

    2016-01-01

    BACKGROUND: The discovery of low-frequency coding variants affecting the risk of coronary artery disease has facilitated the identification of therapeutic targets. METHODS: Through DNA genotyping, we tested 54,003 coding-sequence variants covering 13,715 human genes in up to 72,868 patients with ...

  2. [Serologic study of the diagnosis of Chagas disease in Nicaraguan students in the Juventud island].

    Science.gov (United States)

    Montes de Oca, N V; Cabrera Alonso, C; Martínez, R; Cantelar de Francisco, N; Pérez Insueta, O

    1989-01-01

    The results obtained during the serologic study for the diagnosis of Chagas' disease in 868 Nicaraguan students in the Isle of Youth are reported. Qualitative hemagglutination and indirect immunofluorescence were used. It was found that 8.5% of these students showed antibodies specific to Trypanosoma cruzi by means of this diagnostic test.

  3. Prolonged desipramine treatment increases the production of interleukin-10, an anti-inflammatory cytokine, in C57BL/6 mice subjected to the chronic mild stress model of depression

    Czech Academy of Sciences Publication Activity Database

    Kubera, M.; Maes, M.; Holáň, Vladimír; Basta-Kaim, A.; Roman, A.; Shani, J.

    2001-01-01

    Roč. 63, 1-3 (2001), s. 171-178 ISSN 0165-0327 R&D Projects: GA ČR GA310/99/0360 Institutional research plan: CEZ:AV0Z5052915 Keywords : mild stress model * desipramine * cytokines Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.868, year: 2001

  4. Tetraspan microdomains distinct from lipid rafts enrich select peptide-MHC class II complexes

    Czech Academy of Sciences Publication Activity Database

    Kropshofer, H.; Spindeldreher, S.; Rohn, T. A.; Platania, N.; Grygar, C.; Daniel, N.; Wolpl, A.; Langen, H.; Hořejší, Václav; Vogt, A. B.

    2002-01-01

    Roč. 3, č. 1 (2002), s. 61-68 ISSN 1529-2908 Institutional research plan: CEZ:AV0Z5052915 Keywords : MHC II * tetraspan microdomains * peptide presentation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 27.868, year: 2002

  5. Peptide-selective inrichment of MHC II-peptide complexes in tetraspan microdomains distinct from lipid rafts

    Czech Academy of Sciences Publication Activity Database

    Kropshofer, H.; Spindeldreher, S.; Rohn, T. A.; Platania, N.; Grygar, C.; Wolpl, A.; Langen, H.; Hořejší, Václav; Vogt, A. B.

    2002-01-01

    Roč. 3, č. 1 (2002), s. 61-68 ISSN 1529-2908 R&D Projects: GA MŠk LN00A026 Keywords : Microdomain * tetraspan proteins * MHC class II Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 27.868, year: 2002

  6. 76 FR 774 - Folding Metal Tables and Chairs From the People's Republic of China: Notice of Extension of Time...

    Science.gov (United States)

    2011-01-06

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-868] Folding Metal Tables and... review of the antidumping duty order on folding metal tables and chairs from the People's Republic of China (``PRC''). See Folding Metal Tables and Chairs: Initiation of New Shipper Review, 75 FR 44767...

  7. Arabidopsis Cytokinin Receptor Mutants Reveal Functions in Shoot Growth, Leaf Senescence, Seed Size, Germination, Root Development, and Cytokinin Metabolism

    Czech Academy of Sciences Publication Activity Database

    Riefler, M.; Novák, Ondřej; Strnad, Miroslav; Schmülling, T.

    2006-01-01

    Roč. 18, č. 1 (2006), s. 40-54 ISSN 1040-4651 Institutional research plan: CEZ:AV0Z50380511 Keywords : CYCLIN-DEPENDENT KINASES * PHYTOCHROME-B * SIGNAL-TRANSDUCTION Subject RIV: CE - Biochemistry Impact factor: 9.868, year: 2006

  8. Percutaneous Injuries in Doctors in the School of Medicine ...

    African Journals Online (AJOL)

    drawing blood, 17.4% used them when injections were administered, and 22.4% used gloves during intravenous cannulation. However, 86.8% of the respondents wore gloves when they used a scalpel or any other incision object. The respondents (n = 51) suggested that the three most important precautionary measures to ...

  9. Kansas's forests, 2005: statistics, methods, and quality assurance

    Science.gov (United States)

    Patrick D. Miles; W. Keith Moser; Charles J. Barnett

    2011-01-01

    The first full annual inventory of Kansas's forests was completed in 2005 after 8,868 plots were selected and 468 forested plots were visited and measured. This report includes detailed information on forest inventory methods and data quality estimates. Important resource statistics are included in the tables. A detailed analysis of Kansas inventory is presented...

  10. Automated detection of haemozoin-containing monocytes for the diagnosis of malaria in microscopically negative cases during pregnancy

    NARCIS (Netherlands)

    Hänscheid, Thomas; Längin, Matthias; Codices, Vera; Luty, Adrian J. F.; Adegnika, Ayola A.; Kremsner, Peter G.; Grobusch, Martin P.

    2009-01-01

    Plasmodium falciparum sequesters in the placenta. Cell-Dyn automated flow cytometric haematology analysers have the capacity to detect haemozoin-containing circulating leukocytes during routine FBC analysis. In Lambaréné, Gabon, 685 FBCs of pregnant women were analysed, yielding 86.8% sensitivity

  11. Behaviour of female common cuckoos, Cuculus canorus, in the vicinity of host nests before and during egg laying: a radiotelemetry study

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Taborsky, B.; Taborsky, M.; Teuschl, Y.; Vogl, W.; Moksnes, A.; Roskaft, E.

    2002-01-01

    Roč. 64, č. 6 (2002), s. 861-868 ISSN 0003-3472 R&D Projects: GA ČR GA206/00/P046; GA ČR GA206/97/0168 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cuculus canorus Subject RIV: EG - Zoology Impact factor: 2.423, year: 2002

  12. The control of graphene double-layer formation in copper-catalyzed chemical vapor deposition

    Czech Academy of Sciences Publication Activity Database

    Kalbáč, Martin; Frank, Otakar; Kavan, Ladislav

    2012-01-01

    Roč. 50, č. 10 (2012), s. 3682-3687 ISSN 0008-6223 R&D Projects: GA ČR(CZ) GAP208/12/1062 Institutional support: RVO:61388955 Keywords : graphene * electrochemistry * spectroscopy Subject RIV: CG - Electrochemistry Impact factor: 5.868, year: 2012

  13. A Framework for Hybrid Computational Models

    Czech Academy of Sciences Publication Activity Database

    Neruda, Roman

    2003-01-01

    Roč. 2, č. 4 (2003), s. 868-873 ISSN 1109-2750 R&D Projects: GA ČR(CZ) GA526/03/Z042; GA ČR(CZ) GA201/01/1192 Institutional research plan: CEZ:AV0Z1030915 Keywords : multi-agent systems * hybrid computational models Subject RIV: BA - General Mathematics

  14. Fyn kinase iniates complementary signals required for IgE-dependent mast cell degranulation

    Czech Academy of Sciences Publication Activity Database

    Parravicini, V.; Massimo, G.; Kovářová, Martina; Odom, S.; Gonzales-Espinosa, C.; Furumoto, Y.; Saitoh, S.; Samelson, L.; Oshea, J.; Rivera, J.

    2002-01-01

    Roč. 3, č. 8 (2002), s. 741-748 ISSN 1529-2908 Institutional research plan: CEZ:AV0Z5052915 Keywords : mast cell * IGE receptor Fyn kinase * Lyn kinase Subject RIV: EC - Immunology Impact factor: 27.868, year: 2002

  15. 21 CFR 73.1 - Diluents in color additive mixtures for food use exempt from certification.

    Science.gov (United States)

    2010-04-01

    ... chapter Ethylene glycol monoethyl ether Do. Isobutyl alcohol Do. Isopropyl alcohol Do. Polyoxyethylene... Service. Damar gum (resin). Diethylene glycol distearate. Dioctyl sodium sulfosuccinate. Ethyl cellulose (as identified in § 172.868 of this chapter). Ethylene glycol distearate. Japan wax. Limed rosin...

  16. Accessibility and Usage of Scholarly Information Sources by Faculty ...

    African Journals Online (AJOL)

    Three research questions and one hypothesis were formulated and tested with respect to types of Scholarly Information Sources (SIS) available, accessed and used by the Faculty Members (FM) and Postgraduate (PG) Students of Ahmadu Bello University, (A.B.U.), Zaria, Nigeria, in this study. A number of 868 samples ...

  17. Academic Competencies: Their Interrelatedness and Gender Differences at Their High End

    Science.gov (United States)

    Bergold, Sebastian; Wendt, Heike; Kasper, Daniel; Steinmayr, Ricarda

    2017-01-01

    The present study investigated (a) how a latent profile analysis based on representative data of N = 74,868 4th graders from 17 European countries would cluster the students on the basis of their reading, mathematics, and science achievement test scores; (b) whether there would be gender differences at various competency levels, especially among…

  18. Pattern and outcome of Anaemia in Children Managed at the ...

    African Journals Online (AJOL)

    Themain symptomat presentation was fever in 132 (86.8%) patients, while pallor was the most frequent physical sign in all the patients. Malaria was the leading cause of anaemia with asexual form of being present in 93 (61.2%) of the patients, 68 (44.7%) had sickle cell disease. Other identified causes include PEM in 13 ...

  19. Erratum: Vascular epiphyte vegetation in rocky savannas of southeastern Brazil

    Czech Academy of Sciences Publication Activity Database

    Alves, R. J. V.; Kolbek, Jiří; Becker, J.

    2009-01-01

    Roč. 27, č. 4 (2009), s. 351-352 ISSN 0107-055X Institutional research plan: CEZ:AV0Z60050516 Keywords : epiphytes * Brazil * rocky savannas Subject RIV: EF - Botanics Impact factor: 0.868, year: 2009

  20. Syntheses of copper complexes of nicotinohydroxamic and ...

    African Journals Online (AJOL)

    Nicotinohydroxamic acid (NHA) and isonicotinohydroxamic acid (INHA) were synthesized, characterized by electronic and spectral studies,magnetic measurements and their pKa determined spectrophotometrically as 8.68 ± 0.02 in aqueous medium of 0.1mol dm-3 I=ionic strength. The composition of the complexes was ...

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. PALLAV GUPTA. Articles written in Bulletin of Materials Science. Volume 36 Issue 5 October 2013 pp 859-868. Structural and mechanical behaviour of 5% Al2O3-reinforced Fe metal matrix composites (MMCs) produced by powder metallurgy (P/M) route · Pallav Gupta ...

  2. Fate map of the dental mesenchyme: Dynamic development of the dental papilla and follicle

    Czech Academy of Sciences Publication Activity Database

    Rothová, Michaela; Peterková, Renata; Tucker, A. S.

    2012-01-01

    Roč. 366, č. 2 (2012), s. 244-254 ISSN 0012-1606 R&D Projects: GA ČR GA304/07/0223 Institutional research plan: CEZ:AV0Z50390703; CEZ:AV0Z50390512 Keywords : tooth * mouse * mesenchyme Subject RIV: EA - Cell Biology Impact factor: 3.868, year: 2012

  3. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    Science.gov (United States)

    2010-06-09

    ... licensees to use certain portions of the electromagnetic spectrum or provide service to certain areas in... Telecommunications Bureau, Auctions and Spectrum Access Division: For auction legal questions: Sayuri Rajapakse at... 2. Auction 89 will include a total of 1,868 licenses. These include licenses for spectrum not...

  4. Eesti riikliku arengukava toetused / Margus Palu

    Index Scriptorium Estoniae

    Palu, Margus

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 75-79. 2004. a esitati 1015 taotlust 868,7 mln krooni suruses summas, millest rahuldati 57% ehk 582 taotlust toetussummas 619,3 mln krooni

  5. Interference Impact on Coverage and Capacity for Low Power Wide Area IoT Networks

    DEFF Research Database (Denmark)

    Vejlgaard, Benny; Lauridsen, Mads; Nguyen, Huan Cong

    2017-01-01

    In this paper we analyze and discuss the coverage and capacity of Sigfox and LoRaWAN in a large scale urban environments covering 150 km2 in Northern Denmark. First, the study measures and analyzes interference in the European 868 MHz license free industrial, scientific, and medical band, creatin...

  6. Realization of Timed Reliable Communication over Off-The-Shelf Wireless Technologies

    DEFF Research Database (Denmark)

    Malinowsky, B.; Groenbaek, Jesper; Schwefel, Hans-Peter

    2013-01-01

    selfdeployed networks based on 868 MHz XBee communication and EDGE/UMTS cellular infrastructure networks. Link measurements are conducted using OTS components. The experimental tests show good results for the considered long-range practical scenarios, supporting our approach of using an analytical model...

  7. Children's Sleep and Adjustment over Time: The Role of Socioeconomic Context

    Science.gov (United States)

    El-Sheikh, Mona; Kelly, Ryan J.; Buckhalt, Joseph A.; Hinnant, J. Benjamin

    2010-01-01

    Relations were examined between children's sleep and their externalizing and internalizing symptoms. Longitudinal relations were examined when children were in 3rd (T1) and 5th (T2) grades, and cross-sectional relations were assessed at T2. Participants included 176 children at T1 (M = 8.68 years) and 141 children at T2 (M = 10.70 years). Sleep…

  8. Over-expression of a zeatin O-glucosylation gene in maize leads to growth retardation and tasselseed formation

    Czech Academy of Sciences Publication Activity Database

    Rodó, A.P.; Brugiere, N.; Vaňková, Radomíra; Malbeck, Jiří; Olson, J.M.; Haines, S.C.; Martin, R.C.; Habben, J.E.; Mok, D. W. S.; Mok, M. C.

    2008-01-01

    Roč. 59, č. 10 (2008), s. 2673-2686 ISSN 0022-0957 R&D Projects: GA MŠk ME 868 Institutional research plan: CEZ:AV0Z50380511 Keywords : Corn * cytokinin * plant development * tasselseed Subject RIV: EF - Botanics Impact factor: 4.001, year: 2008

  9. NOVEL ANTI-MICROBIAL PEPTIDE, NK-LYSIN, IS PRODUCED LOCALLY IN THE GUT OF EIMERIA-INFECTED HOST

    Science.gov (United States)

    NK-lysin is an anti-microbial and anti-tumor protein produced by NK cells and T lymphocytes in mammals and is considered to be an important component of the local innate immune response to pathogens. Chicken NK-lysin consists of an 868 bp DNA sequence with an ORF of 140 amino acids with a predicted ...

  10. Reduced representation bisulphite sequencing of the cattle genome reveals DNA methylation patterns

    Science.gov (United States)

    Using reduced representation bisulphite sequencing (RRBS), we obtained the first single-base-resolution maps of bovine DNA methylation in ten somatic tissues. In total, we observed 1,868,049 cytosines in the CG-enriched regions. Similar to the methylation patterns in other species, the CG context wa...

  11. End-to-end Configuration of Wireless Realtime Communication over Heterogeneous Protocols

    DEFF Research Database (Denmark)

    Malinowsky, B.; Grønbæk, Jesper; Schwefel, Hans-Peter

    2015-01-01

    . Such configuration meets requirements on probability of message delivery and deadlines for real-time data. We provide a closed-form expression to calculate viable configurations for lossy environments, and apply it to IEEE 802.11 and XBee 868 MHz technologies for contended channel conditions. Simulation shows...

  12. Gender Representation in the Alternative Media of the Anti-Globalisation Movement

    Czech Academy of Sciences Publication Activity Database

    Kolářová, Marta

    2004-01-01

    Roč. 40, č. 6 (2004), s. 851-868 ISSN 0038-0288 Institutional research plan: CEZ:AV0Z7028912 Keywords : gender * antiglobalisation movement * alternative media Subject RIV: AO - Sociology, Demography Impact factor: 0.200, year: 2004

  13. Gender Representation in the Alternative Media of the Anti-Globalisation Movement

    Czech Academy of Sciences Publication Activity Database

    Kolářová, Marta

    2004-01-01

    Roč. 40, č. 6 (2004), s. 851-868 ISSN 0038-0288 Institutional research plan: CEZ:AV0Z7028912 Keywords : gender * anti- globalisation movement * media Subject RIV: AO - Sociology, Demography Impact factor: 0.200, year: 2004

  14. Download this PDF file

    African Journals Online (AJOL)

    treponemal (RPR) test and a treponemal (PTA—ABS) test for the diagnosis of primary syphilis during the emergence of the HIV epidemic in southern Africa. The serological tests were performed on 868 patients with genital ulcerations, seen in five centres. While primary syphilis was diagnosed by multiplex PCR in 163 ...

  15. Mono-, di- and tetranuclear rhodium(I) complexes of morpholine and ...

    Indian Academy of Sciences (India)

    123, No. 6, November 2011, pp. 861–868. c Indian Academy of Sciences. Mono-, di- and tetranuclear rhodium(I) complexes of morpholine and N-methylpiperazine functionalized cyclodiphosph(III)azanes, cis-[( t. BuN-μ)2(PNC4H8X)2] (X = O, NMe). MARAVANJI S BALAKRISHNAa,∗, D SURESHa and JOEL T MAGUEb.

  16. A novel SNP of Chemerin gene in cattle and its association with ...

    African Journals Online (AJOL)

    User

    2012-04-26

    Apr 26, 2012 ... In this study, two novel SNPs (868A>G in exon 2 and 2692C>T in exon 5) of chemerin gene were identified by PCR-SSCP and ... Key words: Bos bovine, chemerin gene, PCR-SSCP, SNP, meat quality traits. INTRODUCTION. Chemerin is a ... holding capacity (WHC) and tenderness (TD). DNA preparation.

  17. Identification of SNPs in chemerin gene and association with ...

    African Journals Online (AJOL)

    Chemerin is a novel adipokine that regulates adipogenesis and adipocyte metabolism via its own receptor. In this study, two novel SNPs (868A>G in exon 2 and 2692C>T in exon 5) of chemerin gene were identified by PCR-SSCP and DNA sequencing technology. The allele frequencies of the novel SNPs were determined ...

  18. Direct measurement of the temperature profile close to an optically trapped absorbing particle

    Czech Academy of Sciences Publication Activity Database

    Šiler, Martin; Ježek, Jan; Jákl, Petr; Pilát, Zdeněk; Zemánek, Pavel

    2016-01-01

    Roč. 41, č. 5 (2016), s. 870-873 ISSN 0146-9592 R&D Projects: GA ČR GPP205/12/P868 Institutional support: RVO:68081731 Keywords : gold nanoparticles * fluorescence * spectroscopy * tweezers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.416, year: 2016

  19. Group-size effect on scanning behaviour of Maasai Ostrich Struthio ...

    African Journals Online (AJOL)

    Flocking and predator surveillance in House Sparrows: test of a hypothesis. Animal Behaviour 29: 868–872. Fernández-Juricic, e., SmiTh, r. & kaceLnik, a. 2005. Increasing the costs of conspecific scanning in socially foraging starlings affects vigilance and foraging behaviour. Animal Behaviour 69: 73–81. Fernández-Juricic ...

  20. Nálezy hantavirového antigenu u hlodavců v České republice

    Czech Academy of Sciences Publication Activity Database

    Pejčoch, M.; Heroldová, Marta; Zejda, J.; Treml, F.; Kříž, B.

    2003-01-01

    Roč. 52, č. 1 (2003), s. 18-24 ISSN 1210-7913 R&D Projects: GA MZd NI5896 Institutional research plan: CEZ:AV0Z6093917 Keywords : hantavirus * rodents Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology http://www.clsjep.cz/Ukazclanek2.asp?clanek=14101&jazyk=&cislo=868

  1. Draft Genome Sequence of Parabacteroides goldsteinii with Putative Novel Metallo-β-Lactamases Isolated from a Blood Culture from a Human Patient

    DEFF Research Database (Denmark)

    Krogh, Thøger Jensen; Agergaard, Charlotte Nielsen; Møller-Jensen, Jakob

    2015-01-01

    Parabacteroides goldsteinii was isolated from a blood culture. Genomic DNA was sequenced using a MiSeq sequencer and assembled using the SPAdes genome assembler. The draft genome sequence was 6,851,868 bp, spanning 282 contigs of 5,253 coding sequences, 66 tRNAs, and 5 rRNAs. Several putative novel...

  2. Bayesian nonparametric estimation of hazard rate in monotone Aalen model

    Czech Academy of Sciences Publication Activity Database

    Timková, Jana

    2014-01-01

    Roč. 50, č. 6 (2014), s. 849-868 ISSN 0023-5954 Institutional support: RVO:67985556 Keywords : Aalen model * Bayesian estimation * MCMC Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.541, year: 2014 http://library.utia.cas.cz/separaty/2014/SI/timkova-0438210.pdf

  3. Multiphysics field analysis and multiobjective design optimization: a benchmark problem

    Czech Academy of Sciences Publication Activity Database

    di Barba, P.; Doležel, Ivo; Karban, P.; Kůs, P.; Mach, F.; Mognaschi, M. E.; Savini, A.

    2014-01-01

    Roč. 22, č. 7 (2014), s. 1214-1225 ISSN 1741-5977 R&D Projects: GA ČR(CZ) GAP102/11/0498 Institutional support: RVO:61388998 Keywords : coupled-field problems * finite-element analysis * hp-FEM adaptation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.868, year: 2014

  4. acquisition of antigens by airway dendritic cells. do we know enough?

    African Journals Online (AJOL)

    kiama

    The respiratory system is endowed with a number of structural and functional barriers that protect it against harmful and ... However, despite these barriers, pulmonary immune responses are easily generated by introduction of antigens into ..... their role in connecting two branches of the immune system. Nature Med. 5: 868-.

  5. El Arte de Aprender: Una Aventura Cooperativa. Un guia de recursos para trabajar con ninos jovenes. (Learning: A Cooperative Adventure. A Resource Guide for Working with Young Children.)

    Science.gov (United States)

    Arizona State Dept. of Education, Phoenix.

    Due to the large numbers of children from Spanish-speaking homes, many districts send both English and Spanish written communication to parents and community members. Therefore this booklet, a Spanish translation of "Learning: A Cooperative Adventure" (ED 119 868), was prepared to provide parents and preschool and kindergarten staff members with…

  6. Hoeffding’s Inequality for Sums of Dependent Random Variables

    Czech Academy of Sciences Publication Activity Database

    Pelekis, Christos; Ramon, J.

    2017-01-01

    Roč. 14, č. 6 (2017), č. článku 243. ISSN 1660-5446 Institutional support: RVO:67985807 Keywords : dependent random variables * Hoeffding’s inequality * k-wise independent random variables * martingale differences Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.868, year: 2016

  7. Evidence for light-by-light scattering in heavy-ion collisions with the ATLAS detector at the LHC

    Czech Academy of Sciences Publication Activity Database

    Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Hejbal, Jiří; Hladík, Ondřej; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek

    2017-01-01

    Roč. 13, č. 9 (2017), s. 852-868 ISSN 1745-2473 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * background * photon * transverse momentum * quantum mechanics * field strength * planarity Subject RIV: BF - Elementary Particles and High Energy Physics OBOR OECD: Particles and field physics Impact factor: 22.806, year: 2016

  8. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 857-868 Articles. A two-step genetic study on quantitative precursors of coronary artery disease in a homogeneous Indian population: Case–control association discovery and validation by transmission-disequilibrium .... Cancer stem cell hypotheses: Impact on modern molecular physiology and pharmacology research.

  9. Semimetal graphite/ZnO Schottky diodes and their use for hydrogen sensing

    Czech Academy of Sciences Publication Activity Database

    Yatskiv, Roman; Grym, Jan; Žďánský, Karel; Piksová, K.

    2012-01-01

    Roč. 50, č. 10 (2012), s. 3928-3933 ISSN 0008-6223 R&D Projects: GA MŠk(CZ) OC10021 Institutional support: RVO:67985882 Keywords : Schottky diodes * ZnO * Hydrogen sensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 5.868, year: 2012

  10. The impact of trans-zeatin O-glucosyltransferase gene over-expression

    Czech Academy of Sciences Publication Activity Database

    Haisel, Daniel; Vaňková, Radomíra; Synková, Helena; Pospíšilová, Jana

    2008-01-01

    Roč. 52, č. 1 (2008), s. 49-58 ISSN 0006-3134 R&D Projects: GA ČR GA522/04/0549; GA MŠk ME 868 Institutional research plan: CEZ:AV0Z50380511 Keywords : carotenoids * chlorophylls * net photosynthetic rate * Nicotiana tabacum Subject RIV: ED - Physiology Impact factor: 1.426, year: 2008

  11. Pseudo-base formation in the attempted synthesis of a conjugatively coupled bis(nitrosylruthenium) complex and spectroelectrochemistry of bipyrimidine-bridged dinuclear Ru(terpy)X precursor compounds (X = Cl, NO2)

    Czech Academy of Sciences Publication Activity Database

    Singh, P.; Sieger, M.; Fiedler, Jan; Su, Ch. Y.; Kaim, W.

    -, č. 7 (2008), s. 868-873 ISSN 1477-9226 R&D Projects: GA MŠk LC510; GA AV ČR IAA400400505 Institutional research plan: CEZ:AV0Z40400503 Keywords : Creutz-Taube ion * electron transfer * redox system * center-dot Subject RIV: CG - Electrochemistry Impact factor: 3.580, year: 2008

  12. Research Article Special Issue

    African Journals Online (AJOL)

    2017-09-10

    Sep 10, 2017 ... A comparison of LoRa in 868 MHz and 433 MHz was done by [6] in Europe.In urban environment, the IoT is aiming to develop smart cities with capabilities to provide a number of benefits in the management and optimization of traditional public services such as transport, parking system, lighting, tank level ...

  13. Aerosol optical properties at Lampedusa (Central Mediterranean. 2. Determination of single scattering albedo at two wavelengths for different aerosol types

    Directory of Open Access Journals (Sweden)

    D. Meloni

    2006-01-01

    Full Text Available Aerosol optical properties were retrieved from direct and diffuse spectral irradiance measurements made by a multi-filter rotating shadowband radiometer (MFRSR at the island of Lampedusa (35.5° N, 12.6° E, in the Central Mediterranean, in the period July 2001–September 2003. In a companion paper (Pace et al., 2006 the aerosol optical depth (AOD and Ångström exponent were used together with airmass backward trajectories to identify and classify different aerosol types. The MFRSR diffuse-to-direct ratio (DDR at 415.6 nm and 868.7 nm for aerosol classified as 'biomass burning-urban/industrial', originating primarily from the European continent, and desert dust, originating from the Sahara, is used in this study to estimate the aerosol single scattering albedo (SSA. A detailed radiative transfer model is initialised with the measured aerosol optical depth; calculations are performed at the two wavelengths varying the SSA values until the modelled DDR matches the MFRSR observations. Sensitivity studies are performed to estimate how uncertainties on AOD, DDR, asymmetry factor (g, and surface albedo influence the retrieved SSA values. The results show that a 3% variation of AOD or DDR produce a change of about 0.02 in the retrieved SSA value at 415.6 and 868.7 nm; a ±0.06 variation of the asymmetry factor g produces a change of the estimated SSA of <0.04 at 415.6 nm, and <0.06 at 868.7 nm; finally, an increase of the assumed surface albedo of 0.05 causes very small changes (0.01–0.02 in the retrieved SSA. The calculations show that the SSA of desert dust (DD increases with wavelength, from 0.81±0.05 at 415.6 nm to 0.94±0.05 at 868.7 nm; on the contrary, the SSA of urban/industrial (UN aerosols decreases from 0.96±0.02 at 415.6 nm to 0.87±0.07 at 868.7 nm; the SSA of biomass burning (BB particles is 0.82±0.04 at 415.6 nm and 0.80±0.05 at 868.7 nm. Episodes of UN aerosols occur usually in June and July; long lasting BB aerosol episodes

  14. The extended pterional approach allows excellent results for removal of anterior cranial fossa meningiomas

    Directory of Open Access Journals (Sweden)

    Jose Carlos Lynch

    2016-05-01

    Full Text Available ABSTRACT Objective To describe a unique operative strategy, instead the classical pterional approach, and to analyses it safety and effectiveness for removal of anterior cranial fossa meningiomas. Method We identify 38 patients with tuberculum sellae and olphactory groove meningiomas operated between 1986 and 2013. Medical charts, operative reports, imaging studies and clinical follow-up evaluations were reviewed and analyzed retrospectively. The pterional craniotomy is extended toward the frontal bone providing access through the subfrontal route, besides the usual anterolateral view provided by the classical pterional approach. Results Surgical mortality occurred in one patient (2.6%. Gross total resection was achieved in 27 patients (86.8%. Median time of follow-up was 69.4 months. Conclusion The extended pterional approach allows excellent results. Total removal of meningiomas of the anterior cranial fossa was obtained in 86.8 % of patients, with low morbidity and mortality.

  15. Dicty_cDB: SLC486 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC486 (Link to dictyBase) - - - Contig-U16480-1 SLC486E (Link... to Original site) - - - - - - SLC486E 451 Show SLC486 Library SL (Link to library) Clone ID SLC486 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC486Q.Seq.d/ Representative seq. ID SLC48...6E (Link to Original site) Representative DNA sequence >SLC486 (SLC486Q) /CSM/SL/SLC4-D/SLC486Q.Seq.d/ GTCAT...7Q.Seq.d/ 868 0.0 SLD427 (SLD427Q) /CSM/SL/SLD4-B/SLD427Q.Seq.d/ 868 0.0 SLC486 (SLC486Q) /CSM/SL/SLC4-D/SLC4

  16. Solution structure of the first SH3 domain of human vinexin and its interaction with vinculin peptides

    International Nuclear Information System (INIS)

    Zhang, Jiahai; Li, Xiang; Yao, Bo; Shen, Weiqun; Sun, Hongbin; Xu, Chao; Wu, Jihui; Shi, Yunyu

    2007-01-01

    Solution structure of the first Src homology (SH) 3 domain of human vinexin (V S H3 1 ) was determined using nuclear magnetic resonance (NMR) method and revealed that it was a canonical SH3 domain, which has a typical β-β-β-β-α-β fold. Using chemical shift perturbation and surface plasmon resonance experiments, we studied the binding properties of the SH3 domain with two different peptides from vinculin hinge regions: P856 and P868. The observations illustrated slightly different affinities of the two peptides binding to V S H3 1 . The interaction between P868 and V S H3 1 belonged to intermediate exchange with a modest binding affinity, while the interaction between P856 and V S H3 1 had a low binding affinity. The structure and ligand-binding interface of V S H3 1 provide a structural basis for the further functional study of this important molecule

  17. Diffusion of 6Li in Ta and W

    Czech Academy of Sciences Publication Activity Database

    Vacík, Jiří; Hnatowicz, Vladimír; Köster, U.; Červená, Jarmila; Havránek, Vladimír; Pasold, G.

    2006-01-01

    Roč. 249, 1-2 (2006), s. 865-868 ISSN 0168-583X R&D Projects: GA MPO 1H-PK2/05; GA ČR GA202/05/0410 Institutional research plan: CEZ:AV0Z10480505 Keywords : diffusion * thermal neutron depth profiling * isotope separation on-line Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.946, year: 2006

  18. The inverse of the divergence operator on perforated domains with applications to homogenization problems for the compressible Navier–Stokes system

    Czech Academy of Sciences Publication Activity Database

    Diening, L.; Feireisl, Eduard; Lu, Y.

    2017-01-01

    Roč. 23, č. 3 (2017), s. 851-868 ISSN 1292-8119 Keywords : perforated domains * Bogovskii type operators * homogenization * compressible Navier–Stokes system Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 1.540, year: 2016 https://www.esaim-cocv.org/ articles /cocv/abs/2017/03/cocv160016-s/cocv160016-s.html

  19. Optical manipulation of aerosol droplets using a holographic dual and single beam trap

    Czech Academy of Sciences Publication Activity Database

    Brzobohatý, Oto; Šiler, Martin; Ježek, Jan; Jákl, Petr; Zemánek, Pavel

    2013-01-01

    Roč. 38, č. 22 (2013), s. 4601-4604 ISSN 0146-9592 R&D Projects: GA ČR GPP205/11/P294; GA ČR GPP205/12/P868; GA MŠk LH12018; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : optical tweezers * optical manipulation Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.179, year: 2013

  20. Borrelie v klíšťatech parazitujících na člověku a profylaxe lymské borreliózy

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina

    2003-01-01

    Roč. 52, č. 1 (2003), s. 13-17 ISSN 1210-7913 R&D Projects: GA ČR GA206/00/1204; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Lyme disease * ticks Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology http://www.clsjep.cz/Ukazclanek2.asp?clanek=14099&jazyk=&cislo=868

  1. molybdenum

    African Journals Online (AJOL)

    A [13]). However, the larger size leads to an enhanced Si-C bond length (1.868 A [13]) relative to that of the C-C bond (1.527 Á [13]). This leads to a net cancellation of effects. Consequently the data suggest that the SiMe, and 'Bu appear of similar size when viewed from the centroid of the substituted cyclopentadienyl ligand ...

  2. 76 FR 59391 - Notice of Availability of Government-Owned Inventions; Available for Licensing

    Science.gov (United States)

    2011-09-26

    ... Issued 7/13/2010//U.S. Patent No. 7,779,772: Submarine Short- Range Defense System Issued 8/24/2010//U.S... Presentation Issued 1/4/2011/ /U.S. Patent No. 7,868,833: An Ultra Wideband Buoyant Cable Antenna Element.... Patent No. 7,952,530: Serpentine Buoyant Cable Antenna Issued 5/31/2011//U.S. Patent No. 7,954,442: Towed...

  3. Recovery of maize (Zea mays L.) inbreds and hybrids from chilling stress of various duration: plant development, photosynthesis and antioxidative enzymes

    Czech Academy of Sciences Publication Activity Database

    Holá, D.; Kočová, M.; Rothová, O.; Wilhelmová, Naděžda; Benešová, M.

    2007-01-01

    Roč. 164, - (2007), s. 868-877 ISSN 0176-1617 Grant - others:Univerzita Karlova v Praze / Přírodovědecká fakulta(CZ) GP522/02/D174 Institutional research plan: CEZ:AV0Z50380511 Source of funding: V - iné verejné zdroje Keywords : Antioxidant enzymes * chilling * intraspecific variability * photosynthesis * recovery * Zea mays Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.239, year: 2007

  4. A highly-deformable composite composed of an entangled network of electrically-conductive carbon-nanotubes embedded in elastic polyurethane

    Czech Academy of Sciences Publication Activity Database

    Slobodian, P.; Říha, Pavel; Sáha, P.

    2012-01-01

    Roč. 50, č. 10 (2012), s. 3446-3453 ISSN 0008-6223 Grant - others:OP VaVpI(XE) CZ.1.05/2.1.00/03.0111 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotubes * polyurethane * high deformation * strain sensor * resistance * biomechanics Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.868, year: 2012

  5. Shock Waves Generated by an Electrical Discharge on Composite Electrode Immersed in Water With Different Conductivities

    Czech Academy of Sciences Publication Activity Database

    Stelmashuk, Vitaliy; Hoffer, Petr

    2012-01-01

    Roč. 40, č. 7 (2012), s. 1907-1912 ISSN 0093-3813 Institutional research plan: CEZ:AV0Z20430508 Keywords : Corona * impedance matching * shock waves Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.868, year: 2012 http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=&arnumber=6205646&contentType=Journals+%26+Magazines&queryText%3Dstelmashuk

  6. AGN X-Ray emission and black holes (Kelly+, 2008)

    DEFF Research Database (Denmark)

    Kelly, B. C.; Bechtold, J.; Trump, J. R.

    2009-01-01

    In this analysis we combine 169 RQQs from Kelly et al. (2007ApJ...665.1489K) with 149 RQQs from the main SDSS sample of Strateva et al. (2005, Cat. J/AJ/130/387) to create a sample of 318 RQQs. Out of these 318 sources, 276 (86.8%) are detected in the X-ray. (1 data file)....

  7. A search for mutations affecting protein structure in children of proximally and distally exposed atomic bomb survivors

    International Nuclear Information System (INIS)

    Neel, J.V.; Satoh, Chiyoko; Hamilton, H.B.; Otake, Masanori; Goriki, Kazuaki; Kageoka, Takeshi; Fujita, Mikio; Neriishi, Shotaro; Asakawa, Jun-ichi.

    1981-07-01

    A total of 289,868 locus tests based on 28 different protein phenotypes, employing one-dimensional electrophoresis to detect variant proteins, has yielded one probable mutation in the offspring of 'proximally exposed' parents, who received an estimated average gonadal exposure dose of between 31 and 39 rem from the atomic bombs in Hiroshima and Nagasaki. There were no mutations in 208,196 locus tests involving children of 'distally exposed' parents, who had essentially no radiation exposure. (author)

  8. Commuting patterns of Czech households exposed to flood risk from the Bečva river

    Czech Academy of Sciences Publication Activity Database

    Vikhrov, Dmytro; Stojanov, Robert; Duží, Barbora; Juřička, D.

    2014-01-01

    Roč. 13, č. 1 (2014), s. 58-72 ISSN 1747-7891 R&D Projects: GA MŠk ED1.1.00/02.0073; GA MŠk EE2.4.31.0056; GA MŠk LD13032 Institutional support: RVO:67179843 Keywords : commuting * income gap * flood risk * selection * probit Subject RIV: AO - Sociology, Demography Impact factor: 0.868, year: 2014

  9. AcEST: DK959490 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Drosophila pseudoobscur... 32 3.2 sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 O... 32 4.2...jct: 828 SPAPGSNTT-TPTGIVSTPTTAAASSAGSEKSTPAAASSGAT 868 >sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98...-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 Length = 2053 Score = 31.6 bits (70), Expect = 4.

  10. Specifically neuropathic Gaucher's mutations accelerate cognitive decline in Parkinson's

    OpenAIRE

    Liu, Ganqiang; Boot, Brendon; Locascio, Joseph J.; Jansen, Iris E.; Winder?Rhodes, Sophie; Eberly, Shirley; Elbaz, Alexis; Brice, Alexis; Ravina, Bernard; van Hilten, Jacobus J.; Cormier?Dequaire, Florence; Corvol, Jean?Christophe; Barker, Roger A.; Heutink, Peter; Marinus, Johan

    2016-01-01

    Objective We hypothesized that specific mutations in the ??glucocerebrosidase gene (GBA) causing neuropathic Gaucher's disease (GD) in homozygotes lead to aggressive cognitive decline in heterozygous Parkinson's disease (PD) patients, whereas non?neuropathic GD mutations confer intermediate progression rates. Methods A total of 2,304 patients with PD and 20,868 longitudinal visits for up to 12.8 years (median, 4.1) from seven cohorts were analyzed. Differential effects of four types of geneti...

  11. Specifically neuropathic Gaucher's mutations accelerate cognitive decline in Parkinson's

    OpenAIRE

    Liu, Ganqiang; Boot, Brendon; Locascio, Joseph J.; Jansen, Iris E.; Winder‐Rhodes, Sophie; Eberly, Shirley; Elbaz, Alexis; Brice, Alexis; Ravina, Bernard; van Hilten, Jacobus J.; Cormier‐Dequaire, Florence; Corvol, Jean‐Christophe; Barker, Roger A.; Heutink, Peter; Marinus, Johan

    2016-01-01

    Objective: We hypothesized that specific mutations in the β‐glucocerebrosidase gene (GBA) causing neuropathic Gaucher's disease (GD) in homozygotes lead to aggressive cognitive decline in heterozygous Parkinson's disease (PD) patients, whereas non‐neuropathic GD mutations confer intermediate progression rates. Methods: A total of 2,304 patients with PD and 20,868 longitudinal visits for up to 12.8 years (median, 4.1) from seven cohorts were analyzed. Differential effects of four types of gene...

  12. Metallic nanoparticles in a standing wave: Optical force and heating

    Czech Academy of Sciences Publication Activity Database

    Šiler, Martin; Chvátal, Lukáš; Zemánek, Pavel

    2013-01-01

    Roč. 126, September (2013), s. 84-90 ISSN 0022-4073 R&D Projects: GA ČR GPP205/12/P868; GA MŠk LH12018; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : Metallic nanoparticle s * Optical trapping * Heating * Generalized Lorenz-Mie theory Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.288, year: 2013

  13. .Pi.-conjugated donor and donor-acceptor metallo-polymers

    Czech Academy of Sciences Publication Activity Database

    Wild, A.; Schlütter, F.; Pavlov, G. M.; Friebe, Ch.; Festag, G.; Winter, A.; Hager, M. D.; Cimrová, Věra; Schubert, U.S.

    2010-01-01

    Roč. 31, 9-10 (2010), s. 868-874 ISSN 1022-1336 R&D Projects: GA MŠk(CZ) 1M06031; GA AV ČR IAA4050409 Institutional research plan: CEZ:AV0Z40500505 Keywords : analytical ultracentrifugation * conducting polymers * metallo-polymers Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.371, year: 2010

  14. Annotated Bibliography for Lake Erie. Volume I. Biological,

    Science.gov (United States)

    1974-10-01

    ADORIESS(If different fom Controlling Office) IS. SECURITY CLASS . (of tiaE roport) Unclassified 15.. OECLASSIFICATION/OOWINORADING I SCHEDULE IS...791, 793, 794, 795, 800, 801, 802, 817, 825, 827, 840, 841, 860, 864, 866, 868, 869, 870, 874, 875, 876, 879 d. Chilopoda - 237 e. Diplopoda - 613...are consistent differences in the average size and weight of age classes among the three habitats. The degree of stunting in Lake Erie for all species

  15. On the island biogeography of aliens: a global analysis of the richness of alien plant and bird species on oceanic islands

    Czech Academy of Sciences Publication Activity Database

    Blackburn, T. M.; Delean, S.; Pyšek, Petr; Cassey, P.

    2016-01-01

    Roč. 25, č. 7 (2016), s. 859-868 ISSN 1466-822X R&D Projects: GA ČR GB14-36079G Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : plants * birds * island invasions Subject RIV: EH - Ecology, Behaviour Impact factor: 6.045, year: 2016

  16. Culture-dependent characterization of hydrocarbon utilizing bacteria ...

    African Journals Online (AJOL)

    Culture-dependent characterization of hydrocarbon utilizing bacteria in selected crude oil-impacted sites in Bodo, Ogoniland, Nigeria. ... 39.50 mg/kg for soil and sediments while water had total nitrogen 868 mg/l, nitrate 40.6 mg/l, total organic carbon 3.1 mg/l, total petroleum hydrocarbon 768 mg/l, nickel 39.2 mg/l, lead 17.3 ...

  17. Thermodynamic and Radiative properties of Plasma Excited in EDM process Through N2 Taking Into Account Fe

    Czech Academy of Sciences Publication Activity Database

    Adineh, V.R.; Coufal, O.; Živný, Oldřich

    2012-01-01

    Roč. 40, č. 10 (2012), s. 2723-2735 ISSN 0093-3813 R&D Projects: GA ČR GAP205/11/2070 Institutional research plan: CEZ:AV0Z20430508 Keywords : Electrical discharge machining * net emission coefficient * nitrogen-iron reaction products * plasma modeling, radiative heat transfer * thermodynamic properties Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.868, year: 2012

  18. Overlap Cycles for Permutations: Necessary and Sufficient Conditions

    Science.gov (United States)

    2013-09-19

    to genetic algorithms [4]. More recently universal cycles are being used in areas such as rank modulation for multilevel flash memories [12], however...that pn+ qs = d. This implies the following. pn+ qs = d pmd+ qkd = d pm+ qk = 1 Thus the same integers p, q provide confirmation that gcd(m,k) = 1. 4...12] Z. Wang and J. Bruck, Partial Rank Modulation for Flash Memories, IEEE Interna- tional Symposium on Information Theory Proceedings (2010), 864-868

  19. Membrane Binding of Recoverin: From Mechanistic Understanding to Biological Functionality

    Czech Academy of Sciences Publication Activity Database

    Timr, Štěpán; Pleskot, Roman; Kadlec, Jan; Kohagen, Miriam; Magarkar, Aniket; Jungwirth, Pavel

    2017-01-01

    Roč. 3, č. 8 (2017), s. 868-874 ISSN 2374-7943 R&D Projects: GA ČR(CZ) GBP208/12/G016 Institutional support: RVO:61388963 Keywords : recoverin * membrane * myristoyl * molecular dynamics Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 7.481, year: 2016 http://pubs.acs.org/doi/full/10.1021/acscentsci.7b00210

  20. A highly-deformable composite composed of an entangled network of electrically-conductive carbon-nanotubes embedded in elastic polyurethane

    Czech Academy of Sciences Publication Activity Database

    Slobodian, P.; Říha, Pavel; Sáha, P.

    2012-01-01

    Roč. 50, č. 10 (2012), s. 3446-3453 ISSN 0008-6223 Grant - others:OP VaVpI(XE) CZ.1.05/2.1.00/03.0111 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotubes * polyurethane * high deformation * strain sensor * resistance * biomechanics Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 5.868, year: 2012

  1. Species Profiles. Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates (Gulf of Mexico). WHITE SHRIMP.

    Science.gov (United States)

    1984-09-01

    detritus, chitin, parts of annelids September 1979. and gastropods, fish parts, bryozoans, sponges , corals, filaments )f algae, The hait shrimp fishery...foods. , and newly hatched brine shrimp to feed the mysis stages. Christmas and White shrimp are an important Etzold (1977) reported that early food for...effort and and marine organisms. Wiley- price-cost trends in the Gulf of Interscience, New York. 868 pp. Mexico shrimp fishery: implications on Mexico’s

  2. Military Personnel: DOD Needs More Complete Data on Active-Duty Servicemembers Use of Food Assistance Programs

    Science.gov (United States)

    2016-07-01

    seek to understand attitudes and views on a wide range of personnel issues and the results of which are used to help DOD decision makers evaluate...Special Milk Program Children in schools, of high school grade or under, child-care institutions, and similar nonprofit institutions that do not...of milk for children in schools, camps, and other programs that do not participate in other child nutrition programs. 3,868 schools, non

  3. The role of cytokinins in responses to water deficit in tobacco plants over-expressing trans-zeatin O-glucosyltransferase gene under 35S or SAG12 promoters

    Czech Academy of Sciences Publication Activity Database

    Havlová, Marie; Dobrev, Petre; Motyka, Václav; Štorchová, Helena; Libus, Jiří; Dobrá, Jana; Malbeck, Jiří; Gaudinová, Alena; Vaňková, Radomíra

    2008-01-01

    Roč. 31, č. 3 (2008), s. 341-353 ISSN 0140-7791 R&D Projects: GA ČR GA522/04/0549; GA MŠk(CZ) LC06034; GA MŠk ME 868 Institutional research plan: CEZ:AV0Z50380511 Keywords : abscisic acid * auxin * cytokinin Subject RIV: EF - Botanics Impact factor: 4.666, year: 2008

  4. An alternative method of estimating the cranial capacity of Olduvai Hominid 7.

    Science.gov (United States)

    Vaisnys, J R; Lieberman, D; Pilbeam, D

    1984-09-01

    The cranial capacity of Olduvai Hominid 7 is estimated to be 690 cc, with a standard uncertainty range of 538 to 868 cc. The estimate is derived from a systematic consideration of the relationships between Bregma-Asterion chords and cranial capacities obtained from a large sample of Homo sapiens and Pan troglodytes and from available fossil hominids. The estimation technique is applicable to other characters and specimens.

  5. GLOBAL JOURNAL OF SOCIAL SCIENCES VOL 8, NO

    African Journals Online (AJOL)

    Ada

    2003. 3759882. 0.460083. 0.456125 3,792,506. 8,243,089. 595,278 8,233,855. 2004. 6230817. 0.406911. 0.658667 3,849,273. 9,459,727 1,086,759 9,446,559. 2005. 7664695. 0.354530. 0.705242 3,853,094. 10,868,170 6,932,062 10,848,768. 14. (FOOD /. BEVERAGES. AND. TOBACCO). CADBURY NIG. PLC. 2006.

  6. Towards Soft Computing Agents

    Czech Academy of Sciences Publication Activity Database

    Neruda, Roman; Krušina, Pavel; Petrová, Zuzana

    2000-01-01

    Roč. 10, č. 5 (2000), s. 859-868 ISSN 1210-0552. [SOFSEM 2000 Works hop on Soft Computing. Milovy, 27.11.2000-28.11.2000] R&D Projects: GA ČR GA201/00/1489; GA ČR GA201/99/P057 Institutional research plan: AV0Z1030915 Keywords : hybrid systems * intelligent agents Subject RIV: BA - General Mathematics

  7. Determination of methicillin-resistant and methicillin-susceptible Staphylococcus aureus bacteria in blood by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Horká, Marie; Tesařová, Marie; Karásek, Pavel; Růžička, F.; Holá, V.; Sittová, M.; Roth, Michal

    2015-01-01

    Roč. 868, APR (2015), s. 67-72 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GAP106/12/0522; GA MV VG20102015023 Institutional support: RVO:68081715 Keywords : capillary zone electrophoresis * Staphylococcus aureus * human whole blood Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.712, year: 2015 http://hdl.handle.net/11104/0245801

  8. Mathematical Model for Hydrodistillation of Essential Oils

    Czech Academy of Sciences Publication Activity Database

    Sovová, Helena; Aleksovski, S.

    2006-01-01

    Roč. 21, č. 6 (2006), s. 881-889 ISSN 0882-5734 R&D Projects: GA AV ČR(CZ) IAA4072102 Grant - others:BEMUSAC(XE) G1MA/CT/2002/0419 Institutional research plan: CEZ:AV0Z40720504 Keywords : hydrodistillation * mass transfer * modelling Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.868, year: 2006

  9. Two approaches to biological decontamination of ground-water and soil polluted by aromatics – characterisation of microbial populations

    Czech Academy of Sciences Publication Activity Database

    Demnerová, K.; Mackova, M.; Spěváková, V.; Beranová, K.; Kochánková, L.; Lovecká, P.; Ryšlava, E.; Macek, Tomáš

    2005-01-01

    Roč. 8, - (2005), s. 205-211 ISSN 1139-6709 R&D Projects: GA MŠk(CZ) 1P05ME745 Grant - others:5thFW(XE) QLK3-CT-2000-00163 Institutional research plan: CEZ:AV0Z4055905 Keywords : bioremediation * multibarrier system * phytoremediation Subject RIV: CC - Organic Chemistry Impact factor: 1.868, year: 2005

  10. TGFβ1 genetic variants are associated with an increased risk of acute brucellosis.

    Science.gov (United States)

    Sepanjnia, Adel; Eskandari-Nasab, Ebrahim; Moghadampour, Mehdi; Tahmasebi, Arezoo; Dahmardeh, Fatemeh

    2015-07-01

    Cytokines play a critical role in the regulation of the immune response against brucellosis infection, and mediate production of many pro- and anti-inflammatory signals. Transforming growth factor-beta 1 (TGFβ1), a powerful suppressive cytokine, inhibits macrophage activation and modulates T-cell function, and plays crucial roles in regulation of microbial replication and host responses to brucella. The association of three polymorphisms in the TGFβ1 gene (-509 C/T [rs1800469], + 868 C/T [rs1800470], and + 913 G/C [rs1800471]) in promoter, codons 10 and 25, respectively, with brucellosis infection was evaluated. This case-control study was performed on a total of 281 Iranian subjects including 153 patients with active brucellosis and 128 age- and sex-matched healthy individuals as controls. Genotyping for the TGFβ1 -509 C/T and + 868 C/T variants was performed using tetra amplification refractory mutation system-polymerase chain reaction (T-ARMS-PCR). Also, the + 913 G/C polymorphism was genotyped using an allele-specific PCR. The results demonstrated that the TGFβ1 + 868 C/T mutant homozygote genotype (TT vs CC), was a risk factor for developing brucellosis in the co-dominant and recessive models (odds ratio (OR) = 2.60, p = 0.023; OR = 2.602, p = 0.014, respectively). Additionally, the diplotype analyses revealed that TGFβ1 codon 10 and 25 diplotype, TT/GG, was associated with an increased risk of brucellosis (OR = 2.49, p = 0.038). Other TGFβ1 variants did not increase the risk of brucellosis infection. Our findings propose that TGFβ1 + 868 TT genotype and TT/GG diplotype may confer increased risk of brucellosis in the examined population.

  11. FERMENTATION ACTIVITY OF LACTOSE-FERMENTATION YEAST IN WHEY-MALT WORT

    Directory of Open Access Journals (Sweden)

    E. V. Greek

    2013-04-01

    Full Text Available The main parameters of fermentation of whey-malt wort with the use of different strains of lactose-fermentation yeast was investigated experimentally. According to the findings of investigation of fermentive activity for different types of lactose-fermentation microorganisms in whey-malt wort it was found that the most active spirituous fermentation for all parameters was in wort fermented by microorganisms Zygosaccharomyces lactis 868-K and Saccharomyces lactis 95. High capacity for utilization of malt carbohydrates represented by easily metabolized carbohydrates of malt extract was determined. Also organoleptic analysis of fermented whey drinks derived from the renewed mixtures of dry whey and fermented malt and yeast Zygosaccharomyces lactis 868-K and Saccharomyces lactis 95 was carried out. It was found that the drink fermented with yeast Zygosaccharomyces lactis 868-K had intense refreshing flavor of rye bread with fruit tones. Intensity growth of aromatization for complex of sample with microorganisms Saccharomyces lactis 95, indicating high organoleptic indexes of the drink was observed.

  12. Case management of severe malaria--a forgotten practice: experiences from health facilities in Uganda.

    Directory of Open Access Journals (Sweden)

    Jane Achan

    Full Text Available INTRODUCTION: Severe malaria is a life-threatening medical emergency and requires prompt and effective treatment to prevent death. There is paucity of published information on current practices of severe malaria case management in sub-Saharan Africa; we evaluated the management practices for severe malaria in Ugandan health facilities METHODS AND FINDINGS: We did a cross sectional survey, using multi-stage sampling methods, of health facilities in 11 districts in the eastern and mid-western parts of Uganda. The study instruments were adapted from the WHO hospital care assessment tools. Between June and August 2009, 105 health facilities were surveyed and 181 health workers and 868 patients/caretakers interviewed. None of the inpatient facilities had all seven components of a basic care package for the management of severe malaria consistently available during the 3 months prior to the survey. Referral practices were appropriate for <10% (18/196 of the patients. Prompt care at any health facility was reported by 29% (247/868 of patients. Severe malaria was correctly diagnosed in 27% of patients (233.Though the quinine dose and regimen was correct in the majority (611/868, 70.4% of patients, it was administered in the correct volumes of 5% dextrose in only 18% (147/815. Most patients (80.1% had several doses of quinine administered in one single 500 ml bottle of 5% dextrose. Medications were purchased by 385 (44% patients and medical supplies by 478 patients (70.6%. CONCLUSIONS: Management of severe malaria in Ugandan health facilities was sub-optimal. These findings highlight the challenges of correctly managing severe malaria in resource limited settings. Priority areas for improvement include triage and emergency care, referral practises, quality of diagnosis and treatment, availability of medicines and supplies, training and support supervision.

  13. Vertebrate predator-prey interactions in a seasonal environment

    DEFF Research Database (Denmark)

    Schmidt, Niels Martin; Berg, Thomas B.; Forchhammer, Mads C.

    2008-01-01

    The High Arctic, with its low number of species, is characterised by a relatively simple ecosystem, and the vertebrate predator-prey interactions in the valley Zackenbergdalen in Northeast Greenland are centred around the collared lemming Dicrostonyx groenlandicus and its multiple predators....... In this chapter, we examine these interactions in a climatic context through the predator-lemming model developed for the more southerly Greenlandic site, Traill empty set (Gilg et al., 2003, Science 302, 866-868), parameterised by means of data from the BioBasis monitoring programme to reflect the situation...

  14. Association analysis of PALB2 and BRCA2 in bipolar disorder and schizophrenia in a scandinavian case-control sample

    DEFF Research Database (Denmark)

    Tesli, Martin; Athanasiu, Lavinia; Mattingsdal, Morten

    2010-01-01

    ,868/2,938) and the STEP-UCL/ED-DUB-STEP2 study (n¿=¿2,558/3,274) in a meta-analysis which revealed a P-value of 1.2¿×¿10(-5) for association between PALB2 SNP rs420259 and BD (n¿=¿5,547/20,241). Neither the PALB2 SNP rs420259 nor the BRCA2 SNP rs9567552 were nominally significantly associated with the SCZ phenotype...

  15. Raw mechanically separated chicken meat and salmon protein hydrolysate as protein sources in extruded dog food

    DEFF Research Database (Denmark)

    Tjernsbekk, M. T.; Tauson, A. H.; Kraugerud, O. F.

    2017-01-01

    .0 and 597.4 g/kg, CP was 670.7, 421.2 and 868.9 g/kg DM, crude fat was 141.4, 547.8 and 18.5 g/kg DM and ash was 126.4, 32.1 and 107.0 g/kg DM for PM, MSC and SPH respectively. The content of essential AA (g/100 g CP) was more than 10.0 percentage units lower in SPH than in PM and MSC. The ATTD of CP...

  16. Proteomic and genomic analysis of PITX2 interacting and regulating networks

    OpenAIRE

    Huang, Yue; Huang, Kan; Boskovic, Goran; Dementieva, Yulia; Denvir, James; Primerano, Donald A.; Zhu, Guo-Zhang

    2009-01-01

    PITX2 is a homeodomain transcription factor that has a substantial role in cell proliferation and differentiation in various tissues. In this report, we have conducted a systematic study, using proteomic and genomic approaches, to characterize PITX2-interacting proteins and PITX2-regulating genes. We identified four novel PITX2-associated protein partners YB-1, hnRNP K, nucleolin and hnRNP U in mass spectrometry analysis. We also found that overexpression of PITX2 upregulated 868 genes (two-f...

  17. iAssist: a software framework for intelligent patient monitoring.

    Science.gov (United States)

    Brouse, Christopher; Dumont, Guy; Yang, Ping; Lim, Joanne; Ansermino, J Mark

    2007-01-01

    A software framework (iAssist) has been developed for intelligent patient monitoring, and forms the foundation of a clinical monitoring expert system. The framework is extensible, flexible, and interoperable. It supports plugins to perform data acquisition, signal processing, graphical display, data storage, and output to external devices. iAssist currently incorporates two plugins to detect change point events in physiological trends. In 38 surgical cases, iAssist detected 868 events, of which clinicians rated more than 50% as clinically significant and less than 7% as artifacts. Clinicians found iAssist intuitive and easy to use.

  18. Forbedret overlevelse hos børn med neuroblastom

    DEFF Research Database (Denmark)

    Schrøder, Henrik; Wacher, Jeanette; Larsson, Heidi

    2010-01-01

    children below 15 years of age with neuroblastoma or ganglioneuroblastoma who were diagnosed in Denmark between 1981 and 2005. RESULTS: The incidence was 8.68 per million children below 15 years of age (world standard 9.6) and 43.5 per million children below 12 months of age and these incidences have...... three years from diagnosis occurred in only 2% of patients. The median time from relapse to death was three months. CONCLUSION: The survival of children with neuroblastoma in Denmark has increased significantly over the last 25 years. Udgivelsesdato: 2010-Oct-4...

  19. Vertebrate predator-prey interactions in a seasonal environment

    DEFF Research Database (Denmark)

    Schmidt, Niels Martin; Berg, Thomas B; Forchhammer, Mads

    2008-01-01

    . In this chapter, we examine these interactions in a climatic context through the predator-lemming model developed for the more southerly Greenlandic site, Traill empty set (Gilg et al., 2003, Science 302, 866-868), parameterised by means of data from the BioBasis monitoring programme to reflect the situation...... therefore examined how variation in the relative length of seasons affected the pattern of fluctuation in the lemming population by gradually advancing or delaying the time of onset of winter. In contrast to advanced winter onset, delayed winter onset led to increased periodicity. The climatic conditions...

  20. United States Air Force Statistical Digest, Fiscal Year 1979, Thirty-Fourth Edition

    Science.gov (United States)

    1980-06-30

    SCT lIIC liMN AB 17 1,123 - - - - - 13 126 86318 15,564 - - - - - 1,79 2,758 11,01219 29,868 - - - - 31 13,57C 8,540 7,72720 38,001 - - - 2 1,288...Tac Ftr Wg NAS H VI L L E METRO A PT 1’=’=~~~mii=’=::Z~t.~~118 T ac Alf! Wx TENNESSEE SPRINGFI ELD MAP 178 Tae Ftr Gp --1;;;;;-~~~;;=:;:~~-’"i----.J

  1. On Dimensionless Numbers

    Czech Academy of Sciences Publication Activity Database

    Růžička, Marek

    2008-01-01

    Roč. 86, č. 8A (2008), s. 835-868 ISSN 0263-8762 R&D Projects: GA ČR GA104/06/1418; GA ČR GA104/07/1110; GA AV ČR IAAX00130702; GA AV ČR(CZ) IAA200720801; GA MŠk ME 952 Institutional research plan: CEZ:AV0Z40720504 Keywords : dimensionless numbers * dimensional analysis * scaling of equation s Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.989, year: 2008

  2. Strouhal number of bridge cables with ice accretion at low flow turbulence

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Tatara, M.; Marušić, Ante

    2016-01-01

    Roč. 22, č. 2 (2016), s. 253-272 ISSN 1226-6116 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GC13-34405J; GA ČR(CZ) GA14-12892S Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JM - Building Engineering Impact factor: 0.868, year: 2016 http://koreascience.or.kr/article/ArticleFullRecord.jsp?cn=KJKHCF_2016_v22n2_253

  3. Prevalence of dental anomalies in patients with cleft lip alveolus and palate treated at Institute Specialized on Children’s Health Lima Perú

    OpenAIRE

    Mogollón Tello, Luis Alberto; Huapaya Paricoto, Olinda; Dpto. Académico Médico Quirúrgico. Facultad Odontología. UNMSM. Lima, Perú.

    2014-01-01

    The Prevalence and distribution of dental anomalies in patients with cleft lip alveolus and palate (CLAP) were studied using panoramic x-rays of 129 children (79 boys and 50 girls), 6 to 12 year old belonging the Institute specialized on Children’s Health, Lima - Perú, during 2005 to 2008. Hypodontia prevalence of 86.8% and supernumerary teeth prevalence in the 49.6% was found in the population. Both anomalies were simultaneously found in 43.4%. The studied population showed 78 patients with ...

  4. 75 FR 33376 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

    Science.gov (United States)

    2010-06-11

    ...,062 536,594 03/01/12 06/01/11 *09-05-C-01-ELP El Paso, TX..... 05/10/10 20,634,000 20,634,000 08/01/12........ 05/12/10 45,027,956 45,868,477 05/01/97 05/01/97 97-01-C-01-RAP Rapid City, SD... 05/12/10 1,087,206... charged from $3.00 per enplaned passenger to $4.50 per enplaned passenger. For El Paso, TX, this change is...

  5. The Shock and Vibration Digest. Volume 15, Number 4

    Science.gov (United States)

    1983-04-01

    8217 *,■--■ REFERENCES 1. Cady, W.G., Piezoelectricity, Vols 1 and 2, Dover Publications (1964). 2. Curie, P., Oeuvres de Pierre Curie, Gauthier...airplane velocity. The frequency result appears to be new data. 83-707 Airport Noise: Land-Use Compatibility by the Year 2000 R.J. Koenig and J...A 683 Kilcullen,A,F 764 Kipersztok, 0 705 Knowles, J.A 868 Koenig , R.J 707 Kohler, E 724 Koide, T 733 Kosawada, T 769 Kot, C.A 694 Krejsa

  6. KEBANGKRUTAN VERSUS RESTRUKTURISASI: EVALUASI DAN PREDIKSI KELANGSUNGAN HIDUP PERUSAHAAN PASCA KRISIS KEUANGAN 1997

    Directory of Open Access Journals (Sweden)

    Hermeindito Kaaro

    2016-11-01

    models are robust. The models provide highly accurate results in matching the classifications of actual observations and the prediction results, range from 86,8% through 100%. Fourth, four strategic attributes, the change of director boards, the composition change of capital ownerships, strategic alliances, and acquisitions, are effective to increase the firm performance. However, surprise that debt restructuring is less powerful to cope with the firm financial distress during three year periods of analysis. Keywords: healthy firm, debt restructuring, corporate strategy, business and financial risks

  7. Impact of foliage on LoRa 433MHz propagation in tropical environment

    Science.gov (United States)

    Ahmad, Khairol Amali; Salleh, Mohd Sharil; Segaran, Jivitraa Devi; Hashim, Fakroul Ridzuan

    2018-02-01

    LoRa is being considered as one of the promising system for Low-Power-Wide-Area-Network (LPWAN) to support the growth of Internet of Things (IoT) applications. Designed to operate in the industrial, scientific and medical (ISM) bands, LoRa had been tested and evaluated mainly in Europe and US in the 868 MHz and 915 MHz modulation bands. Using chirp spread spectrum technology, LoRa is expected to be robust against degredation. This paper provides some early results in the performance of LoRa signal propagation of 433 MHz modulation in tropical foliage environments.

  8. On the shape and albedo variegation of asteroids - Results from Fourier analysis of synthetic and observed asteroid lightcurves

    Science.gov (United States)

    Barucci, M. Antonietta; Capria, M. Teresa; Harris, Alan W.; Fulchignoni, Marcello

    1989-01-01

    Fourier analyses have been conducted of those asteroids in the Lagerkvist et al. (1987) lightcurves with substantially complete phase coverage and point density, and for which a unique period has been identified. Fourier coefficients are thereby obtained for 188 lightcurves of 91 asteroids, as well as for 868 synthetic lightcurves from a set of models different in shape and albedo markings; by comparing model and asteroid lightcurve coefficients, the possible shape and albedo variations for 18 asteroids are derived. An attempt is made to define the general distribution of shapes of all asteroid samples analyzed.

  9. Screening for urinary tract cancer with urine cytology in Lynch syndrome and familial colorectal cancer

    DEFF Research Database (Denmark)

    Myrhøj, T; Andersen, M-B; Bernstein, I

    2008-01-01

    ) UC lead to a false positive screening diagnosis. During the study period fourteen persons (1.4%) developed a UTC and five of these were interval tumours. The sensitivity of UC in diagnosing asymptomatic UTC in HNPCC patients was 29%. Twelve of the tumours were found in persons from families......-the National Danish Pathology database. All UC and UTC (Urinary Tract Tumours) were listed and evaluated. RESULTS: 977 persons had a total of 1,868 screening procedures performed. Two of these procedures (0.1%) lead to diagnosis of an asymptomatic urothelial tumour. In ten times as many procedures (22 persons...

  10. Automated detection of haemozoin-containing monocytes for the diagnosis of malaria in microscopically negative cases during pregnancy.

    Science.gov (United States)

    Hänscheid, Thomas; Längin, Matthias; Codices, Vera; Luty, Adrian J F; Adegnika, Ayola A; Kremsner, Peter G; Grobusch, Martin P

    2009-03-01

    Plasmodium falciparum sequesters in the placenta. Cell-Dyn automated flow cytometric haematology analysers have the capacity to detect haemozoin-containing circulating leukocytes during routine FBC analysis. In Lambaréné, Gabon, 685 FBCs of pregnant women were analysed, yielding 86.8% sensitivity and 78.5% specificity compared to microscopy. In a subset of 37 Cell-Dyn positive but microscopy negative samples, PCR detected five positive cases. This methodology may serve as an adjunct rapid diagnostic tool for malaria during pregnancy, even in microscopically negative cases.

  11. 77 FR 15841 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

    Science.gov (United States)

    2012-03-16

    ...: February 2, 2012. FOR FURTHER INFORMATION CONTACT: Mary Vargas, Seattle Airports District Office, (425) 227...,373,302 01/01/23 07/01/22 94-01-C-04-RIC; Richmond, VA.... 2/23/12 11,847,867 11,846,842 05/01/98 05/01/98 01-04-C-04-RIC; Richmond, VA.... 2/23/12 3,401,433 2,647,868 11/01/16 114/01/16 Issued in...

  12. Remote controlled gate controller using a GSM network and Arduino platform

    Directory of Open Access Journals (Sweden)

    Pospisilik Martin

    2016-01-01

    Full Text Available Most remote controllers for entrance gates operate on free frequencies 433 or 868 MHz. However, this technology limits the user comfort, as it is usually not common that bi-directional communication is established. A higher comfort of controlling the entrance gates can be achieved by employing the GSM network for transmission of commands and messages between the gate controller and the user. In this case, only a conventional GSM cellular phone is needed to control the gate. A description of such a controller based on the GSM module and Arduino controller is provided in this paper.

  13. Elastic properties of silicon nitride ceramics reinforced with graphene nanofillers

    Czech Academy of Sciences Publication Activity Database

    Seiner, Hanuš; Ramírez, C.; Koller, M.; Sedlák, Petr; Landa, Michal; Miranzo, P.; Belmonte, M.; Osendí, M. I.

    2015-01-01

    Roč. 87, December (2015), s. 675-680 ISSN 0264-1275 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61388998 Keywords : multilayer graphene * graphene oxide (GO) * silicon nitride * elastic constants * elastic modulus * shear modulus Subject RIV: JI - Composite Materials Impact factor: 3.997, year: 2015 http://www.sciencedirect.com/science/article/pii/S0264127515302938/pdfft?md5=571e00fd7f976e9b66ed789ae2a868b2&pid=1-s2.0-S0264127515302938-main.pdf

  14. techno-economic packaging of palm wine preservation and bottling

    African Journals Online (AJOL)

    Admin

    Table 4: Net Income Statement N'000. Year. 1. 2. 3. 4. 5. Capacity Utilization % 75. 80. 85. 90. 95. Sales Revenue. 33,750.00. 36,000.00. 38,250.00. 40,500.00. 42,750.00. Less: Production Cost 21,292.19. 22,174.79. 23,381.98. 24,282.09. 25,198.93. Profit Before Tax. 12,457.81. 13,825.21. 14,868.02. 16,217.91. 17,551.07.

  15. INTELLIGENT TRAFFIC-SAFETY MIRROR BY USING WIRELESS SENSOR NETWORK

    Directory of Open Access Journals (Sweden)

    Peter Danišovič

    2014-03-01

    Full Text Available This article is focused on the problematic of traffic safety, dealing with the problem of car intersections with blocked view crossing by a special wireless sensor network (WSN proposed for the traffic monitoring, concretely for vehicle’s detection at places, where it is necessary. Some ultra-low-power TI products were developed due to this reason: microcontroller MSP430F2232, 868MHz RF transceiver CC1101 and LDO voltage regulator TPS7033. The WSN consist of four network nodes supplied with the special safety lightings which serve the function of intelligent traffic safety mirror.

  16. Antioxidant Activity and the relationship with Panholic Composition in some Egyptian Pomegranate Cultivars

    International Nuclear Information System (INIS)

    Mahmoud, K.A.; Ibrahim, G.E.

    2013-01-01

    Pomegranate fruit is an important source of potentially healthy bioactive compounds. Changes in total phenolic content, phenolic compounds and anti radical activity in juice and peel extracts of pomegranate fruit of five cultivars were studied. Total phenolic content (TPC) varied between 1598.96 and 2315.10 mg gallic acid L-1 for pulp juice while TPC ranged from 8.68 to 15.46 mg/g in peel extract. All cultivars juice and peel extracts undertaken had a high capacity while TPC changed from 8.68 to 15.94 mg gallic acid scavenge 1,1-diphenyl-2-picrylhydrazyl (DPPH0) and β- carotene assays Increasing the concentration of either pomegranate juice (PJ) or peel extract increased (P < 0.05) the radical scavenging activity, however anti radical activity of peel extracts was higher than juice one. A good correlation between phenolic content and the radical scavenging activities was observed higher in peel extract than fruit juice. According to the results of high performance liquid chromatography (HPLC), the gallic acids, chlorogenic acid and caffeic were the predominant phenolic compounds of the pomegranate cultivars. We concluded that pomegranate peel extract and juice appeared to have more potential as a health supplement rich in natural antioxidants than the pulp extract and merits and need further intensive study.

  17. Correlation of infrared thermography and skin perfusion in Raynaud patients and in healthy controls.

    Science.gov (United States)

    Schlager, Oliver; Gschwandtner, Michael E; Herberg, Karin; Frohner, Tanja; Schillinger, Martin; Koppensteiner, Renate; Mlekusch, Wolfgang

    2010-07-01

    We aimed to investigate the correlation of infrared thermography (IT) with laser Doppler perfusion imager (LDPI) among patients with primary Raynaud's phenomenon and healthy controls. Forty-seven individuals were included: we examined 25 patients with primary Raynaud's phenomenon and 22 age and gender matched healthy controls. IT of the volar surface of the subjects' left hands was performed to record skin temperature while skin perfusion of the same area was determined using LDPI. All measurements were obtained at room temperature (baseline measurements) and following standardized cold provocation. Good correlation of baseline measurements was found between IT and LDPI in primary Raynaud patients and healthy controls (r=0.868, pRaynaud's phenomenon in contrast to controls (Chi Quadrat, p=0.023 vs. p=0.306). A significant correlation was found between IT and LDPI in primary Raynaud patients and in healthy controls (r=0.868 and r=0.742, both p<0.0001). Following cold provocation, correlation decreases in both groups. Thus, at room temperature IT might substitute for skin perfusion measured by LDPI. Copyright 2010 Elsevier Inc. All rights reserved.

  18. The pathogen-inducible promoter of defense-related LsGRP1 gene from Lilium functioning in phylogenetically distinct species of plants.

    Science.gov (United States)

    Lin, Chia-Hua; Chen, Chao-Ying

    2017-01-01

    A suitable promoter greatly enhances the efficiency of target gene expression of plant molecular breeding and farming; however, only very few promoters are available for economically important non-graminaceous ornamental monocots. In this study, an 868-bp upstream region of defense-related LsGRP1 of Lilium, named P LsGRP1 , was cloned by genome walking and proven to exhibit promoter activity in Nicotiana benthamiana and Lilium 'Stargazer' as assayed by agroinfiltration-based β-glucuronidase (GUS) expression system. Many putative biotic stress-, abiotic stress- and physiological regulation-related cis-acting elements were found in P LsGRP1 . Serial deletion analysis of P LsGRP1 performed in Nicotiana tabacum var. Wisconsin 38 accompanied with types of treatments indicated that 868-bp P LsGRP1 was highly induced upon pathogen challenges and cold stress while the 131-bp 3'-end region of P LsGRP1 could be dramatically induced by many kinds of abiotic stresses, biotic stresses and phytohormone treatments. Besides, transient GUS expression in a fern, gymnosperms, monocots and dicots revealed good promotor activity of P LsGRP1 in many phylogenetically distinct plant species. Thus, pathogen-inducible P LsGRP1 and its 131-bp 3'-end region are presumed potential as tools for plant molecular breeding and farming. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  19. Glycoalkaloid content in pet food by UPLC-tandem mass spectrometry.

    Science.gov (United States)

    Sheridan, Robert S; Kemnah, Jennifer L

    2010-11-01

    The glycoalkaloid content of pet food containing potatoes is investigated using a liquid-liquid solvent extraction followed by analysis by ultra-high pressure liquid chromatography tandem mass spectrometry (UPLC-MS-MS). Pet food samples are homogenized and extracted with a solution of 50:50 (v/v) acetonitrile-deionized water containing 5% acetic acid. Following vortexing and centrifugation, 3 mL of the supernatant is filtered and diluted in deionized water. The extract is injected onto a reverse phase C18 UPLC column with an initial mobile phase composed of 0.15% acetic acid in water (A) and 0.15% acetic acid in methanol (B) in a ratio of 70:30, respectively. The mobile phase reaches a final concentration of 15% A and 85% B over 10 min, at which point it is returned to the initial conditions. α-Solanine is measured by monitoring transitions m/z = 868.50 → 398.40 and 868.50 → 722.50, while α-chaconine is measure by monitoring transitions m/z = 852.60 → 97.80 and 852.60 → 706.50. Each analyte is measured and combined to determine total glycoalkaloid content (TGA). The results of the analysis of 52 pet food samples indicate both glycoalkaloids are present in all samples and two pet foods were found to contain > 100 μg/g total glycoalkaloid.

  20. Evaluation of package inserts of Ayurveda drug formulations from Mumbai city.

    Science.gov (United States)

    Shirolkar, Sudatta; Tripathi, Raakhi K; Potey, Anirudha V

    2015-01-01

    Package insert (PI) is a vital document accompanying a prescribed medication to provide information to the prescriber and end-user at a glance. Studies regarding PIs of Ayurvedic medicines in accordance with standard guidelines are lacking. Present study was undertaken to evaluate PI of Ayurveda drugs. PIs of Ayurveda drugs were obtained from five randomly selected Ayurveda medical shops located in three main zones of Mumbai. From each medical shop, a range of 15-20 PI was planned to be collected for different formulations. It was decided to collect a minimum fifty PIs/group for equitable distribution of various formulations in period of January-June2013. Checklist was prepared, and content validity was achieved. Final validated checklist contained a total of 13 items, and the presence or absence of information pertaining to these items on the PI was evaluated. Any other additional information present on PI was also noted. Each item was analyzed and expressed as percentages. The information on 258 PIs included: Name of ingredients (67%), quantity of ingredients (47.27%), route of administration (86.8%), dosage form (86.8%), indications (18%), dose (18%), contraindications (18%), side effects (9%), shelf life (5.81%), storage conditions (11%), and manufacturers name with contact details (34%). PIs accompanying Ayurveda medicinal products in India are deficient in information required to be furnished by them.

  1. Ingesta de hierro dietario en mujeres adolescentes de instituciones educativas

    Directory of Open Access Journals (Sweden)

    Mabel Vila

    2008-09-01

    Full Text Available Introducción: La anemia por deficiencia de hierro es un problema de salud pública. La baja ingesta de hierro dietario es una de sus causas. Objetivo: Estimar la ingesta de hierro dietario en mujeres adolescentes. Diseño: Estudio descriptivo, transversal. Lugar: Instituciones educativas del distrito de Ancón. Participantes: Trescientos cincuenticinco mujeres adolescentes estudiantes del nivel secundario, elegidas en forma aleatoria. Intervenciones: Previo consentimiento informado, se aplicó un cuestionario de frecuencia de consumo de alimentos y bebidas semicuantitativo. Principales medidas de resultados: Ingesta dietaria diaria de hierro. Resultados: La edad promedio de las adolescentes fue 14 ± 1,69 años. La mediana de ingesta dietaria de hierro fue 10,4 mg/día (cuartil 1= 9 mg/día, cuartil 3 =12,1 mg/día y la mediana de adecuación, 38,4% (cuartil 1 = 33,45%; cuartil 3 = 45,56%. El 86,8% de las adolescentes no cubrieron ni el 50% de sus recomendaciones diarias de hierro. El hierro de alta biodisponibilidad representó la décima parte del total del hierro ingerido. El pan y el arroz fueron los alimentos que más hierro aportaron a la dieta. Conclusiones: El 86,8 % de las adolescentes evaluadas mostró riesgo alto de ingesta inadecuada de hierro. La ingesta de hierro de alta biodisponibilidad fue baja.

  2. The Utilization of Traditional Medicine to Treat Fever in Children in Western Javanese Culture.

    Science.gov (United States)

    Maulida, Tiany Futihat; Wanda, Dessie

    2017-01-01

    Fever regularly affects toddlers and may make their parents uneasy. This study aimed to identify common traditional medicines used by parents to treat their children's fever at home. The study was conducted in Karyasari, Leuwiliang, Bogor District. It was descriptive in design, and the instrument used was a questionnaire developed by the authors. A group of 106 respondents was selected through the cluster sampling method. All respondents were female; the youngest was 20 years old, and the oldest was 53 years old. The majority of respondents had graduated from elementary and junior high school (93%), were currently unemployed (95%), and had a household income of less than Bogor's regional minimum wage (RMW) (91%). The majority of mothers (90.6%) identified fever through tactile perception. The most common traditional medicines used by respondents were onion (86.8%) mixed with oil (64.2%) and applied to the body (86.8%). The results of this study suggested the need for health education concerning the use of traditional medicine to treat fever.

  3. Overweight, adipocytokines and hypertension

    DEFF Research Database (Denmark)

    Seven, Ekim; Husemoen, Lise L N; Wachtell, Kristian

    2014-01-01

    OBJECTIVE: The adipocytokines, leptin, adiponectin, and interleukin-6, which stimulate liver C-reactive protein (CRP) production, are regarded as potential candidate intermediates between adipose tissue and overweight-induced hypertension. METHODS: We examined the associations between leptin......, adiponectin, and CRP levels with both prevalent and 5-year incident hypertension (IHT) in a general population of Danish adults (n = 5,868, 51.3% women, mean age 45.8 ± 7.9 years). RESULTS: We recorded 2195 prevalent and 379 incident cases of hypertension. In models including leptin, CRP, adiponectin, sex.......023) in the fully adjusted model. The population attributable risk estimate of IHT owing to overweight was 31%. CONCLUSION: Leptin, but not adiponectin or CRP, may play a mediating role in overweight-induced hypertension. However, as BMI was a strong independent predictor of hypertension, other factors than leptin...

  4. ADOLESCENT IDIOPATHIC SCOLIOSIS: EVALUATION ON THE EFFECT OF SCREW DENSITY IN THE CORRECTION

    Directory of Open Access Journals (Sweden)

    Enguer Beraldo Garcia

    2016-03-01

    Full Text Available ABSTRACT Objective: The objective was to investigate implant density or the number of screws correlated with the correction of the main curve in patients undergoing surgery for adolescent idiopathic scoliosis (AIS. Methods: We evaluated 112 medical records: 33 patients with screw density of up to 50%, and 79 patients with a density of 100%; all patients underwent surgical correction by posterior approach with transpedicular fixation. Results: In the group of patients with screw density of up to 50% the residual Cobb median was 10°; in the group with 100% density, the median was 7°. Conclusion: Biostatistical analysis showed that the group with up to 50% of screw density presented correction rate of 82.1% and the group with 100% density had correction of about 86.8%. It is therefore concluded that the difference is statistically significant in favor of the fixation with 100% density (p =0.010.

  5. A Measurement of the t $\\bar{t}$ Production Cross Section in p $\\bar{p}$ Collisions at √s = 1.96-TeV using Soft Muon Tagging

    Energy Technology Data Exchange (ETDEWEB)

    Grundler, Ulysses Allen [Univ. of Illinois, Urbana-Champaign, IL (United States)

    2008-01-01

    I present a measurement of the t$\\bar{t}$ production cross section at √s = 1.96 TeV using 2034 pb-1 of CDF Run II data using events with a high transverse momentum electron or muon, three or more jets, and missing transverse energy. The measurement assumes a t → Wb branching fraction of 100 percent. Events consistent with t$\\bar{t}$ decay are found by identifying jets containing heavy-flavor semileptonic decays to muons. The dominant backgrounds are evaluated directly from the data. Based on 248 candidate events and an expected background of 86.8 ± 5.6 events, I measure a production cross section of 8.7 ± 1.1$+0.9\\atop{-0.8}$ ± 0.6 pb, in agreement with the Standard Model.

  6. A clinical study of the relationship between diabetes mellitus and periodontal disease.

    Science.gov (United States)

    Rajhans, Neelima S; Kohad, Ramesh M; Chaudhari, Viren G; Mhaske, Nilkanth H

    2011-10-01

    The relationship between diabetes mellitus and periodontal disease is not clear, even though studied intensively. From the available data, it seemed reasonable to believe that diabetics were more susceptible to periodontal disease than non.diabetics. The present study was to clinically evaluate the relationship of diabetes mellitus with periodontal disease along with various parameters. Fifteen hundred patients with diabetes mellitus were examined. A thorough oral examination was carried out and relevant history was recorded for all the patients. Results indicated that the prevalence of periodontal disease in diabetic patients was 86.8%. It can be concluded that poorer the glycemic control, and longer the duration of diabetes, the greater will be the prevalence and severity of periodontal disease.

  7. DOE Zero Energy Ready Home Case Study: Thrive Home Builders, Lowry Plan

    Energy Technology Data Exchange (ETDEWEB)

    Pacific Northwest National Laboratory

    2017-09-01

    Thrive Home Builders built this 4,119-ft2 home at the Lowry development in Denver, Colorado, to the high-performance criteria of the U.S. Department of Energy’s Zero Energy Ready Home Program. Despite the dense positioning of the homes, mono-plane roof designs afforded plenty of space for the 8.68 kW of photovoltaic panels. With the PV, the home achieves a Home Energy Rating System (HERS) score of 4 and the home owners should enjoy energy bills of about $-11 a year. Without the PV, the home would score a HERS 38 (far lower than the HERS 80 to 100 of typical new homes).

  8. Shutdown dose rate analysis for the European TBM system in ITER

    Czech Academy of Sciences Publication Activity Database

    Pereslavtsev, P.; Fischer, U.; Grosse, D.; Leichtle, D.; Majerle, Mitja

    2012-01-01

    Roč. 87, 5/6 (2012), s. 493-497 ISSN 0920-3796. [10th International Symposium on Fusion Nuclear Technology (ISFNT). Portland, Oregon, 11.09.2011-16.09.2011] Institutional research plan: CEZ:AV0Z10480505 Keywords : ITER * test blanket module * dose rate * neutron streaming Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 0.842, year: 2012 http://ac.els-cdn.com/S0920379612000087/1-s2.0-S0920379612000087-main.pdf?_tid=5dbc1c80-9d09-11e2-b0cd-00000aab0f02&acdnat=1365067612_87a914bcde868dedc633d192db7d6b7b

  9. Monazite processing of tin mining waste : rare earth separation from U and Th

    International Nuclear Information System (INIS)

    Hafni, L.N.; Faizal, R.; Sugeng, W.; Budi, S.; Arif, S.; Susilaningtyas

    2000-01-01

    Separation of Rare Earths from U and Th of Bangka monazite digestion solution, by using NaOH reagent and precipitation system has been carried out. The aim of the experiment is to find a condition of RE(OH) sub.3 precipitation to produce maximal RE recovery and high purity of RE that are free from radioelements U and Th. Parameters studied were pH, NaOH normality and precipitation time. The optimal conditions obtained were pH 9.8, 1N NaOH and 3 hours precipitation time. At this condition recovery of the RE(OH) sub.3 is 99.79 % and Th 4.52 %. However uranium and phosphate were not detected. Purity of the products are RE(OH) sub.3 98.868 %, Th(OH) sub.4 0.009 % and the others 1.123 %. (author)

  10. [Effect of extra-cellular polymeric substances on filtration of modified non-woven fabric in membrane bio-reactor].

    Science.gov (United States)

    Zhang, Chun-hua; Yang, Feng-lin; Wang, Wen-jun; An, Xiao-wen; Zhang, Feng-jie

    2008-06-01

    The effect of extra-cellular polymeric substances (EPS) on filtration of polyvinyl alcohol modified polypropylene non-woven in submerged membrane bioreactor (SMBR) was investigated by statistical method. The results show that soluble extra-cellular polymeric substances (EPSs) of activated sludge on the non-woven modules surface, components (protein/carbohydrate, P/C) of EPSs and relative hydrophobicity (RH) have a significant influence on filtration performance of module B, the Pearson's correlation coefficient (r(p)) related to membrane fouling resistance are 0.868, 0.840, 0.890, respectively. Modified module can effectively restrict the adsorption of EPSs, can reduce the ratio of P/C in EPSs and can decrease the accumulation of activated sludge. After hydrophilic modification of non-woven, the filtration performance is improved obviously and the un-fouling performance is increased.

  11. Piezoelectric and electromechanical properties of ultrahigh temperature CaBi2Nb2O9 ceramics

    International Nuclear Information System (INIS)

    Wang, Jin-Feng; Zhang, Shujun; Shrout, Thomas R.; Wang, Chun-Ming

    2009-01-01

    The piezoelectric, dielectric, and electromechanical properties of the (KCe) co-substituted calcium bismuth niobate (CaBi 2 Nb 2 O 9 , CBN) were investigated. The piezoelectric activities of CBN ceramics were significantly enhanced and the dielectric loss tan δ decreased by (KCe) substitution. The Ca 0.9 (KCe) 0.05 Bi 2 Nb 2 O 9 ceramics possess the optimal piezoelectric properties, and the piezoelectric coefficient (d 33 ), Curie temperature (T C ), and electromechanical coupling factors (k p and k t ) were found to be 16 pC/N, 868 C, 8.6%, and 23.8%, respectively. The excellent dielectric and electromechanical spectra, together with the high piezoelectric activities and ultrahigh Curie temperature, make CBN ceramics promising candidates for high temperature piezoelectric applications. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  12. Estadiaje local del carcinoma rectal: imágenes de ecografía versus resonancia magnética. Revisión sistemática de la literatura y metaanálisis.

    Science.gov (United States)

    Guenaga, Katia F; Otoch, Jose P; Artifon, Everson L A

    2016-01-01

    New surgical techniques in the treatment of rectal cancer have improved survival mainly by reducing local recurrences. A preoperative staging method is required to accurately identify tumor stage and planning the appropriate treatment. MRI and ERUS are currently being used for the local staging (T stage). In this review, the accuracy of MRI and ERUS with rigid probe was compared against the gold standard of the pathological findings in the resection specimens. Five studies met the inclusion criteria and were included in this meta-analysis. The accuracy was 91.0% to ERUS and 86.8% to MRI (p=0.27). The result has no statistical significance but with pronounced heterogeneity between the included trials as well as other published reviews. We can conclude that there is a clear need for good quality, larger scale and prospective studies.

  13. Aeroelastic flutter energy harvesters self-polarized by triboelectric effects

    Science.gov (United States)

    Perez, M.; Boisseau, S.; Geisler, M.; Gasnier, P.; Willemin, J.; Despesse, G.; Reboud, J. L.

    2018-01-01

    This paper presents the performances of several electrostatic flutter energy harvesters tested in a wind tunnel between 0 and 20 m s-1. The main idea is to use the flutter capability of thin flexible films confined between lateral walls to induce simultaneously the capacitance variations and the electrostatic polarization required by the triboelectric/electrostatic conversion. This technology provides thin and flexible devices and solve the electret’s stability issue (Perez et al 2015 Smart Mater. Struct., Perez et al 2015 New Circuits and Systems). Our prototypes (light breeze) to 35 μW cm-2@20 m s-1 (fresh gale). A Maximum Power Point circuit has been developed to efficiently use the power provided by the energy harvesters. The energy harvester combined with its power management circuit has finally been used to supply an 868 MHz wireless sensor node with temperature and acceleration measurements, validating the complete energy harvesting chain.

  14. Hombres Sanos: exposure and response to a social marketing HIV prevention campaign targeting heterosexually identified Latino men who have sex with men and women.

    Science.gov (United States)

    Martínez-Donate, Ana P; Zellner, Jennifer A; Fernández-Cerdeño, Araceli; Sañudo, Fernando; Hovell, Melbourne F; Sipan, Carol L; Engelberg, Moshe; Ji, Ming

    2009-10-01

    This study examined the reach and impact of a social marketing intervention to reduce HIV risk among heterosexually identified (HI) Latino men who have sex with men and women (MSMW). Repeated cross-sectional intercept surveys were conducted in selected community venues during and after the campaign with 1,137 HI Latino men. Of them, 6% were classified as HI Latino MSMW. On average, 85.9% of the heterosexual respondents and 86.8% of the HI MSMW subsample reported exposure to the campaign. Responses to the campaign included having made an appointment for a male health exam that included HIV testing and using condoms. Campaign exposure was significantly associated with HIV testing behavior and intentions and with knowledge of where to get tested. The campaign reached its underserved target audience and stimulated preventive behaviors. Social marketing represents a promising approach for HIV prevention among HI Latinos, in general, and HI Latino MSMW, in particular.

  15. Incretin-based therapy and risk of acute pancreatitis

    DEFF Research Database (Denmark)

    Thomsen, Reimar Wernich; Pedersen, Lars; Møller, Niels

    2015-01-01

    OBJECTIVE: To investigate whether the use of incretin-based drugs (GLP-1 receptor agonists and dipeptidyl peptidase 4 [DPP4] inhibitors) is associated with acute pancreatitis. RESEARCH DESIGN AND METHODS: The study was a nationwide population-based case-control study using medical databases...... in Denmark. Participants were 12,868 patients with a first-time hospitalization for acute pancreatitis between 2005 and 2012 and a population of 128,680 matched control subjects. The main outcome measure was the odds ratio (OR) for acute pancreatitis associated with different antihyperglycemic drugs. We...... adjusted for history of gallstones, alcoholism, obesity, and other pancreatitis-associated comorbidities and medications. RESULTS: A total of 89 pancreatitis patients (0.69%) and 684 control subjects (0.53%) were ever users of incretins. The crude OR for acute pancreatitis among incretin users was 1.36 (95...

  16. Organochlorine insecticides (DDT and heptachlor in dry fish: Traditional washing and cooking effect on dietary intake

    Directory of Open Access Journals (Sweden)

    Matiur Rahim

    2009-06-01

    Full Text Available The concentrations of organochlorine insecticides (DDT and heptachlor were investigated to estimate the effect of various washing and boiling/cooking to elucidate the concentration level we intake actually. For this study five most popular dry fish samples namely bombay duck (loittya, ribbon fish (chhuri, shrimp (chingri, chinese pomfret (rupchanda and Indian salmon (lakhua were analyzed. The highest concentrations of DDT and heptachlor were found 737.238 ppb (Indian salmon, normal and 44.806 ppb (shrimp, normal respectively; after boiling treatment a big amount was washed out and remained only 135.516 ppb and 16.868 ppb respectively. Boiling treatment was found more effective than the others.

  17. Microstructure, Mechanical and Tribological Properties of Oxide Dispersion Strengthened High-Entropy Alloys.

    Science.gov (United States)

    Liu, Xinyu; Yin, Hangboce; Xu, Yi

    2017-11-15

    A novel metal matrix composite CrMnFeCoNi with Y₂O₃ as reinforcement phase was designed and manufactured by mechanical alloying and spark plasma sintering. After sintering at 900 °C for 5 min, the microstructure consisted of a FCC matrix and Y₂O₃ nanoparticles. The addition of 0.25 wt % Y₂O₃ increased the room temperature tensile strength of the CrMnFeCoNi base from 868 MPa to 1001 MPa, while the mechanical properties of the addition of 0.5 wt % Y₂O₃ composite decreased. In the meantime, the addition of Y₂O₃ had no significant influence on the coefficient of friction, while the addition of 0.25 wt % Y₂O₃ composite shows excellent wear-resistance.

  18. A study of electrode wear ratio on EDM of Ti-6AL-4V with copper-tungsten electrode

    Directory of Open Access Journals (Sweden)

    Zainal Nurezayana

    2016-01-01

    Full Text Available In this work, a study of electrode wear ratio (EWR on the diesinking electrical discharge machining (EDM of Ti-6AL-4V titanium alloy with copper-tungsten (Cu-W electrode has been carried out. Pulse on time (ON, pulse of time (OFF, peak current (V and servo voltage (SV were seen as the machining parameters. The experiments were run according to the design of experiments (DOE, which is two levels of full factorial with added centre points. The experimental results reveal that pulse on time and peak current are statistically significant parameters for affecting EWR with the p-value of 0.0013 and 0.0012 respectively. Moreover, based on ANOVA, we recognized peak current as the most significant parameters which contribute 31.75%, followed by pulse on time, servo voltage and pulse on time which contribute 30.99%, 8.68% and 0.72%, respectively.

  19. Perspectives on palliative care in Lebanon: knowledge, attitudes, and practices of medical and nursing specialties.

    Science.gov (United States)

    Abu-Saad Huijer, Huda; Dimassi, Hani; Abboud, Sarah

    2009-09-01

    Our objective was to determine the knowledge, attitudes, and practices of physicians and nurses on Palliative Care (PC) in Lebanon, across specialties. We performed a cross-sectional descriptive survey using a self-administered questionnaire; the total number of completed and returned questionnaires was 868, giving a 23% response rate, including 74.31% nurses (645) and 25.69% physicians (223). Significant differences were found between medical and surgical nurses and physicians concerning their perceptions of patients' and families' outbursts, concerns, and questions. Knowledge scores were statistically associated with practice scores and degree. Practice scores were positively associated with continuing education in PC, exposure to terminally ill patients, and knowledge and attitude scores. Acute critical care and oncology were found to have lower practice scores than other specialties. Formal education in palliative care and development of palliative care services are very much needed in Lebanon to provide holistic care to terminally ill patients.

  20. Trabalhando em Educação Ambiental a importância de uma estação de tratamento de esgoto na cidade de São Leopoldo, Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Juliana Cristina Soares de Souza

    2014-02-01

    Full Text Available Em 2010, foi inaugurada uma nova Estação de Tratamento de Esgoto (ETE em São Leopoldo, que passou a atender em torno de 40 mil moradores da região. Com o objetivo de despertar nas pessoas o interesse pelas questões ambientais relacionadas à ETE, apresentou-se, a uma daquelas comunidades, um projeto onde foram desenvolvidas atividades práticas e teóricas envolvendo crianças, jovens e adultos, totalizando 868 atendimentos. Entende-se que, com o comprometimento adquirido pelas pessoas através da educação ambiental, é possível fazer com que elas percebam a importância de uma ETE para a melhoria de sua qualidade de vida e do meio ambiente.

  1. DENGUE PATIENTS AT PHOTHARAM HOSPITAL: A CLINICAL TRIAL SITE OF DENGUE VACCINE.

    Science.gov (United States)

    Nunthanid, Somboon; Tiawilai, Anongrat

    2015-01-01

    Between 2005 and 2013, 1,868 dengue patients, 916 male and 952 female, were admitted to Photharam Hospital, Ratchaburi, Thailand. Among these patients, there were 1,209 with dengue fever (DF), 598 with dengue hemorrhagic fever (DHF), and 61 with dengue shock syndrome (DSS) with 1 death. The disease was seen all year round with a higher incidence in the rainy season. A trend of shift in age group towards older children and adults was seen during the study period. These data show that dengue patient admissions to Photharam Hospital are common, causing a heavy burden on the health system. Only one death was seen during the period of study, indicating that early recognition and effective management of dengue patients occurred. The trend towards higher age in dengue patients during the study period is a problem of concern and needs further clarification.

  2. Determination of the 4 mm Gamma Knife helmet relative output factor using a variety of detectors

    International Nuclear Information System (INIS)

    Tsai, J.-S.; Rivard, Mark J.; Engler, Mark J.; Mignano, John E.; Wazer, David E.; Shucart, William A.

    2003-01-01

    Though the 4 mm Gamma Knife helmet is used routinely, there is disagreement in the Gamma Knife users community on the value of the 4 mm helmet relative output factor. A range of relative output factors is used, and this variation may impair observations of dose response and optimization of prescribed dose. To study this variation, measurements were performed using the following radiation detectors: silicon diode, diamond detector, radiographic film, radiochromic film, and TLD cubes. To facilitate positioning of the silicon diode and diamond detector, a three-dimensional translation micrometer was used to iteratively determine the position of maximum detector response. Positioning of the films and TLDs was accomplished by manufacturing custom holders for each technique. Results from all five measurement techniques indicate that the 4 mm helmet relative output factor is 0.868±0.014. Within the experimental uncertainties, this value is in good agreement with results obtained by other investigators using diverse techniques

  3. A ENFERMAGEM DE SAÚDE PÚBLICA NO CONTROLE DA HANSENÍASE: CONHECIMENTO DO PESSOAL DE ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Elisete Silva Pedrazzani

    Full Text Available Este trabalho é parte do relato da pesquisa realizada na área de Dermatologia Sanitária - Hanseniase nos Centros de Saúde I do Departamento Regional de Saúde de Ribeirão Preto, da Secretaria da Saúde do Estado de São Paulo. A investigação procurou verificar o conhecimento do pessoal de enfermagem que atuava diretamente na área, constatando que o conhecimento correto variou de 86,8% a 60,4% para os itens "noções sobre a doença" e "noções sobre provas e testes", sendo que as respostas completas também apresentaram um coeficiente superior às incompletas. No entanto, foi significativo o número de respostas "incorretas" e "não sabe", de acordo com a classificação realizada para cada item.

  4. Organization of the cysts in bee (Hymenoptera, Apidae testis: number of spermatozoa per cyst

    Directory of Open Access Journals (Sweden)

    Cruz-Landim Carminda da

    2001-01-01

    Full Text Available The morphology of the cyst cells in Apis mellifera Linné, 1758, Scaptotrigona postica Latreille, 1804, and Melipona bicolor bicolor Lepeletier, 1836 testis, as well as the average number of spermatic cells are reported. The data indicates a supporting and nourrishing role of the cyst cells to the developing cystocytes. The counts of immature spermatozoa in the cysts show an average of 202.8 ± 21.2 spermatozoa for A. mellifera, 117.4 ± 8.68 for S. postica and 88.8 ± 15.57 for M. bicolor, which predict the occurrence of 8 mitotic cycles in the cystocytes of A. mellifera and 7 in the meliponines, considering that only one spermatozoom originates of each final spermatogonium.

  5. The State of Food Security Report 2012 and the Enigma of Achieving Millennium Development Goals

    Directory of Open Access Journals (Sweden)

    Vikas Bajpai

    2013-07-01

    Full Text Available Globally quoted and unquestioningly accepted, the State of the Food Insecurity in the world report 2012, has made significant reduction in the numbers of hungry globally at 868 million. In case of India it has made significant upward revision of hunger prevalence in 1990-92 and significant downward revision for 2010 resulting in 34.9% estimated hunger decline. In the midst of claims of robust methodological revisions, its calculations and assumptions set a dangerous precedence for the policy-makers and planners of the reluctant country governments and worst for the hungry of the world. This paper discusses the SOFI 2012, critiques the declining hunger numbers in SOFI 2012 and produces alternate data sets including independent surveys of Government of India, to counter the reduction claims. It also makes a case for greater public dialogue and engagement in such reports, their methods, metrics and numbers.

  6. Accumulation of cadmium in and its effect on the midgut gland of terrestrial snail Helix pomatia L. from urban areas in Poland.

    Science.gov (United States)

    Włostowski, Tadeusz; Kozłowski, Paweł; Laszkiewicz-Tiszczenko, Barbara; Oleńska, Ewa; Aleksandrowicz, Olgierd

    2014-11-01

    The objectives of this study were (1) to determine cadmium (Cd) accumulation in the midgut gland of a land snail Helix pomatia L. inhabiting residential areas of the 14 largest cities in Poland, and (2) to examine whether the accumulated Cd exerted any toxic effects. The average accumulation of Cd in the midgut gland of snails, weighing 16-18 g, ranged from 7.00 to 87.3 µg/g dry weight (0.06-0.77 µmol/g) and differed significantly among animals from the various urban areas. This difference in Cd accumulation was not related to city population, but was associated with the topsoil Cd (R(2) = 0.868, p < 0.0001). The tissue Cd was not found to produce toxicity (histopathology, programmed cell death, lipofuscin formation or lipid peroxidation), probably due to the induction of sufficiently high quantities of metallothionein and glutathione, well-known protective molecules.

  7. Small Size and Low Cost UHF RFID Tag Antenna Mountable on Metallic Objects

    Directory of Open Access Journals (Sweden)

    Sergio López-Soriano

    2015-01-01

    Full Text Available Reducing tag size while maintaining good performance is one of the major challenges in radio-frequency identification applications (RFID, in particular when labeling metallic objects. In this contribution, a small size and low cost tag antenna for identifying metal objects in the European UHF band (865–868 MHz is presented. The antenna consists of a transmission line mounted on an inexpensive thin dielectric which is proximity-coupled to a short-ended patch mounted on FR4 substrate. The overall dimensions of the tag are 33.5 × 30 × 3.1 mm. Experimental results show that, for an EIRP of 3.2 W (European regulations, such a small and cheap tag attains read ranges of about 5 m when attached to a metallic object.

  8. Impact of omalizumab on medical cost of childhood asthma in Japan.

    Science.gov (United States)

    Yoshikawa, Hideki; Iwata, Mihoko; Matsuzaki, Hiroshi; Ono, Rintaro; Murakami, Yoko; Taba, Naohiko; Honjo, Satoshi; Motomura, Chikako; Odajima, Hiroshi

    2016-05-01

    Omalizumab is effective in children with severe asthma, but its impact on medical cost in Japan is not clear. We evaluated the impact of omalizumab on medical cost by comparing the pre- vs post-omalizumab-initiation medical costs of 12 children with severe asthma who received omalizumab for 2 years, and calculating incremental cost-effectiveness ratio for omalizumab therapy. Health outcome was measured as hospital-free days (HFD). The median total medical costs and medication fee per patient increased significantly after omalizumab initiation because of the high cost of omalizumab. The median hospitalization fee per patient, however, decreased significantly after omalizumab initiation due to reduction in hospitalization. Omalizumab led to an estimated increase of 40.8 HFD per omalizumab responder patient per 2 years. The cost was JPY 20 868 per additional HFD. Omalizumab can therefore reduce hospitalization cost in children with severe asthma in Japan. © 2016 Japan Pediatric Society.

  9. Highly efficient betanin dye based ZnO and ZnO/Au Schottky barrier solar cell

    Energy Technology Data Exchange (ETDEWEB)

    Thankappan, Aparna, E-mail: aparna.subhash@gmail.com [International School of Photonics (ISP), Cochin University of Science and Technology, Kochi (India); Inter University Centre for Nanomaterials and Devices (IUCND), Cochin University of Science and Technology, Kochi (India); Divya, S.; Augustine, Anju K.; Girijavallaban, C.P.; Radhakrishnan, P.; Thomas, Sheenu; Nampoori, V.P.N. [International School of Photonics (ISP), Cochin University of Science and Technology, Kochi (India)

    2015-05-29

    Performance of dye sensitized solar cells based on betanin natural dye from red beets with various nanostructured photoanodes on transparent conducting glass has been investigated. In four different electrolyte systems cell efficiency of 2.99% and overall photon to current conversion efficiency of 20% were achieved using ZnO nanosheet electrode with iodide based electrolyte in acetonitrile solution. To enhance solar harvesting in organic solar cells, uniform sized metal nanoparticles (gold (Au) of ~ 8 nm) synthesized via microwave irradiation method were incorporated into the device consisting of ZnO. Enhanced power conversion efficiency of 1.71% was achieved with ZnO/Au nanocomposite compared to the 0.868% efficiency of the bare ZnO nanosheet cell with ferrocene based electrolyte. - Highlights: • The influence of electrolytes has been studied. • Cell efficiency of 2.99% was achieved by ZnO. • Enhancement of efficiency with incorporation of Au nano.

  10. ICT Competences of teachers. Influence of personal and contextual factors [Las competencias en TIC del profesorado. Influencia de factores personales y contextuales

    Directory of Open Access Journals (Sweden)

    Jesús Suárez Rodríguez

    2012-03-01

    Full Text Available The ICT competences of teachers remain a crucial issue for educational development. This work aims to establish a framework to specify the relations of the two elements of competence (technological and pedagogical and analyze the influence of key personal and contextual factors. The data were collected from a questionnaire in a sample of 868 teachers from primary and secondary education in Comunidad Valenciana (Spain. The results show the importance of a multivariate approach to assess the complexity of the problem. They provide an overview of the influences of different personal and contextual factors that go beyond the many contributions based on univariate approaches. This is very relevant to the development of education policies for both programs for endowments as those aimed at teacher training.

  11. RNA-binding protein VICKZ is expressed in a germinal center associated pattern among lymphoma subtypes

    DEFF Research Database (Denmark)

    Natkunam, Y.; Vainer, G.; Zhao, S.C.

    2005-01-01

    and tumorigenesis/metastasis. We generated an antibody that recognizes all three isoforms of VICKZ protein and characterized its expression in normal lymphoid tissue and in lymphoma subtypes. In normal tonsils, VICKZ protein showed a germinal center-specific pattern of expression with staining localized...... to the cytoplasm. Among 868 non-Hodgkin and Hodgkin lymphomas tested by immunohistochemistry on tissue microarrays, staining for VICKZ protein was present in 76% (126/165) of follicular lymphoma, 78% (155/200) of DLBCL, 90% (9/10) of mediastinal large B-cell lymphoma, and 100% (2/2) of Burkitt lymphoma. A subset...... protein in lymphoma subtypes suggests a potential utility for VICKZ in the identification of subgroups of DLBCL associated with different prognoses....

  12. Project hunt: an assessment of wildlife hunting practices by local community in Chizami, Nagaland, India

    Directory of Open Access Journals (Sweden)

    Erekhrou Naro

    2015-09-01

    Full Text Available Hunting is suggested as a major threat to Indian wildlife, especially in the northeastern states. In Nagaland hunting has a traditional and cultural significance, which should be taken into consideration by conservation efforts.  Limited information is available on this issue, and in order to establish a baseline for efforts aimed at education and implementation of conservation programmes, in this study we investigated various aspects of hunting practices in Chizami Village, Nagaland.  Our study involved general voting by 868 people and detailed interviews of 80 hunters, and explores the demography of hunters, hunting areas, hunting preference for season and animals, methods of hunting, reasons for hunting and willingness to cease hunting.  Our results indicate that education could be an important primer for initiating biological conservation efforts in Chizami and other areas. 

  13. (R,S-2′-Amino-6′-methyl-2,5′,5′-trioxo-6′H-spiro[indoline-3,4′-pyrano[3,2-c][2,1]benzothiazine]-3′-carbonitrile dimethylformamide monosolvate

    Directory of Open Access Journals (Sweden)

    Svitlana V. Shishkina

    2014-07-01

    Full Text Available The title solvate, C20H14N4O4S·C3H7NO, comprises a stereogenic centre but the centrosymmetric space group causes the presence of the racemate in the crystal. The spiro-joined fragments are almost orthogonal, with a dihedral angle of 86.8 (2° between the mean planes of the pyrane ring and the dihydroindolone ring system. The atoms of the indolinone bicycle are coplanar, with an r.m.s. deviation of 0.005 Å. In the crystal, pairs of N—H...O hydrogen bonds link the molecules into centrosymmetric dimers which are linked to the dimethylformamide solvent molecules by further N—H...O hydrogen bonds. N—H...N hydrogen bonds link neighbouring dimers into [010] chains.

  14. 1-Amine-1,2,3-triazolium salts with oxidizing anions: A new family of energetic materials with good performance

    Science.gov (United States)

    Zhang, Zhi-Bin; Zhang, Jian-Guo

    2018-04-01

    A series of 1-amino-1,2,3-triazole (ATZ) based energetic nitrogen-rich salts are prepared by using acid-base neutralization reaction (1:1 M ratio), and fully characterized. Structures of the salts are recrystallized and determined by single-crystal X-ray diffraction, which dominated by a strong hydrogen-bond influence with the densities ranging from 1.692 to 1.868 g cm-3. Thermal behaviors have characterized by using the DSC and TG-DTG technologies. The enthalpies of formation have calculated by using Gaussian 03. The detonation parameters of the salts are determined by using the K-J method, and most salts show promising detonation performances (D: 6699-8231 m s-1, P: 19.2-30.7 GPa), among which the salt of 1-amino-1,2,3-triazolium trinitrophloroglucinate has a detonation properties comparable to RDX. The sensitivities results provided the salts as insensitive energetic materials.

  15. A practical approach for the calculation of the activation energy of the sintering

    Directory of Open Access Journals (Sweden)

    Pouchly Vaclav

    2016-01-01

    Full Text Available Newly developed software for calculation of activation energy (Qs in the following of sintering using the Wang and Raj model is presented. To demonstrate the practical potential of the software and to evaluate the behaviour of the Qs during the sintering process, alumina and cubic zirconia ceramic compacts were prepared from nanometric powders. The results obtained with both materials are in agreement with previously published data calculated by different approaches. In the interval of interest (relative densities from 60 % to almost 100 % of theoretical density, both materials show similar behaviour. Three distinct regions can be seen: the initial constant values of Qs 868 kJ/mol and 762 kJ/mol for alumina and cubic zirconia, respectively; a region containing linear drop of Qs and the final region of constant Qs values 625 kJ/mol and 645 kJ/mol for alumina and cubic zirconia, respectively.

  16. Identification of Tilletia species using rep-PCR fingerprinting technique

    Directory of Open Access Journals (Sweden)

    Župunski Vesna

    2011-01-01

    Full Text Available Analyzing 167 non-processed seed samples of wheat, it was found that 145 samples (86.8 % were contaminated with Tilletia species, while 22 (13.2 % samples were not contaminated. By using rep-PCR fingerprinting technique, it was found that DNA isolates of T. tritici originated from Serbian wheat samples had 80 % similarity with positive control for T. tritici. One isolate shared similarity of 60% with T. tritici, T. controversa and T. laevis. It was supposed that this isolate belongs to T. bromi. Isolate of T. laevis shared a similarity of 70 % with isolates of T. tritici and T. controversa, while T. walkeri was more than 10 % similar with T. tritici, T. controversa and T. laevis. Although T. controversa and T. tritici had high percent of genetic similarity, they were clustered separately. Our results suggest that rep-PCR fingerprinting could be a useful tool for monitoring presence of morphologically similar Tilletia species in wheat production areas.

  17. Analytical correlation of centrifugal compressor design geometry for maximum efficiency with specific speed

    Science.gov (United States)

    Galvas, M. R.

    1972-01-01

    Centrifugal compressor performance was examined analytically to determine optimum geometry for various applications as characterized by specific speed. Seven specific losses were calculated for various combinations of inlet tip-exit diameter ratio, inlet hub-tip diameter ratio, blade exit backsweep, and inlet-tip absolute tangential velocity for solid body prewhirl. The losses considered were inlet guide vane loss, blade loading loss, skin friction loss, recirculation loss, disk friction loss, vaneless diffuser loss, and vaned diffuser loss. Maximum total efficiencies ranged from 0.497 to 0.868 for a specific speed range of 0.257 to 1.346. Curves of rotor exit absolute flow angle, inlet tip-exit diameter ratio, inlet hub-tip diameter ratio, head coefficient and blade exit backsweep are presented over a range of specific speeds for various inducer tip speeds to permit rapid selection of optimum compressor size and shape for a variety of applications.

  18. Dicty_cDB: Contig-U15757-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2GFT0) RecName: Full=30S ribosomal protein S4; &CP000236_868(... 63 7e-08 X84131_1( X84131 |pid:none) Luzula sylvatica cloro...era marginata ribosomal pro... 61 3e-07 X84125_1( X84125 |pid:none) Dioscorea batatas cloro...01_1586... 61 3e-07 X84136_1( X84136 |pid:none) Oncidium ansiferum cloroplast rps...1( X84124 |pid:none) Dioscorea balcanica cloroplast rps4 ge... 61 3e-07 AY212322_1( AY212322 |pid:none) Pass...7 X84108_1( X84108 |pid:none) Aechmea galbata cloroplast rps4 gene f... 60 6e-07 ( O20231 ) RecName: Full=30

  19. Dicty_cDB: Contig-U15184-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 236_868(... 63 1e-08 X84131_1( X84131 |pid:none) Luzula sylvatica cloroplast rps4...ne) Anisoptera marginata ribosomal pro... 61 4e-08 X84125_1( X84125 |pid:none) Dioscorea batatas cloro...ame: Full=30S ribosomal protein S4; &CP000301_1586... 61 5e-08 X84136_1( X84136 |pid:none) Oncidium ansiferum cloro...ein S4, chloroplastic; ... 61 5e-08 X84124_1( X84124 |pid:none) Dioscorea balcanica cloroplast rps4 ge... 61... ribo... 60 9e-08 X84108_1( X84108 |pid:none) Aechmea galbata cloroplast rps4 gen

  20. Estrategias de aprendizaje y hábitos de estudio en el nivel superior: Diferencias según el año de cursado

    Directory of Open Access Journals (Sweden)

    Nancy Malander

    2014-05-01

    Full Text Available This research is meant to identify if the learning strategies and study habits of Higher Education students vary according to the year of study; and to detect the strategies that are used deficiently by students, mainly by first year students. The Learning and Study Strategies Inventory (LASSI was administered to 115 Higher Education students (ME age= 21.76; SD= 3.868. Statistically significant differences were found in the following LASSI scales: Motivation, Time Management, Concentration, Information Processing, Test Strategies, Attitude and Selecting Main Ideas. First year students obtained the lowest averages in every scale. The scales they put to use the least were: Time Management, Concentration, Anxiety, and Self-Testing or Control.

  1. Malaria in New Guinea during the Second World War: the Land Headquarters Medical Research Unit.

    Science.gov (United States)

    Fenner, F; Sweeney, A W

    1998-06-01

    In June 1943 arrangements were made to carry out experiments on malaria suppressive drugs on human volunteers in Cairns, in north Queensland, under the direction of Brigadier Neil Hamilton Fairley; early in 1944 the Land Headquarters Medical Research Unit was established to continue this work. Using 868 healthy volunteers and 317 infected soldiers and A. punctulatus mosquitoes flow in from New Guinea or bred locally, several suppressive drugs were tested. Doses of 10 grains of quinine daily failed to suppress New Guinea strains of P. falciparum and were only partially effective against P. vivax infections, whereas 100 mg of atebrin daily controlled symptoms of P. vivax infection and cured infections with most New Guinea strains of P. falciparum, however some strains of P. falciparum from Wewak were resistant to this dose, but were cured with double the daily dose.

  2. Amino Acids in the TM4-TM5 loop of Na,K-ATPase Are Important for Biosynthesis

    DEFF Research Database (Denmark)

    Jørgensen, Jesper Roland; Houghton-Larsen, Jens; Jacobsen, Mette Dorph

    2003-01-01

    -sensitive folding mutants, as they induce the unfolded protein response at 30°C but not at 15°C. We used an algorithm to predict that residues 868ENGFLIPIHLL878 in the L78 loop exposed to the endoplasmic reticulum lumen constitute the most likely BiP binding site. Correct folding of this sequence may be important...... in the endoplasmic reticulum quality control, as the same loop is responsible for the a-ß-associations required to leave this compartment. On the basis of the Ca-ATPase crystal structure and the presented data, we propose a model to account for the role of the TM4-TM5 loop in Na,K-ATPase biosynthesis....

  3. An epidemiological study of headache among the Monks of Athos (Greece).

    Science.gov (United States)

    Mitsikostas, D D; Thomas, A; Gatzonis, S; Ilias, A; Papageorgiou, C

    1994-10-01

    The Monks of Athos in Greece constitute a particular group with unusual sleep schedule and specific diet. In order to study the frequency of headache among them, a special questionnaire was designed. Four hundred forty-nine monks below the age of 50 were approached, 39 of whom suffered from frequent (more than one episode per month, in the last 6 months) headaches (8.68%). The prevalence of migraine was 1.78% (0.66% with aura and 1.11% without) and of tension-type headache 3.34% (1.33% chronic and 2% episodic). Furthermore, 1.87% of monks suffered from mixed headaches (tension-type and migraine attacks as well). Cluster headache was not traced.

  4. Measurement of $\\omega$ meson parameters in $\\pi^{+}\\pi^{-}\\pi^{0}$ decay mode with CMD-2

    CERN Document Server

    Akhmetshin, R R; Aulchenko, V M; Banzarov, V S; Barkov, L M; Baru, S E; Bashtovoy, N S; Bondar, A E; Bondarev, D V; Chernyak, D V; Dhawan, S K; Eidelman, S I; Fedotovich, G V; Gabyshev, N I; Grebeniuk, A A; Grigoriev, D N; Hughes, V W; Khazin, B I; Koop, I A; Kurdadze, L M; Kuzmin, A S; Logashenko, I B; Lukin, P A; Lysenko, A P; Nesterenko, I N; Okhapkin, V S; Perevedentsev, E A; Polunin, A A; Purlatz, T A; Root, N I; Ruban, A A; Ryskulov, N M; Shamov, A G; Shatunov, Yu M; Shekhtman, A I; Sher, A E; Shwartz, B A; Sidorov, V A; Skrinsky, A N; Smakhtin, V P; Snopkov, I G; Solodov, E P; Stepanov, P Yu; Sukhanov, A Yu; Thompson, J A; Titov, V M; Valishev, A A; Yudin, Yu V; Zverev, S G

    2000-01-01

    About 11 200 $ e^+e^- \\to \\omega \\to \\pi^+\\pi^-\\pi^0$ events selected in the center of mass energy range from 760 to 810 MeV were used for the measurement of the $\\omega$ meson parameters. The following results have been obtained: $\\sigma _{0}=(1457 \\pm 23 \\pm 19 )$ nb, $m_{\\omega }=(782.71 \\pm 0.07 \\pm 0.04)$ MeV/c$^{2}$, $\\Gamma _{\\omega }=(8.68 \\pm 0.23 \\pm 0.10 )$ MeV, $\\Gamma _{e^+e^-}\\cdot$Br$(ømega \\to \\pi^+\\pi^-\\pi^0)= (0.528 \\pm 0.012 \\pm 0.007) \\cdot 10^{-3}$ MeV.

  5. Reflexões acerca da modulação de efeitos: decisões proferidas pelo STF em matéria tributária

    OpenAIRE

    Farias, Érika Dias Machado Costa de

    2011-01-01

    Atualmente tem-se verificado grande número de julgados contendo a modulação de efeitos da decisão de inconstitucionalidade em matéria tributária no Supremo Tribunal Federal, conforme disposto do artigo 27 da Lei 9.868/99. Para o exame do tema, faz-se uma análise das teorias da anulabilidade e nulidade. A modulação dos efeitos temporais é uma forma de atenuação à teoria da nulidade do ato inconstitucional, pois impede a adoção de eficácia retroativa das decisões de inconstitu...

  6. 3D-QSAR Investigation of Synthetic Antioxidant Chromone Derivatives by Molecular Field Analysis

    Directory of Open Access Journals (Sweden)

    Jiraporn Ungwitayatorn

    2008-02-01

    Full Text Available A series of 7-hydroxy, 8-hydroxy and 7,8-dihydroxy synthetic chromone derivatives was evaluated for their DPPH free radical scavenging activities. A training set of 30 synthetic chromone derivatives was subject to three-dimensional quantitative structure-activity relationship (3D-QSAR studies using molecular field analysis (MFA. The substitutional requirements for favorable antioxidant activity were investigated and a predictive model that could be used for the design of novel antioxidants was derived. Regression analysis was carried out using genetic partial least squares (G/PLS method. A highly predictive and statistically significant model was generated. The predictive ability of the developed model was assessed using a test set of 5 compounds (r2pred = 0.924. The analyzed MFA model demonstrated a good fit, having r2 value of 0.868 and crossvalidated coefficient r2cv value of 0.771.

  7. An experimental evaluation of the performance deficit of an aircraft engine starter turbine

    Science.gov (United States)

    Haas, J. E.; Roelke, R. J.; Hermann, P.

    1980-01-01

    An experimental investigation is presented to determine the aerodynamic performance deficit of a 13.5 - centimeter-tip-diameter aircraft engine starter turbine. The two-phased evaluation comprised both the stator and the stage performance, and the experimental design is described in detail. Data obtained from the investigation of three honeycomb shrouds clearly showed that the filled honeycomb reached a total efficiency of 0.868, 8.2 points higher than the open honeycomb shroud, at design equivalent conditions of speed and blade-jet speed ratio. It was concluded that the use of an open honeycomb shroud caused the large performance deficit for the starter turbine. Further research is suggested to ascertain stator inlet boundary layer measurements.

  8. Polymorphism of 15 short tandem repeat loci in Hui population of Ningxia Tongxin district.

    Science.gov (United States)

    Ma, Xiuzi; Sun, Runguang; Hao, Changchun

    2017-11-01

    To investigate the polymorphism of 15 STR loci in Hui population from Ningxia Tongxin district. Identifiler Plus kit used to detect the allelic frequencies of 15 STR loci in 598 unrelated Tongxin Hui individuals, and the population genetics parameters were calculated by using statistic software. The results demonstrated that all loci were found to be no deviation from Hardy-Weinberg equilibrium (P > 0.05), Heterozygosity (H) ranged from 0.637 to 0.868, matching probability (Pm) ranged from 0.034 to 0.213, power of discrimination (DP) ranged from 0.787 to 0.966, polymorphism information content (PIC) ranged from 0.560 to 0.850, power of exclusion (PE) ranged from 0.338 to 0.730. The 15 STR loci are relatively abundant in polymorphic information and suitable for paternity testing and personal identification. Copyright © 2017. Published by Elsevier Ltd.

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'

  10. Metastable phases freezing from melts of reciprocal systems PbX + CdI2=CdX + PbI2 (X=S, Se, Te)

    International Nuclear Information System (INIS)

    Odin, I.N.; Chukichev, M.V.

    2001-01-01

    The transformations in the mutual PbX + CdI 2 =CdX + PbI 2 (X=S, Se, Te) systems leading to the crystallization of metastable polytypical modifications of lead iodide in metastable ternary compounds are studied for the first time. Microstructural and X-ray diffraction analyses were conducted. Their phase diagrams were constructed. The luminescence properties of the stable and metastable modifications of the lead iodide and the metastable compound Pb 4 SeI 6 were investigated. The lines 504 and 512 nm are noted in the 2H-PbI 2 cathodoluminescence spectra. The close lines - 508 and 516 nm provide for the 6R-PbI 2 modification. The metastable compound Pb 4 SeI 6 is characterized by the 769 and 868 nm lines [ru

  11. Gamma Radiation-Induced Mutations in Soybeans

    International Nuclear Information System (INIS)

    Smutkupt, S.

    1998-01-01

    The main objective of soybean radiation experiments was to create genetic variability in soybeans of various cultivars, mutants and mutation-derived lines with the aim of producing superior breeding lines with resistance to soybean rust (Phakopsora pachyhrizi Syd.) It took altogether 12 generations over six years after gamma irradiation if soybean seeds to produce the best resistant line (81-1-038) which a variety could be developed from it. This Line 81-1-038 showed a very good specific resistance to soybean rust, Thai race 2 and moderately resistance to Thai race 1. In the rainy season of 1985, Line 81-1-038 out yielded S.J.4 (a mother line) by 868 kg/ha in a yield trail at Suwan Farm, Pak Chong, Nakorn Rajchasima. This soybean rust mutant was later named D oi Kham

  12. Pore structure of the activated coconut shell charcoal carbon

    Science.gov (United States)

    Budi, E.; Nasbey, H.; Yuniarti, B. D. P.; Nurmayatri, Y.; Fahdiana, J.; Budi, A. S.

    2014-09-01

    The development of activated carbon from coconut shell charcoal has been investigated by using physical method to determine the influence of activation parameters in term of temperature, argon gas pressure and time period on the pore structure of the activated carbon. The coconut shell charcoal was produced by pyrolisis process at temperature of about 75 - 150 °C for 6 hours. The charcoal was activated at various temperature (532, 700 and 868 °C), argon gas pressure (6.59, 15 and 23.4 kgf/cm2) and time period of (10, 60 and 120 minutes). The results showed that the pores size were reduced and distributed uniformly as the activation parameters are increased.

  13. Exhuming South Polar Crater

    Science.gov (United States)

    2004-01-01

    7 February 2004 The large, circular feature in this image is an old meteor impact crater. The crater is larger than the 3 kilometers-wide (1.9 miles-wide) Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image, thus only part of the crater is seen. The bright mesas full of pits and holes--in some areas resembling swiss cheese--are composed of frozen carbon dioxide. In this summertime view, the mesa slopes and pit walls are darkened as sunlight causes some of the ice to sublime away. At one time in the past, the crater shown here may have been completely covered with carbon dioxide ice, but, over time, it has been exhumed as the ice sublimes a little bit more each summer. The crater is located near 86.8oS, 111.6oW. Sunlight illuminates this scene from the upper left.

  14. Elevated Remnant Cholesterol in 25-Hydroxyvitamin D Deficiency in the General Population

    DEFF Research Database (Denmark)

    Ooi, Esther M; Afzal, Shoaib; Nordestgaard, Børge G

    2014-01-01

    this hypothesis. METHODS AND RESULTS: Using a Mendelian randomization approach, potential genetic associations between plasma levels of atherogenic lipoproteins and 25(OH)D were examined in ≤85,868 white, Danish individuals in whom we genotyped for variants affecting plasma levels of 25(OH)D, nonfasting remnant......BACKGROUND: Low plasma 25-hydroxyvitamin D [25(OH)D] levels are associated with high cardiovascular risk. This may be because that low 25(OH)D levels are associated with high levels of atherogenic lipoproteins, but whether these 2 risk factors are genetically associated is unknown. We tested...... cholesterol, low-density lipoprotein-cholesterol, and high-density lipoprotein-cholesterol. Lipoprotein levels were measured in all and 25(OH)D levels in 31,435. A doubling in nonfasting remnant cholesterol levels was observationally and genetically associated with -6.0%(95% confidence interval [CI], -6...

  15. Depression and anxiety in a case series of amyotrophic lateral sclerosis: frequency and association with clinical features.

    Science.gov (United States)

    Prado, Laura de Godoy Rousseff; Bicalho, Isabella Carolina Santos; Vidigal-Lopes, Mauro; Prado, Vitor de Godoy Rousseff; Gomez, Rodrigo Santiago; de Souza, Leonardo Cruz; Teixeira, Antônio Lúcio

    2017-01-01

    To investigate the frequency of anxiety and depression and their association with clinical features of amyotrophic lateral sclerosis. This is a cross-sectional and descriptive study including a consecutive series of patients with sporadic amyotrophic lateral sclerosis according to Awaji's criteria. Patients underwent clinical and psychiatric assessment (anxiety and depression symptoms). We included 76 patients. The men/women ratio was 1.6:1. Participants' mean age at disease onset was 55 years (SD±12.1). Sixty-six patients (86.8%) were able to complete psychiatric evaluation. Clinically significant anxiety was found in 23 patients (34.8%) while clinically significant depression was found in 24 patients (36.4%). When we compared patients with and without depression a significant difference was seen only in the frequency of anxiety symptoms (pescala funcional. Foi encontrada correlação positiva entre os sintomas de ansiedade e depressão (pescala funcional.

  16. [Antibiotic sensitivity of strains of Klebsiella isolated in Geneva and Algiers].

    Science.gov (United States)

    Sekfali, K; Rahal, K; Ducel, G

    1989-01-01

    573 strains of Klebsiella were isolated in Geneva (239 strains) and in Algiers (334 strains). The complete work with bacteriologic features (culture, biochemistry and antigenicity) will be published later. Two investigations took place in surgical cardio-vascular service in Geneva cantonal hospital and in Algiers hospitals: Pediatric (Beni-Messous) and intensive care service (Mustapha). High resistance percentages are found with Penicillins (greater than 60% by C.M.I.) in Geneva and Algiers. The strains are susceptible to aminoglycosides: in Algiers, 8.68% strains are resistant to Gentamicin and 5.99% to Tobramycin. In Geneva, all the strains are susceptible to Aminoglycosides. All the strains are susceptible to Trimethoprim and the Furans resistant strains are rare. The C.M.I. test is more precise than disc diffusion technique, especially for Penicillin and Furans. Cephalosporins and aminoglycosides are the best choice for treatment of Klebsiella infections.

  17. A second course in topos quantum theory

    CERN Document Server

    Flori, Cecilia

    2018-01-01

    This advanced course, a sequel to the first volume of this lecture series on topos quantum theory, delves deeper into the theory, addressing further technical aspects and recent advances. These include, but are not limited to, the development of physical quantities and self-adjoint operators; insights into the quantization process; the description of an alternative, covariant version of topos quantum theory; and last but not least, the development of a new concept of spacetime. The book builds on the concepts introduced in the first volume (published as Lect. Notes Phys. 868), which presents the main building blocks of the theory and how it could provide solutions to interpretational problems in quantum theory, such as: What are the main conceptual issues in quantum theory? And how can these issues be solved within a new theoretical framework of quantum theory? These two volumes together provide a complete, basic course on topos quantum theory, offering a set of mathematical tools to readers interested in tac...

  18. Marital conflict and children's sleep: reciprocal relations and socioeconomic effects.

    Science.gov (United States)

    Kelly, Ryan J; El-Sheikh, Mona

    2011-06-01

    We examined reciprocal relations between parental marital conflict and children's sleep disruptions over two years. The roles of ethnicity (African American and European American) and socioeconomic status were tested as moderators of the examined relations. A community sample of 176 school-age children (M age = 8.68 at T1) and their parents participated at T1 and T2 with a 2-year interval between waves. Mothers, fathers, and children reported on parental marital conflict, and children's sleep was measured via actigraphy and self-reports. Latent variable modeling indicated that T1 marital conflict predicted increases in children's sleep disruptions longitudinally; results were more pronounced for African American children and those from lower SES homes. Further, children's sleep disruptions at T1 predicted increases in marital conflict over time. Results demonstrate the importance of reciprocal relations between a prevalent familial stressor and a fundamental facet of children's health, especially when considering the sociocultural milieu. 2011 APA, all rights reserved

  19. Assessment of gamma radionuclides in sediments from the Atlantic and Pacific Oceans of Guatemala

    International Nuclear Information System (INIS)

    Orozco Chilel, R.M.

    1997-01-01

    The study consisted in the assesment of radioactivity levels in marine sediments of Guatemala due to gamma radionuclides. The samples were taken from 5 selected places, the activity of each sediment was measured by gamma spectrometry using an GE High-Purity detector. The methodology used consisted in to measure the efficiency of the Ge detector, then the calibration for Pb-210 was made. The radioactivity ranges from 1.69 Bq/Kg to 8.68 Bq/Kg for Cs-137, 356.99 Bq/Kg to 431.18 Bq/Kg for K-40, 48.71 Bq/Kg to 59.94 Bq/Kg for Ra-226 and 151.283 Bq/Kg to 224.47 Bq/Kg for Pb-210

  20. EXPERIENCE OF USING RECOMBINANT ALLERGEN OF MYCOBACTERIUM TUBERCULOSIS FOR DIAGNOSTICS OF TUBERCULOUS INFECTION

    Directory of Open Access Journals (Sweden)

    T. A. Parfenova

    2016-01-01

    Full Text Available 117,662 children and adolescents were examined with the skin test of Diaskintest when registered for dispensary follow-up for the first time in tuberculosis control units in Orenburg Region from 2010 to 2015. Positive and questionable results of Diaskintest were in 96.4% (86.8 and 10.6% of children with active tuberculosis. 435 patients with latent tuberculous infection, 6 patients with questionable active disease and 3 with active tuberculosis were missed basing on the results of tuberculin diagnostics only and detected with Diaskintest. No case of active tuberculosis has been registered forthe last 5 years among patients with negative reaction to Diaskintest in Group VI ofthe dispensary follow-up. When using traditional methods including tuberculin diagnostics 90% of children registered for dispensary follow-up were groundlessly treated with preventive chemotherapy.

  1. Hydrogen-bonding interactions in thiosemicarbazones of carboxylic acids: Structure of 2-ketobutyric acid thiosemicarbazone hemihydrate

    International Nuclear Information System (INIS)

    Sonawane, P.; Chikate, R.; Kumbhar, A.; Padhye, S.; Doedens, R.J.

    1991-01-01

    2-Thiosemicarbazonobutanoic acid hemihydrate, C 5 H 9 N 3 O 2 S.0.5H 2 O, M r =184.22, triclinic, Panti 1, a=8.163(2), b=8.868(2), c=12.438(2) A, α=72.99(2), β=79.47(2), γ=84.06(2)deg, V=845.3(3) A 3 , Z=4, D x =1.447 Mg m -3 , λ(Mo Kα)=0.71073 A, μ=0.332 mm -1 , F(000)=392, T=296 K, R=0.038 for 3830 independent reflections with I>3σ(I). Three hydrogen bonds link the two crystallographically independent molecules in a pairwise fashion. The two molecules both have E configurations about each C-N and N-N bond, but differ by nearly 180deg in the orientation of the -COOH group. (orig.)

  2. Alcohol consumption and prostate cancer incidence and progression

    DEFF Research Database (Denmark)

    Brunner, Clair; Davies, Neil M; Martin, Richard M

    2017-01-01

    Prostate cancer is the most common cancer in men in developed countries, and is a target for risk reduction strategies. The effects of alcohol consumption on prostate cancer incidence and survival remain unclear, potentially due to methodological limitations of observational studies. In this study......, we investigated the associations of genetic variants in alcohol-metabolising genes with prostate cancer incidence and survival. We analysed data from 23,868 men with prostate cancer and 23,051 controls from 25 studies within the international PRACTICAL Consortium. Study-specific associations of 68...... single nucleotide polymorphisms (SNPs) in 8 alcohol-metabolising genes (Alcohol Dehydrogenases (ADHs) and Aldehyde Dehydrogenases (ALDHs)) with prostate cancer diagnosis and prostate cancer-specific mortality, by grade, were assessed using logistic and Cox regression models, respectively. The data across...

  3. Alcohol intake and colorectal cancer: a comparison of approaches for including repeated measures of alcohol consumption

    DEFF Research Database (Denmark)

    Thygesen, Lau Caspar; Wu, Kana; Grønbaek, Morten

    2008-01-01

    BACKGROUND: In numerous studies, alcohol intake has been found to be positively associated with colorectal cancer risk. However, the majority of studies included only one exposure measurement, which may bias the results if long-term intake is relevant.METHODS: We compared different approaches...... for including repeated measures of alcohol intake among 47,432 US men enrolled in the Health Professionals Follow-up Study. Questionnaires including questions on alcohol intake had been completed in 1986, 1990, 1994, and 1998. The outcome was incident colorectal cancer during follow-up from 1986 to 2002.RESULTS......: During follow-up, 868 members of the cohort experienced colorectal cancer. Baseline, updated, and cumulative average alcohol intakes were positively associated with colorectal cancer, with only minor differences among the approaches. These results support moderately increased risk for intake >30 g...

  4. Molecular Basis of Resistance to Selected Antimicrobial Agents in the Emerging Zoonotic Pathogen Streptococcus suis.

    Science.gov (United States)

    Gurung, Mamata; Tamang, Migma Dorji; Moon, Dong Chan; Kim, Su-Ran; Jeong, Jin-Ha; Jang, Geum-Chan; Jung, Suk-Chan; Park, Yong-Ho; Lim, Suk-Kyung

    2015-07-01

    Characterization of 227 Streptococcus suis strains isolated from pigs during 2010 to 2013 showed high levels of resistance to clindamycin (95.6%), tilmicosin (94.7%), tylosin (93.8%), oxytetracycline (89.4%), chlortetracycline (86.8%), tiamulin (72.7%), neomycin (70.0%), enrofloxacin (56.4%), penicillin (56.4%), ceftiofur (55.9%), and gentamicin (55.1%). Resistance to tetracyclines, macrolides, aminoglycosides, and fluoroquinolone was attributed to the tet gene, erm(B), erm(C), mph(C), and mef(A) and/or mef(E) genes, aph(3')-IIIa and aac(6')-Ie-aph(2″)-Ia genes, and single point mutations in the quinolone resistance-determining region of ParC and GyrA, respectively. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  5. Speciation of 127I and 129I in atmospheric aerosols at Risø, Denmark: insight into sources of iodine isotopes and their species transformations

    DEFF Research Database (Denmark)

    Zhang, Luyuan; Hou, Xiaolin; Xu, Sheng

    2016-01-01

    iodine have been determined for 129I and 127I in the aerosols collected at Risø, Denmark, between March and May 2011 (shortly after the Fukushima nuclear accident) and in December 2014. The measured concentrations of total iodine are in the range of 1.04–2.48 ng m−3 for 127I and (11.3–97.0) × 105 atoms m......−3 for 129I, and 129I / 127I atomic ratios of (17.8–86.8) × 10−8. The contribution of Fukushima-derived 129I (peak value of 6.3 × 104 atoms m−3) is estimated to be negligible (less than 6 %) compared to the total 129I concentration in northern Europe. The concentrations and species of 129I and 127I...

  6. Speciation of 127I and 129I in atmospheric aerosols at Risø, Denmark: insight into sources of iodine isotopes and their species transformations

    DEFF Research Database (Denmark)

    Zhang, Luyuan; Hou, Xiaolin; Xu, Sheng

    2015-01-01

    iodine have been determined for 129I and 127I in the aerosols collected at Risø, Denmark, between March and May 2011 (shortly after the Fukushima nuclear accident) and in December 2014. The measured concentrations of total iodine are in the range of 1.04–2.48 ng m−3 for 127I and (11.3–97.0) × 105 atoms m......−3 for 129I, and 129I / 127I atomic ratios of (17.8–86.8) × 10−8. The contribution of Fukushima-derived 129I (peak value of 6.3 × 104 atoms m−3) is estimated to be negligible (less than 6 %) compared to the total 129I concentration in northern Europe. The concentrations and species of 129I and 127I...

  7. Achieving high power factor and output power density in p-type half-Heuslers Nb1-xTixFeSb.

    Science.gov (United States)

    He, Ran; Kraemer, Daniel; Mao, Jun; Zeng, Lingping; Jie, Qing; Lan, Yucheng; Li, Chunhua; Shuai, Jing; Kim, Hee Seok; Liu, Yuan; Broido, David; Chu, Ching-Wu; Chen, Gang; Ren, Zhifeng

    2016-11-29

    Improvements in thermoelectric material performance over the past two decades have largely been based on decreasing the phonon thermal conductivity. Enhancing the power factor has been less successful in comparison. In this work, a peak power factor of ∼106 μW⋅cm -1 ⋅K -2 is achieved by increasing the hot pressing temperature up to 1,373 K in the p-type half-Heusler Nb 0.95 Ti 0.05 FeSb. The high power factor subsequently yields a record output power density of ∼22 W⋅cm -2 based on a single-leg device operating at between 293 K and 868 K. Such a high-output power density can be beneficial for large-scale power generation applications.

  8. Identification of β-Amino alcohol grafted 1,4,5 trisubstituted 1,2,3-triazoles as potent antimalarial agents.

    Science.gov (United States)

    Devender, Nalmala; Gunjan, Sarika; Chhabra, Stuti; Singh, Kartikey; Pasam, Venkata Reddy; Shukla, Sanjeev K; Sharma, Abhisheak; Jaiswal, Swati; Singh, Sunil Kumar; Kumar, Yogesh; Lal, Jawahar; Trivedi, Arun Kumar; Tripathi, Renu; Tripathi, Rama Pati

    2016-02-15

    In a quest to discover new drugs, we have synthesized a series of novel β-amino alcohol grafted 1,2,3-triazoles and screened them for their in vitro antiplasmodial and in vivo antimalarial activity. Among them, compounds 16 and 25 showed potent activity against chloroquine-sensitive (Pf3D7) strain with IC50 of 0.87 and 0.3 μM respectively, while compounds 7 and 13 exhibited better activity in vitro than the reference drug against chloroquine-resistance strain (PfK1) with IC50 of 0.5 μM each. Compound 25 showed 86.8% in vivo antimalarial efficacy with favorable pharmacokinetic parameters. Mechanistic studies divulged that potent compounds significantly boosted p53 protein levels to exhibit the antimalarial activity. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  9. Sleep-spindle identification on EEG signals from polysomnographie recordings using correntropy.

    Science.gov (United States)

    Ulloa, Sebastian; Estevez, Pablo A; Huijse, Pablo; Held, Claudio M; Perez, Claudio A; Chamorro, Rodrigo; Garrido, Marcelo; Algarin, Cecilia; Peirano, Patricio

    2016-08-01

    Sleep spindles (SSs) are characteristic electroencephalographic (EEG) waveforms of sleep stages N2 and N3. One of the main problems associated with SS detection is the high number of false positives. In this paper we propose a new periodogram based on correntropy to detect SSs and enhance their characterization. Correntropy is a generalized correlation, under the information theoretic learning framework. A non-negative matrix factorization decomposition of correntropy allows us to obtain a new periodogram, which shows an improved resolution capability compared to the conventional power spectrum density. Preliminary results show that the proposed method obtained a sensitivity rate of 0.868 with a false positive rate of 0.121.

  10. First report of Toxoplasma gondii Seroprevalence in Farmed Arctic Foxes (Vulpes lagopus) in Eastern and Northeastern China.

    Science.gov (United States)

    Lou, Zhi-Long; Cong, Wei; Meng, Qing-Feng; Sun, Wu-Wen; Qin, Si-Yuan; Zhang, Xiao-Xuan; Zhu, Xing-Quan; Qian, Ai-Dong

    2015-12-01

    Until now, no information on Toxoplasma gondii seroprevalence in Arctic foxes (Vulpes lagopus) was available in China. A serological survey was undertaken to assess T. gondii seroprevalence in farmed Arctic foxes in eastern and northeastern China. Antibodies to T. gondii were examined in 1346 farmed Arctic foxes using the modified agglutination test (MAT). A total of 113 (8.39%, 95% confidence interval [CI] 6.91-9.87) serum samples were positive to T. gondii at a 1:25 cutoff. Seroprevalence of T. gondii infection in male Arctic foxes was 8.68% (95% CI 6.75-10.6), which was higher than that in the female Arctic foxes (7.95%, 95% CI 5.65-10.26). The prevalence in polar foxes was 7.07% (95% CI 5.14-8.99), which was lower than that in the blue foxes (9.75%, 95% CI 7.49-11.99). T. gondii seroprevalence in Arctic foxes in Heilongjiang, Jilin, Liaoning, and Shandong Provinces was 9.85% (95% CI 5.75-13.95), 9.21% (95% CI 5.54-12.87), 7.37% (95% CI 5.22-9.51), and 8.68% (95% CI 5.66-11.70), respectively. There were no statistically significant differences between T. gondii seroprevalence and morphs, sex, or regions of Arctic foxes in logistic regression analysis (p < 0.05). The results of the present survey indicated that T. gondii infection in farmed Arctic foxes is prevalent in China. To our knowledge, this is the first report of T. gondii seroprevalence in Arctic foxes in China.

  11. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    Directory of Open Access Journals (Sweden)

    Schreiber Mark

    2006-11-01

    Full Text Available Abstract Background Single nucleotide polymorphisms (SNPs are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence tagged (EST sequences were used to search for coding SNPs (cSNPs. A total of 15,353 SNPs were detected in the transcribed sequences studied, of which 6,325 were predicted to be coding SNPs with the remaining 9,028 SNPs presumed to be in untranslated regions. Of the cSNPs detected, 2,868 were predicted to result in a change in the amino acid encoded. In order to determine the actual number of non-synonymous polymorphic SNPs we designed assays for 920 of the putative SNPs. These SNPs were then genotyped through a panel of cattle DNA pools using chip-based MALDI-TOF mass spectrometry. Of the SNPs tested, 29% were found to be polymorphic with a minor allele frequency >10%. A subset of the SNPs was genotyped through animal resources in order to look for association with age of puberty, facial eczema resistance or meat yield. Three SNPs were nominally associated with resistance to the disease facial eczema (P Conclusion We have identified 15,353 putative SNPs in or close to bovine genes and 2,868 of these SNPs were predicted to be non-synonymous. Approximately 29% of the non-synonymous SNPs were polymorphic and common with a minor allele frequency >10%. Of the SNPs detected in this study, 99% have not been previously reported. These novel SNPs will be useful for association studies or gene mapping.

  12. O censo escolar como estratégia de busca de crianças e adolescentes em estudos epidemiológicos The school census as a search strategy for children and adolescents in epidemiological studies

    Directory of Open Access Journals (Sweden)

    Regina Maria Veras Gonçalves-Silva

    2012-02-01

    Full Text Available Alternativas de baixo custo que possibilitem o acompanhamento de grupos populacionais constituem estratégias importantes na condução de estudos de coorte. Este trabalho apresenta os procedimentos para o uso do censo escolar como instrumento de busca de crianças e adolescentes em estudos de seguimento. O estudo foi realizado entre os estudantes adolescentes que frequentaram os postos de saúde de Cuiabá, Estado de Mato Grosso, Brasil, para vacinação em 1999. Foram localizados 86,8% de adolescentes com o uso do censo escolar e 0,2% pelo Sistema de Informações sobre Mortalidade. Dentre os adolescentes localizados, foram entrevistados 1.716, representando uma taxa de seguimento de 71,4%. Neste estudo, o censo escolar mostrou ser um método efetivo na busca de estudantes.Low-cost alternatives that allow for the monitoring of population groups are important strategies in conducting cohort studies. This paper presents the procedures for the use of the National School Census as a search tool for children and adolescents in follow-up studies. The study was conducted among adolescent students who took vaccinations in clinics in Cuiabá, Mato Grosso State, Brazil in 1999. A total of 86.8% were identified in the census and 0.2% in the Mortality Information System. Of those identified, 1,716 were interviewed, representing a follow-up rate of 71.4%. In this study, the school census proved to be an effective method for finding students.

  13. Balance del proceso de Desmovilización, Desarme y Reinserción (DDR de los bloques Cacique Nutibara y Héroes de Granada en la ciudad de Medellín Overview of the Process of Demobilization, Disarmament and Re-integration (DDR in the Cacique Nutibara and Héroes de Granada Blocks in the City of Medellín

    Directory of Open Access Journals (Sweden)

    Manuel Alberto Alonso Espinal

    2008-07-01

    Full Text Available El artículo realiza una descripción general y un balance del proceso de Desmovilización, Desarme y Reinserción (DDR de los bloques Cacique Nutibara y Héroes de Granada en la ciudad de Medellín. El primero, desmovilizado el 9 de diciembre de 2003, con 868 excombatientes y 467 armas entregadas; el segundo, el 1 de agosto de 2005, con 2.033 excombatientes y 1.120 armas entregadas. El artículo describe y analiza el proceso local, con base en las variables propuestas por Gleichman y su grupo de trabajo en el año de 2004, y lo contrapone con el nacional, a la vez que construye una serie hipótesis que se deben tener presentes a la hora de caracterizar la naturaleza del paramilitarismo en la ciudad. El resultado es un programa con fortalezas y logros, pero también con vacíos y limitaciones.This article carries out a general description and an overview of the processes of De-mobilization, Disarmament and Re-insertion (DDR in the Cacique Nutibara y Héroes de Granada blocks in the city of Medellín. The first of these areas, was demobilized December 9, 2003, with 868 ex-combatants and 467 weapons delivered; the second, August 1, 2005, with 2,033 ex-combatants and 1,120 weapons delivered. The article describes and analyzes the local processes, based on the variables proposed by Gleichman and his working group in the year 2004, it and contrasts them with the national one, at the same time building a series of hypotheses that should be kept in mind at the moment of characterizing the nature of para-militarism in the city. The result is a program with strengths and achievements, but also with empty spaces and limitations.

  14. Evaluation of Ovarian Reserve with Anti-Müllerian Hormone in Familial Mediterranean Fever

    Directory of Open Access Journals (Sweden)

    Ali Şahin

    2015-01-01

    Full Text Available Objective. To investigate ovarian reserves in attack-free familial Mediterranean fever (AF-FMF patients at the reproductive age by anti-Müllerian hormone (AMH, antral follicle count (AFC, ovarian volume, and hormonal parameters. Methods. Thirty-three AF-FMF patients aging 18–45 years and 34 healthy women were enrolled and FSH, LH, E2, PRL, and AMH levels were measured in the morning blood samples at 2nd–4th days of menstruation by ELISA. Concomitant pelvic ultrasonography was performed to calculate AFC and ovarian volumes. Results. In FMF patient group, median AMH levels were statistically significantly lower in the M69V mutation positive group than in the negative ones (P=0.018. There was no statistically significant difference in median AMH levels between E148Q mutation positive patients and the negative ones (P=0.920. There was also no statistically significant difference in median AMH levels between M680I mutation positive patients and the negative ones (P=0.868. No statistically significant difference was observed in median AMH levels between patients who had at least one mutation and those with no mutations (P=0.868. We realized that there was no difference in comparisons between ovarian volumes, number of follicles, and AMH levels ovarian reserves when compared with FMF patients and healthy individuals. Conclusions. Ovarian reserves of FMF pateints were similar to those of healthy subjects according to AMH. However, AMH levels were lower in FMF patients with M694V mutation.

  15. [Analysis of clinical features in patients with pneumoconiosis complicated with pulmonary emphysema].

    Science.gov (United States)

    Li, X; Dai, W R; Li, L; Liu, W F; Yang, Z X; Xie, L

    2017-11-20

    Objective: To investigate the clinical features of pneumoconiosis complicated with pulmo-nary emphysema. Methods: selected 868 patients with pneumoconiosis were selected from December 2015 to December 2016 in Hunan occupational disease prevention and treatment hospital. Collected the results of high-resolution spiral CT, arterial blood gas, ECG, pulmonary function and MRC score. The subjects were divided into pneumoconiosis complicated with pulmonary emphysema group and simple pneumoconiosis group accord-ing to the results of HRCT. The smoking, MRC score, pulmonary function, blood gas and complications were compared. Results: A total of 868 patients were enrolled in the study. Emphysema 232 people, accounting for 26.73%. The incidence of emphysema in the first phase of pneumoconiosis was 12.69%, and the incidence rate of emphysema in pneumoconiosis was 17.03%, The incidence of three Stage pneumoconiosis was highest, up to 60.76%, the incidence of emphysema increased with the increase of stages of pneumoconiosis ( P =0.000) .The smoking index of pneumoconiosis combined with emphysema group was significantly higher than that of simple pneumoconiosis group ( P emphysema group the FEV(1.0)%, FVC%, FEV(1.0)/FVC, DLCO%, oxygen partial pressure were significantly lower than that of simple pneumoconiosis group ( P ≤0.05) . The combined rate of Bullae of lung in pneumoconiosis complicated with pulmonary emphysema group was higher than that of simple pneumo-coniosis group ( P emphysema had heavier breathing difficulties, more serious pulmonary function and active endurance, the degree of hypoxia is more serious, and had a higher incidence of complications. The pul-monary function of pneumoconiosis complicated with pulmonary emphysema is not consistent with the typical CPFE.

  16. Diagnostic labels assigned to patients with orthopedic conditions and the influence of the label on selection of interventions: a qualitative study of orthopaedic clinical specialists.

    Science.gov (United States)

    Miller-Spoto, Marcia; Gombatto, Sara P

    2014-06-01

    A variety of diagnostic classification systems are used by physical therapists, but little information about how therapists assign diagnostic labels and how the labels are used to direct intervention is available. The purposes of this study were: (1) to examine the diagnostic labels assigned to patient problems by physical therapists who are board-certified Orthopaedic Clinical Specialists (OCSs) and (2) to determine whether the label influences selection of interventions. A cross-sectional survey was conducted. Two written cases were developed for patients with low back and shoulder pain. A survey was used to evaluate the diagnostic label assigned and the interventions considered important for each case. The cases and survey were sent to therapists who are board-certified OCSs. Respondents assigned a diagnostic label and rated the importance of intervention categories for each case. Each diagnostic label was coded based on the construct it represented. Percentage responses for each diagnostic label code and intervention category were calculated. Relative importance of intervention category based on diagnostic label was examined. For the low back pain and shoulder pain cases, respectively, "Combination" (48.5%, 34.9%) and "Pathology/Pathophysiology" (32.7%, 57.3%) diagnostic labels were most common. Strengthening (85.9%, 98.1%), stretching (86.8%, 84.9%), neuromuscular re-education (87.6%, 93.4%), functional training (91.4%, 88.6%), and mobilization/manipulation (85.1%, 86.8%) were considered the most important interventions. Relative importance of interventions did not differ based on diagnostic label (χ2=0.050-1.263, P=.261-.824). The low response rate may limit the generalizability of the findings. Also, examples provided for labels may have influenced responses, and some of the label codes may have represented overlapping constructs. There is little consistency with which OCS therapists assign diagnostic labels, and the label does not seem to influence

  17. Adaptabilidade e estabilidade de híbridos de famílias endogâmicas de milho, obtidos pelo método dos híbridos crípticos

    Directory of Open Access Journals (Sweden)

    Lopes Maria Teresa Gomes

    2001-01-01

    Full Text Available Neste trabalho avaliou-se o comportamento de híbridos de famílias endogâmicas de milho obtidos pelo método dos híbridos crípticos, produzidos pelo programa de melhoramento de milho do Departamento de Biologia da UFV. A caracterização dos híbridos foi feita com base em 22 ambientes, usando-se os métodos de Eberhart & Russell e de Carneiro. Pelo método de Eberhart & Russell, foram identificados 15 híbridos com produção acima da média geral. Entre eles, 53,3% tiveram bom desempenho em qualquer ambiente, e alta estabilidade (84-6, 86-1, 86-19, 86-11, 86-15, 86-21, 86-27 e 86-10, e 20% são mais responsivos à melhoria ambiental e possuem alta estabilidade (86-22, 85-2 e 84-5. Os híbridos 85-1, 85-3 e 86-2 apresentaram bom desempenho em qualquer ambiente e baixa estabilidade, correspondem também a 20% dos mais produtivos. O último (86-8, correspondendo a 6,7%, apresentou adaptação específica a ambientes favoráveis, e baixa estabilidade. Pela análise, considerando o método de Carneiro, foram identificados os híbridos 86-22, 86-8, 84-5, 85-2 e 86-19 como os mais responsivos à melhoria do ambiente. Os híbridos 86-11, 85-3, 86-27 e 86-2 apresentaram adaptação a ambientes desfavoráveis.

  18. Computed Tomography Assessment of Peroneal Tendon Displacement and Posteromedial Structure Entrapment in Pilon Fractures.

    Science.gov (United States)

    Fokin, Alex; Huntley, Samuel R; Summers, Spencer H; Lawrie, Charles M; Miranda, Alejandro D; Caban-Martinez, Alberto J; Steinlauf, Steven D

    2016-11-01

    To determine the proportion of (1) peroneal tendon displacement (PTD) and posteromedial structure entrapment (PMSE) cases in a sample of pilon fractures, (2) missed diagnoses of PTD and PMSE on computed tomography (CT) by radiologists and attending orthopaedic trauma surgeons, and PTD and PMSE cases by (3) OTA/AO classification, and (4) fibular fracture. Retrospective cohort review. Regional level 1 Trauma Center. Two hundred patients treated between July 2008 and November 2014. Axial and reconstructed CT images were used in bone and soft tissue windows to identify PTD and PMSE. Medical charts were reviewed to identify OTA/AO fracture classification, the presence of concomitant fibular fracture, whether radiologist CT interpretation noted PTD or PMSE, and whether attending orthopaedic trauma surgeons' operative notes mentioned recognition of and management of PTD or PMSE. From the retrospective review of CT, PTD was identified in 11.0% and PMSE in 19.0% of all pilon fractures. Of the 22 patients with PTD, 59.1% sustained a concomitant fibular fracture and 90.9% sustained a 43-C fracture. Patients with PTD sustained more 43-C fractures (90.9% vs. 62.9%) but significantly fewer fibular fractures (59.1% vs. 80.3%; P = 0.023) than patients without PTD. Of the 38 patients with PMSE, 81.6% sustained a fibular fracture and 86.8% sustained a 43-C fracture. PMSE was more common in patients with 43-C fractures (86.8% vs. 61.1%). The final preoperative radiologist CT interpretation commented on PTD and PMSE in 50.0% of cases. Higher energy pilon fractures (43-C) are associated with higher incidence of PMSE and PTD. Concomitant fibula fracture may play a protective role in PTD in the setting of pilon fractures. Both attending radiologists and attending orthopaedic trauma surgeons frequently fail to recognize the diagnoses of PTD and PMSE. Prognostic level III. See Instructions for Authors for a complete description of levels of evidence.

  19. Electromagnetic interference from radio frequency identification inducing potentially hazardous incidents in critical care medical equipment.

    Science.gov (United States)

    van der Togt, Remko; van Lieshout, Erik Jan; Hensbroek, Reinout; Beinat, E; Binnekade, J M; Bakker, P J M

    2008-06-25

    Health care applications of autoidentification technologies, such as radio frequency identification (RFID), have been proposed to improve patient safety and also the tracking and tracing of medical equipment. However, electromagnetic interference (EMI) by RFID on medical devices has never been reported. To assess and classify incidents of EMI by RFID on critical care equipment. Without a patient being connected, EMI by 2 RFID systems (active 125 kHz and passive 868 MHz) was assessed under controlled conditions during May 2006, in the proximity of 41 medical devices (in 17 categories, 22 different manufacturers) at the Academic Medical Centre, University of Amsterdam, Amsterdam, The Netherlands. Assessment took place according to an international test protocol. Incidents of EMI were classified according to a critical care adverse events scale as hazardous, significant, or light. In 123 EMI tests (3 per medical device), RFID induced 34 EMI incidents: 22 were classified as hazardous, 2 as significant, and 10 as light. The passive 868-MHz RFID signal induced a higher number of incidents (26 incidents in 41 EMI tests; 63%) compared with the active 125-kHz RFID signal (8 incidents in 41 EMI tests; 20%); difference 44% (95% confidence interval, 27%-53%; P RFID signal induced EMI in 26 medical devices, including 8 that were also affected by the active 125-kHz RFID signal (26 in 41 devices; 63%). The median distance between the RFID reader and the medical device in all EMI incidents was 30 cm (range, 0.1-600 cm). In a controlled nonclinical setting, RFID induced potentially hazardous incidents in medical devices. Implementation of RFID in the critical care environment should require on-site EMI tests and updates of international standards.

  20. Web Conversations About Complementary and Alternative Medicines and Cancer: Content and Sentiment Analysis

    Science.gov (United States)

    Truccolo, Ivana; Antonini, Marialuisa; Rinaldi, Fabio; Omero, Paolo; Ferrarin, Emanuela; De Paoli, Paolo; Tasso, Carlo

    2016-01-01

    Background The use of complementary and alternative medicine (CAM) among cancer patients is widespread and mostly self-administrated. Today, one of the most relevant topics is the nondisclosure of CAM use to doctors. This general lack of communication exposes patients to dangerous behaviors and to less reliable information channels, such as the Web. The Italian context scarcely differs from this trend. Today, we are able to mine and analyze systematically the unstructured information available in the Web, to get an insight of people’s opinions, beliefs, and rumors concerning health topics. Objective Our aim was to analyze Italian Web conversations about CAM, identifying the most relevant Web sources, therapies, and diseases and measure the related sentiment. Methods Data have been collected using the Web Intelligence tool ifMONITOR. The workflow consisted of 6 phases: (1) eligibility criteria definition for the ifMONITOR search profile; (2) creation of a CAM terminology database; (3) generic Web search and automatic filtering, the results have been manually revised to refine the search profile, and stored in the ifMONITOR database; (4) automatic classification using the CAM database terms; (5) selection of the final sample and manual sentiment analysis using a 1-5 score range; (6) manual indexing of the Web sources and CAM therapies type retrieved. Descriptive univariate statistics were computed for each item: absolute frequency, percentage, central tendency (mean sentiment score [MSS]), and variability (standard variation σ). Results Overall, 212 Web sources, 423 Web documents, and 868 opinions have been retrieved. The overall sentiment measured tends to a good score (3.6 of 5). Quite a high polarization in the opinions of the conversation partaking emerged from standard variation analysis (σ≥1). In total, 126 of 212 (59.4%) Web sources retrieved were nonhealth-related. Facebook (89; 21%) and Yahoo Answers (41; 9.7%) were the most relevant. In total, 94 CAM

  1. Prevalência de fatores de risco para Síndrome Coronariana aguda em pacientes atendidos em uma emergência Prevalencia de los factores de riesgo para el Síndrome Coronario agudo en los pacientes tratados en una emergencia Prevalence of risk factors for acute Coronary Syndrome in patients treated in an emergency

    Directory of Open Access Journals (Sweden)

    Karine Franke Lemos

    2010-03-01

    Full Text Available Objetivou-se caracterizar o perfil do paciente portador de Síndrome Coronária Aguda (SCA atendido em um serviço de emergência de Porto Alegre, Rio Grande do Sul, no que se refere aos fatores de risco. Estudo de prevalência entre agosto de 2007 e fevereiro de 2008. Para coleta de dados, foi utilizado um questionário, consulta ao prontuário e aferição de medidas antropométricas. Foram avaliados 152 pacientes com SCA, 63,8% do sexo masculino, idade média de 61±10,26 anos. Com diagnóstico de infarto agudo do miocárdio sem supradesnivelamento de ST em 50,7%, infarto agudo do miocárdio com supradesnivelamento de ST em 14,5% e angina instável em 34,9%. Os fatores de risco foram: sedentarismo (86,8%; sobrepeso e obesidade (77%; hipertensão arterial sistêmica (75,7%; história familiar (56,6%; estresse (52,6%; dislipidemia (44,7%; diabete mellitus (40,1%; tabagismo (39,5%; e ingesta de álcool (14,4%. Constatou-se uma alta prevalência de fatores de risco para SCA, necessitando de programas de educação em saúde, visando reduzir a morbi-mortalidade.Propusimos caracterizar el perfil de pacientes portador del Síndrome Coronariana Agudo (SCA en un servicio de emergencia de Porto Alegre, Rio Grande do Sul, Brasil, en lo que se refiere a los factores de riesgo. Estudio de prevalencia entre agosto/2007 y febrero/2008. Para la colecta de datos, fue utilizado un cuestionario, consulta al prontuario y contraste de medidas antropométricas. Fueron avaliados 152 pacientes con SCA, 63,8% de sexo masculino, edad media de 61 ± 10,26 años. Con diagnóstico de infarto agudo del miocardio sin elevación ST en 50,7%, infarto agudo del miocardio con elevación ST en 14,5% y angina inestable 34,9%. Los factores de riesgo fueron, sedentarismo (86,8%; sobrepeso y obesidad (77%; hipertensión arterial sistémica (75,7%; histórico familiar (56,6%; estrés (52,6%; dislipidemía (44,7%; diabetes mellitus (40,1%; tabaquismo (39,5%; ingetión de alcohol(14

  2. Web Conversations About Complementary and Alternative Medicines and Cancer: Content and Sentiment Analysis.

    Science.gov (United States)

    Mazzocut, Mauro; Truccolo, Ivana; Antonini, Marialuisa; Rinaldi, Fabio; Omero, Paolo; Ferrarin, Emanuela; De Paoli, Paolo; Tasso, Carlo

    2016-06-16

    The use of complementary and alternative medicine (CAM) among cancer patients is widespread and mostly self-administrated. Today, one of the most relevant topics is the nondisclosure of CAM use to doctors. This general lack of communication exposes patients to dangerous behaviors and to less reliable information channels, such as the Web. The Italian context scarcely differs from this trend. Today, we are able to mine and analyze systematically the unstructured information available in the Web, to get an insight of people's opinions, beliefs, and rumors concerning health topics. Our aim was to analyze Italian Web conversations about CAM, identifying the most relevant Web sources, therapies, and diseases and measure the related sentiment. Data have been collected using the Web Intelligence tool ifMONITOR. The workflow consisted of 6 phases: (1) eligibility criteria definition for the ifMONITOR search profile; (2) creation of a CAM terminology database; (3) generic Web search and automatic filtering, the results have been manually revised to refine the search profile, and stored in the ifMONITOR database; (4) automatic classification using the CAM database terms; (5) selection of the final sample and manual sentiment analysis using a 1-5 score range; (6) manual indexing of the Web sources and CAM therapies type retrieved. Descriptive univariate statistics were computed for each item: absolute frequency, percentage, central tendency (mean sentiment score [MSS]), and variability (standard variation σ). Overall, 212 Web sources, 423 Web documents, and 868 opinions have been retrieved. The overall sentiment measured tends to a good score (3.6 of 5). Quite a high polarization in the opinions of the conversation partaking emerged from standard variation analysis (σ≥1). In total, 126 of 212 (59.4%) Web sources retrieved were nonhealth-related. Facebook (89; 21%) and Yahoo Answers (41; 9.7%) were the most relevant. In total, 94 CAM therapies have been retrieved. Most

  3. Systematic study on surface and magnetostructural changes in Mn-substituted dysprosium ferrite by hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Rekha, G. [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Tholkappiyan, R. [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Department of Physics, College of Science, UAE University, Al-Ain 15551 (United Arab Emirates); Vishista, K., E-mail: raovishista@gmail.com [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Hamed, Fathalla [Department of Physics, College of Science, UAE University, Al-Ain 15551 (United Arab Emirates)

    2016-11-01

    Highlights: • Garnet type Dy{sub 3}Fe{sub 5-x}Mn{sub x}O{sub 12} (x = 0–0.06) nanoparticles of 88.4–86.8 nm were synthesized by hydrothermal method. • The Dy, Mn, Fe and O elements in the ferrites were confirmed from XPS. • The multiple oxidation states of Fe and Mn ions, bonding energy and cationic distributions of the samples were examined by XPS. • The magnetic property shows ferromagnetic behavior from VSM technique. • The results from these studies are correlated with respect to Mn dopant. - Abstract: Dysprosium iron garnets are of scientific importance because of the wide range of magnetic properties that can be obtained in substituting dysprosium by a rare earth metal. In the present work, the effect of Mn substitution on magnetostructural changes in dysprosium ferrite nanoparticles is studied. Highly crystalline pure and Mn doped dysprosium ferrite nanoparticles were synthesized by hydrothermal method. The samples were calcined at 1100 °C for 2 h in air atmosphere which is followed by characterization using XRD, FT-IR analysis, SEM, XPS and VSM. The average crystallite size of synthesized samples were calculated by X-ray diffraction falls in the range of 88.4–86.8 nm and was found to be in cubic garnet structure. For further investigation of the structure and corresponding changes in the tetrahedral and octahedral stretching vibrational bonds, FT-IR was used. The synthesized samples consist of multiple oxidation (Fe{sup 3+} and Fe{sup 2+}) states for Fe ions and (Mn{sup 3+} and Mn{sup 2+}) Mn ions analyzed in three ways of Fe 2p and Mn 2p spectra from the XPS analysis. With respect to Mn dopant in Dy{sub 3}Fe{sub 5}O{sub 12}, the cationic distributions of elements were discussed from high resolution XPS spectra by peak position and shift, area, width. To find out the porous/void surface morphology of the sample, scanning electron microscopy was used. From XPS analysis, the presence of elements (Dy, Mn, Fe and O) and their composition in the

  4. Influencia del rol de género en la conducta sexual de riesgo en adolescentes universitarios Influence of gender role on the sexual behavior of university students

    Directory of Open Access Journals (Sweden)

    Yesica Yolanda Rangel Flores

    2010-12-01

    Full Text Available Objetivo: Analizar el comportamiento sexual de estudiantes universitarios y la influencia del género en la caracterización del mismo. Material y métodos: Estudio transversal, descriptivo y correlacional efectuado de Enero a Junio de 2009. Muestra probabilística estratificada de 250 estudiantes de cinco programas de Licenciatura. Aplicación de instrumento creado ex profeso, validado mediante expertos y con una confiabilidad comprobada de .78 mediante Alpha de Cronbach. Estadística descriptiva e inferencial a través de SPSS 17.0. Resultados: 56.6% de la población refiere vida sexual activa, con mayor ejercicio en los hombres (x²=13.272 p=.01. Hombres más que mujeres y con una diferencia significativa refirieron tener relaciones sexuales con más de una persona en un mismo periodo de tiempo (Tb=.730 p=.000, tener encuentros sexuales casuales (Tb=.294 p=.000. La utilización del condón se refiere como habitual más en hombres (86.8% que en mujeres (50% (V=.377 p=.002. Conclusiones: Se identifican conductas de riesgo tanto en hombres como en mujeres, en ambos casos íntimamente ligados a las representaciones sociales de género.Objective: Analyze the sexual behavior of University students and the influence of gender in the characterization of the referred behavior. Material and methods: Transverse, descriptive and correlational study which was carried out from January to June 2009. Stratified probabistical sample of 250 students from five bachelor degree programs. Application of an instrument created on purpose, validated by experts with a proven reliability of .78 using Cronbach Alpha. Descriptive statistical s and inferential using SPSS 17.0. Results: 56.6% of the population referred having an active sex life, with greater exercise in men (x² = 13. 272 p =. 01. Men more than women and with a significant difference, men spoke of having sex with more than one person in a same period of time (Tb =. 730 p =. 000, having casual sexual

  5. Setting efficiency indicators for center pivots Ajuste de indicadores de eficiência para pivôs centrais

    Directory of Open Access Journals (Sweden)

    Ricardo L. Schons

    2012-06-01

    Full Text Available In this study, it was discussed the efficiency criteria in each of the elements that compose a central pivot, and this analysis was applied to two sets of systems located in regions of Cruz Alta and Santo Augusto, state of Rio Grande do Sul, Brazil. The methodology used combines water and energy assessment through an indicator called Normalized Specific Consumption in Irrigation (C ENI, allowing thus a comparison between equipment and projects. The C ENI in Cruz Alta region showed 72% of the equipment above the standard (8.68 kWh mm-1 ha-1 100m-1, and in Santo Augusto region 64.28% with consumption above the standard. The mean irrigation efficiency for Cruz Alta region was 29.85%, with standard deviation of 5.41%, and for Santo Augusto region, it was 29.02%, with standard deviation of 5.15%.Neste trabalho, são discutidos critérios de eficiência em cada um dos elementos que compõem um pivô central, sendo esta análise aplicada a dois conjuntos de sistemas localizados, nas regiões de Cruz Alta e Santo Augusto, Rio Grande do Sul. A metodologia utilizada associa as avaliações hídrica e energética por meio de um indicador denominado Consumo Específico Normalizado na Irrigação (C ENI, possibilitando, desta forma, uma comparação entre equipamentos e entre projetos. O C ENI na região de Cruz Alta apresentou 72% dos equipamentos acima do padrão (8,68 kWh mm-1 ha-1 100m-1, e na região de Santo Augusto, 64,28% com o consumo acima do padrão. A eficiência de irrigação média para a região de Cruz Alta foi de 29,85%, com desvio-padrão de 5,41%; e para a Região de Santo Augusto foi de 29,02%, com desvio padrão de 5,15%.

  6. Analysis of the complement and molecular evolution of tRNA genes in cow

    Directory of Open Access Journals (Sweden)

    Barris Wesley C

    2009-04-01

    Full Text Available Abstract Background Detailed information regarding the number and organization of transfer RNA (tRNA genes at the genome level is becoming readily available with the increase of DNA sequencing of whole genomes. However the identification of functional tRNA genes is challenging for species that have large numbers of repetitive elements containing tRNA derived sequences, such as Bos taurus. Reliable identification and annotation of entire sets of tRNA genes allows the evolution of tRNA genes to be understood on a genomic scale. Results In this study, we explored the B. taurus genome using bioinformatics and comparative genomics approaches to catalogue and analyze cow tRNA genes. The initial analysis of the cow genome using tRNAscan-SE identified 31,868 putative tRNA genes and 189,183 pseudogenes, where 28,830 of the 31,868 predicted tRNA genes were classified as repetitive elements by the RepeatMasker program. We then used comparative genomics to further discriminate between functional tRNA genes and tRNA-derived sequences for the remaining set of 3,038 putative tRNA genes. For our analysis, we used the human, chimpanzee, mouse, rat, horse, dog, chicken and fugu genomes to predict that the number of active tRNA genes in cow lies in the vicinity of 439. Of this set, 150 tRNA genes were 100% identical in their sequences across all nine vertebrate genomes studied. Using clustering analyses, we identified a new tRNA-GlyCCC subfamily present in all analyzed mammalian genomes. We suggest that this subfamily originated from an ancestral tRNA-GlyGCC gene via a point mutation prior to the radiation of the mammalian lineages. Lastly, in a separate analysis we created phylogenetic profiles for each putative cow tRNA gene using a representative set of genomes to gain an overview of common evolutionary histories of tRNA genes. Conclusion The use of a combination of bioinformatics and comparative genomics approaches has allowed the confident identification of a

  7. Mobile Phone Ownership Is Not a Serious Barrier to Participation in Studies: Descriptive Study.

    Science.gov (United States)

    Harvey, Emily J; Rubin, Leslie F; Smiley, Sabrina L; Zhou, Yitong; Elmasry, Hoda; Pearson, Jennifer L

    2018-02-19

    Rather than providing participants with study-specific data collection devices, their personal mobile phones are increasingly being used as a means for collecting geolocation and ecological momentary assessment (EMA) data in public health research. The purpose of this study was to (1) describe the sociodemographic characteristics of respondents to an online survey screener assessing eligibility to participate in a mixed methods study collecting geolocation and EMA data via the participants' personal mobile phones, and (2) examine how eligibility criteria requiring mobile phone ownership and an unlimited text messaging plan affected participant inclusion. Adult (≥18 years) daily smokers were recruited via public advertisements, free weekly newspapers, printed flyers, and word of mouth. An online survey screener was used as the initial method of determining eligibility for study participation. The survey screened for twenty-eight inclusion criteria grouped into three categories, which included (1) cell phone use, (2) tobacco use, and (3) additional criteria. A total of 1003 individuals completed the online screener. Respondents were predominantly African American (605/1003, 60.3%) (60.4%), male (514/1003, 51.3%), and had a median age of 35 years (IQR 26-50). Nearly 50% (496/1003, 49.5%) were unemployed. Most smoked menthol cigarettes (699/1003, 69.7%), and had a median smoking history of 11 years (IQR 5-21). The majority owned a mobile phone (739/1003, 73.7%), could install apps (86.8%), used their mobile phone daily (89.5%), and had an unlimited text messaging plan (871/1003, 86.8%). Of those who completed the online screener, 302 were eligible to participate in the study; 163 were eligible after rescreening, and 117 were enrolled in the study. Compared to employed individuals, a significantly greater proportion of those who were unemployed were ineligible for the study based on mobile phone inclusion criteria (Pmobile phone inclusion criteria. Inclusion criteria

  8. Evaluación del rendimiento de tesauros españoles en sistemas de recuperación de información

    Directory of Open Access Journals (Sweden)

    Gil Urdiciain, B.

    1998-09-01

    Full Text Available The article describes an experimental test developed in Spanish databases. The test compares the performance between different thesauri and the natural language, in the process of information retrieval. The test was carried out with the combination of the analytic and sampling methods. The searches were made interactively, the records were evaluated, and the search strategies modified based on the parcial results. The references obtained with each kind of language were evaluated on the basis of the precision and recall ratios. The results point out that free text obtained a precision ratio of 63.4 % and a recall of 59.5 %; with the help of the thesauri both ratios improved: the precision reached a 86.8 % and the recall a 61.6 %. The conclusion is that the controlled vocabulary experiences lower levels of noise than the free text, at the same time it can develop high ratios of recall as the controlled one. Also, it is possible to conclude that the controlled vocabulary neutralizes the deficiences of the free text and vice versa, so both are complementary.

    El artículo describe un estudio experimental desarrollado en bases de datos españolas en el que se establece la comparación del rendimiento entre diferentes tesauros y el lenguaje natural, en el proceso de recuperación de la información. El test se llevó a cabo mediante la combinación de los métodos analítico y de muestreo y validación de datos. Las consultas se realizaron de modo interactivo, evaluándose los registros y modificándose las estrategias a la vista de los resultados. Las referencias recuperadas en cada modalidad se valoraron en base a las tasas de precisión y exhaustividad. Los resultados muestran que en lenguaje libre se consiguió una precisión del 63,4 % y una exhaustividad del 59,5 %; con la ayuda del tesauro ambos índices mejoraron: en precisión se alcanzó un 86,8 % y en exhaustividad un 61,6 %. Se concluye que el lenguaje controlado consigue más bajos

  9. Exigência de lisina digestível para poedeiras semipesadas de 50 a 66 semanas de idade

    Directory of Open Access Journals (Sweden)

    R.V. Nunes

    2015-12-01

    Full Text Available Com o objetivo de determinar a exigência de lisina digestível para poedeiras semipesadas no período de 50 a 66 semanas de idade, foi realizado experimento utilizando-se 150 poedeiras Shaver Brown, distribuídas em delineamento inteiramente ao acaso, com cinco tratamentos (níveis de lisina digestível: 0,79; 0,82; 0,85; 0,88 e 0,91%, seis repetições e cinco aves por unidade experimental. Foram avaliados a produção de ovos, peso médio e a massa de ovos, consumo de ração e de lisina, conversão alimentar por massa e por dúzia de ovos, gravidade específica, unidade Haugh, o índice de gema e albúmen, porcentagem de albúmen, gema e casca. O consumo de ração, a conversão alimentar por massa e dúzia de ovos, a produção, o peso e a massa de ovos não foram influenciados (P>0,05 pelos níveis de lisina digestível. Houve aumento linear no consumo de lisina (P0,05 pelos níveis de lisina digestível estudados. Os níveis de lisina influenciaram de forma quadrática (P>0,05 a unidade Haugh e o índice de albúmen, sendo estimados os níveis de 0,884 e 0,868% de lisina digestível, respectivamente. Para o índice de gema, a associação do modelo quadrático ao Linear Response Plateau (LRP estimou o nível de 0,903% de lisina digestível. Quando o objetivo é maximizar a qualidade interna dos ovos, recomenda-se o nível dietético de 0,884%, 0,868% e 0,903% de lisina digestível para unidade Haugh, índice de albúmen e índice de gema, respectivamente.

  10. Níveis de metionina + cistina para frangos de corte de 1 a 21 e 22 a 42 dias de idade Methionine + cystine levels for broilers from 1 to 21 and from 22 to 42 days of age

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Teixeira Albino

    1999-01-01

    Full Text Available Este experimento foi realizado para determinar a exigência nutricional em metionina + cistina (aminoácidos sulfurosos para frangos de corte Hubbard e Ross de ambos os sexos, no período de 1 a 21 e 22 a 42 dias de idade. Ganho de peso, consumo, conversão alimentar e composição de carcaça das aves foram avaliados. Foram usadas 2400 aves na fase de 1 a 21 dias de idade e 1800 na fase de 22 a 42 dias de idade. Rações basais com 21e 19% PB e 3000 e 3100 kcal EM/kg foram suplementadas com seis níveis de metionina + cistina ( 0; 0,06; 0,12; 0,18; 0,24; e 0,30 nas fases de 1 a 21 e 22 a 42 dias de idade, respectivamente. As estimativas das exigências de metionina + cistina para a fase de 1 a 21 dias foram 0,886 e 0,896% e 0,890 e 0,868% e para a fase de 22 a 42 dias, 0,795 e 0,802% e 0,810 e 0,792%, para machos e fêmeas Hubbard e Ross, respectivamente.This experiment was carried out to determine the nutritional requirement of methionine + cystine (sulfur amino acids for Hubbard and Ross broilers from 1 to 21 and from 22 to 42 days of age, of both sexes. Weight gain, intake, feed:gain and carcass composition were evaluated. Two thousand and four hundred broilers were used in the phase from 1 to 21 of age and 1800 broilers in the phase from 22 a 42 days of age. Basal diets with 21 and 19% of the CP and 3000 and 3100 kcal ME/kg were supplemented with six levels of methionine + cystine in the phases from 1 to 21 and from 22 to 42 of age, respectively. The estimated requirements of methionine + cystine ( 0; .06; .12; .18; .24; and .30 for the phase from 1 to 21 days were. 886% and .896%, .890% and .868% and for the phase from 22 to 42 days, .795%, and .802%, .810% and .792% for Hubbard and Ross male and female, respectively.

  11. Diferencias en los conocimientos de los recursos tecnológicos en profesores a partir del género, edad y tipo de centro [Differences in the knowledge of the technological resources in professors starting for gender, age and center type.

    Directory of Open Access Journals (Sweden)

    Gonzalo Almerich

    2005-09-01

    Full Text Available The integration of Information and Communication Technologies (ICT in education supposes that faculty must possess competencies for it. In this paper, it is analyzed how gender, age and type of educational institution influence teacher’s knowledge about different technological resources. The study is based in a survey design, whose population is made up of teachers from Primary and Secondary educational institutions in the Comunidad Valenciana, both public as private ones. The sample is composed of 868 teachers and the questionnaire is the instrument of collection of the information. The results, obtained by means of ANOVA model, indicate that the variable gender is the one that most influences in the knowledge of faculty’s technological resources, while age and type of educational institution present smaller influence. Therefore, the personal and contextual factors influence in the knowledge of technological resources on the part of faculty and they must consider carrying out the appropriate formative actions La integración de las Tecnologías de la Información y Comunicación (TIC en la educación supone que el profesorado ha de poseer competencias para ello. En este artículo, se analiza como el género, edad y tipo de centro influyen en el conocimiento del profesor de los diferentes recursos tecnológicos. El estudio se basa en un diseño de encuesta, cuya población la constituye el profesorado de centros de primaria y secundaria de la Comunidad Valenciana, tanto públicos como privados. La muestra está compuesta de 868 profesores y el cuestionario es el instrumento de recogida de la información. Los resultados, obtenidos mediante un modelo ANOVA, indican que la variable género es la que más influye en el conocimiento de los recursos tecnológicos del profesorado, mientras que la edad y el tipo de centro presentan menor influencia. Por lo tanto, los factores personales y contextuales influyen en el conocimiento de los recursos

  12. Acidentes por centopéia notificados pelo "Centro de Informações Toxicológicas de Belém", num período de dois anos Centipede accidents notified by "Centro de Informações Toxicológicas de Belém", over a two-year period

    Directory of Open Access Journals (Sweden)

    Eduardo Barroso

    2001-12-01

    Full Text Available Centopéias são animais invertebrados do filo dos artrópodes e da classe Chilopoda . Este trabalho objetiva estudar o perfil dos acidentes por centopéias notificados pelo "Centro de Informações Toxicológicas de Belém" (CIT-Belém. Foram estudados 76 protocolos registrados no período de março de 1998 a março de 2000. Corresponderam a 16,7% dos acidentes por animais peçonhentos, superados apenas pelo ofidismo (44,4% e escorpionismo (20,5%. O local do acidente foi a residência em 86,8% dos casos. A faixa etária 20 - 49 anos foi a mais acometida (64,4 % e 61,8 % dos casos registrados pertenciam ao sexo feminino. Membros superiores foram a parte do corpo mais acidentada (47,4%. Dor local ocorreu em 95,8 % dos pacientes e edema local leve em 52,1%. O tratamento foi predominantemente sintomático; 94,7% evoluíram para a cura e ignora-se a evolução nos outros 5,3 %. Sugere-se que o acidente por centopéia é benigno e doméstico e que tratamentos analgésicos são suficientes.Centipedes are arthropods of the class Chilopoda. The objective of this work was to study the incidence of accidents involving centipedes at "Centro de Informações Toxicológicas de Belém" (CIT-Belém over a two-year period. Seventy-six patients were studied from March 30, 1998 until March 30, 2000. Centipede accidents occurred in 16.8% of all accidents by venomous animals at Centro de Informações Toxicológicas de Belém; compared to snake accidents, 44.4 % and scorpion accidents, 20.5%. The majority of cases occurred in the residence (86.8%. The most important age group was 20-49 years old (64.4%. The part of human body mostly affected was the superior members (47.4 %. Local pain and edema were found in 95.8% and 52.1% of the patients, respectively. Treatment was symptomatic. Healing occurred in 94.7%, although the outcome of 5.3% of cases was unknown. Centipede accidents are a benign accident, occurring within the residence and treatment consists of measures

  13. The diet of the fox (Vulpes vulpes in woodlands of Orobie Alps (Lombardy region, Northern Italy / Alimentazione della Volpe (Vulpes vulpes in aree boscate delle Alpi Orobie

    Directory of Open Access Journals (Sweden)

    Marco Cantini

    1991-07-01

    Full Text Available Abstract The diet of the fox was investigated by analysis of 273 scats, collected along standard trails from April to November 1987 and 1988. Food habits of foxes were described for three altitudinal ranges. Mammals, mainly Clethrionomys glareolus and Microtus multiplex, were the staple food (percentage of frequency 42.8%, followed by fruits and other vegetables (26.7% and 37.3% respectively. Birds, Invertebrates (mainly Insects and garbage were little eaten. The game species (ungulates, hares, pheasants occurred with a low frequency (8.4% in the diet. The trophic niche breadth varied little through the altitudinal ranges and the seasons. The trophic niche overlap between the fox and the genus Martes (190 scats of M. martes and M. foina were examined is relatively wide (O=0.868. Riassunto La dieta della Volpe (Vulpes vulpes in aree boscate delle Alpi Orobie (Val Lesina è stata indagata nel periodo aprile-novembre 1987 e 1988 mediante l'analisi di 273 feci, raccolte lungo percorsi-campione ricadenti in tre piani vegetazionali. I Mammiferi, in particolare Clethrionomys glareolus e Microtus multiplex, sono la componente principale della dieta (frequenza percentuale 42,8%. Rilevante è anche il consumo di frutti (soprattutto in estate e autunno e di altri vegetali (26,7% e 37,3% rispettivamente, mentre poco frequente è quello di Uccelli, Invertebrati e rifiuti. Complessivamente ridotta è l'azione predatoria della Volpe nei confronti delle specie di interesse venatorio (Ungulati, lepri, Galliformi. L'ampiezza della nicchia trofica mostra modeste variazioni stagionali e altitudinali. I1 grado di sovrapposizione tra la nicchia trofica della Volpe e quella del genere Martes, quest'ultima ricavata dall'analisi di 190 feci di Martora (M. martes e Faina (M. foina, è elevato (O=0,868. Tuttavia, poiché in condizioni di

  14. Evaluating a commercial PCR assay against bacterial culture for diagnosing Streptococcus uberis and Staphylococcus aureus throughout lactation.

    Science.gov (United States)

    Steele, N M; Williamson, J H; Thresher, R; Laven, R A; Hillerton, J E

    2017-05-01

    The performance of a commercial, real-time PCR assay was compared with traditional bacterial culture for the identification of Streptococcus uberis and Staphylococcus aureus in bovine milk collected at different stages of lactation. Initial validation tests using fresh and frozen quarter milk samples identified factors that affected the success of the PCR. Therefore, the standard protocol was adjusted for samples collected at the first milking postpartum (colostrum) and from clinical mastitis cases. The adjustment involved PCR testing both undiluted and diluted (1 in 10 with sterile water) DNA extracts. The performance comparison between culture and the PCR assay used milk samples collected aseptically from individual quarters of mixed-age spring-calving dairy cows, during early, mid, and late lactation. Bacterial culture results were used to select a subset of samples for PCR testing (n = 315) that represented quarters with a current or prior Strep. uberis or Staph. aureus infection. Compared with culture, PCR had a sensitivity of 86.8% and specificity of 87.7% for detecting Strep. uberis (kappa = 0.74) and 96.4% and 99.7%, respectively, for detecting Staph. aureus (kappa = 0.96). The dilution of DNA extracts for colostrum and clinical samples increased the relative sensitivity from 79.2% to 86.8% for Strep. uberis detection and from 92.9% to 96.4% for Staph. aureus, presumably through diluting unidentified PCR inhibitors. The sensitivity for detecting Strep. uberis using PCR, relative to culture, was similar throughout lactation (85-89%), whereas relative specificity was lowest immediately postcalving (64%) but improved in mid and late lactation (98%). Specificity estimates for samples collected in early lactation can be optimized by reducing the cutoff cycle threshold (Ct) value from the recommended value of 37 to 34. Although using this value improved specificity (77%), it reduced test sensitivity (77%). The PCR assay lacked agreement with culture in early

  15. Pengaruh Zat Aditif Urea terhadap Kuantitas Biodiesel Pada Reaksi Transesterfikasi

    Directory of Open Access Journals (Sweden)

    Rismawati Rasyid

    2017-03-01

    Full Text Available Abstrak Asam lemak jenuh maupun tak jenuh pada minyak nabati memiliki potensi untuk diubah menjadi bahan kimia penyusun bahan bakar . Komponen asam lemak pada CPO RBD dengan komposisi terbesar adalah asam palmitat (38.2% dan asam oleat (45.89%.  Pembuatan biodiesel dalam penelitian ini menggunakan CPO (Crude Palm Oil yang telah dimurnikan melalui reaksi transesterfikasi dengan pereaksi etanol dan katalisator KOH. Penambahan urea sebagai zat aditif pada reaksi dapat meningkatkan kualitas biodiesel yang diperoleh serta lebih efisien dalam tahapan pemurnian. Persentase kadar FAME (Fatty Acid Metyl Ester setara dengan persen yield biodiesel pada proses reaksi tanpa penambahan urea adalah 90.34% dan mengalami peningkatan setelah penambahan urea sebesar 98%. Densitas yang dihasilkan pada reaksi tanpa zat aditif  0.868 gr/ ml dan reaksi dengan penambahan zat aditif memiliki densitas  0.866 gr/ml,  kedua produk tersebut telah sesuai dengan standar SNI yakni berkisar 0.85–0.89. Kata kunci : biodiesel, CPO, zat aditif Abstract Saturated and unsaturated fatty acids in vegetable oils have potential to be converted into constituent of chemicals fuel. Fatty acids in the RBD palm oil with the largest composition are palmitic acid (38.2% and oleic acid (45.89%. Production of fuel which substitute diesel fuel (biodiesel from CPO (Crude Palm Oil which has been purified by transesterification reaction with ethanol reagent and KOH catalyst. The addition of urea as an additive substancein the reaction to improve  the quality as well as more efficient biodiesel obtained in the purification stages. Percentage value of FAME(Fatty Acid Metyl Esteror yield biodiesel in the reaction without the addition of urea is 90.34% and after the addition of urea increased by 98%. Density of product that produced in the reaction without additives is 0.868 g / ml and for reaction with additives has a density of 0.866 g / ml, both of these products are met the criteria of SNI

  16. PENGARUH KETERAMPILAN MENGAJAR GURU, DISIPLIN BELAJAR DAN SIKAP SISWA TERHADAP MOTIVASI BELAJAR MATA DIKLAT BEKERJASAMA DENGAN KOLEGA DAN PELANGGAN PADA SISWA KELAS X PROGRAM KEAHLIAN ADMINISTRASI PERKANTORAN DI SMK PL TARCISIUS 1 SEMARANG

    Directory of Open Access Journals (Sweden)

    Parastining Mulyany

    2013-11-01

    Full Text Available Tujuan penelitian ini adalah: (1 Untuk mengetahui keterampilan mengajar guru, disiplin belajar dan sikap siswa terhadap motivasi belajar (2 Untuk mengetahui ada tidaknya pengaruh keterampilan mengajar guru, disiplin belajar dan sikap siswa terhadap motivasi belajar. Populasi penelitian ini adalah siswa kelas X Program Keahlian Administrasi Perkantoran SMK PL Tarcisius 1 Semarang yang berjumlah 110 siswa. Metode pengumpulan data menggunakan kuesioner dan dokumentasi. Analisis data menggunakan analisis regresi berganda. Hasil penelitian menunjukkan bahwa analisis regresi linear berganda diperoleh persamaan: Y = 2,241 + 0,034 X1 + 0,419 X2 + 0,594 X3 Uji F diperoleh Fhitung33,753, sehingga H4 diterima. Secara parsial (uji t variabel keterampilan mengajar guru (X1 diperoleh thitung = 0,407, sehingga H1 ditolak. Variabel disiplin belajar (X2 diperoleh thitung = 3.272, sehingga H2 diterima. Variabel sikap siswa (X3 diperoleh thitung = 5.868, sehingga H3 diterima. Secara simultan (R2 keterampilan mengajar guru, disiplin belajar dan sikap siswa berpengaruh terhadap motivasi belajar sebesar 47,4%. The aim problems of this study were : (1 the teaching skills, the students’ learning discipline, the students’ attitudes, and the students’ motivation. (2 the effects of the teaching skills, the students’ learning discipline, and the students’ attitudes on the students’ motivation. The population of this study were the tenth grade students of Office Administration Program of SMK PL Tarcisius 1 Semarang which consisted of 110 students. The data were collected by questionnaires and documentations. The data then, were analyzed by multiple regression analysis. The results of the study showed that the multiple linear regression analysis, it was gained an equation Ŷ = 2.241 + 0.034 X1 + 0.419 X2 + 0.594 X3. The Fvalue obtained from F-test was 33.753 so that H4 was accepted. Partially (t-test, the tvalue for the teachers’ teaching skills variable (X1

  17. Associations between the big five personality factors and multiple mini-interviews.

    Science.gov (United States)

    Griffin, B; Wilson, I

    2012-08-01

    Given the accumulating evidence that performance in medical school and beyond is related to personality, it is important for research to consider how personality assessment can be included as part of the process of selecting medical students. Interviews are one way of measuring personality and this study extends prior research investigating whether the multiple mini interview (MMI) is related to the five factor model of personality. In contrast to prior results (Kulasegaram et al. in Adv Health Sci Edu 15:415-423, 2010), examination of MMI scores for 868 applicants to an Australian medical school over 3 years showed significant uncorrected correlations every year with extraversion (.19, .19, .30) and conscientiousness (.20, .22, .25) and with agreeableness in 2 years (.17, .19). Investigation of personality at a facet-level revealed differing relationships with the MMI within the five factors of personality. MMI scores were also correlated in 2 years (.17, .22) with a situational judgment test of interpersonal understanding (UMAT Section 2) but were unrelated to tests of logical reasoning ability (UMAT Section 1), non-verbal reasoning (Section 3), or past academic performance (Higher School Certificate results).

  18. Visual working memory in decision making by honey bees

    Science.gov (United States)

    Zhang, Shaowu; Bock, Fiola; Si, Aung; Tautz, Juergen; Srinivasan, Mandyam V.

    2005-01-01

    The robustness and plasticity of working memory were investigated in honey bees by using a delayed matching-to-sample (DMTS) paradigm. The findings are summarized as follows: first, performance in the DMTS task decreases as the duration between the presentation of the sample stimulus and the presentation of the comparison stimuli is increased. This decrease is well approximated by an exponential decay function. Performance is significantly better than random-choice level even at delays as long as 5 sec and is reduced to random-choice levels at an average delay time of 8.68 ± 0.06 sec. Second, when the DMTS task involves two samples (one relevant, the other irrelevant), bees can be trained to learn to use the relevant sample to perform the task if (i) the relevant sample is always at a fixed position, or (ii) the relevant sample always has the same place in the sequence of presentation (always first or always second). Bees that have learned to use the relevant sample and to ignore the irrelevant sample can generalize this learning, and apply it to novel sets of sample and comparison stimuli that they have never previously encountered. The findings point to a remarkably robust, and yet plastic, working memory in the honey bee. PMID:15795382

  19. A community-based, mixed-methods study of the attitudes and behaviors of men regarding modern family planning in Nigeria.

    Science.gov (United States)

    Akaba, Godwin; Ketare, Nathaniel; Tile, Wilfred

    2016-10-01

    To investigate the knowledge, attitudes, and extent of involvement of men in family planning in Nigeria, and to evaluate spousal communication regarding family planning. A community-based, mixed-methods study enrolled participants in Gwagwalada, Abuja, Nigeria between January 11 and June 30, 2012. Quantitative surveys including semi-structured interviews were used to collect information from married men regarding their knowledge and attitudes to modern family planning. The qualitative components constituted focus group discussion sessions and in-depth interviews that included married men, married women, religious leaders, community leaders, and family-planning providers. Quantitative surveys were completed by 152 men; 99 (65.1%) reported that they would accompany their wives to family-planning clinics in the future, 116 (76.3%) reported approving of the use of modern contraception by their wives, and 132 (86.8%) reported wanting to know more about family planning. Both quantitative and qualitative aspects of the study indicated that husbands were the major decision makers regarding family size, choice of contraceptive, and pregnancy timing. In terms of fertility goals and family planning, men were the primary decision makers; consequently, obtaining their support and commitment to family planning is of crucial importance in Nigeria. Copyright © 2016 International Federation of Gynecology and Obstetrics. Published by Elsevier Ireland Ltd. All rights reserved.

  20. Predicting perceived risk of crime: a multilevel study.

    Science.gov (United States)

    Russo, Silvia; Roccato, Michele; Vieno, Alessio

    2011-12-01

    With a sample of Italians selected from 71 Italian counties (N = 1,868), we performed two multilevel analyses aimed at predicting the perceived risk of crime at local (i.e., in the participants' county of residence) and at societal (i.e., in the context of Italian society) levels. A significant proportion of the variation in local risk perception was at the county level. The following individual variables predicted higher levels of this variable: indirect victimization, the perception of social and physical disorder, being a woman, being poorly educated, and being an older person. Among the ecological predictors, the crime rate and unemployment rate predicted higher levels of local crime risk perception, while the immigrant rate did not. Perceived risk of crime at the societal level did not show significant variation at the county level. Education, being a man, trusting people, and adhesion to post-materialistic values predicted lower levels of societal crime risk perception, while number of sons/daughters and exposure to television news increased it. The limitations and possible development of this study are discussed.

  1. Status of non-steroidal anti-inflammatory drugs use and its association with chronic kidney disease: a cross-sectional survey in China.

    Science.gov (United States)

    Pan, Yujing; Zhang, Luxia; Wang, Fang; Li, Xiaomei; Wang, Haiyan

    2014-10-01

    Non-steroidal anti-inflammatory drugs (NSAIDs) have been reported to be associated with adverse effects including kidney injury, while relevant studies from developing countries are limited. We aimed to explore the status of NSAIDs use in China, as well as cross-sectional association between NSAIDs intake and presence of chronic kidney disease (CKD). A national representative sample of 47,204 adults in China was used. Prevalence of regular NSAIDs use was reported. Age- and sex- matched controls of NSAIDs users were then selected. The association between NSAIDs use and kidney injury were analyzed using logistic regression. Altogether 1129 participants reported regular use of NSAIDs, with the adjusted prevalence of 3.6% (95% CI, 3.2%-3.9%). And 76.9% of them (n = 868) had taken phenacetin-containing analgesics, with an adjusted prevalence of 3.2% (95% CI, 2.9%-3.5%). After adjusting for potential confounders, long-term NSAIDs intake (≥ 48 months) was associated with eGFR < 60 mL/min per 1.73 m2, with an OR of 2.36 (95% CI, 1.28-4.37). Regular use of NSAIDs, especially phenacetin-containing drugs, is prevalent in China. And long-term NSAIDs intake (≥ 48 months) was independently associated with reduced renal function. © 2014 Asian Pacific Society of Nephrology.

  2. Aqueous Hybrids of Silica Nanoparticles and Hydrophobically Associating Hydrolyzed Polyacrylamide Used for EOR in High-Temperature and High-Salinity Reservoirs

    Directory of Open Access Journals (Sweden)

    Dingwei Zhu

    2014-06-01

    Full Text Available Water-soluble polymers are known to be used in chemically enhanced oil recovery (EOR processes, but their applications are limited in high-temperature and high-salinity oil reservoirs because of their inherent poor salt tolerance and weak thermal stability. Hydrophobic association of partially hydrolyzed polyacryamide (HAHPAM complexed with silica nanoparticles to prepare nano-hybrids is reported in this work. The rheological and enhanced oil recovery (EOR properties of such hybrids were studied in comparison with HAHPAM under simulated high-temperature and high-salinity oil reservoir conditions (T: 85 °C; total dissolved solids: 32,868 mg∙L−1; [Ca2+] + [Mg2+]: 873 mg∙L−1. It was found that the apparent viscosity and elastic modulus of HAHPAM solutions increased with addition of silica nanoparticles, and HAHPAM/silica hybrids exhibit better shear resistance and long-term thermal stability than HAHPAM in synthetic brine. Moreover, core flooding tests show that HAHPAM/silica hybrid has a higher oil recovery factor than HAHPAM solution.

  3. Palm oil derived trimethylolpropane triesters synthetic lubricants and usage in industrial metalworking fluid.

    Science.gov (United States)

    Chang, Teck-Sin; Yunus, Robiah; Rashid, Umer; Choong, Thomas S Y; Awang Biak, Dayang Radiah; Syam, Azhari M

    2015-01-01

    Trimethylolpropane triesters are biodegradable synthetic lubricant base oil alternative to mineral oils, polyalphaolefins and diesters. These oils can be produced from trimethylolpropane (TMP) and fatty acid methyl esters via chemical or enzymatic catalyzed synthesis methods. In the present study, a commercial palm oil derived winter grade biodiesel (ME18) was evaluated as a viable and sustainable methyl ester source for the synthesis of high oleic trimethylolpropane triesters (HO-TMPTE). ME18 has fatty acid profile containing 86.8% oleic acid, 8.7% linoleic acid with the remaining minor concentration of palmitic acid, stearic acid and linolenic acid. It's high oleic property makes it superior to produce synthetic lubricant base oil that fulfills both the good low temperature property as well as good oxidative stability. The synthetic base oil produced had a viscosity of 44.3 mm(2)/s at 40°C meeting the needs for ISO 46 oils. It also exhibited an excellent viscosity index of 219 that is higher than some other commercial brands of trimethylolpropane trioleate. Properties of base oil such as cloud point, density, acid value, demulsibility and soap content were also examined. The oil was then used in the formulation of tapping oil and appraised in term of adaptability, stability and field test performance.

  4. Age trends and within-site effects in wood density and radial growth in Quercus faginea mature trees

    Directory of Open Access Journals (Sweden)

    Vicelina B. Sousa

    2016-04-01

    Full Text Available Aim of the study: This paper aims to valorize the wood of Quercus faginea Lam. for high quality end uses (e.g. furniture by studying growth and quality properties using mature trees. Age trends in tree-ring width and wood density are shown and the main factors responsible for variations in tree-ring width and wood density within and between trees are investigated. Area of study: The study site is in the center of Portugal within the natural species distribution area.Material and methods: Radial samples from ten mature trees were collected at 6 heights (from base to 9.7 m and prepared for X-ray microdensity.Main results: Wood density showed high values, ranging from 0.868 g/cm3 to 0.957 g/cm3. Wood density decreased from pith to bark and with stem height. Cambial age showed a linear relationship with wood density and most of the variation in wood is explained by age. Intra-ring and axial within-tree homogeneity was good.Research highlights: Mature trees of Q. faginea showed high wood density and a high potential for high quality end uses, comparable to other oaks. Wood density is influenced by cambial age and tree-ring width. Wood quality may be improved by tree growth rates adjustment e.g. through an adequate tree stand density (e.g. thinning operations. 

  5. Increasing socio-economic inequalities in life expectancy and QALYs in Sweden 1980-1997

    DEFF Research Database (Denmark)

    Burström, Kristina; Johannesson, Magnus; Diderichsen, Finn

    2005-01-01

    The aim of this study was to estimate the change in socio-economic differences in life expectancy and in quality-adjusted life years (QALYs), for men and women at different ages, in Sweden 1980 to 1997. We used data from the Swedish Survey of Living Conditions (the ULF survey), which is linked......=34 447). For 20-year-old men the difference in life expectancy between the highest (higher non-manual) and the lowest socio-economic group (unskilled manual) was 2.11 years in 1980 and 3.79 years in 1997. The corresponding figures for 20-year-old women were 1.56 in 1980 and 2.15 in 1997...... to mortality data, to estimate the life expectancy in different socio-economic groups in 1980 and 1997 (n=100 868). Health state scores were obtained by mapping responses to selected ULF survey interview questions into the generic health-related quality of life measure EQ-5D, using the UK EQ-5D index tariff (n...

  6. Report on evaluation for SRC-2 coal liquefaction project; SRC-II sekitan ekika project hyoka sagyo hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1979-10-01

    Among the EDS, H-Coal and SRC-2 lined up in the coal liquefaction project of the U.S., the SRC is aimed at producing 6,000 t/day as a module for a 30,000 t/day commercial plant. They expect Ash contents (iron, sulfur, etc.) in coal without basically using catalysts. The products are applicable to fuels for electricity and gas for the moment. In the element technology, there are some problems in manufacturing hydrogen by gasification of residuals as well as in slurry systems, reaction towers, etc.. In the 30,000 ton commercial plant, the coal-liquefied oil costs $19.89/bbl (price as of 1978) assuming coal costs $29.47; therefore, the feasibility is strong as a substitute for petroleum. Japan's share for the required funds will be 86.8 billion yen (if 250 yen per dollar). Since the kinds of coal are conceivably increased in number through the improvement of the process, the Pacific rim countries and these which lie on the Indian Ocean are assumed to be the major coal producing countries for Japan. The stability in storage of coal-liquefied oil is experimentally excellent, as is the compatibility with petroleum products for example. Great results can be expected in the technical know-how and the spread of element technology for Japan. (NEDO)

  7. Geothermal energy. Ground source heat pumps

    International Nuclear Information System (INIS)

    2009-01-01

    Geothermal energy can be harnessed in 2 different ways: electricity or heat generation. The combined net electrical geothermal power of the European Union countries reached 719.3 MWe in 2008 (4.8 MW up on 2007) for 868.1 MWe of installed capacity. Gross electrical production contracted slightly in 2008 (down 1% on the 2007 level) and stood at 5809.5 GWh in 2008. Italy has a overwhelming position with a production of 5520.3 GWh. Geothermal heat production concerning aquifers whose temperature is 30-150 C. degrees generally at a depth of 1-3 km is called low- and medium-enthalpy energy. 18 of the 27 EU members use low- and medium-enthalpy energy totaling 2560.0 MWth of installed capacity that yielded 689.2 ktoe in 2008 and 3 countries Hungary, Italy and France totaling 480.3 ktoe. Very low-enthalpy energy concerns the exploitation of shallow geothermal resources using geothermal heat pumps. In 2008, 114452 ground heat pumps were sold in Europe. At the end of 2008, the installed capacity was 8955.4 MWth (16.5% up on 2007 level, it represented 785206 pumps. Over one million ground heat pumps are expected to be operating in 2010 in Europe. (A.C.)

  8. Refractive outcomes comparison between the Lenstar LS 900® optical biometry and immersion A-scan ultrasound.

    Science.gov (United States)

    Naicker, Palanyraj; Sundralingam, Siva; Peyman, Mohammadreza; Juana, Azida; Mohamad, Nor Fadhilah; Win, Maung Maung; Loo, Angela; Subrayan, Visvaraja

    2015-08-01

    To determine the accuracy of intraocular lens (IOL) calculations in eyes undergoing phacoemulsification cataract surgery with IOL implantation using immersion A-scan ultrasound (US) and Lenstar LS 900(®) biometry. In this prospective study, 200 eyes of 200 patients were randomized to undergo either Lenstar LS 900(®) or immersion A-scan US biometry to determine the IOL dioptric power prior to phacoemulsification cataract surgery. Post-operative refractive outcomes of these two groups of patients were compared. The result showed no significant difference between the target spherical equivalent (SE) and the post-operative SE value by the Lenstar LS 900(®) (p value = 0.632) or immersion A-scan US biometry (p value = 0.438) devices. The magnitude of difference between the two biometric devices were not significantly different (p value = 0.868). There was no significant difference in the predicted post-operative refractive outcome between immersion A-scan US biometry and Lenstar LS 900(®). Based on the results, the immersion A-scan US technique is as accurate as Lenstar LS 900(®) in the hands of an experienced operator.

  9. Does Googling lead to statin intolerance?

    Science.gov (United States)

    Khan, Sarah; Holbrook, Anne; Shah, Baiju R

    2018-07-01

    The nocebo effect, where patients with expectations of adverse effects are more likely to experience them, may contribute to the high rate of statin intolerance found in observational studies. Information that patients read on the internet may be a precipitant of this effect. The objective of the study was to establish whether the number of websites about statin side effects found using Google is associated with the prevalence of statin intolerance. The prevalence of statin intolerance in 13 countries across 5 continents was established in a recent study via a web-based survey of primary care physicians and specialists. Using the Google search engine for each country, the number of websites about statin side effects was determined, and standardized to the number of websites about statins overall. Searches were restricted to pages in the native language, and were conducted after connecting to each country using a virtual private network (VPN). English-speaking countries (Australia, Canada, UK, USA) had the highest prevalence of statin intolerance and also had the largest standardized number of websites about statin side effects. The sample Pearson correlation coefficient between these two variables was 0.868. Countries where patients using Google are more likely to find websites about statin side effects have greater levels of statin intolerance. The nocebo effect driven by online information may be contributing to statin intolerance. Copyright © 2018 Elsevier B.V. All rights reserved.

  10. Numerical Simulation of Fragment Separation during Rock Cutting Using a 3D Dynamic Finite Element Analysis Code

    Directory of Open Access Journals (Sweden)

    Zhenguo Lu

    2017-01-01

    Full Text Available To predict fragment separation during rock cutting, previous studies on rock cutting interactions using simulation approaches, experimental tests, and theoretical methods were considered in detail. This study used the numerical code LS-DYNA (3D to numerically simulate fragment separation. In the simulations, a damage material model and erosion criteria were used for the base rock, and the conical pick was designated a rigid material. The conical pick moved at varying linear speeds to cut the fixed base rock. For a given linear speed of the conical pick, numerical studies were performed for various cutting depths and mechanical properties of rock. The numerical simulation results demonstrated that the cutting forces and sizes of the separated fragments increased significantly with increasing cutting depth, compressive strength, and elastic modulus of the base rock. A strong linear relationship was observed between the mean peak cutting forces obtained from the numerical, theoretical, and experimental studies with correlation coefficients of 0.698, 0.8111, 0.868, and 0.768. The simulation results also showed an exponential relationship between the specific energy and cutting depth and a linear relationship between the specific energy and compressive strength. Overall, LS-DYNA (3D is effective and reliable for predicting the cutting performance of a conical pick.

  11. Clinical, biochemical, molecular, and histological features of 65 Portuguese patients with mitochondrial disorders.

    Science.gov (United States)

    Cruz, Simão; Taipa, Ricardo; Nogueira, Célia; Pereira, Cristina; Almeida, Lígia S; Neiva, Raquel; Geraldes, Tiago; Guimarães, António; Melo-Pires, Manuel; Vilarinho, Laura

    2017-11-01

    Mitochondrial disorders display remarkable genetic and phenotypic heterogeneity. We performed a retrospective analysis of the clinical, histological, biochemical, and genetic features of 65 patients with molecular diagnoses of mitochondrial disorders. The most common genetic diagnosis was a single large-scale mitochondrial DNA (mtDNA) deletion (41.5%), and the most frequent clinical phenotype was chronic progressive external ophthalmoplegia (CPEO). It occurred in 41.5% of all patients, primarily in those with mtDNA deletions. Histological signs of mitochondrial dysfunction were found in 73.8% of patients, and respiratory chain enzyme assay (RCEA) abnormalities were detected in 51.9%. This study confirms the high relative frequency of single large-scale deletions among mitochondrial disorders as well as its particular association with CPEO. Muscle histology seems to be particularly useful in older patients and those with mtDNA deletions, whereas RCEA might be more helpful in young children or individuals with mtDNA depletion. Muscle Nerve 56: 868-872, 2017. © 2017 Wiley Periodicals, Inc.

  12. Sex and age differences in head acceleration during purposeful soccer heading.

    Science.gov (United States)

    Caccese, Jaclyn B; Buckley, Thomas A; Tierney, Ryan T; Rose, William C; Glutting, Joseph J; Kaminski, Thomas W

    2018-01-01

    Differences in head-neck segment mass, purposeful heading technique, and cervical strength and stiffness may contribute to differences in head accelerations across sex and age. The purpose of this study was to compare head acceleration across sex and age (youth [12-14 years old], high school and collegiate) during purposeful soccer heading. One-hundred soccer players (42 male, 58 female, 17.1 ± 3.5 years, 168.5 ± 20.3 cm, 61.5 ± 13.7 kg) completed 12 controlled soccer headers at an initial ball velocity of 11.2 m/s. Linear and rotational accelerations were measured using a triaxial accelerometer and gyroscope and were transformed to the head centre-of-mass. A MANOVA revealed a significant multivariate main effect for sex (Pillai's Trace = .165, F(2,91) = 11.868, p accelerations were higher in females (40.9 ± 13.3 g; 3279 ± 1065 rad/s 2 ) than males (27.6 ± 8.5 g, 2219 ± 823 rad/s 2 ). These data suggest that under controlled soccer heading conditions, females may be exposed to higher head accelerations than males.

  13. Acceleration capability in elite sprinters and ground impulse: Push more, brake less?

    Science.gov (United States)

    Morin, Jean-Benoît; Slawinski, Jean; Dorel, Sylvain; de Villareal, Eduardo Saez; Couturier, Antoine; Samozino, Pierre; Brughelli, Matt; Rabita, Giuseppe

    2015-09-18

    Overground sprint studies have shown the importance of net horizontal ground reaction force impulse (IMPH) for acceleration performance, but only investigated one or two steps over the acceleration phase, and not in elite sprinters. The main aim of this study was to distinguish between propulsive (IMPH+) and braking (IMPH-) components of the IMPH and seek whether, for an expected higher IMPH, faster elite sprinters produce greater IMPH+, smaller IMPH-, or both. Nine high-level sprinters (100-m best times range: 9.95-10.60s) performed 7 sprints (2×10 m, 2×15 m, 20 m, 30 m and 40 m) during which ground reaction force was measured by a 6.60 m force platform system. By placing the starting-blocks further from the force plates at each trial, and pooling the data, we could assess the mechanics of an entire "virtual" 40-m acceleration. IMPH and IMPH+ were significantly correlated with 40-m mean speed (r=0.868 and 0.802, respectively; Pacceleration performance. Similar results were obtained when considering these mechanical data averaged over the first half of the sprint, but not over the second half. In conclusion, faster sprinters were those who produced the highest amounts of horizontal net impulse per unit body mass, and those who "pushed more" (higher IMPH+), but not necessarily those who also "braked less" (lower IMPH-) in the horizontal direction. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Non-alcoholic fatty liver disease and its associated risk factors in Brazilian postmenopausal women.

    Science.gov (United States)

    Bruno, A de Souza; Rodrigues, M H; Alvares, M C B; Nahas-Neto, J; Nahas, E A Petri

    2014-08-01

    To evaluate the prevalence and risk factors of non-alcoholic fatty liver disease (NAFLD) in postmenopausal women. A cross-sectional study was carried involving 188 women (age ≥ 45 years and amenorrhea ≥ 12 months) attending the outpatient unit in south-eastern Brazil. Exclusion criteria were liver disease (hepatitis B and C, cholestatic disease, liver insufficiency), use of drugs that affect liver metabolism; alcoholics; AIDS or cancer history; and morbid obesity. NAFLD was diagnosed by abdominal ultrasound. Clinical, anthropometric (body mass index, waist circumference) and biochemical variables were measured. Of the 188 women, 73 (38.8%) had NAFLD. Blood pressure, waist circumference, body mass index, LDL cholesterol, triglycerides and glucose were significantly higher in NAFLD patients when compared with women without NAFLD (control group) (p NAFLD group (6.1 ± 4.6 vs. 2.4 ± 1.4 in control group, p NAFLD, and 46.1% of the control group (p NAFLD, were: high waist circumference (odds ratio (OR) 1.07, 95% confidence interval (CI) 1.01-1.13), insulin resistance (OR 3.81, 95% CI 2.01-7.13), and presence of metabolic syndrome (OR 8.68, 95% CI 3.3-24.1). NAFLD showed a high prevalence among postmenopausal women. The presence of metabolic syndrome, abdominal obesity and IR were indicators of risk for the development of NAFLD.

  15. Body mass index categories and mortality risk in US adults: the effect of overweight and obesity on advancing death.

    Science.gov (United States)

    Borrell, Luisa N; Samuel, Lalitha

    2014-03-01

    We examined the association of body mass index with all-cause and cardiovascular disease (CVD)-specific mortality risks among US adults and calculated the rate advancement period by which death is advanced among the exposed groups. We used data from the Third National Health and Nutrition Examination Survey (1988-1994) linked to the National Death Index mortality file with follow-up to 2006 (n = 16 868). We used Cox proportional hazards regression to estimate the rate of dying and rate advancement period for all-cause and CVD-specific mortality for overweight and obese adults relative to their normal-weight counterparts. Compared with normal-weight adults, obese adults had at least 20% significantly higher rate of dying of all-cause or CVD. These rates advanced death by 3.7 years (grades II and III obesity) for all-cause mortality and between 1.6 (grade I obesity) and 5.0 years (grade III obesity) for CVD-specific mortality. The burden of obesity was greatest among adults aged 45 to 64 years for all-cause and CVD-specific mortality and among women for all-cause mortality. These findings highlight the impact of the obesity epidemic on mortality risk and premature deaths among US adults.

  16. Analysis of physical and magnetic properties of composite NdFeB bind with polyvinyl alcohol

    Science.gov (United States)

    Ramlan; Sardjono, P.; Muljadi; Setiabudidaya, D.; Gulo, F.

    2018-03-01

    The composite magnet NdFeB has been made using magnetic powder MQP-B and polyvinyl alcohol (PVA) as the binder. The mixing compositions of raw materials used are: 95 wt% NdFeB - 5 wt% PVA, 92.5 wt% NdFeB - 7.5 wt% PVA, 90 wt.% NdFeB - 10 wt% PVA, and 87.5 wt% NdFeB - 12.5 wt% PVA. Both raw materials are weighed according to the composition, and then mixed until homogeneous. Furthermore, pellet forming was made using dry pressing at 50 kgf/cm2 pressures and continued with drying at 100 °C and 10 mmbar for 4 hours. The characterization includes bulk density, hardness, compressive strength measurements, and magnetic properties testing. The characterization results show that the optimal composition of binder PVA is achieved at 5–7.5 wt% NdFeB composite magnet with following properties: bulk density = 5.21–5.25 g/cm3, hardness = 302.17 - 304.32 Hv, compressive strength = 25.17–3.17 kgf/cm2, magnetic flux = 1150-1170 Gauss, remanence = 70.90–74.97 emu/g or 4.7–5.0 kGauss, coercivity = 8.68–8.76 kOe, and energy product = 2.89–3.04 MgOe.

  17. Vector and Serologic Survey for Crimean-Congo Hemorrhagic Fever Virus in Poland.

    Science.gov (United States)

    Bażanów, Barbara A; Pacoń, Jarosław; Gadzała, Łukasz; Frącka, Agnieszka; Welz, Mirosław; Paweska, Janusz

    2017-07-01

    In contrast to animals, Crimean-Congo hemorrhagic fever (CCHF) causes a severe disease in humans with a high mortality rate. The etiological agent, CCHF virus (CCHFV), can be transmitted by argasid and ixodid ticks, but arachnids of the genus Hyalomma, followed by Rhipicephalus and Dermacentor serve as the major vectors of this virus. The goal of the study was to assess the epidemiological situation of CCHFV infection in cattle in south-east Poland, and survey for potential tick vector species. A total of 592 bovine blood samples from animals located in the southernmost region in Poland were tested by IgG sandwich enzyme-linked immunosorbent assay. Ticks (n = 993) from south-east Poland were collected from dogs, cats, cattle, and horses and tested by RT-PCR. All 592 serum samples were negative for IgG antibodies to CCHFV. Of the ticks collected, 125 were Dermacentor reticulatus and 868 represented Ixodes ricinus, both species are regarded as potential vectors of CCHFV. All tick samples were negative for the presence of CCHFV. Considering the zoonotic nature, public health importance, and the virus increasing spread, it was prudent to assess the seroprevalence of CCHFV in the south-east area of Poland, bordering with CCHFV endemic areas. It seems unlikely that CCHFV infection will suddenly spread in Poland, but considering the multiple possibilities of the virus introduction, serosurveys and vector biosurveillance should be conducted at regular intervals.

  18. Hydrothermal alteration at the Roosevelt Hot Springs thermal area, Utah: Petrographic characterization of the alteration to 2 kilometers depth

    Energy Technology Data Exchange (ETDEWEB)

    Ballantyne, J.M.; Parry, W.T.

    1978-04-01

    Hydrothermal alteration in drill cuttings from Thermal Power drillhole 14-2, Roosevelt Hot Springs Thermal area, has been studied petrographically. The hole is sited in alluvium approximately 1.6 km southeast of the old Resort and was rotary drilled to a depth of 1866.0 m. The exact hole location is 2310 FNL, 350 FWL, Sec. 2, Twp 27S, Rge 9W, elevation 1908.5 m. Core was extracted from 792.5 to 795.5 m. Thin sections were made from samples at 15.2 m intervals of drill cuttings collected at 1.5 or 3.0 m intervals during drilling. Thin sections were made of 1.5 or 3.0 m intervals from 274.3 to 304.8 m, 487.9 to 581.2 m, and 868.7 to 899.2 m. These intervals were chosen for close spaced sampling on the basis of increases in temperature, porosity, conductivity and acoustic velocity shown in geophysical logs. A total of 153 thin sections of cuttings were made, and an additional 9 sections were made from the core. Depths of thin section samples are listed in the appendix. A visual estimate of the percentage of each rock type was made for each thin section.

  19. Simple and rapid preparation of [11C]DASB with high quality and reliability for routine applications

    International Nuclear Information System (INIS)

    Haeusler, D.; Mien, L.-K.; Nics, L.; Ungersboeck, J.; Philippe, C.; Lanzenberger, R.R.; Kletter, K.; Dudczak, R.; Mitterhauser, M.; Wadsak, W.

    2009-01-01

    [ 11 C]DASB combines all major prerequisites for a successful SERT-ligand, providing excellent biological properties and in-vivo behaviour. Thus, we aimed to establish a fully automated procedure for the synthesis and purification of [ 11 C]DASB with a high degree of reliability reducing the overall synthesis time while conserving high yields and purity. The optimized [ 11 C]DASB synthesis was applied in more than 60 applications with a very low failure rate (3.2%). We obtained yields up to 8.9 GBq (average 5.3±1.6 GBq). Radiochemical yields based on [ 11 C]CH 3 I, (corrected for decay) were 66.3±6.9% with a specific radioactivity (A s ) of 86.8±24.3 GBq/μmol (both at the end of synthesis, EOS). Time consumption was kept to a minimum, resulting in 43 min from end of bombardment to release of the product after quality control. Form our data, it is evident that the presented method can be implemented for routine preparations of [ 11 C]DASB with high reliability.

  20. Avaliação genética de seleções e híbridos de limões cravo, volkameriano e rugoso como porta-enxertos para laranjeiras Valência na presença da morte súbita dos citros Genetic evaluation of selections and hybrids of rangpur lime, volkamer and rough lemons rootstocks for Valência orange trees in the presence of the citrus sudden death

    Directory of Open Access Journals (Sweden)

    Jorgino Pompeu Junior

    2013-03-01

    Full Text Available Este estudo teve como objetivo realizar a avaliação genética da produção de frutos, eficiência produtiva e altura de laranjeiras Valência (Citrus sinensis enxertadas em seleções e híbridos dos limões Cravo (C. limonia, Volkameriano (C. volkameriana e Rugoso (C. jambhiri, em área endêmica para morte súbita dos citros (MSC. Foram avaliados 36 genótipos desses porta-enxertos, representados por cinco plantas cada, avaliados em cinco safras, do terceiro ao sétimo ano após o plantio. Sete dos genótipos avaliados apresentaram plantas com sintomas de MSC até o sétimo ano: Rangpur Otaheite orange 12901 (859, Rangpur Red Lime D.33.30 (866, Limão-Cravo EEL (871, Rangpur Borneo red (874, Citrus kokhai (1649, Limão-Rugoso 58329 (1655 e Limão- Cravo x Swingle B (1695. Para os genótipos que não manifestaram sintomas da doença, foram estimados parâmetros genéticos e fenotípicos e realizada a predição de valores genéticos dos indivíduos, visando à seleção e ao melhoramento genético para as características citadas, empregando-se o método REML/BLUP (máxima verossimilhança restrita/melhor predição linear não viciada. A análise de produção de frutos de cinco safras mostrou acurácia seletiva de 84,59%, tornando-se desnecessária a avaliação de maior número de safras. A seleção dos sete melhores genótipos proporcionou ganhos genéticos de 11,5% na produção de frutos, enquanto a do melhor genótipo conferiu ganho genético de 16,3%. As maiores médias genéticas preditas (>70,0 kg.pl-1 para produção de frutos foram obtidas pelos genótipos Limão-Cravo- Ipanema (1522, Santa- Bárbara-Red- Lime (884, Limão- Cravo- Limeira (863, Limão- Cravo- Taquaritinga (869, Limão- Rugoso- do -Cabo (1643, Rangpur- Rose Lime (868 e Limão- Cravo- da- Califórnia (1467. Já a acurácia seletiva da eficiência produtiva, para quatro colheitas, foi 77,4%. Para este caráter, as maiores médias genéticas (>8,0 kg.m-3 foram dos

  1. Seed production and quality of maize in High Valleys of Mexico.

    Directory of Open Access Journals (Sweden)

    Juan Virgen-Vargas

    2015-12-01

    Full Text Available The objective of this study was to increase the productivity of maize in High Valleys of Mexico, at the Valley of México and Bajio Experimental Stations of the National Institute for Forestry, Agriculture and Livestock Research (INIFAP. The following activities were carried out: production of registered seed to strengthen seed micro- enterprises of national capital, quality evaluation of certified seed, and generation of production technology. Between 2005 and 2013, 46.71 tons of registered seed of the hybrids parents: H-40, H-48, H-50, H-52, H-66, H-70 and H-161, and the varieties: VS-22, V-54A and V-55A were produced and sold to 31 seed producers in the Estado de Mexico, Tlaxcala, Puebla, Hidalgo, Morelos, Guanajuato, Michoacan, and Jalisco; that satisfied 60 % of demand per year (8.68 t. In 2013 and 2014, agreements were signed between INIFAP and four micro-enterprises to produce registered seeds. The certified seed produced by companies reached certification standards, germination percentage ≥ 85, 98% pure seed and less than 2% inert matter; test weight between 72 and 78 kg/hl, thousand seed weight between 288 and 361 g and genetic quality between 96 and 98 % of the true type plants. The study identified information about locations, potential yields, population density, and planting dates for the production of parents, lines and single crosses, in the Estado de Mexico and Tlaxcala.

  2. Disordered eating in Jewish adolescent girls.

    Science.gov (United States)

    Pinhas, Leora; Heinmaa, Margus; Bryden, Pier; Bradley, Susan; Toner, Brenda

    2008-09-01

    To examine the presence and nature of disordered eating attitudes and behaviours among Jewish Canadian adolescents, as compared with non-Jewish Canadian adolescents in an urban community. A secondary goal was to examine whether rates of eating-disordered behaviour differed among the adolescents based on the degree of Jewish religious observance. High school students (n = 868) from the Toronto area completed a demographic and religious practice questionnaire together with the Eating Attitudes Test (EAT), a self-report test that discriminated adolescents with syndromal eating disorders from normal adolescents. Jewish females aged 13 to 20 years, but not males, reported significantly more disordered eating behaviours and attitudes, compared with their non-Jewish female counterparts. Twenty-five percent of Jewish females, as compared with 18% of non-Jewish females, scored above the clinical cut-off for the EAT. No differences in vulnerability to disordered eating were found within the group of Jewish females or males related to their degree of religious observance. Adolescent Jewish females, but not males, appear to be at greater risk for abnormal attitudes and behaviours related to eating, compared with their non-Jewish female peers. While the reasons for this finding are unclear, this study is a step toward improving understanding of the relations between sex, culture, religion, and the development of eating disorders. Culturally sensitive and sex-specific prevention strategies and treatment interventions are indicated.

  3. Platelet counts as a biomarker in ANCA-associated vasculitis.

    Science.gov (United States)

    Willeke, P; Kümpers, P; Schlüter, B; Limani, A; Becker, H; Schotte, H

    2015-01-01

    To determine whether platelet (PLT) counts might serve as a biomarker to distinguish between active anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis (AAV) and remission and also between active disease and systemic infection. PLTs were analysed before treatment in patients with AAV in the active state and in remission. PLTs were also analysed in AAV patients with acute infections. The results were correlated with clinical manifestations, the Birmingham Vasculitis Activity Score version 3 [BVAS(v.3)], and other laboratory findings [i.e. C-reactive protein (CRP), leucocytes, differential count, procalcitonin (PCT)]. Diagnostic accuracy was calculated with a receiver operating characteristic (ROC) curve. PLT counts were significantly increased in 98 patients with AAV during the active disease state [median: 405 PLTs/nL; interquartile range (IQR) 288-504] compared to patients in remission (246 PLT/nL; IQR 214-289) (p counts in active disease with the BVAS(v.3) (r = 0.582, p counts exhibited significantly lower values (226 PLT/nL; IQR 163-273) compared to patients with active disease (p active disease from systemic infection (AUC 0.868) compared to leucocytes (AUC 0.590), CRP (AUC 0.522), or procalcitonin (AUC 0.515) (p counts were found to correlate with disease activity in AAV and thus may be used to represent immunological activity. In addition, PLT counts serve as a marker that can distinguish acute infection from active disease.

  4. Study of clad ballooning and rupture behaviour of Indian PHWR fuel pins under transient heating condition in steam environment

    Science.gov (United States)

    Sawarn, Tapan K.; Banerjee, Suparna; Sheelvantra, Smita S.; Singh, J. L.; Bhasin, Vivek

    2017-11-01

    This paper presents the results of the investigation on the deformation and rupture characteristics of Indian pressurized heavy water reactor (IPHWR) fuel pins under simulated loss of coolant accident (LOCA) condition in steam environment. Transient heating experiments were carried out on single fuel pin internally pressurized with argon gas in the range 3-70 bar. Effect of internal pressure on burst temperature, influence of burst temperature on the circumferential strain and rupture opening area were also studied. Two circumferential strain maxima at the burst temperatures of 740 & ∼979 °C and a minimum at the burst temperature of ∼868 °C were observed. It was found that oxidation had considerable effect on the burst behavior. Test data were used to derive a direct empirical correlation for burst stress exclusively as a function of temperature. The ballooning and rupture behaviours in steam and argon environments have been compared. Experimental data were examined against various correlations using Erbacher equation and author's previous correlation in argon. A second burst correlation has also been developed combining the equation in argon from the previous work of the authors and an exponential factor with oxygen content as a parameter assuming the burst stress to be a function of both temperature and oxygen concentration. The burst temperatures predicted by this empirical correlation are in good agreement with the test data.

  5. Prevalence and risk indicators for attachment loss in an urban population of South India.

    Science.gov (United States)

    Rao, Suresh Ranga; Thanikachalam, S; Sathiyasekaran, B W C S; Vamsi, Lavu; Balaji, Thodur Madapusi; Jagannathan, Raghunathan

    2014-03-01

    To estimate the prevalence and severity of attachment loss in an urban population of South India and to determine related risk indicators. This population based cross sectional study used a subset of data from a large survey representative of urban population from Chennai city. The sample consisted of 900 subjects in the age range of 17 years to 87 years. Participants were interviewed using a structured proforma and subjected to a full mouth clinical examination of six sites per tooth. The prevalence of clinical attachment level (CAL) and association with various risk indicators was assessed. Out of the 900 subjects examined, 868 (96.4%) had CAL <5 mm and 32 (3.6%) had CAL ≥ 5 mm. Age, smoking, poor oral hygiene were found to be independent risk indicators for CAL (p<0.05). Smoking (pack years) was found to exhibit a dose response effect with CAL (Kendall's Tau coefficient = 0.098) (p<0.05). In this urban population, a low prevalence of CAL ≥ 5 mm was observed. Amongst the risk indicators evaluated, age, smoking and poor oral hygiene contribute significantly to attachment loss.

  6. A study about the possible mining and benefit of the uranium ores of the ''Las Margaritas'' deposit, in Sierra de Pena Blanca, municipality of Villa Aldama, State of Chihuahua, Mexico

    International Nuclear Information System (INIS)

    Herrera, M.E.

    1976-01-01

    Considering all the characteristics of the deposit as well as its location in relation to the others, the necessary personnel, the extraction yield the structural conditions, etc. we can say that an advisable method of exploitation is the open pit method because in that way we can resolve a great number of problems, principally the high radiation to which the personnel would be exposed in a subterraneous work. The deposit reserves are 1,221,868 tons of ore with an average of 880 grams of U 3 O 8 per ton. During the exploitation at open pit 1,147,025 tons will be extracted and through subterraneous work other 50,406 tons will be recuperated. The exploitation will cost $84.00 Mexican currency per ton. According to the experimental studies about the mineral which will be treated it has been concluded that the conventional acid leaching is the appropriate treatment to be followed since the recoveries were of 88 to 95%. However, it is suggested to make more studies about the metallurgical aspect and industrial engineering studies in order to lower costs, since these are theoretical and can be improved in the practice. (author)

  7. Reverse Engineering Adverse Outcome Pathways

    Energy Technology Data Exchange (ETDEWEB)

    Perkins, Edward; Chipman, J.K.; Edwards, Stephen; Habib, Tanwir; Falciani, Francesco; Taylor, Ronald C.; Van Aggelen, Graham; Vulpe, Chris; Antczak, Philipp; Loguinov, Alexandre

    2011-01-30

    The toxicological effects of many stressors are mediated through unknown, or poorly characterized, mechanisms of action. We describe the application of reverse engineering complex interaction networks from high dimensional omics data (gene, protein, metabolic, signaling) to characterize adverse outcome pathways (AOPs) for chemicals that disrupt the hypothalamus-pituitary-gonadal endocrine axis in fathead minnows. Gene expression changes in fathead minnow ovaries in response to 7 different chemicals, over different times, doses, and in vivo versus in vitro conditions were captured in a large data set of 868 arrays. We examined potential AOPs of the antiandrogen flutamide using two mutual information theory methods, ARACNE and CLR to infer gene regulatory networks and potential adverse outcome pathways. Representative networks from these studies were used to predict a network path from stressor to adverse outcome as a candidate AOP. The relationship of individual chemicals to an adverse outcome can be determined by following perturbations through the network in response to chemical treatment leading to the nodes associated with the adverse outcome. Identification of candidate pathways allows for formation of testable hypotheses about key biologic processes, biomarkers or alternative endpoints, which could be used to monitor an adverse outcome pathway. Finally, we identify the unique challenges facing the application of this approach in ecotoxicology, and attempt to provide a road map for the utilization of these tools. Key Words: mechanism of action, toxicology, microarray, network inference

  8. Effect of Heat Treatment on Microstructures and Mechanical Properties of Severe Plastically Deformed Hypo- and Hyper-Eutectoid Steels by Caliber Rolling Process.

    Science.gov (United States)

    Yun, Shin-Cheon; Kim, Hyun-Jin; Bae, Chul-Min; Lee, Kee-Ahn

    2016-02-01

    This study investigated the effect of post-heat treatment on the microstructures and mechanical properties of severe plastically deformed hypo- and hyper-eutectoid steels that underwent a caliber rolling process. First, 28 passes of caliber rolling were performed on both the hypo-eutectoid steel with Fe-0.47% C (wt%) composition and the hyper-eutectoid steel with Fe-1.02%C (wt%) composition. Then, the caliber rolled materials underwent heat treatment at 500 degrees C for 1, 3, 5, 10, 30 and 60 minutes. The caliber rolled steel possessed a 300-400 nm-sized oval cementite structure created through elongating and segmentation regardless of the C composition. The observation of heat-treated microstructures showed that cementite structure became globular and ferrite size increased as heat treatment temperature increased. In the hardness measurement, the initial caliber rolled samples showed 372.8 Hv (hypoeutectoid) and 480.1 Hv (hyper-eutectoid). However, hardness dramatically decreased up to 10 min. heat treatments, and then showed a constant or small reduction with time. The yield strengths (compression) of caliber rolled hypo- and hypereutectoid steels obtained were 1097 MPa and 1426 MPa, respectively, and the yield strengths of the same steels after heat treatment (500 degrees C, 60 min.) were identified to be 868 MPa and 1316 MPa, respectively.

  9. Proxy and self-reported Quality of Life in adults with intellectual disabilities: Impact of psychiatric symptoms, problem behaviour, psychotropic medication and unmet needs.

    Science.gov (United States)

    Koch, Andrea D; Vogel, Anke; Becker, Thomas; Salize, Hans-Joachim; Voss, Elke; Werner, Amelie; Arnold, Katrin; Schützwohl, Matthias

    2015-01-01

    Proxies often underestimate the subjective Quality of Life (QoL) of adults with intellectual disability (ID). However, little is known about the reasons for these differences. Accordingly, the purpose of the present study is to, firstly, compare the self-reported QoL of adults with ID with proxy reports from staff of sheltered working and housing facilities, and, secondly, to identify possible differences of the impact of four potential predictor variables. Data of 102 adults with ID were collected as part of the MEMENTA study ('Mental health care provision for adults with ID and a mental disorder'). Results show that self-report QoL scores ranged from 72.6 to 86.8. Both proxies consistently reported lower QoL scores and agreement between self and proxy ratings was predominantly poor. Unmet needs and psychotropic medication were identified as the most important predictors of reduced self-rated QoL, whereas an increase of psychiatric symptoms, problem behaviours, and psychotropic medication best predicted the reduced QoL proxy ratings. To conclude, proxies still have to strive for a more holistic approach in surrogate QoL assessments and according to adults with ID, service providers should focus on a reduction of unmet needs and psychotropic medication to further improve QoL. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Stromal proteome expression profile and muscle-invasive bladder cancer research

    Directory of Open Access Journals (Sweden)

    Niu Haitao

    2012-08-01

    Full Text Available Abstract Background To globally characterize the cancer stroma expression profile of muscle-invasive transitional cell carcinoma and to discuss the cancer biology as well as biomarker discovery from stroma. Laser capture micro dissection was used to harvest purified muscle-invasive bladder cancer stromal cells and normal urothelial stromal cells from 4 paired samples. Two-dimensional liquid chromatography tandem mass spectrometry was used to identify the proteome expression profile. The differential proteins were further analyzed using bioinformatics tools and compared with the published literature. Results We identified 868/872 commonly expressed proteins and 978 differential proteins from 4 paired cancer and normal stromal samples using laser capture micro dissection coupled with two-dimensional liquid chromatography tandem mass spectrometry. 487/491 proteins uniquely expressed in cancer/normal stroma. Differential proteins were compared with the entire list of the international protein index (IPI, and there were 42/42 gene ontology (GO terms exhibited as enriched and 8/5 exhibited as depleted in cellular Component, respectively. Significantly altered pathways between cancer/normal stroma mainly include metabolic pathways, ribosome, focal adhesion, etc. Finally, descriptive statistics show that the stromal proteins with extremes of PI and MW have the same probability to be a biomarker. Conclusions Based on our results, stromal cells are essential component of the cancer, biomarker discovery and network based multi target therapy should consider neoplastic cells itself and corresponding stroma as whole one.

  11. Halogenated flame retardants (HFRs) in surface sediment from the Pearl River Delta region and Mirs Bay, South China.

    Science.gov (United States)

    Zhu, Bingqing; Lam, James C W; Lam, Paul K S

    2017-10-24

    A total of 43 surface sediment collected from rivers and the estuaries in the Pearl River Delta (PRD) region and Mirs Bay from the South China were analyzed for twelve halogenated flame retardants (HFRs) including polybrominated diphenyl ethers (PBDEs) using liquid chromatography-tandem mass spectrometer system. Their levels, spacial distribution, congener profiles and possible sources were investigated. Decabromodiphenyl ethane (DBDPE) was the predominant contaminant (1.520-1714ng/g dw) in the study area exceeding those of PBDEs (8.090-595.8ng/g dw), implying that DBDPE has been the predominant HFR products in this region in recent years in addition to PBDEs. Whereas the ratio of [DBDPE/BDE 209] varied among samples, this is indicative of different usage patterns of HFRs between PRD region and Mirs Bay. The PBDEs congener was dominated by BDE 209, with the average value accounting for 86.8% of the total PBDE in the sediment samples. Copyright © 2017. Published by Elsevier Ltd.

  12. The Adult Male Rape Victim: Forensic Description of a Series of 57 Cases.

    Science.gov (United States)

    Casali, Michelangelo Bruno; Palazzo, Elisa; Blandino, Alberto; Battistini, Alessio; Motta, Francesca; Kustermann, Alessandra; Cattaneo, Cristina

    2017-09-01

    A retrospective analysis on 57 adult male victims of sexual violence has been performed. Age, nationality and anamnesis of the victims, location of the assault, type of violence, number and identity of the assailants, presence of physical injuries, lapse of time between the assault and the request of medical assistance, and toxicological and semen detection tests were analyzed. Victims were mostly in the 31- to 40-year age group. Ten victims referred themselves as either active homosexuals or bisexuals. Forced oral and/or anal penetration was registered in 86.8% of cases, mostly performed by a single assailant. Anogenital injuries were recorded in 61.4% of cases, whereas extragenital injuries in 35.1%: abrasions and perianal reddening were the most frequent acute anogenital marks, whereas the head and lower limbs were the body parts most commonly affected by blunt trauma. No clinically severe injuries were found. Anal and perianal swabs for semen detection tested positive in less than 20% cases, whereas oral swabs always tested negative. When performed, nearly 50% of cases tested positive in drug tests, above all for psychoactive substances. No definite forensic diagnosis in terms of confirmation of rape was possible on the basis of type and topography of injuries.

  13. Work or place? Assessing the concurrent effects of workplace exploitation and area-of-residence economic inequality on individual health.

    Science.gov (United States)

    Muntaner, Carles; Li, Yong; Ng, Edwin; Benach, Joan; Chung, Haejoo

    2011-01-01

    Building on previous multilevel studies in social epidemiology, this cross-sectional study examines, simultaneously, the contextual effects of workplace exploitation and area-of-residence economic inequality on social inequalities in health among low-income nursing assistants. A total of 868 nursing assistants recruited from 55 nursing homes in Kentucky, Ohio, and West Virginia were surveyed between 1999 and 2001. Using a cross-classified multilevel design, the authors tested the effects of area-of-residence (income inequality and racial segregation), workplace (type of nursing home ownership and managerial pressure), and individual-level (age, gender, race/ethnicity, health insurance, length of employment, social support, type of nursing unit, preexisting psychopathology, physical health, education, and income) variables on health (self-reported health and activity limitations) and behavioral outcomes (alcohol use and caffeine consumption). Findings reveal that overall health was associated with both workplace exploitation and area-of-residence income inequality; area of residence was associated with activity limitations and binge drinking; and workplace exploitation was associated with caffeine consumption. This study explicitly accounts for the multiple contextual structure and effects of economic inequality on health. More work is necessary to replicate the current findings and establish robust conclusions on workplace and area of residence that might help inform interventions.

  14. Response surface methodology optimization of lipase catalyzed transesterification of Jatropha curcas L. seed oil for biodiesel production

    International Nuclear Information System (INIS)

    Li, Yingxia; Wang, Yun; Guan, Xiu Li; Yu, Dong Dong

    2013-01-01

    The immobilized lipase-catalyzed transesterification of Jatropha curcas L. seed oil and methanol for biodiesel production in tert-butanol was investigated. The effects of different tert-butanol volume, methanol molar ratio, reaction temperature, reaction time and immobilized lipase amount on the total conversion were systematically analyzed by response surface methodology (RSM). RSM analysis showed good correspondence between experimental and predicted values. The optimal conditions for the transesterification were a reaction time of 17.355 h, a reaction temperature of 34.868 °C, an immobilized lipase amount of 12.435 %, a methanol molar ratio of 5.282:1, a tert-butanol volume ratio of 0.577:1. The optimal predicted yield of fatty acid methyl esters (FAME) was 88.5 % and the actual value was 88.1 %. The predicted yield of fatty acid esters and the real one was very close, indicating that the RSM based on central composite design (CCD) was adaptable for a FAME study for the present transesterification system. Moreover, the infrared spectrum of biodiesel showed the characteristic bands of C=O, O–C–O, C=C and –(CH 2 )n–. Furthermore, GC-linked mass spectrometry showed that biodiesel was mainly composed of the methyl esters of hexadecanoic, 9,12-octadecadienoic and 9-octadecadienoic acid

  15. Back propagation artificial neural network for community Alzheimer's disease screening in China.

    Science.gov (United States)

    Tang, Jun; Wu, Lei; Huang, Helang; Feng, Jiang; Yuan, Yefeng; Zhou, Yueping; Huang, Peng; Xu, Yan; Yu, Chao

    2013-01-25

    Alzheimer's disease patients diagnosed with the Chinese Classification of Mental Disorders diagnostic criteria were selected from the community through on-site sampling. Levels of macro and trace elements were measured in blood samples using an atomic absorption method, and neurotransmitters were measured using a radioimmunoassay method. SPSS 13.0 was used to establish a database, and a back propagation artificial neural network for Alzheimer's disease prediction was simulated using Clementine 12.0 software. With scores of activities of daily living, creatinine, 5-hydroxytryptamine, age, dopamine and aluminum as input variables, the results revealed that the area under the curve in our back propagation artificial neural network was 0.929 (95% confidence interval: 0.868-0.968), sensitivity was 90.00%, specificity was 95.00%, and accuracy was 92.50%. The findings indicated that the results of back propagation artificial neural network established based on the above six variables were satisfactory for screening and diagnosis of Alzheimer's disease in patients selected from the community.

  16. Bacterial genus is a risk factor for major amputation in patients with diabetic foot

    Directory of Open Access Journals (Sweden)

    NATÁLIA ANÍCIO CARDOSO

    Full Text Available ABSTRACT Objective: to evaluate whether bacterial genus is a risk factor for major amputation in patients with diabetic foot and infected ulcer. Methods: we conducted a case-control, observational study of 189 patients with infected ulcers in diabetic feet admitted to the Vascular Surgery Service of the Risoleta Tolentino Neves Hospital, from January 2007 to December 2012. The bacteriological evaluation was performed in deep tissue cultures from the lesions and amputation was considered major when performed above the foot'smiddle tarsus. Results: the patients'mean age was 61.9±12.7 years; 122 (64.6% were men. The cultures were positive in 86.8%, being monomicrobial in 72% of the cases. In patients with major amputation, Acinetobacter spp. (24.4%, Morganella spp. (24.4%, Proteus spp. (23.1% and Enterococcus spp. (19.2% were the most frequent types of bacteria. The most commonly isolated species were Acinetobacter baumannii, Morganella morganii, Pseudomonas aeruginosa and Proteus mirabilis. As predictors of major amputation, we identified the isolation of the generaAcinetobacter spp. and Klebsiella spp., serum creatinine ≥1.3mg/dl and hemoglobin <11g/dl. Conclusion: the bacterial genera Acinetobacter spp. and Klebsiella spp. identified in infected ulcers of patients with diabetic foot were associated with a higher incidence of major amputation.

  17. A comparative assessment of culture and serology in the diagnosis of brucellosis in dairy cattle.

    Science.gov (United States)

    O'Grady, D; Byrne, W; Kelleher, P; O'Callaghan, H; Kenny, K; Heneghan, T; Power, S; Egan, J; Ryan, F

    2014-03-01

    To investigate the usefulness of culture for the confirmation of brucellosis in cattle, a comparison of culture and serology was undertaken on 248 animals in four dairy herds where the disease was active. Paired supramammary (SM), retropharyngeal (RP), and internal iliac (IL) lymph nodes were cultured, and five serological tests were deployed: the microserum agglutination test (MSAT), complement fixation test (CFT), the indirect (iELISA) and competitive ELISA, and the fluorescence polarisation assay (FPA). Brucella abortus was isolated from 86.8% of animals on combined culture of all three lymph nodes. Individually, the highest isolation rate was from the RP (90.5% of culture positives). Of culture positive animals, 13.7% and 6.2% were positive from the RP and SM alone, respectively. Approximately half of the positive cultures yielded bovine brucellosis. While the MSAT and FPA were the most sensitive serological tests, a significant percentage of infected animals were undetectable using these standard serological assays. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Pattern of alcohol consumption by young people from North Eastern Portugal

    Directory of Open Access Journals (Sweden)

    Gonçalves Isabel Amorim

    2017-12-01

    Full Text Available Alcohol is the most used psychoactive substance among adolescents, is an important public health problem and a major risk factor for the health of this group. This study is regarding to the pattern of alcohol consumption by adolescents. Descriptive, correlational and cross-sectional study, with a sample of 378 adolescents, which are attending three high schools, in north-eastern Portugal. In the data collection we used a questionnaire. Data was analysed using SPSS. The prevalence of alcohol is 86.8%. The mean score of Alcohol Use Disorders Identification Test (AUDIT was 3.53±4.525 points. The vast majority of participants were located in the non-excessive alcohol consumption area (91.3%. The pattern of alcohol consumption differs significantly between gender (Wald: p ≤ 0,004 and the religious practice (Wald: p ≤ 0,027, with greater percentage of boys and students who did not practice any religion in excessive consumers. The prevalence of alcohol consumers is high. The proportion of young people with excessive consumption in our sample is lower than in other studies, but shows that there is a group of adolescents in excessive consumption. It found a relationship between consumption pattern, gender and religious practice. These results justify the development of public health interventions.

  19. Trends in female representation in published ophthalmology literature, 2000-2009.

    Science.gov (United States)

    Shah, Deepika N; Huang, Jiayan; Ying, Gui-shuang; Pietrobon, Ricardo; O'Brien, Joan M

    2013-01-01

    To examine trends in female first and last authors in clinical ophthalmology literature published from January 2000 to December 2009. A total of 3760 articles in American Journal of Ophthalmology (AJO), 2347 articles in Archives of Ophthalmology (Archives), and 3838 articles in Ophthalmology spanning 10 years of published ophthalmology peer-reviewed literature were examined. All original research articles and brief reports indexed online were included. Author gender was determined by an exhaustive Internet search. Articles were excluded if the sex of the author could not be determined or was not applicable (for example, articles by a study group rather than an individual author). Gender information was identified in 86.8% of articles for first authors and 86% for last authors. The number of female first authors (P representation increased for last authors significantly only in Ophthalmology. There was a significant correlation between gender of the first author and total number of authors that was not observed with last-author sex. Female first authorship has increased from 2000 to 2009 and is correlated with the gender of the last author; however, there were fewer female last authors compared to female first authors in the same period.

  20. Assessment of Economic Condition Impact on People's Awareness, Attitudes and Practices Towards Recycling of Solid Wastes, a Case Study in Tabriz

    Directory of Open Access Journals (Sweden)

    Farzaneh Baghal Asghari

    2015-08-01

    Full Text Available Background and Objectives : Waste production is an integral part of human life. Besides reduction in waste production, one of the most important strategies solid waste management is solid waste recycling which has environmental and economic benefits. The aim of the present study was to evaluate the knowledge, attitude and practice (KAP of Tabriz citizens to participate in recycling. Material and Methods : This cross-sectional study involved 450 samples, in three different regions of Tabriz with high, average and low income levels (150 from each district, selected by systematic sampling. The relevant data were collected by questionnaires and were analyzed in SPSS and Excel software.  Results : The results of this study showed that the majority of Tabriz citizens had acceptable information about waste and recycling. Average knowledge, attitude and practices of the various regions were 86.8%, 75.6% and 59% respectively. There was no significant association in this field in three different regions (p.value > 0.05. Comparing the regions, education and welfare of the residents had no effect on the willingness to participate in recycling programs. : Conclusion: The results of the study reflect the community's readiness to accept the change and management of Municipal Solid Waste (MSW in the recycling programs. Consequently, recycling would be implemented successfully if organizations (e.g. municipalities, health center, education... have been coordinated and collaborated with citizens. ​

  1. Design Variations on Planar Differential Antenna with Potential for Multiple, Wide, and Narrow Band Coverage

    Directory of Open Access Journals (Sweden)

    Domenico Pepe

    2015-01-01

    Full Text Available This paper presents three practical antenna implementations based on variations of one general planar differential antenna topology originally proposed for ultrawideband (UWB applications. All designs were implemented on a low-cost FR4 substrate and experimentally characterized in an anechoic chamber. The results show how the proposed design variations lead to the required antenna performances and how they give rise to new opportunities in terms of coverage of wide, narrow, and multiple frequency bands for communication and sensing applications below 5 GHz. In particular, the results show how a significant enhancement in bandwidth performance is achieved by folding the differential radiating elements. Moreover, they show how an agile design strategy enables adaption of the antenna design to different requirements for covering wide, narrow, and multiple bands, making the proposed class of antennas suitable for different wireless applications. In detail, the proposed class of antennas covers multiple frequency bands, ranging from the 868 MHz and 915 MHz bands to 2.4 GHz industrial scientific and medical (ISM bands, including the 1.2 GHz L band for Global Positioning and Navigation Satellite Systems (GNSS and the lower portion of the UWB band.

  2. Age trends and within-site effects in wood density and radial growth in Quercus faginea mature trees

    Energy Technology Data Exchange (ETDEWEB)

    Sousa, V.B.; Louzada, J.L.; Pereira, H.

    2016-07-01

    Aim of study: This paper aims to valorize the wood of Quercus faginea Lam. for high quality end uses (e.g. furniture) by studying growth and quality properties using mature trees. Age trends in tree-ring width and wood density are shown and the main factors responsible for variations in tree-ring width and wood density within and between trees are investigated. Area of study: The study site is in the center of Portugal within the natural species distribution area. Material and methods: Radial samples from ten mature trees were collected at 6 heights (from base to 9.7 m) and prepared for X-ray microdensity. Main results: Wood density showed high values, ranging from 0.868 g/cm3 to 0.957 g/cm3. Wood density decreased from pith to bark and with stem height. Cambial age showed a linear relationship with wood density and most of the variation in wood is explained by age. Intra-ring and axial within-tree homogeneity was good. Research highlights: Mature trees of Q. faginea showed high wood density and a high potential for high quality end uses, comparable to other oaks. Wood density is influenced by cambial age and tree-ring width. Wood quality may be improved by tree growth rates adjustment e.g. through an adequate tree stand density (e.g. thinning operations). (Author)

  3. Hyperbaric oxygen as sole treatment for severe radiation - induced haemorrhagic cystitis

    Energy Technology Data Exchange (ETDEWEB)

    Dellis, Athanasios, E-mail: aedellis@gmail.com [Department of Surgery, National and Kapodistrian University of Athens, Aretaieion Academic Hospital, Athens (Greece); Papatsoris, Athanasios; Deliveliotis, Charalambos; Skolarikos, Andreas [Department of Urology, University of Athens, Sismanoglio General Hospital, Athens (Greece); Kalentzos, Vasileios [Department of Diving and Hyperbaric Oxygen, Naval and Veterans Hospital, Athens (Greece)

    2017-05-15

    Purpose: To examine the safety and efficacy of hyperbaric oxygen as the primary and sole treatment for severe radiation-induced haemorrhagic cystitis. Materials and methods: Hyperbaric oxygen was prospectively applied as primary treatment in 38 patients with severe radiation cystitis. Our primary endpoint was the incidence of complete and partial response to treatment, while the secondary endpoints included the duration of response, the correlation of treatment success-rate to the interval between the onset of haematuria and initiation of therapy, blood transfusion need and total radiation dose, the number of sessions to success, the avoidance of surgery and the overall survival. Results: All patients completed therapy without complications with a mean follow-up of 29.33 months. Median number of sessions needed was 33. Complete and partial response rate was 86.8% and 13.2%, respectively. All 33 patients with complete response received therapy within 6 months of the haematuria onset. One patient needed cystectomy, while 33 patients were alive at the end of follow-up. Conclusions: Our study suggests the early primary use of hyperbaric oxygen for radiation-induced severe cystitis as an effective and safe treatment option. (author)

  4. Genome-wide fitness test and mechanism-of-action studies of inhibitory compounds in Candida albicans.

    Directory of Open Access Journals (Sweden)

    Deming Xu

    2007-06-01

    Full Text Available Candida albicans is a prevalent fungal pathogen amongst the immunocompromised population, causing both superficial and life-threatening infections. Since C. albicans is diploid, classical transmission genetics can not be performed to study specific aspects of its biology and pathogenesis. Here, we exploit the diploid status of C. albicans by constructing a library of 2,868 heterozygous deletion mutants and screening this collection using 35 known or novel compounds to survey chemically induced haploinsufficiency in the pathogen. In this reverse genetic assay termed the fitness test, genes related to the mechanism of action of the probe compounds are clearly identified, supporting their functional roles and genetic interactions. In this report, chemical-genetic relationships are provided for multiple FDA-approved antifungal drugs (fluconazole, voriconazole, caspofungin, 5-fluorocytosine, and amphotericin B as well as additional compounds targeting ergosterol, fatty acid and sphingolipid biosynthesis, microtubules, actin, secretion, rRNA processing, translation, glycosylation, and protein folding mechanisms. We also demonstrate how chemically induced haploinsufficiency profiles can be used to identify the mechanism of action of novel antifungal agents, thereby illustrating the potential utility of this approach to antifungal drug discovery.

  5. Study of radiological risk at the Regional Hospital of Trujillo-Peru

    International Nuclear Information System (INIS)

    Regalado C, S.; Benavente A, T.; Celedonio O, E.; Vasquez A, M.

    1996-01-01

    The irradiation doses have been measured in operators, patients and members of public, who attend the diagnostic service of the Hospital Regional Docente in Trujillo, Peru by using TLD-100 and TLD-200. For cranium test, the results are 8,68 x 10 -3 mSv in operators and 7,8 x 10 -4 mSv in members of the public. It means a fatal cancer risk of 3,7 x 10 -7 and 3,9 x 10 -8 , respectively. For patients, the equivalent doses in the examined organs are 0,181 mSv in lung; 4,982 mSv in spine; 6,466 mSv in abdomen; 6,039 mSv in pelvis and 2,174 mSv in cranium. In order to maximize benefits for patients, a quality control program was carried out in x-ray equipment. It consisted in the measurement of an effective, average and maximum kilovoltage, as well as in the determination of the HVL, linearity, exposition time and coincidence between luminous and radiation fields. It was concluded that the measured doses are similar to the international ones reported. In the same way, it is indicated that it is possible to reduce risks in patients and operators by regulating kilo-voltages, adjusting the radiation fields and electronic calibration equipment. (authors). 4 refs., 2 tabs

  6. Man in his 50s with chest pain and dyspnoea.

    Science.gov (United States)

    Obayashi, Yuki; Izumi, Chisato; Nakagawa, Yoshihisa

    2018-05-01

    A man in his 50s with sudden-onset chest pain and dyspnoea was transferred to the emergency room. He had a history of aortic valve replacement due to aortic regurgitation with a mechanical valve 6 years previously. Heart rate was 90 bpm, and blood pressure was too low to measure. In the emergency room, he presented with severe dyspnoea and a chest X-ray showed severe lung congestion (figure 1A). ECG showed complete left bundle branch block. His respiratory status rapidly worsened, and he went into cardiopulmonary arrest. After cardiopulmonary resuscitation, transthoracic echocardiography was performed (figure 1B, online supplementary video 1).DC1SP110.1136/heartjnl-2017-312477.supp1Supplementary file 1 heartjnl;104/10/868/F1F1F1Figure 1(A) Chest X-ray. (B) Colour Doppler image from apical five-chamber view. What is the most likely cause of the patient's cardiopulmonary arrest?Myocardial infarction in left main trunkAortic dissectionProsthetic valve thrombosisProsthetic valve embolisationPulmonary embolism. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  7. [Preliminary experience with the Storz Modulith SL 20 lithotriptor in reno-ureteral lithiasis].

    Science.gov (United States)

    Simone, M; Carluccio, G; Daniele, C; Russo, G R; Romano, A; Reggiani, A

    1992-12-01

    The authors report their initial results in ESWL of urinary calculi with the Storz Modulith SL 20 lithotriptor, a multipurpose device for both urinary and biliary stone treatment. During 176 sessions, a total of 144 cases (81 renal and 63 ureteral) were treated and then, followed up. The over-all rate free of stones was 86.8% (90.1% for kidney and for ureteral stones). The treatment rate was 1.23 per patient. Auxiliary procedures before ESWL were performed in 7.9% of the sessions: insertion of "double-J" stent or nephrostomy tube; all ureteral stones received "in situ" treatment. Mean number of shock waves per session was 1836.1 (range 300-3020). The maximum voltage on the average reached was 17.1 kv. Sedo-analgesia by Diazepam and Ketoprofen was given in 75% of the cases. No serious complications were observed. The experience with this machine is discussed in regard to performance; the advantages of its fluoroscopy and ultrasound guided system of focusing are stressed.

  8. Subunit structure of karatasin, the proteinase isolated from Bromelia plumieri (karatas).

    Science.gov (United States)

    Montes, C; Amador, M; Cuevas, D; Cordoba, F

    1990-01-01

    Close to 15% of the karatasin proteinase activity in the fruit juice of Bromelia plumieri (karatas) is present outside dialysis Visking tubing in 7 days in 0.2 M acetate buffer (pH) 3.5 or 6.5) containing phenyl mercuric acetate. The small proteinase(s), distinct from the 85% activity in juice due to nondialysable karatasin with a reported Mr of 24,868, separates across Spectrapore (13 kDa) membranes but not across Spectrapore with 3.5 kDa average pore diameter. The dialyzed proteinase is named karatasin-D (K-D). Purified non-Dialysable karatasin can be dissociated to what seems to be K-D by incubation in a buffer solution, containing SDS and 2-mercaptoethanol with phenyl mercuric acetate, in dialysis experiments for 8 days at room temperature using Spectrapore 13 kDa tubing. Thus, native karatasin in B. plumieri fruit juice seem to be the result of association of 2 small molecular mass K-D subunits, linked together by disulfide bonds and electrostatic forces, in equilibrium with small amounts of free K-D molecules. The amino acid composition and partial sequence of karatasin up to the 14th position from the amino terminus have discrete analogies with papain and with stem bromelain.

  9. UK emissions of the greenhouse gas nitrous oxide

    Science.gov (United States)

    Skiba, U.; Jones, S. K.; Dragosits, U.; Drewer, J.; Fowler, D.; Rees, R. M.; Pappa, V. A.; Cardenas, L.; Chadwick, D.; Yamulki, S.; Manning, A. J.

    2012-01-01

    Signatories of the Kyoto Protocol are obliged to submit annual accounts of their anthropogenic greenhouse gas emissions, which include nitrous oxide (N2O). Emissions from the sectors industry (3.8 Gg), energy (14.4 Gg), agriculture (86.8 Gg), wastewater (4.4 Gg), land use, land-use change and forestry (2.1 Gg) can be calculated by multiplying activity data (i.e. amount of fertilizer applied, animal numbers) with simple emission factors (Tier 1 approach), which are generally applied across wide geographical regions. The agricultural sector is the largest anthropogenic source of N2O in many countries and responsible for 75 per cent of UK N2O emissions. Microbial N2O production in nitrogen-fertilized soils (27.6 Gg), nitrogen-enriched waters (24.2 Gg) and manure storage systems (6.4 Gg) dominate agricultural emission budgets. For the agricultural sector, the Tier 1 emission factor approach is too simplistic to reflect local variations in climate, ecosystems and management, and is unable to take into account some of the mitigation strategies applied. This paper reviews deviations of observed emissions from those calculated using the simple emission factor approach for all anthropogenic sectors, briefly discusses the need to adopt specific emission factors that reflect regional variability in climate, soil type and management, and explains how bottom-up emission inventories can be verified by top-down modelling. PMID:22451103

  10. Ten-year survival and prognostic markers in one thousand patients with advanced heart failure. A single-centre analysis.

    Science.gov (United States)

    Lesny, Peter; Luknar, Milan; Matejka, Martin; Varga, Ivan; Solik, Peter; Wimmerova, Sona; Goncalvesova, Eva

    2016-06-01

    Patients with advanced heart failure (HF) represent a pool of candidates for heart transplantation and long-term mechanical circulatory support devices. The aim of our study was to determine simple and reliable markers of one-year mortality for selection of the most suitable patients for heart replacement therapy. One thousand consecutive patients with HF (mean age 49 ± 10.9 years; 86.8% males) referred to a single tertiary centre from January 1998 to January 2010 in order to assess the indication for heart transplantation were enrolled. Kaplan-Meier survival analysis was performed. Independent mortality predictors were established using logistic regression analysis. The mean follow-up was 4.3 ± 2.7 years (range 1-12 years). Cumulative survival was as follows: 1-year survival 83%, 3-year 63%, 5-year 50%, 7-year 39%, and 10-year 23%. Independent predictors of 1-year mortality included coronary artery disease, left ventricular diastolic diameter >79 mm, plasma sodium 240 mg/day. Short-term prognosis of HF patient can be estimated based on simple parameters. Patients with signs of poor prognosis should be referred to tertiary centres to be considered for heart replacement therapy.

  11. Reliability and Comparability of Psychosis Patients’ Retrospective Reports of Childhood Abuse

    Science.gov (United States)

    Fisher, Helen L.; Craig, Thomas K.; Fearon, Paul; Morgan, Kevin; Dazzan, Paola; Lappin, Julia; Hutchinson, Gerard; Doody, Gillian A.; Jones, Peter B.; McGuffin, Peter; Murray, Robin M.; Leff, Julian; Morgan, Craig

    2011-01-01

    An increasing number of studies are demonstrating an association between childhood abuse and psychosis. However, the majority of these rely on retrospective self-reports in adulthood that may be unduly influenced by current psychopathology. We therefore set out to explore the reliability and comparability of first-presentation psychosis patients’ reports of childhood abuse. Psychosis case subjects were drawn from the Aetiology and Ethnicity of Schizophrenia and Other Psychoses (ÆSOP) epidemiological study and completed the Childhood Experience of Care and Abuse Questionnaire to elicit abusive experiences that occurred prior to 16 years of age. High levels of concurrent validity were demonstrated with the Parental Bonding Instrument (antipathy: rs = 0.350–0.737, P antipathy: κ = 0.492, P antipathy: U = 2216.5, P = .988; neglect: U = 1906.0, P = .835) or depressed mood (sexual abuse: χ2 = 0.634, P = .277; physical abuse: χ2 = 0.159, P = .419; antipathy: χ2 = 0.868, P = .229; neglect: χ2 = 0.639, P = .274). These findings provide justification for the use in future studies of retrospective reports of childhood abuse obtained from individuals with psychotic disorders. PMID:19776204

  12. Reliability and comparability of psychosis patients' retrospective reports of childhood abuse.

    Science.gov (United States)

    Fisher, Helen L; Craig, Thomas K; Fearon, Paul; Morgan, Kevin; Dazzan, Paola; Lappin, Julia; Hutchinson, Gerard; Doody, Gillian A; Jones, Peter B; McGuffin, Peter; Murray, Robin M; Leff, Julian; Morgan, Craig

    2011-05-01

    An increasing number of studies are demonstrating an association between childhood abuse and psychosis. However, the majority of these rely on retrospective self-reports in adulthood that may be unduly influenced by current psychopathology. We therefore set out to explore the reliability and comparability of first-presentation psychosis patients' reports of childhood abuse. Psychosis case subjects were drawn from the Aetiology and Ethnicity of Schizophrenia and Other Psychoses (ÆSOP) epidemiological study and completed the Childhood Experience of Care and Abuse Questionnaire to elicit abusive experiences that occurred prior to 16 years of age. High levels of concurrent validity were demonstrated with the Parental Bonding Instrument (antipathy: r(s)=0.350-0.737, Pantipathy: κ=0.492, Pantipathy: U=2216.5, P=.988; neglect: U=1906.0, P=.835) or depressed mood (sexual abuse: χ(2)=0.634, P=.277; physical abuse: χ(2)=0.159, P=.419; antipathy: χ(2)=0.868, P=.229; neglect: χ(2)=0.639, P=.274). These findings provide justification for the use in future studies of retrospective reports of childhood abuse obtained from individuals with psychotic disorders. © The Author 2009. Published by Oxford University Press on behalf of the Maryland Psychiatric Research Center. All rights reserved.

  13. Airborne Microorganism Disinfection by Photocatalytic HEPA Filter

    Directory of Open Access Journals (Sweden)

    Rotruedee Chotigawin

    2010-07-01

    Full Text Available This study determined the efficacy of photocatalytic HEPA filters on microorganism disinfection in a closed-loop chamber and later applied it in an air purifier and tested its efficacy in an 8-m3 chamber and in a hospital. The photocatalytic filters were made by dip-coating a HEPA filter in a TiO2 slurry. In order to disinfect the microorganisms retained on the filter, UV-A light was irradiated onto the filter to create strong oxidative radicals which can destroy microorganisms. The findings showed that disinfection efficiency of the photocatalytic filters with high TiO2 loading was insignificantly higher than with lower loading. S. epidermidis was completely eliminated within 2 hours, while 86.8% of B. subtilis, 77.1% of A. niger, and 82.7% of P. citrinum were destroyed within 10 hours. When applying the photocatalytic filters into an air purifier in a 8-m3 chamber, it was found that as soon as the air purifier was turned on, 83.4% of S. epidermidis, 81.4% of B. subtilis, 88.5% of A. niger, and 75.8% of P. citrinum were removed from the air. In a hospital environment, the PCO air purifier efficacy was lower than that in the chamber. Besides, relative humidity, distances from the air purifier and room size were suspected to affect the efficacy of the photocatalytic filters.

  14. Self-Monitoring and the Metatraits.

    Science.gov (United States)

    Wilmot, Michael P; DeYoung, Colin G; Stillwell, David; Kosinski, Michal

    2016-06-01

    Prior attempts at locating self-monitoring within general taxonomies of personality traits have largely proved unsuccessful. However, past research has typically neglected (a) the bidimensionality of the Self-Monitoring Scale and (b) the hierarchical nature of personality. The objective of this study was to test hypotheses that the two self-monitoring factors are located at the level of the metatraits. Using data from two large multi-informant samples, one community (Sample 1: N = 552, Mage  = 51.26, 61% female; NPeers  = 1,551, Mage  = 48.61, 37% female) and one online (Sample 2: N = 3,726, Mage  = 24.89, 59% female; NPeers  = 17,868, Mage  = 26.23, 64% female), confirmatory factor analysis was used to test the hypotheses. Results confirmed hypotheses that acquisitive self-monitoring would have a strong positive relation to metatrait Plasticity, whereas protective self-monitoring would have a moderate negative relation to metatrait Stability. In both samples, constraining the correlation between acquisitive self-monitoring and Plasticity to unity did not alter model fit indices, indicating that the two putatively distinct constructs are identical. Findings have wide-ranging implications, including integration of the construct of self-monitoring into the mainstream of personality research, as the latter moves toward the development of broad explanatory theories. © 2015 Wiley Periodicals, Inc.

  15. A complete mitochondrial genome sequence of Asian black bear Sichuan subspecies (Ursus thibetanus mupinensis)

    Science.gov (United States)

    Hou, Wan-ru; Chen, Yu; Wu, Xia; Hu, Jin-chu; Peng, Zheng-song; Yang, Jung; Tang, Zong-xiang; Zhou, Cai-Quan; Li, Yu-ming; Yang, Shi-kui; Du, Yu-jie; Kong, Ling-lu; Ren, Zheng-long; Zhang, Huai-yu; Shuai, Su-rong

    2007-01-01

    We obtained the complete mitochondrial genome of U.thibetanus mupinensis by DNA sequencing based on the PCR fragments of 18 primers we designed. The results indicate that the mtDNA is 16 868 bp in size, encodes 13 protein genes, 22 tRNA genes, and 2 rRNA genes, with an overall H-strand base composition of 31.2% A, 25.4% C, 15.5% G and 27.9% T. The sequence of the control region (CR) located between tRNA-Pro and tRNA-Phe is 1422 bp in size, consists of 8.43% of the whole genome, GC content is 51.9% and has a 6bp tandem repeat and two 10bp tandem repeats identified by using the Tandem Repeats Finder. U. thibetanus mupinensis mitochondrial genome shares high similarity with those of three other Ursidae: U. americanus (91.46%), U. arctos (89.25%) and U. maritimus (87.66%). PMID:17205108

  16. Humans do not switch between path knowledge and landmarks when learning a new environment.

    Science.gov (United States)

    Foo, Patrick; Duchon, Andrew; Warren, William H; Tarr, Michael J

    2007-05-01

    Using a metric shortcut paradigm, we have found that like honeybees (Dyer in Animal Behaviour 41:239-246, 1991), humans do not seem to build a metric "cognitive map" from path integration. Instead, observers take novel shortcuts based on visual landmarks whenever they are available and reliable (Foo, Warren, Duchon, & Tarr in Journal of Experimental Psychology-Learning Memory and Cognition 31(2):195-215, 2005). In the present experiment we examine whether humans, like ants (Wolf & Wehner in Journal of Experimental Biology 203:857-868, 2000), first use survey-type path knowledge, built up from path integration, and then subsequently shift to reliance on landmarks. In our study participants walked in an immersive virtual environment while head position and orientation were recorded. During training, participants learned two legs of a triangle with feedback: paths from Home to Red and Home to Blue. A configuration of colored posts surrounded the Red location. To test reliance on landmarks, these posts were covertly translated, rotated, or left unchanged during six probe trials. These probe trials were interspersed during the training procedure to measure changes over learning. Dependence on visual landmarks was immediate and sustained during training, and no significant learning effects were observed other than a decrease in hesitation time. Our results suggest that while humans have at least two distinct navigational strategies available to them, unlike ants, a computationally-simpler landmark strategy dominates during novel shortcut navigation.

  17. Novel Glycoprotein VI Antagonists as Antithrombotics: Synthesis, Biological Evaluation, and Molecular Modeling Studies on 2,3-Disubstituted Tetrahydropyrido(3,4-b)indoles.

    Science.gov (United States)

    Bhunia, Shome S; Misra, Ankita; Khan, Imran A; Gaur, Stuti; Jain, Manish; Singh, Surendra; Saxena, Aaruni; Hohlfield, Thomas; Dikshit, Madhu; Saxena, Anil K

    2017-01-12

    The development of small molecule inhibitors targeting GPVI has promising therapeutic role, as they inhibit arterial thrombosis with limited risk of bleeding. Among the compounds showing in vivo antithrombotic activity, the most active compound 6b (ED 50 = 28.36 μmol/kg po in mice) showed improved inhibition for collagen (IC 50 = 6.7 μM), CRP-XL (IC 50 = 53.5 μM), and convulxin (CVX) (IC 50 = 5.7 μM) mediated platelet aggregation as compared to losartan (LOS) (collagen, IC 50 = 10.4 μM; CRP-XL, IC 50 = 158 μM; CVX, IC 50 = 11 μM) than any of its enantiomers S (6c) (collagen, IC 50 = 25.3 μM; CRP-XL, IC 50 = 181.4 μM; CVX, IC 50 = 9 μM) and R (6d) (collagen, IC 50 = 126.3 μM; CRP-XL, IC 50 > 500 μM; CVX, IC 50 = 86.8 μM). Compound 6b also inhibited platelet P-selectin expression and thus may diminish atherosclerosis. The molecular interactions of both enantiomers 6c and 6d at the GPVI receptor have been explained through docking studies.

  18. Clinical characteristics of acute pancreatitis in pregnancy: experience based on 121 cases.

    Science.gov (United States)

    Luo, Lingyu; Zen, Hao; Xu, Hongrong; Zhu, Yin; Liu, Pi; Xia, Liang; He, Wenhua; Lv, Nonghua

    2018-02-01

    Acute pancreatitis in pregnancy (APIP) is a rare condition; however, it markedly affects maternal and fetal health. This study aimed to describe the types, clinical characteristics, mortality, and the safety and necessity of gestation termination of acute pancreatitis in pregnancy (APIP). We retrospectively reviewed 121 APIP cases in the Gastroenterology Department of The First Affiliated Hospital of Nanchang University. APIP diagnosis were based on 2012 Atlanta Criteria. The correlation between APIP types, severity, biochemical parameters and mortality was analyzed. The most common symptoms for APIP were abdominal pain (86.8%) and vomiting (73.6%). The most common causes for APIP were gallstone (36.4%) and hypertriglyceridemia (32.2%) and hypertriglyceridemic APIP was correlated with a higher rate for local complication (P = 0.012). Serum calcium level was negatively correlated with the severity of APIP (P < 0.01). The overall maternal and fetal mortality rate were 3.3% (4/121) and 11.6% (14/121), respectively. The severity of APIP was significantly correlated with higher risks for maternal and fetal death (P < 0.01). 72.7% of moderate-to-severe APIP patients underwent Cesarean section to terminate gestation safely. The most common causes of APIP were gallstone and hypertriglyceridemia. Lower level of serum calcium could be used as an indicator for the severity of the APIP. The severity of APIP was associated with higher risk for neonate asphyxia, and maternal and fetal death.

  19. Diagnostic value of pleural fluid adenosine deaminase activity in tuberculosis pleurisy

    Directory of Open Access Journals (Sweden)

    Abbas ali Niazi

    2009-09-01

    Full Text Available Background: Diagnosis of tuberculosis pleurisies is difficult because of its nonspecific clinical presentation and insufficient traditional diagnostic methods. We investigated the use of adenosine deaminase (ADA activity in tuberculosis pleurisies. Methods: A number of 85 patients were analyzed with exudative pleural effusions. Using the ROC curve, we determined the optimal cutoff for TB pleurisy. Results: A number of 58 exudative samples were nontuberculous (non-TB and 27 were tuberculosis (TB. There was statistically significant difference (p<0.0001 between the means of pleural fluid ADA levels among the TB and non-TB populations. The prevalence of TB pleurisy in the studied population was 31%. Using the cutoff point equal to 35 for diagnosing TB effusions the sensitivity and specificity 70.3% and 91.3%, respectively. The positive predictive value (PPV was 79.1% and the negative predictive value (NPV was 86.8%. A pleural fluid ADA value <19 IU/L suggests that a tuberculosis effusion is highly unlikely. Conclusion: Pleural fluid total ADA assay is a sensitive and specific test suitable for rapid diagnosis of TB pleurisy.

  20. New electronic apex locator Romiapex A-15 presented accuracy for working length determination in permanent teeth

    Directory of Open Access Journals (Sweden)

    Etevaldo Matos Maia Filho

    2014-12-01

    Full Text Available Purpose: The present study aims to evaluate, ex vivo, the accuracy of electronic apex locators Root ZX II and Romiapex-15, for working length (WL determination in permanent teeth. Materials and Methods: Fourteen single-rooted teeth (incisors and canines, with their apices fully formed were used. The dental crowns were removed. The anatomic length of the tooth (real measurement was visually determined through the insertion of a size 10 K-file until the tip of the instrument could be observed in the apical foramen under a microscope (20X. Teeth were fixed in a model of resin and adapted into alginate soaked with saline solution, which was used as an  electrical conductor. Using a K-file, root canals were measured electronically using both devices. The results obtained for each apex locator were compared to the real measurements. The accuracy between the devices was statistically analyzed using the Bland-Altman graph, Intraclass Correlation Coefficient (ICC, and Student’s t-test. Results: The mean difference between the measurements using the Root ZX II was 0.277mm greater than the real measurement, while the measurements from the Romiapex-15 were 0.308mm higher on average. The comparison between Root ZX II and Romiapex-15 had no significant difference (p= 0.868. Conclusion: It was concluded that Root ZX II and Romiapex-15 had similar accuracy. Romiapex-15 could be an option for WL determination in permanent teeth.

  1. Enhanced Passive RF-DC Converter Circuit Efficiency for Low RF Energy Harvesting

    Science.gov (United States)

    Chaour, Issam; Fakhfakh, Ahmed; Kanoun, Olfa

    2017-01-01

    For radio frequency energy transmission, the conversion efficiency of the receiver is decisive not only for reducing sending power, but also for enabling energy transmission over long and variable distances. In this contribution, we present a passive RF-DC converter for energy harvesting at ultra-low input power at 868 MHz. The novel converter consists of a reactive matching circuit and a combined voltage multiplier and rectifier. The stored energy in the input inductor and capacitance, during the negative wave, is conveyed to the output capacitance during the positive one. Although Dickson and Villard topologies have principally comparable efficiency for multi-stage voltage multipliers, the Dickson topology reaches a better efficiency within the novel ultra-low input power converter concept. At the output stage, a low-pass filter is introduced to reduce ripple at high frequencies in order to realize a stable DC signal. The proposed rectifier enables harvesting energy at even a low input power from −40 dBm for a resistive load of 50 kΩ. It realizes a significant improvement in comparison with state of the art solutions. PMID:28282910

  2. Reliability and validity of the Chinese version of the HIV Treatment Adherence Self-Efficacy Scale in mainland China.

    Science.gov (United States)

    Sun, Liang; Yang, Shu-Min; Wu, Hui; Chen, Bing; Wang, Chong-Jian; Li, Xiao-Fang

    2017-07-01

    The aim of this study was to translate the HIV Treatment Adherence Self-Efficacy Scale (HIV-ASES) and evaluate its reliability and validity in people living with HIV (PLWHIV) in mainland China. The original HIV-ASES was translated from English into Chinese and adapted for cultural context according to cross-cultural adaptation guidelines. A cross-sectional survey investigating 1742 PLWHIV receiving antiretroviral treatment was conducted. Exploratory factor analysis with varimax rotation confirmed the presence of two factors with an accumulated contribution rate of 58.357%. Furthermore, confirmatory factor analysis revealed the model's goodness-of-fit index. The comparative fit index was greater than 0.9 and the overall efficacy of the model was satisfactory. The Cronbach α coefficient of the questionnaire was 0.876 (95% CI: 0.868-0.885), and the correlation coefficient of each item and the total was 0.536-0.660 ( P < 0.01). The Chinese version of the HIV-ASES has high reliability and validity; however, the individual item requires some adjustment.

  3. Effect of incorporation of zinc oxide nanoparticles on mechanical properties of conventional glass ionomer cements.

    Science.gov (United States)

    Panahandeh, Narges; Torabzadeh, Hassan; Aghaee, Mohammadamin; Hasani, Elham; Safa, Saeed

    2018-01-01

    The aim of this study is to investigate the physical properties of conventional and resin-modified glass ionomer cements (GICs) compared to GICs supplemented with zinc oxide (ZnO) nanofiller particles at 5% (w/w). In this in vitro study, ZnO nanoparticles of different morphologies (nanospherical, nanorod, and nanoflower) were incorporated to glass ionomer powder. The samples were subjected to the flexural strength ( n = 20) and surface hardness test ( n = 12) using a universal testing machine and a Vickers hardness machine, respectively. Surface analysis and crystal structure of samples were performed with scanning electron microscope and X-radiation diffraction, respectively. The data were analyzed using one-way ANOVA, Shapiro-Wilk, and Tukey's tests ( P glass ionomer containing nanoparticles was not significantly different from the control group ( P > 0.05). The surface hardness of the glass ionomer containing nanospherical or nanoflower ZnO was significantly lower than the control group ( P glass ionomer containing nanorod ZnO was not significantly different from the control group ( P = 0.868). Incorporation of nanospherical and nanoflower ZnO to glass ionomer decreased their surface hardness, without any changes on their flexural strength. Incorporation of nanorod ZnO particles caused no effect on the mechanical properties.

  4. An outbreak of chickenpox in an asylum seeker centre in Italy: outbreak investigation and validity of reported chickenpox history, December 2015-May 2016.

    Science.gov (United States)

    Vairo, Francesco; Di Bari, Virginia; Panella, Vincenzo; Quintavalle, Giuseppe; Torchia, Saul; Serra, Maria Cristina; Sinopoli, Maria Teresa; Lopalco, Maurizio; Ceccarelli, Giancarlo; Ferraro, Federica; Valle, Sabrina; Bordi, Licia; Capobianchi, Maria Rosaria; Puro, Vincenzo; Scognamiglio, Paola; Ippolito, Giuseppe

    2017-11-01

    An outbreak of chickenpox occurred between December 2015 and May 2016 among asylum seekers in a reception centre in Latium, Italy. We describe the epidemiological and laboratory investigations, control measures and validity of reported history of chickenpox infection. Serological screening of all residents and incoming asylum seekers was performed, followed by vaccine offer to all susceptible individuals without contraindication. Forty-six cases were found and 41 were associated with the outbreak. No complications, hospitalisations or deaths occurred. Serological testing was performed in 1,278 individuals and 169 were found to be susceptible, with a seroprevalence of 86.8%. A questionnaire was administered to 336 individuals consecutively attending the CARA health post to collect their serological result. The sensitivity, specificity and the positive and negative predictive value (PPV and NPV) of the reported history of chickenpox were 45.0%, 76.1%, 88.3% and 25.6%, respectively. We observed an increasing trend for the PPV and decreasing trend for the NPV with increasing age. Our report confirms that, in the asylum seeker population, chickenpox history is not the optimal method to identify susceptible individuals. Our experience supports the need for additional prevention and control measures and highlights the importance of national and local surveillance systems for reception centres.

  5. Penggunaan Limbah Hasil Pembakaran Batu Bara dan Sugar Cane Bagasse Ash (SCBA pada Paving Geopolimer dengan Proses Steam Curing

    Directory of Open Access Journals (Sweden)

    Dimas Setiyo Nugroho

    2015-12-01

    Full Text Available Bottom ash merupakan limbah sisa pembakaran batu bara disamping fly ash yang saat ini tidak banyak dimanfaatkan. Di dalam penelitian ini bahan dasar yang digunakan adalah bottom ash dan larutan alkali sebagai pengikat untuk membuat bahan dasar paving geopolimer. Abu batu digunakan sebagai filler. Selain itu bahan lain yang digunakan adalah SCBA (Sugar Cane Bagasse Ash / abu ampas tebu untuk menambah sumber silika aktif pada bottom ash. Sebelum digunakan SCBA dikalsinasi pada suhu 850oC selama 7 jam. Dalam penelitian ini, benda uji yang digunakan adalah paving berukuran 20cm x 10cm x 8cm. Selain itu dibuat variasi pembakaran SCBA antara lain 450oC selama 6 jam; 600oC selama 3 jam; dan 850oC selama 3 jam sebagai pembanding. Paving yang terbuat dari fly ash dari PT. Petrokimia digunakan sebagai pembanding terhadap bottom ash. Seluruh paving dicetak dengan menggunakan alat pres manual di laboratorium. Didapat hasil bahwa semakin banyak berat SCBA dalam campuran, akan menurunkan kualitas paving. Kuat tekan maksimum terdapat pada variasi 0% SCBA pada umur 28 hari dengan kuat tekan rata-rata sebesar 9.65 MPa, resapan air sebesar 8.68%, dan ketahanan aus sebesar 0.61 mm/menit. Disimpulkan bahwa, perawatan steam tidak memberikan hasil yang lebih baik dibandingkan paving geopolimer yang tidak di-steam.

  6. Treatment of Enterococcal Peritonitis in Peritoneal Dialysis Patients by Oral Amoxicillin or Intra-Peritoneal Vancomcyin: a Retrospective Study

    Directory of Open Access Journals (Sweden)

    Cheuk Chun Szeto

    2017-10-01

    Full Text Available Background/Aims: Enterococcal peritonitis in peritoneal dialysis (PD patients is associated with a high complication rate. The optimal treatment regimen of PD-related enterococcal peritonitis is controversial. The latest international guideline recommends intra-peritoneal (IP vancomycin. Although ampicillin is often effective for systemic enterococcal infections, they have little in vitro activity when added to common PD solutions. Since oral amoxicillin achieves therapeutic drug level in the peritoneal cavity, we explore the efficacy of oral amoxicillin for enterococcal peritonitis. Methods: We studied 105 episodes of enterococcal peritonitis over 20 years in our unit; 43 (41.0% were treated with oral amoxicillin, and 62 (59.0% with IP vancomycin. Their clinical outcome was reviewed. Result: The overall primary response rate to oral amoxicillin and IP vancomycin was 76.4% and 85.5%, respectively (p = 0.3. The complete cure rate of oral amoxicillin and IP vancomycin was 55.8% and 54.8%, respectively (p = 0.8. When the 5 episodes of ampicillin-resistant Enterococcus episodes were excluded, the primary response rate and complete cure rate of oral amoxicillin were 86.8% and 63.2%, respectively. Conclusion: Oral amoxicillin has an excellent primary response rate and complete cure rate for PD-related peritonitis episodes caused by Enterococcus species, indicating that oral amoxicillin is a valid and convenient therapeutic option for enterococcal peritonitis episodes.

  7. Assessment of exposure to radio frequency electromagnetic fields from smart utility meters in GB; part II) numerical assessment of induced SAR within the human body.

    Science.gov (United States)

    Qureshi, Muhammad R A; Alfadhl, Yasir; Chen, Xiaodong; Peyman, Azadeh; Maslanyj, Myron; Mann, Simon

    2018-04-01

    Human body exposure to radiofrequency electromagnetic waves emitted from smart meters was assessed using various exposure configurations. Specific energy absorption rate distributions were determined using three anatomically realistic human models. Each model was assigned with age- and frequency-dependent dielectric properties representing a collection of age groups. Generalized exposure conditions involving standing and sleeping postures were assessed for a home area network operating at 868 and 2,450 MHz. The smart meter antenna was fed with 1 W power input which is an overestimation of what real devices typically emit (15 mW max limit). The highest observed whole body specific energy absorption rate value was 1.87 mW kg -1 , within the child model at a distance of 15 cm from a 2,450 MHz device. The higher values were attributed to differences in dimension and dielectric properties within the model. Specific absorption rate (SAR) values were also estimated based on power density levels derived from electric field strength measurements made at various distances from smart meter devices. All the calculated SAR values were found to be very small in comparison to International Commission on Non-Ionizing Radiation Protection limits for public exposure. Bioelectromagnetics. 39:200-216, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  8. Physicians' Attitudes Towards the Advice of a Guideline-Based Decision Support System: A Case Study With OncoDoc2 in the Management of Breast Cancer Patients.

    Science.gov (United States)

    Bouaud, Jacques; Spano, Jean-Philippe; Lefranc, Jean-Pierre; Cojean-Zelek, Isabelle; Blaszka-Jaulerry, Brigitte; Zelek, Laurent; Durieux, Axel; Tournigand, Christophe; Rousseau, Alexandra; Vandenbussche, Pierre-Yves; Séroussi, Brigitte

    2015-01-01

    When wrongly used, guideline-based clinical decision support systems (CDSSs) may generate inappropriate propositions that do not match the recommendations provided by clinical practice guidelines (CPGs). The user may decide to comply with or react to the CDSS, and her decision may finally comply or not with CPGs. OncoDoc2 is a guideline-based CDSS for breast cancer management. We collected 394 decisions made by multidisciplinary meeting physicians in three hospitals where the CDSS was evaluated. We observed a global CPG compliance of 86.8% and a global CDSS compliance of 75.4%. Non-CPG compliance was observed in case of a negative reactance to the CDSS, when users did not follow a correct CDSS proposition (8.6% of decisions). Because of errors in patient data entry, OncoDoc2 delivered non-recommended propositions in 21.3% of decisions, leading to compliances with CDSS and CPGs of respectively 21.4% and 65.5%, whereas both compliances exceeded 90% when CDSS advices included CPG recommendations. Automation bias, when users followed an incorrect CDSS proposition explained the remaining non-compliance with CPGs (4.6% of decisions). Securing the use of CDSSs is of major importance to warranty patient safety and benefit of their potential to improve care.

  9. Collecting wrappers, labels, and packages to enhance accuracy of food records among children 2-8 years in the Pacific region: Children's Healthy Living Program (CHL).

    Science.gov (United States)

    Yonemori, Kim M; Ennis, Tui; Novotny, Rachel; Fialkowski, Marie K; Ettienne, Reynolette; Wilkens, Lynne R; Leon Guerrero, Rachael T; Bersamin, Andrea; Coleman, Patricia; Li, Fenfang; Boushey, Carol J

    2017-12-01

    The aim was to describe differences in dietary outcomes based on the provision of food wrappers, labels or packages (WLP) to complement data from dietary records (DR) among children from the US Affiliated Pacific. The WLP were intended to aid food coding. Since WLP can be associated with ultra-processed foods, one might expect differences in sodium, sugar, and other added ingredients to emerge. Dietary intakes of children (2-8 y) in Alaska, Hawai'i, Commonwealth of the Northern Mariana Islands, and Guam were collected using parent/caregiver completed 2-day DR. Parents were encouraged to collect WLP associated with the child's intake. Trained staff entered data from the DRs including the WLP when available using PacTrac3, a web application. Of the 1,868 DRs collected and entered at the time of this report, 498 (27%) included WLP. After adjusting for confounders (sex, age, location, education, food assistance), the DRs with WLP had significantly higher amounts of energy (kcal), total fat, saturated fat, added sugar, and sodium. These results suggest the inclusion of WLP enhanced the dietary intake data. The intake of energy, fat, added sugar and sodium derived from processed foods and foods consumed outside the home was better captured in children who had WLP.

  10. Osteoporosis: knowledge and practices among females of reproductive age group

    International Nuclear Information System (INIS)

    Idrees, Z.; Zakir, U.; Khushdil, A.; Shehzadi, H.

    2017-01-01

    To assess the knowledge of osteoporosis and evaluation of the practice of osteoporosis preventive measures, among females of reproductive age group. Methodology: A cross-sectional questionnaire based study was undertaken from September 2015 to February 2016 on 174 females (age range 15-49 years) from Military Hospital and Combined Military Hospital, Rawalpindi, Pakistan through non- probability convenient sampling. Females with any metabolic, muscular or diagnosed bone disease were excluded from the study. The self -administered questionnaire consisted of questions regarding basic demographics, knowledge and practice of preventive factors related to osteoporosis. Result: Majority (86.8%) females knew about osteoporosis. 80% considered major risk factor to be low calcium intake. Regarding practices, 44.3% of women practiced daily intake of milk in their diet, 69.5 % females practiced physical activity like walking on daily basis and 65.5% have direct exposure of sunlight but only 12.1% of women used calcium supplements. Conclusion: The study revealed that majority of the women knew about osteoporosis and its risk factors but many of them were not practicing appropriate lifestyle and dietary habits to decrease their risk of osteoporosis. Thus, there is a need of standardized approach to promote healthy behaviors to decrease the risk of osteoporosis before menopause. (author)

  11. Thrombus length discrepancy on dual-phase CT can predict clinical outcome in acute ischemic stroke

    International Nuclear Information System (INIS)

    Park, Mina; Kim, Kyung-eun; Lee, Seung-Koo; Shin, Na-Young; Lim, Soo Mee; Song, Dongbeom; Heo, Ji Hoe; Kim, Jin Woo; Oh, Se Won

    2016-01-01

    The thrombus length may be overestimated on early arterial computed tomography angiography (CTA) depending on the collateral status. We evaluated the value of a grading system based on the thrombus length discrepancy on dual-phase CT in outcome prediction. Forty-eight acute ischemic stroke patients with M1 occlusion were included. Dual-phase CT protocol encompassed non-contrast enhanced CT, CTA with a bolus tracking technique, and delayed contrast enhanced CT (CECT) performed 40s after contrast injection. The thrombus length discrepancy between CTA and CECT was graded by using a three-point scale: G0 = no difference; G1 = no difference in thrombus length, but in attenuation distal to thrombus; G2 = difference in thrombus length. Univariate and multivariate analyses were performed to define independent predictors of poor clinical outcome at 3 months. The thrombus discrepancy grade showed significant linear relationships with both the collateral status (P = 0.008) and the presence of antegrade flow on DSA (P = 0.010) with good interobserver agreement (κ = 0.868). In a multivariate model, the presence of thrombus length discrepancy (G2) was an independent predictor of poor clinical outcome [odds ratio = 11.474 (1.350-97.547); P =0.025]. The presence of thrombus length discrepancy on dual-phase CT may be a useful predictor of unfavourable clinical outcome in acute M1 occlusion patients. (orig.)

  12. Mediastinal Gray Zone Lymphoma: A Wider Category Than We Think?

    Science.gov (United States)

    Verma, Anuj; Shet, Tanuja; Epari, Sridhar; Gupta, Manjudevi; Gujral, Sumeet; Khanna, Nehal; Laskar, Siddhartha; Sengar, Manju; Arora, Brijesh; Menon, Hari; Banavali, Shripad

    2016-08-01

    To identify aggressively behaving classical Hodgkin lymphoma (CHL) of mediastinum and primary mediastinal B-cell lymphoma (PMBCL) and to classify them as mediastinal gray zone lymphoma(MGZL) and to define a minimum immunopanel for the diagnosis of MGZL. Ninety-two mediastinal B-cell lymphomas were reviewed with a wide immunopanel and were classified as CHL, PMBCL, or MGZL. CHL with an expression of 3 or 4 transcription factors performed worse, and hence the CHL with ≥3 transcription factors were classified as MGZL-CHL. In PMBCL, the cases with a weak or negative CD20 and positive CD15 as well as those cases showing cyclin E positivity with a negative or focal LCA and any one of the transcription factors were classified as MGZL-PMBCL. The MGZL cases expanded from 9 to 28 cases after using an extended immunopanel. CHL and PMBCL had a disease-free survival rate of 86.8% and 69.2% and an overall survival rate of 97.4% and 80.8%, respectively. MGZL-CHL and MGZL-PMBCL had a disease-free survival rate of 33% and 40% and an overall survival rate of 66.7% and 60%, respectively. Thus, the MGZL may be a wider category than we think and hence the use of a wide immunopanel is recommended to identify the aggressively behaving mediastinal B-cell lymphomas. © The Author(s) 2016.

  13. Detection of greenhouse gas precursors from diesel engines using electrochemical and photoacoustic sensors.

    Science.gov (United States)

    Mothé, Geórgia; Castro, Maria; Sthel, Marcelo; Lima, Guilherme; Brasil, Laisa; Campos, Layse; Rocha, Aline; Vargas, Helion

    2010-01-01

    Atmospheric pollution is one of the worst threats to modern society. The consequences derived from different forms of atmospheric pollution vary from the local to the global scale, with deep impacts on climate, environment and human health. Several gaseous pollutants, even when present in trace concentrations, play a fundamental role in important processes that occur in atmosphere. Phenomena such as global warming, photochemical smog formation, acid rain and the depletion of the stratospheric ozone layer are strongly related to the increased concentration of certain gaseous species in the atmosphere. The transport sector significantly produces atmospheric pollution, mainly when diesel oil is used as fuel. Therefore, new methodologies based on selective and sensitive gas detection schemes must be developed in order to detect and monitor pollutant gases from this source. In this work, CO(2) Laser Photoacoustic Spectroscopy was used to evaluate ethylene emissions and electrochemical analyzers were used to evaluate the emissions of CO, NO(x) and SO(2) from the exhaust of diesel powered vehicles (rural diesel with 5% of biodiesel, in this paper called only diesel) at different engine rotation speeds. Concentrations in the range 6 to 45 ppmV for ethylene, 109 to 1,231 ppmV for carbon monoxide, 75 to 868 ppmV for nitrogen oxides and 3 to 354 ppmV for sulfur dioxide were obtained. The results indicate that the detection techniques used were sufficiently selective and sensitive to detect the gaseous species mentioned above in the ppmV range.

  14. Tensile strength of a weave tendon suture using tendons of different sizes.

    Science.gov (United States)

    Mazurek, Tomasz; Strankowski, Michał; Ceynowa, Marcin; Rocławski, Marek

    2011-05-01

    This study compared the maximum load, stress, elongation at failure and the mode of failure of three kinds of tendons most frequently used for tendon grafting and tendon transfers, using the Pulvertaft weave suture. Sixty tendons were used from fresh human cadaver upper and lower extremities. The performed repairs included: 9 specimens of flexor digitorum superficialis or profundus tendon with flexor digitorum superficialis or profundus tendon (thick-thick suture), 10 specimens of flexor digitorum superficialis or profundus tendon with palmaris longus tendon (thick-medium thin suture), and 10 specimens of flexor digitorum superficialis or profundus tendon with plantaris tendon (thick-thin suture). Material testing machine was used to test repairs to failure. The mean maximum load at failure increased with the thickness of donor tendon. For the thick-thick specimen, the maximum load at failure was 125 newtons (N), for the thick-medium thin specimen it was 86,8N, and for the thick-thin it was 65,2N. These differences were all statistically significant. The active rehabilitation protocol is possible only with thick-thick connections used, the strength of the thick-medium thin connection is on the border of indications for the active rehabilitation protocol, and the thick-thin connection strength is sufficient only for the passive rehabilitation protocol. Copyright © 2010. Published by Elsevier Ltd.

  15. A novel NADPH-dependent aldehyde reductase gene from Vigna radiata confers resistance to the grapevine fungal toxin eutypine.

    Science.gov (United States)

    Guillén, P; Guis, M; Martínez-Reina, G; Colrat, S; Dalmayrac, S; Deswarte, C; Bouzayen, M; Roustan, J P; Fallot, J; Pech, J C; Latché, A

    1998-11-01

    Eutypine, 4-hydroxy-3-(3-methyl-3-butene-1-ynyl) benzyl aldehyde, is a toxin produced by Eutypa lata, the causal agent of eutypa dieback of grapevines. It has previously been demonstrated that tolerance of some cultivars to this disease was correlated with their capacity to convert eutypine to the corresponding alcohol, eutypinol, which lacks phytotoxicity. We have thus purified to homogeneity a protein from Vigna radiata that exhibited eutypine-reducing activity and have isolated the corresponding cDNA. This encodes an NADPH-dependent reductase of 36 kDa that we have named Vigna radiata eutypine-reducing enzyme (VR-ERE), based on the capacity of a recombinant form of the protein to reduce eutypine into eutypinol. The strongest homologies (86.8%) of VR-ERE at the amino acid level were found with CPRD14, a drought-inducible gene of unknown function, isolated from Vigna unguiculata and with an aromatic alcohol dehydrogenase (71.7%) from Eucalyptus gunnii. Biochemical characterization of VR-ERE revealed that a variety of compounds containing an aldehyde group can act as substrates. However, the highest affinity was observed with 3-substituted benzaldehydes. Expression of a VR-ERE transgene in Vitis vinifera cells cultured in vitro conferred resistance to the toxin. This discovery opens up new biotechnological approaches for the generation of grapevines resistant to eutypa dieback.

  16. Thermal SiO as a probe of high velocity motions in regions of star formation

    International Nuclear Information System (INIS)

    Downes, D.; Genzel, R.; Hjalmarson, A.; Nyman, L.A.; Roennaeng, B.

    1982-01-01

    New observations of the v = 0, J = = 2→1 line of SiO at 86.8 GHz show a close association of the thermal SiO emission and infrared and maser sources in regions of star formation. In addition to SiO emission with low velocity dispersion (Δν -1 ), we report the first detection of high velocity (''plateau'') emission toward W49 and W51. The low velocity SiO component may come from the core of the molecular cloud which contains the infrared and maser sources. The ''plateau'' may indicate mass clusters. In Orion KL, the positional centroid of the high velocity SiO emission (Vertical BarΔνVertical Bar> or =20 km s -1 ) is near that of the component we identify as the ''18 km s -1 flow''. However, the centriods of the blue- and redshifted wings are displaced from each other by a few arcseconds, to the NW and NE of the position of the 18 km s -1 component. The mass-loss rates of the high velocity flow and the 18 km s -1 flow are similar

  17. Species-Level Differences in Hyperspectral Metrics among Tropical Rainforest Trees as Determined by a Tree-Based Classifier

    Directory of Open Access Journals (Sweden)

    Dar A. Roberts

    2012-06-01

    Full Text Available This study explores a method to classify seven tropical rainforest tree species from full-range (400–2,500 nm hyperspectral data acquired at tissue (leaf and bark, pixel and crown scales using laboratory and airborne sensors. Metrics that respond to vegetation chemistry and structure were derived using narrowband indices, derivative- and absorption-based techniques, and spectral mixture analysis. We then used the Random Forests tree-based classifier to discriminate species with minimally-correlated, importance-ranked metrics. At all scales, best overall accuracies were achieved with metrics derived from all four techniques and that targeted chemical and structural properties across the visible to shortwave infrared spectrum (400–2500 nm. For tissue spectra, overall accuracies were 86.8% for leaves, 74.2% for bark, and 84.9% for leaves plus bark. Variation in tissue metrics was best explained by an axis of red absorption related to photosynthetic leaves and an axis distinguishing bark water and other chemical absorption features. Overall accuracies for individual tree crowns were 71.5% for pixel spectra, 70.6% crown-mean spectra, and 87.4% for a pixel-majority technique. At pixel and crown scales, tree structure and phenology at the time of image acquisition were important factors that determined species spectral separability.

  18. Anti-phytopathogen potential of endophytic actinobacteria isolated from tomato plants (Lycopersicon esculentum) in southern Brazil, and characterization of Streptomyces sp. R18(6), a potential biocontrol agent.

    Science.gov (United States)

    de Oliveira, Margaroni Fialho; da Silva, Mariana Germano; Van Der Sand, Sueli T

    2010-09-01

    Tomato plants (Lycopersicon esculentum) are highly susceptible to phytopathogen attack. The resulting intensive application of pesticides on tomato crops can affect the environment and health of humans and animals. The objective of this study was to select potential biocontrol agents among actinobacteria from tomato plants, in a search for alternative phytopathogen control. We evaluated 70 endophytic actinobacteria isolated from tomato plants in southern Brazil, testing their antimicrobial activity, siderophore production, indoleacetic acid production, and phosphate solubility. The actinomycete isolate with the highest antimicrobial potential was selected using the agar-well diffusion method, in order to optimize conditions for the production of compounds with antimicrobial activity. For this study, six growth media (starch casein-SC, ISP2, Bennett's, Sahin, Czapek-Dox, and TSB), three temperatures (25 degrees C, 30 degrees C, and 35 degrees C) and different pH were tested. Of the actinobacteria tested, 88.6% showed antimicrobial activity against at least one phytopathogen, 72.1% showed a positive reaction for indoleacetic acid production, 86.8% produced siderophores and 16.2% showed a positive reaction for phosphate solubility. Isolate R18(6) was selected due to its antagonistic activity against all phytopathogenic microorganisms tested in this study. The best conditions for production were observed in the SC medium, at 30 degrees C and pH 7.0. The isolate R18(6) showed close biochemical and genetic similarity to Streptomyces pluricolorescens. Copyright 2010 Elsevier Masson SAS. All rights reserved.

  19. Hydrogen sorption and permeability of compacted LiBH4 nanoconfined into activated carbon nanofibers impregnated with TiO2

    Science.gov (United States)

    Sitthiwet, Chongsutthamani; Thiangviriya, Sophida; Thaweelap, Natthaporn; Meethom, Sukanya; Kaewsuwan, Dechmongkhon; Chanlek, Narong; Utke, Rapee

    2017-11-01

    Activated carbon nanofibers impregnated with titanium (IV) oxide (TiO2), denoted as ACNF-Ti are prepared by carbonization and activation of electrospun nanofibers of polyacrylonitrile (PAN)-titanium (IV) isopropoxide composite. Pristine LiBH4 and nanoconfined LiBH4 in ACNF-Ti, denoted as LiBH4-ACNF-Ti are compacted under the pressures of 434 and 868 MPa. Dehydrogenation temperature of compacted LiBH4 increases (up to 485 °C) with compaction pressure due to poor hydrogen permeability. In the case of compacted LiBH4-ACNF-Ti, major dehydrogenation temperature at 352-359 °C and hydrogen content liberated (74-76% of theoretical capacity) are obtained despite enhanced compaction pressure. Mechanical stability during cycling of compacted LiBH4-ACNF-Ti is achieved. Although hydrogen permeability of compacted LiBH4-ACNF-Ti improves with enhanced compaction pressure, detrimental kinetics and reversibility are detected. Since the fibrous structure of ACNF-Ti are brittle, the broken and/or shorten fibers are observed after compaction under high pressure. The latter results in not only inferior nanoconfinement of LiBH4 into ACNF-Ti, but also agglomeration of hydride materials upon cycling.

  20. Analisis kesehatan di Kota Mataram tahun 2011: suatu penerapan Bryant method

    Directory of Open Access Journals (Sweden)

    Aini Khulaila

    2014-02-01

    Full Text Available The budget for health program of Mataram City is only allocated IDR 39,868,095,387 or 3.9% of the total annual city budget. It is lower than minimum 5% proportion as required by the government regulation. This study involved assessing the priority areas in health according to implicated stakeholders from the department of health (head of communicable diseases control, family health, living environments, immunisations and surveillence staff. Data was collected through the months of January-July 2012 through self administered questionnaire using the Bryant Method. Secondary data (census, economic, socio-cultural and health records as well as population income levels was obtained through government records. Data was analysed and interpreted in order to gain insight into perceived priority areas. Cross checking of respondent input was conducted to validate data. Results indicated that the priority health issues are: dengue fever, HIV/AIDS, TB, respiratory infections, hypertension, diarrhea and traffic accidents. Obstacles experienced during fieldwork included time restraints from respondents and inconsistencies within secondary data. The absent of the key persons in several discussions and unavailability of written data and reports are the main challenges during investigation. Improving the quality of program data findings and taking the beneficiary of the data source are suggested. Future recommendations include further more qualitative research into the issue, increased collaboration and cooperation between implicated stakeholders as well as more conscientious keeping of public records.

  1. The Effect of Language Learning Strategies on Proficiency, Attitudes and School Achievement.

    Science.gov (United States)

    Habók, Anita; Magyar, Andrea

    2017-01-01

    This study examines language learning strategy (LLS) use in connexion with foreign language attitude, proficiency and general school achievement among lower secondary students in Years 5 and 8 ( n = 868) in Hungary. An adapted version of the Strategies Inventory for Language Learning questionnaire was used for data collection. The results showed that Hungarian students mainly engage in metacognitive strategies in both years. Differences between more and less proficient language learners' strategy use have also been found. With regard to the effect of LLS on foreign language attitude, the foreign language mark and school achievement, path analysis indicated a good fit in both years. The metacognitive, social and memory strategies primarily influenced foreign language attitudes and marks in Year 5. The metacognitive strategies had a slight impact on school achievement as well as on foreign language marks. We demonstrated the dominant effect of metacognitive strategies and the low effect of memory strategies in Year 8. In addition, metacognitive strategies also influenced foreign language marks. The effect of foreign language marks on school achievement was also remarkable. There was a strong impact on the children's attitudes through these variables.

  2. The Effect of Language Learning Strategies on Proficiency, Attitudes and School Achievement

    Directory of Open Access Journals (Sweden)

    Anita Habók

    2018-01-01

    Full Text Available This study examines language learning strategy (LLS use in connexion with foreign language attitude, proficiency and general school achievement among lower secondary students in Years 5 and 8 (n = 868 in Hungary. An adapted version of the Strategies Inventory for Language Learning questionnaire was used for data collection. The results showed that Hungarian students mainly engage in metacognitive strategies in both years. Differences between more and less proficient language learners’ strategy use have also been found. With regard to the effect of LLS on foreign language attitude, the foreign language mark and school achievement, path analysis indicated a good fit in both years. The metacognitive, social and memory strategies primarily influenced foreign language attitudes and marks in Year 5. The metacognitive strategies had a slight impact on school achievement as well as on foreign language marks. We demonstrated the dominant effect of metacognitive strategies and the low effect of memory strategies in Year 8. In addition, metacognitive strategies also influenced foreign language marks. The effect of foreign language marks on school achievement was also remarkable. There was a strong impact on the children’s attitudes through these variables.

  3. On the frequency of thyroid diseases in outpatients in an ENT clinic.

    Science.gov (United States)

    Morinaka, S

    1995-01-01

    The prevalence of thyroid diseases was studied in the ENT department of Kobe Teishin Hospital. Between January 1990 and June 1994, 6,348 outpatients (3,004 women and 3,344 men) visited the ENT department with problems of ear, nose, and throat. Among them 114 patients (82 women and 32 men) were revealed to have thyroid diseases (1.8%). The prevalence of thyroid diseases increased in patients over the age of 40 (4.6% for 40-80 year aged women, 1.6% for 40-80 year aged men). The male/female ratio was about 1:2.7. There was no subjective symptom in 86.8% of the patients. The prevalence of Hashimoto's thyroiditis was 53.5%, nontoxic diffuse goiter 16.7%, cyst(s) 8.8%, adenoma 7.0%, nontoxic nodular goiter 4.4%, subacute thyroiditis or acute exacerbation of Hashimoto's thyroiditis 4.4%, Graves' disease 1.8%, thyroid carcinoma 1.8%, adenomatous goiter 0.8%, and primary hypothyroidism 0.8%. Visible goiter was observed in only 5 patients and 93% of the patients had palpable but not visible thyroids. Therefore, it is important to palpate the thyroid gland during examination of the neck not only in women but also in men. Hashimoto's thyroiditis is thought to be increasing in frequency and is becoming a more important disease in the ENT clinic.

  4. Study on the diagnostic value of combined determination of serum CA125, CA199 and SIL-2R levels in patients with endometriosis

    International Nuclear Information System (INIS)

    Yang Jingxiu; Shi Shaohong; Wang Yuping; Xie Xueqin; Qin Jibao

    2005-01-01

    Objective: To investigate the diagnostic values of combined determination of serum CA125, CA199 and SIL-2R levels in patients with endometriosis. Methods: Serum CA125, CA199 were measured with RIA and SIL-2R levels with ELISA in 54 patients with endometriosis and 35 controls. Results: The serum levels of CA125, CA199 and SIL-2R in patients with endometriosis were significantly higher than those in controls (P<0.01). The sensitivity and speciality of CA125 for endometriosis was 70.2% and 80.4% respectively, the sensitivity and speciality of CA199 for endometriosis was 62.4% and 71.8% respectively, the sensitivity and speciality of SIL-2R was 89.5% and 60.2% respectively. The sensitivity of the combined determination of CA125, CA199 and SIL-2R for endometriosis was 86.8% being significantly higher than that of CA125 and CA199 respectively. Conclusion: Combined determination of the serum CA125, CA199 and SIL-2R levels in serum can increase the diagnostic sensitivity for endometriosis. (authors)

  5. The Effects of Evolution Education: Examining Attitudes toward and Knowledge of Evolution in College Courses

    Directory of Open Access Journals (Sweden)

    Stephen D. Short

    2015-01-01

    Full Text Available The present study examined changes in university students' attitudes toward and knowledge of evolution measured by the previously validated Evolutionary Attitudes and Literacy Survey (EALS in response to curricular content. Specifically, student responses on the survey were compared across an evolutionary psychology course, an introductory biology course with significant evolutionary content, and a political science course with no evolutionary content. To this end, 868 students were assessed at a large Midwestern U.S. university prior to and following completion of one of the three courses. A multiple group repeated measures confirmatory factor analysis (CFA was conducted to examine latent mean differences in self-reported Evolution Knowledge/Relevance, Creationist Reasoning, Evolutionary Misconceptions, and Exposure to Evolution. A significant and notable increase in Knowledge/Relevance, as well as decreases in Creationist Reasoning and Evolutionary Misconceptions, was observed for the evolutionary psychology course, whereas the biology course demonstrated no change in Knowledge/Relevance and a significant increase in Evolutionary Misconceptions. The implications of these findings for evolution education are discussed.

  6. Comparison of reverse-transcription real-time PCR and immunohistochemistry for the detection of canine distemper virus infection in raccoons in Ontario, Canada.

    Science.gov (United States)

    Nemeth, Nicole M; Oesterle, Paul T; Campbell, G Douglas; Ojkic, Davor; Jardine, Claire M

    2018-03-01

    Canine distemper virus (CDV) is a widespread morbillivirus that causes subclinical to fatal infections in domestic and wild carnivores. Raccoons ( Procyon lotor) are CDV reservoirs and suffer from associated disease. Aspects of pathogenesis may lead to difficulty in the interpretation of commonly used testing modalities, such as reverse-transcription real-time (RT-rt)PCR and immunohistochemistry (IHC). The reliance upon such tests is greater for wildlife, which are often submitted as carcasses with no clinical history. We compared CDV RT-rtPCR results to immunohistochemistry (the gold standard) in tissues from 74 raccoons. These tests had high kappa agreement (lymph node: 0.9335; lung: 0.8671) and a negative correlation between IHC score and threshold cycle (Ct) value for lymph node and lung (Spearman rank correlation coefficient [ r s ] = -0.8555 and -0.8179, respectively; p < 0.00001). An RT-rtPCR Ct value of 30 in lung and lymph node with sensitivity and specificity of 92.3 and 92.6% and 86.8 and 96.4%, respectively, was suitable for determining CDV involvement. Conjunctival swabs provide an alternative for distemper diagnosis, as there was a strong correlation between Ct values of conjunctival swabs and tissues ( r s = -0.8498, p < 0.00001, n = 46). This information will aid in more efficient and accurate diagnoses in individuals, small-scale outbreaks, and epidemiologic investigations in wildlife.

  7. Application of Transtheoretical Model to Exercise in Office Staff.

    Science.gov (United States)

    Mahmoodabab, Saied Saeed Mazloomy; Mohammadi, Maryam; Abad, Mohammad Ali Morowati Sharif

    2013-01-01

    Transtheoretical model is identified as a comprehensive model for behavior exercise. The aim of this study was to check the situation of stage of change in exercise behavior of office personnel of Yazd city using transtheoretical model. In a cross-sectional study, 220 office personnel selected from administrative offices of Yazd through two-stage cluster-sampling method. The instrument for data collection was a questionnaire that included demographic variables and constructs of transtheoretical model. The reliability and validity of the instruments were examined and approved by experts. The data was analyzed using SPSS soft ware. 152 males (69.1%) and 68 females (30.9%) with an average age of 34±8.68 years were selected. Sixty percent of the subjects were in precontemplation and contemplation stages and only 7.3% were in action stages. Significant differences were found between TTM constructs and stages of change (P=0.000). The results also showed significant differences between components of decisional balance and behavioral process and cognitive process with the stages of change. We found that behavioral process of change and self efficacy were the most important variables for improving levels of exercise. Most of the participants were in the precontemplation and contemplation stages and most problems were related to behavioral process and self efficacy. Therefore, strategies and programs are needed to be taken into account to improve exercise among the staff.

  8. An outbreak of chickenpox in an asylum seeker centre in Italy: outbreak investigation and validity of reported chickenpox history, December 2015–May 2016

    Science.gov (United States)

    Vairo, Francesco; Di Bari, Virginia; Panella, Vincenzo; Quintavalle, Giuseppe; Torchia, Saul; Serra, Maria Cristina; Sinopoli, Maria Teresa; Lopalco, Maurizio; Ceccarelli, Giancarlo; Ferraro, Federica; Valle, Sabrina; Bordi, Licia; Capobianchi, Maria Rosaria; Puro, Vincenzo; Scognamiglio, Paola; Ippolito, Giuseppe

    2017-01-01

    An outbreak of chickenpox occurred between December 2015 and May 2016 among asylum seekers in a reception centre in Latium, Italy. We describe the epidemiological and laboratory investigations, control measures and validity of reported history of chickenpox infection. Serological screening of all residents and incoming asylum seekers was performed, followed by vaccine offer to all susceptible individuals without contraindication. Forty-six cases were found and 41 were associated with the outbreak. No complications, hospitalisations or deaths occurred. Serological testing was performed in 1,278 individuals and 169 were found to be susceptible, with a seroprevalence of 86.8%. A questionnaire was administered to 336 individuals consecutively attending the CARA health post to collect their serological result. The sensitivity, specificity and the positive and negative predictive value (PPV and NPV) of the reported history of chickenpox were 45.0%, 76.1%, 88.3% and 25.6%, respectively. We observed an increasing trend for the PPV and decreasing trend for the NPV with increasing age. Our report confirms that, in the asylum seeker population, chickenpox history is not the optimal method to identify susceptible individuals. Our experience supports the need for additional prevention and control measures and highlights the importance of national and local surveillance systems for reception centres. PMID:29162209

  9. The fragile X syndrome in a large family. II. Psychological investigations.

    Science.gov (United States)

    Veenema, H; Veenema, T; Geraedts, J P

    1987-01-01

    Intelligence levels and intelligence profiles were investigated in 52 members of a large family with the fragile X syndrome. The mental abilities were evaluated by the three Wechsler intelligence tests (WAIS, WISC-R, and WPPSI). Chromosomal and psychological data were then compared. In 22 non-retarded fra(X) negative family members, a mean IQ of 102 was found (males 97, females 106). Eleven non-retarded carrier females had IQs between 70 and 110 (mean 86.8), which is 20 points below the mean of normal women (alpha = 0.01). One non-retarded male with 6% fra(X) positive cells had an IQ of 98. His intelligence profile closely resembled the profile in the non-retarded female carriers. The highest IQ in the group of retarded males was 31. The mentally retarded females scored IQs between 26 and 41. In male and female patients verbal intelligence substantially exceeded performance abilities. There was a considerable gap between the highest IQ in the group of retarded females and the lowest IQ in the group of non-retarded carriers (41 and 71 respectively) and a considerable overlap was found between the IQ levels of the non-retarded carriers and normal women. PMID:3806640

  10. Impact of different cutoff criteria on rate of (central auditory processing disorders diagnosis using the central test battery

    Directory of Open Access Journals (Sweden)

    Mohsin Ahmed Shaikh

    2016-11-01

    Full Text Available The purpose of this study was to quantify how the use of two different cutoff criteria affects the test failure rate and potential diagnosis of central auditory processing disorder ([C]APD in a sample of children subjected to central auditory processing ([C]AP assessment. Test failure rates for the central test battery (CTB using two different cutoff criteria (1 and 2 SDs below the mean were measured retrospectively for 98 children who completed (CAP assessment. The rates of potential (CAPD diagnosis ranged from 86.8% [when a 1 standard deviation (SD cutoff was used] to 66.2% (when a 2 SD cutoff was used. The current use of two different cutoffs for the CTB has a large impact on the diagnostic rate for (CAPD. These findings have clinical implications for the diagnosis of (CAPD due to the widespread use of the CTB in the United States for the assessment of (CAPD in children. Thus, it is important to create awareness among audiologists that use of the 2 SDs cutoff criterion is recommended for reducing false positives (error.

  11. Prevalence of enteric protozoa in human immunodeficiency virus (HIV)-positive and HIV-negative men who have sex with men from Sydney, Australia.

    Science.gov (United States)

    Stark, Damien; Fotedar, Rashmi; van Hal, Sebastian; Beebe, Nigel; Marriott, Deborah; Ellis, John T; Harkness, John

    2007-03-01

    A prospective, comparative study of the prevalence of enteric protozoa was determined among human immunodeficiency virus (HIV)- positive and HIV-negative men who have sex with men (MSM) in Sydney, Australia. A total of 1,868 patients submitted stool specimens; 1,246 were from MSM (628 HIV positive and 618 HIV positive) and 622 from non-MSM were examined over a 36-month period. A total of 651 (52.2%) stool specimens from MSM were positive for protozoa compared with 85 (13%) from non-MSM. There was a significant difference in the prevalence of Blastocystis hominis, Endolimax nana, Entamoeba histolytica/dispar complex, Entamoeba hartmanni, Iodamoeba butschlii, and Enteromonas hominis detected between MSM and non-MSM (P<0.001). The only notable difference between HIV-negative and HIV-positive MSM was that HIV-infected MSM were found to more likely have a Cryptosporidium parvum infection. Entamoeba histolytica was found in 3 patients, E. dispar in 25, and E. moshkovskii in 17, all of whom were MSM. When compared with a control group, MSM were significantly more likely to harbor intestinal protozoa and have multiple parasites present. The results of this study show high rates of enteric parasites persist in MSM and highlight the importance of testing for intestinal parasites in MSM. This is the first report of E. moshkovskii from MSM.

  12. The Effect of Annealing on Nanothick Indium Tin Oxide Transparent Conductive Films for Touch Sensors

    Directory of Open Access Journals (Sweden)

    Shih-Hao Chan

    2015-01-01

    Full Text Available This study aims to discuss the sheet resistance of ultrathin indium tin oxide (ITO transparent conductive films during the postannealing treatment. The thickness of the ultrathin ITO films is 20 nm. They are prepared on B270 glass substrates at room temperature by a direct-current pulsed magnetron sputtering system. Ultrathin ITO films with high sheet resistance are commonly used for touch panel applications. As the annealing temperature is increased, the structure of the ultrathin ITO film changes from amorphous to polycrystalline. The crystalline of ultrathin ITO films becomes stronger with an increase of annealing temperature, which further leads to the effect of enhanced Hall mobility. A postannealing treatment in an atmosphere can enhance the optical transmittance owing to the filling of oxygen vacancies, but the sheet resistance rises sharply. However, a higher annealing temperature, above 250°C, results in a decrease in the sheet resistance of ultrathin ITO films, because more Sn ions become an effective dopant. An optimum sheet resistance of 336 Ω/sqr was obtained for ultrathin ITO films at 400°C with an average optical transmittance of 86.8% for touch sensor applications.

  13. Cooperative wireless network control based health and activity monitoring system.

    Science.gov (United States)

    Prakash, R; Ganesh, A Balaji; Girish, Siva V

    2016-10-01

    A real-time cooperative communication based wireless network is presented for monitoring health and activity of an end-user in their environment. The cooperative communication offers better energy consumption and also an opportunity to aware the current location of a user non-intrusively. The link between mobile sensor node and relay node is dynamically established by using Received Signal Strength Indicator (RSSI) and Link Quality Indicator (LQI) based on adaptive relay selection scheme. The study proposes a Linear Acceleration based Transmission Power Decision Control (LA-TPDC) algorithm to further enhance the energy efficiency of cooperative communication. Further, the occurrences of false alarms are carefully prevented by introducing three stages of sequential warning system. The real-time experiments are carried-out by using the nodes, namely mobile sensor node, relay nodes and a destination node which are indigenously developed by using a CC430 microcontroller integrated with an in-built transceiver at 868 MHz. The wireless node performance characteristics, such as energy consumption, Signal-Noise ratio (SNR), Bit Error Rate (BER), Packet Delivery Ratio (PDR) and transmission offset are evaluated for all the participated nodes. The experimental results observed that the proposed linear acceleration based transmission power decision control algorithm almost doubles the battery life time than energy efficient conventional cooperative communication.

  14. Análise da estrutura arbustivo-arbórea de uma área de cerrado sensu stricto, município de Aquidauana-Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Bruna Gardenal Fina

    2013-08-01

    Full Text Available Este trabalho teve como objetivo registrar a composição florística e estrutura de uma área de Cerrado stricto senso, com ênfase no estrato arbustivo-arbóreo. Foram instaladas 30 parcelas de 10 x 10 m, distribuídas em blocos de 10 parcelas contíguas, onde os indivíduos com PAP superior ou igual a 10 cm foram incluídos. O número total de indivíduos amostrados foi de 1.107, pertencentes a 33 famílias e 88 espécies, evidenciando-se alta riqueza. A área basal total e a densidade total foram, respectivamente, de 6,651 m² e 3.690 indivíduos por hectare. Os valores de diversidade (3.868 nats/indivíduo e equabilidade (0,86 indicaram grande heterogeneidade e baixa dominância ecológica. As espécies mais importantes foram Qualea grandiflora Mart., Lafoensia pacari St. Hil., Magonia pubescens St. Hil e Qualea parviflora Mart., que juntas representaram 57,7% do VI

  15. CROP COEFFICIENT, DRY MATTER PARTITION AND SEEDLINGS QUALITY OF Hymenaea courbaril L. IN CONTAINERS SIZES UNDER WATER DEFICIT IRRIGATION1

    Directory of Open Access Journals (Sweden)

    César Antônio da Silva

    2017-02-01

    Full Text Available ABSTRACT Native species seedlings are commonly used in the degraded areas reforestation, riparian forests and legal reserve. Among the factors that influence the seedlings quality, are the container size and the substrate water availability. Thus, the objective of this paper was to evaluate Hymenaea courbaril L. seedlings response in function of irrigation levels and container sizes. The experiment was carried out in greenhouse, in randomized blocks design, with three replications in split plots, in 2 x 5 scheme. Rigid pots of 3.1 L and stiff plastic tubes of 4.0 L were used in the plots, while irrigation levels equals to 20%, 40%, 60%, 80% and 100% of the maximum evapotranspiration (ETm were used in the subplots. The stiff plastic tube provided larger ETm and increased seedlings quality and, consequently, larger crop coefficient (Kc in comparison with rigid pot, in the phase from 80 to 200 days after the sowing (DAS. The Kc of the seedlings in citrovase varired from 0.54 to 1.12, of the planting at 200 DAS, according the Penman-Monteith methodology. Irrigation levels between ETm 86.8% and 100% propitiated larger seedlings quality index. To the 200 DAS, the roots dry matter was larger than the leaves dry matter, unlike the initial phases.

  16. Chemical Composition and Antioxidant Activity of Essential Oils from Cinnamodendron dinisii Schwacke and Siparuna guianensis Aublet.

    Science.gov (United States)

    Andrade, Milene Aparecida; das Graças Cardoso, Maria; de Andrade, Juliana; Silva, Lucilene Fernandes; Teixeira, Maria Luisa; Valério Resende, Juliana Maria; da Silva Figueiredo, Ana Cristina; Barroso, José Gonçalves

    2013-11-26

    The objectives of this study were to chemically characterize and evaluate the antioxidant activity of essential oils Cinnamodendron dinisii Schwacke (pepper) and Siparuna guianensis Aublet (negramina). The essential oil was isolated by hydrodistillation using a Clevenger modified apparatus, and the identification and quantification of constituents, through GC/MS and GC-FID analysis. The antioxidant activity was evaluated using β-carotene/linoleic acid system and the DPPH radical sequestering method. In chromatographic analysis, the majority constituents found in the essential oil of C. dinisii were bicyclic monoterpenes, α-pinene (35.41%), β-pinene (17.81%), sabinene (12.01%) and sesquiterpene bicyclogermacrene (7.59%). In the essential oil of the fresh leaves of Siparuna guianensis Aublet, acyclic monoterpene, β-myrcene (13.14%), and sesquiterpenes, germacrene-D (8.68%) and bicyclogermacrene (16.71%) were identified. The antioxidant activity was low by the β-carotene/linoleic acid test and was not evidenced by the DPPH test, for both oils evaluated.

  17. Chemical Composition and Antioxidant Activity of Essential Oils from Cinnamodendron dinisii Schwacke and Siparuna guianensis Aublet

    Directory of Open Access Journals (Sweden)

    Milene Aparecida Andrade

    2013-11-01

    Full Text Available The objectives of this study were to chemically characterize and evaluate the antioxidant activity of essential oils Cinnamodendron dinisii Schwacke (pepper and Siparuna guianensis Aublet (negramina. The essential oil was isolated by hydrodistillation using a Clevenger modified apparatus, and the identification and quantification of constituents, through GC/MS and GC-FID analysis. The antioxidant activity was evaluated using β-carotene/linoleic acid system and the DPPH radical sequestering method. In chromatographic analysis, the majority constituents found in the essential oil of C. dinisii were bicyclic monoterpenes, α-pinene (35.41%, β-pinene (17.81%, sabinene (12.01% and sesquiterpene bicyclogermacrene (7.59%. In the essential oil of the fresh leaves of Siparuna guianensis Aublet, acyclic monoterpene, β-myrcene (13.14%, and sesquiterpenes, germacrene-D (8.68% and bicyclogermacrene (16.71% were identified. The antioxidant activity was low by the β-carotene/linoleic acid test and was not evidenced by the DPPH test, for both oils evaluated.

  18. [Usefulness of assessment of voice capabilities in female patients with reflux-related dysphonia].

    Science.gov (United States)

    Siupsinskiene, Nora; Adamonis, Kestutis; Toohill, Robert J

    2009-01-01

    To analyze vocal capabilities in patients diagnosed with reflux related dysphonia versus controls with healthy voice with selection of the most informative discriminating quantitative parameters and to assess voice changes following treatment. Six parameters of voice range profile (VRP) and five parameters of speech range profile were taken and analyzed from 60 dysphonic outpatient females with laryngopharyngeal reflux (LPR) diagnosed by reflux-related atypical and typical symptoms, videolaryngoscopic findings, upper gastrointestinal endoscopy, and positive response to empiric 3-month omeprazole treatment. Seventy-six females with healthy voice served as controls. All six parameters of voice range profile and three of 5 parameters of speech range profile showed significant differences comparing LPR patients with controls before omeprazole treatment (Prange to be the most informative parameter for discrimination between reflux-related dysphonic and healthy voices (overall prediction accuracy, 86.8%). A threshold value of significant parameter was stated using the receiver operating characteristic curve. Treatment with omeprazole significantly improved voice quality showing the greatest changes in the mean scores of majority of voice range profile parameters. Vocal capabilities, especially evaluated by voice range profile, are restricted in LPR female patients in comparison to subjects with healthy voice. Quantitative voice assessment with voice range profile may add more objective aspect for screening dysphonia and could be used as a criterion of evaluation of treatment efficacy in such patients.

  19. Airborne demonstration of a quantum key distribution receiver payload

    Science.gov (United States)

    Pugh, Christopher J.; Kaiser, Sarah; Bourgoin, Jean-Philippe; Jin, Jeongwan; Sultana, Nigar; Agne, Sascha; Anisimova, Elena; Makarov, Vadim; Choi, Eric; Higgins, Brendon L.; Jennewein, Thomas

    2017-06-01

    Satellite-based quantum terminals are a feasible way to extend the reach of quantum communication protocols such as quantum key distribution (QKD) to the global scale. To that end, prior demonstrations have shown QKD transmissions from airborne platforms to receivers on ground, but none have shown QKD transmissions from ground to a moving aircraft, the latter scenario having simplicity and flexibility advantages for a hypothetical satellite. Here, we demonstrate QKD from a ground transmitter to a receiver prototype mounted on an airplane in flight. We have specifically designed our receiver prototype to consist of many components that are compatible with the environment and resource constraints of a satellite. Coupled with our relocatable ground station system, optical links with distances of 3-10 km were maintained and quantum signals transmitted while traversing angular rates similar to those observed of low-Earth-orbit satellites. For some passes of the aircraft over the ground station, links were established within 10 s of position data transmission, and with link times of a few minutes and received quantum bit error rates typically ≈3%-5% , we generated secure keys up to 868 kb in length. By successfully generating secure keys over several different pass configurations, we demonstrate the viability of technology that constitutes a quantum receiver satellite payload and provide a blueprint for future satellite missions to build upon.

  20. Kinesio Taping effects on knee extension force among soccer players

    Directory of Open Access Journals (Sweden)

    Maysa V. G. B. Serra

    2015-04-01

    Full Text Available Background : Kinesio Taping (KT is widely used, however the effects of KT on muscle activation and force are contradictory. Objective : To evaluate the effects of KT on knee extension force in soccer players. Method: This is a clinical trial study design. Thirty-four subjects performed two maximal isometric voluntary contractions of the lower limbs pre, immediately post, and 24 hours after tape application on the lower limbs. Both lower limbs were taped, using K-Tape and 3M Micropore tape randomly on the right and left thighs of the participants. Isometric knee extension force was measured for dominant side using a strain gauge. The following variables were assessed: peak force, time to peak force, rate of force development until peak force, time to peak rate of force development, and 200 ms pulse. Results : There were no statistically significant differences in the variables assessed between KT and Micropore conditions (F=0.645, p=0.666 or among testing sessions (pre, post, and 24h after (F=0.528, p=0.868, and there was no statistical significance (F=0.271, p=0.986 for interaction between tape conditions and testing session. Conclusion: KT did not affect the force-related measures assessed immediately and 24 hours after the KT application compared with Micropore application, during maximal isometric voluntary knee extension.

  1. Analysis of the Two-Regime Method on Square Meshes

    KAUST Repository

    Flegg, Mark B.

    2014-01-01

    The two-regime method (TRM) has been recently developed for optimizing stochastic reaction-diffusion simulations [M. Flegg, J. Chapman, and R. Erban, J. Roy. Soc. Interface, 9 (2012), pp. 859-868]. It is a multiscale (hybrid) algorithm which uses stochastic reaction-diffusion models with different levels of detail in different parts of the computational domain. The coupling condition on the interface between different modeling regimes of the TRM was previously derived for onedimensional models. In this paper, the TRM is generalized to higher dimensional reaction-diffusion systems. Coupling Brownian dynamics models with compartment-based models on regular (square) two-dimensional lattices is studied in detail. In this case, the interface between different modeling regimes contains either flat parts or right-angle corners. Both cases are studied in the paper. For flat interfaces, it is shown that the one-dimensional theory can be used along the line perpendicular to the TRM interface. In the direction tangential to the interface, two choices of the TRM parameters are presented. Their applicability depends on the compartment size and the time step used in the molecular-based regime. The two-dimensional generalization of the TRM is also discussed in the case of corners. © 2014 Society for Industrial and Applied Mathematics.

  2. ARHGEF9 mutations in epileptic encephalopathy/intellectual disability: toward understanding the mechanism underlying phenotypic variation.

    Science.gov (United States)

    Wang, Jing-Yang; Zhou, Peng; Wang, Jie; Tang, Bin; Su, Tao; Liu, Xiao-Rong; Li, Bing-Mei; Meng, Heng; Shi, Yi-Wu; Yi, Yong-Hong; He, Na; Liao, Wei-Ping

    2018-01-01

    ARHGEF9 resides on Xq11.1 and encodes collybistin, which is crucial in gephyrin clustering and GABA A receptor localization. ARHGEF9 mutations have been identified in patients with heterogeneous phenotypes, including epilepsy of variable severity and intellectual disability. However, the mechanism underlying phenotype variation is unknown. Using next-generation sequencing, we identified a novel mutation, c.868C > T/p.R290C, which co-segregated with epileptic encephalopathy, and validated its association with epileptic encephalopathy. Further analysis revealed that all ARHGEF9 mutations were associated with intellectual disability, suggesting its critical role in psychomotor development. Three missense mutations in the PH domain were not associated with epilepsy, suggesting that the co-occurrence of epilepsy depends on the affected functional domains. Missense mutations with severe molecular alteration in the DH domain, or located in the DH-gephyrin binding region, or adjacent to the SH3-NL2 binding site were associated with severe epilepsy, implying that the clinical severity was potentially determined by alteration of molecular structure and location of mutations. Male patients with ARHGEF9 mutations presented more severe phenotypes than female patients, which suggests a gene-dose effect and supports the pathogenic role of ARHGEF9 mutations. This study highlights the role of molecular alteration in phenotype expression and facilitates evaluation of the pathogenicity of ARHGEF9 mutations in clinical practice.

  3. Performance Test of Openflow Agent on Openflow Software-Based Mikrotik RB750 Switch

    Directory of Open Access Journals (Sweden)

    Rikie Kartadie

    2016-11-01

    Full Text Available A network is usually developed by several devices such as router, switch etc. Every device forwards data package manipulation with complicated protocol planted in its hardware. An operator is responsible for running configuration either to manage rules or application applied in the network. Human error may occur when device configuration run manually by operator. Some famous vendors, one of them is MikroTik, has also been implementing this OpenFlow on its operation. It provides the implementation of SDN/OpenFlow architecture with affordable cost. The second phase research result showed that switch OF software-based MikroTik resulted higher latency value than both mininet and switch OF software-based OpenWRT. The average gap value of switch OF software-based MikroTik is 2012 kbps lower than the value of switch OF software-based OpenWRT. The average gap value of throughput bandwidth protocol UDP switch OF software-based MikroTik is 3.6176 kBps lower than switch OF software-based OpenWRT and it is 8.68 kBps lower than mininet. The average gap throughput jitter protokol UDP of switch OF software-based MiktoTik is 0.0103ms lower than switch OF software-based OpenWRT and 0.0093ms lower than mininet. 

  4. Electrodermal Screening of Asthmatics with AcuGraph 4

    Directory of Open Access Journals (Sweden)

    Kuntal Ghosh

    2017-04-01

    Full Text Available Traditional Chinese Medicine holds that acupuncture meridian activity is correlated with quality of function of specific organs. This study sets out to determine acupuncture meridian characteristics of subjects with moderate asthma distinguishing them from healthy subjects. Fifty asthma patients (age 35.36 ± 8.68 years and fifty similarly aged (34.11 ± 7.29 years healthy volunteers were enrolled in the study. Electrodermal conductances at Jing Well points were measured with Acugraph 4 and also Peak Expiratory Flow Rate (PEFR for the asthma group. All mean meridian conductances were lower for the asthma group, significance differences were in Lung and right Bladder meridians. In contrast, all but two of the standard deviations of group meridian conductances for the Asthma group were higher than those for the Healthy group. Difference in mean PEFR values between Asthma and Healthy groups was significant. These suggest that group measures of electrical conductance at Jing Well points can distinguish asthma from healthy individuals. The study provides support for the usefulness of meridian energy measurements to assess organ related dysfunction and for the idea that pathology groups exhibit higher standard deviations i.e. lower quality of regulation.

  5. Adaptação da “The Resilience Scale” para a população adulta portuguesa

    Directory of Open Access Journals (Sweden)

    Cláudia Alexandra Ferreira de Carvalho Ng Deep

    2012-06-01

    Full Text Available Este artigo descreve a adaptação da “The Resilience Scale” para portugueses adultos. Procedeu-se à retradução e validação psicométrica. Fez-se pré-teste e reteste. Obteve-se equivalência linguística/conceptual e validação psicométrica com alpha de Cronbach 0,868 para 23 itens, sugerindo consistência interna. A análise fatorial agrupou 23 variáveis em 4 fatores: I - Perseverança; II - Sentido de vida; III - Serenidade; IV - Autossuficiência e autoconfiança, com valores alpha de Cronbach satisfatórios para cada fator. Verificou-se sensibilidade dos itens através do coeficiente de assimetria e achatamento e comprovou-se a estabilidade temporal. A escala revela boas características psicométricas aferindo níveis de resiliência nesta população.

  6. Development of an LCD-Based Visual Field System.

    Science.gov (United States)

    Joo, Jin Ho; Lee, Jihyoung; You, Heecheon; Kang, Jaheon

    2018-01-15

    The present study investigated the diagnostic effectiveness of an LCD-based visual field testing system (LVF) in comparison with the standard automated perimetry Humphrey Field Analyzer II-750i (HFA). A randomized controlled crossover study was conducted with 202 normal and 128 glaucomatous eyes using both LVF and HFA. The visual field testing systems were compared in terms of mean deviation (MD), pattern standard deviation (PSD), and area under the receiver operating characteristics curve (AUC) of MD and PSD differentiating the normal and glaucomatous eyes. Significant correlations were found between MD measurements from LVF and those from HFA for normal eyes (r = 0.342) and glaucomatous eyes (r = 0.796); slightly higher significant correlations were identified between PSD measurements from LVF and those from HFA for normal eyes (r = 0.363) and glaucomatous eyes (r = 0.828). Furthermore, high AUCs of MD were found as 0.786 for LVF and 0.868 for HFA and AUCs of PSD as 0.913 for LVF and 0.932 for HFA. The comparison results of the present study support the competence of LVF compared with HFA in visual field testing for early detection of glaucoma.

  7. Classification of mammographic masses using generalized dynamic fuzzy neural networks

    International Nuclear Information System (INIS)

    Lim, Wei Keat; Er, Meng Joo

    2004-01-01

    In this article, computer-aided classification of mammographic masses using generalized dynamic fuzzy neural networks (GDFNN) is presented. The texture parameters, derived from first-order gradient distribution and gray-level co-occurrence matrices, were computed from the regions of interest. A total of 343 images containing 180 benign masses and 163 malignant masses from the Digital Database for Screening Mammography were analyzed. A fast approach of automatically generating fuzzy rules from training samples was implemented to classify tumors. This work is novel in that it alleviates the problem of requiring a designer to examine all the input-output relationships of a training database in order to obtain the most appropriate structure for the classifier in a conventional computer-aided diagnosis. In this approach, not only the connection weights can be adjusted, but also the structure can be self-adaptive during the learning process. By virtue of the automatic generation of the classifier by the GDFNN learning algorithm, the area under the receiver-operating characteristic curve, A z , attains 0.868±0.020, which corresponds to a true-positive fraction of 95.0% at a false positive fraction of 52.8%. The corresponding accuracy is 70.0%, the positive predictive value is 62.0%, and the negative predictive value is 91.4%

  8. Prevalence and Associated Factors of Playing-Related Musculoskeletal Disorders in Brazilian Violin Players.

    Science.gov (United States)

    Kochem, Frederico B; Silva, Julio G

    2017-03-01

    To investigate the prevalence of playing-related musculoskeletal disorders (PRMD) and associated factors among violinists from the state of Rio de Janeiro, Brazil. This cross-sectional study included 106 violinists from eight cities in the state of Rio de Janeiro. Sociodemographic and musical characteristic data, pain symptoms, and upper-limb functionality were collected using the DASH and the Standardized Nordic Questionnaires. The associations between musculoskeletal complaints and possible predictors were analyzed by binary logistic regression. Of the 106 surveyed violin players, 86.8% reported at least one painful area in the last 12 months and 77.4% in the last week. These symptoms were responsible for the temporary interruption of musical activity in 8.1% of musicians. More than 50% of violinists showed dysfunctional upper limbs according to the DASH optional module. Women were more likely to develop musculoskeletal disorders (OR 4.4, CI 1.9-10.0, p<0.001). In addition, older musicians were more likely to report pain in the last 7 days (OR 3.3, CI 5.1-10.97; p=0.04) and also had higher scores on the DASH (OR 1.8, CI 1.1-3.1; p=0.01). Other factors associated with the development of PRMD were body mass index, practice hours per week, and final DASH score. Violinists living and working in the state of Rio de Janeiro have a high prevalence of PRMD, especially women and older musicians.

  9. Lidocaine gel versus plain lubricating gel for pain reduction during transrectal sonography (LIPS): A randomized controlled trial.

    Science.gov (United States)

    Nam, Su Hyun; Kim, Kye Hyun; Choi, Chahien; Nam, Se Hyun; Song, Taejong; Lee, Kyo Won

    2017-05-01

    To compare the efficacy and safety of lidocaine gel and plain lubricating gel in relieving pain during transrectal sonography (TRS) in patients with gynecologic problems. A randomized controlled trial was conducted in 80 participants who were scheduled to undergo TRS. The participants were allocated into the lidocaine gel group and the aqueous gel group at a 1:1 ratio. The intensity of pain during TRS based on the visual analogue scale (0-10 points) and the adverse events were assessed and compared between the two groups. The two groups had similar demographic characteristics. Between the lidocaine and aqueous gel groups, there was no significant difference in the pain score at probe manipulation (4.04±2.14 vs. 4.21±2.79; P=0.868), as well as at baseline, probe insertion, and 5min after probe removal. The degree of acceptability of the sonographer also did not differ between the two groups. No acute and delayed adverse events was occurred. Intrarectal lidocaine gel for TRS provides no analgesic benefit compared with aqueous gel. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Classifying Step and Spin Turns Using Wireless Gyroscopes and Implications for Fall Risk Assessments

    Directory of Open Access Journals (Sweden)

    Peter C. Fino

    2015-05-01

    Full Text Available Recent studies have reported a greater prevalence of spin turns, which are more unstable than step turns, in older adults compared to young adults in laboratory settings. Currently, turning strategies can only be identified through visual observation, either in-person or through video. This paper presents two unique methods and their combination to remotely monitor turning behavior using three uniaxial gyroscopes. Five young adults performed 90° turns at slow, normal, and fast walking speeds around a variety of obstacles while instrumented with three IMUs (attached on the trunk, left and right shank. Raw data from 360 trials were analyzed. Compared to visual classification, the two IMU methods’ sensitivity/specificity to detecting spin turns were 76.1%/76.7% and 76.1%/84.4%, respectively. When the two methods were combined, the IMU had an overall 86.8% sensitivity and 92.2% specificity, with 89.4%/100% sensitivity/specificity at slow speeds. This combined method can be implemented into wireless fall prevention systems and used to identify increased use of spin turns. This method allows for longitudinal monitoring of turning strategies and allows researchers to test for potential associations between the frequency of spin turns and clinically relevant outcomes (e.g., falls in non-laboratory settings.

  11. The application of the drug user quality of life scale (DUQOL in Australia

    Directory of Open Access Journals (Sweden)

    Zubaran Carlos

    2012-03-01

    Full Text Available Abstract Background The concept of quality of life relates to the perceptions of individuals about their mental and physical health as well as non-health related areas. The evaluation of quality of life in the context of substance abuse has been conducted using generic instruments. The Drug Users Quality of Life Scale (DUQOL is a specific assessment tool in which the most pertinent and salient areas to drug abusers are taken into consideration. In this study, the authors report the results of a validation study in which the DUQOL was used for the first time in Australia. Methods A sample of 120 participants from inpatient and outpatient treatment facilities completed a series of questionnaires, including the DUQOL and the World Health Organization Quality of Life Assessment-BREF (WHOQOL-BREF. Parameters investigated in this study included the demographic characteristics of the sample, internal structure, and convergent validity. Correlations between the DUQOL scale scores and the scores of the WHOQOL-Bref test were investigated via Pearson product-moment correlation analyses. Results The English version of the DUQOL attained a significant overall Cronbach's alpha of 0.868. The factorial analysis of the DUQOL identified one principal factor that accounted for 28.499% of the variance. Convergent validity analyses demonstrate significant correlations (p Conclusions This study demonstrates that the DUQOL constitutes a reliable research instrument for evaluating quality of life of substance users in Australia.

  12. Adversarios del sindicalismo. Un análisis del discurso antisindical en el diario español La Razón

    Directory of Open Access Journals (Sweden)

    Beltran Roca Martinez

    2017-10-01

    Full Text Available Recientes estudios de opinión desvelan el alto nivel de deslegitimación de las organizaciones sindicales en España. En este artículo nos centramos en una de las expresiones de esta deslegitimación: el discurso sobre el sindicalismo que difunden los medios de comunicación de masas. Para ello analizamos el discurso sobre los sindicatos del diario conservador La Razón en el primer semestre de 2012. En una primera parte analizamos los 868 titulares de noticias sobre sindicatos publicadas en dicho periodo, diferenciando aquellos con contenido aséptico, negativo o positivo sobre los sindicatos. En segundo lugar, realizamos un análisis del discurso antisindical para conocer sus elementos y estructura. Los resultados refuerzan la tesis de que los sindicatos españoles son objeto de una intensa campaña de desprestigio que está deteriorando su imagen pública y su poder social.

  13. Validación de la prueba "Sentido del Trabajo" en población colombiana

    Directory of Open Access Journals (Sweden)

    Efrén Martínez Ortiz

    2012-01-01

    Full Text Available Se evaluaron las características psicométricas de validez y confiabilidad del instrumento "Sentido del trabajo", así como sus dimensiones experiencia (Cognición y vivencia (Afectividad. El cuestionario se aplicó a 842 empleados de los niveles operativo, medio y alto de organizaciones tanto del sector público como privado seleccionados intencionalmente previa construcción y revisión por jueces expertos y posterior pilotaje. La versión final, compuesta por 18 reactivos, mostró un nivel de respuesta a la totalidad de los ítems del 86,8% y una consistencia interna con el alfa de Cronbach de 0.83. Se realizó un análisis factorial exploratorio que identificó 3 componentes consistentes con la estructura teórica: Confusión existencial-laboral, Propósito-laboral e Identidad y Coherencia laboral. Se presenta un instrumento de fácil aplicabilidad en la consulta individual y en la valoración colectiva, con utilidad para el abordaje de problemáticas relacionadas con esta característica de la naturaleza humana.

  14. Can low back loading during lifting be reduced by placing one leg beside the object to be lifted?

    Science.gov (United States)

    Kingma, Idsart; Faber, Gert S; Bakker, Anja J M; van Dieën, Jaap H

    2006-08-01

    Lifting technique could, through its effect on low back loading, affect the risk of developing low back pain. In this study, 2 lifting techniques (a straddle technique and a 1-leg kneeling technique), which aimed to reduce low back loading by placing one leg beside a load, were compared with stoop lifting and squat lifting with respect to their effect on low back loading. Twelve men with no history of low back pain participated in the study. The subjects lifted wide and narrow 20-kg boxes from 2 initial hand heights. With measured kinematics, ground reaction forces, and electromyography, 3-dimensional spinal forces were calculated. When the subjects lifted a narrow box from a 290-mm height, peak L5-S1 compression forces were 5,060 (SD = 827), 3,980 (SD = 701), 4,208 (SD = 762), and 4,719 (SD = 1,015) N for the stoop, squat, straddle, and kneeling techniques, respectively. When the subjects lifted a wide box from 50 mm, spinal compression forces were much higher and distributed differently over lifting techniques: 5,926 (SD = 610), 6,868 (SD = 924), 6,472 (SD = 1,042), and 6,064 (SD = 968) N, respectively. The authors conclude that no single lifting technique can be advised for all lifting conditions.

  15. Detection of Greenhouse Gas Precursors from Diesel Engines Using Electrochemical and Photoacoustic Sensors

    Directory of Open Access Journals (Sweden)

    Aline Rocha

    2010-11-01

    Full Text Available Atmospheric pollution is one of the worst threats to modern society. The consequences derived from different forms of atmospheric pollution vary from the local to the global scale, with deep impacts on climate, environment and human health. Several gaseous pollutants, even when present in trace concentrations, play a fundamental role in important processes that occur in atmosphere. Phenomena such as global warming, photochemical smog formation, acid rain and the depletion of the stratospheric ozone layer are strongly related to the increased concentration of certain gaseous species in the atmosphere. The transport sector significantly produces atmospheric pollution, mainly when diesel oil is used as fuel. Therefore, new methodologies based on selective and sensitive gas detection schemes must be developed in order to detect and monitor pollutant gases from this source. In this work, CO2 Laser Photoacoustic Spectroscopy was used to evaluate ethylene emissions and electrochemical analyzers were used to evaluate the emissions of CO, NOx and SO2 from the exhaust of diesel powered vehicles (rural diesel with 5% of biodiesel, in this paper called only diesel at different engine rotation speeds. Concentrations in the range 6 to 45 ppmV for ethylene, 109 to 1,231 ppmV for carbon monoxide, 75 to 868 ppmV for nitrogen oxides and 3 to 354 ppmV for sulfur dioxide were obtained. The results indicate that the detection techniques used were sufficiently selective and sensitive to detect the gaseous species mentioned above in the ppmV range.

  16. The role of religious attendance on mental health among Mexican populations: A contribution toward the discussion of the immigrant health paradox.

    Science.gov (United States)

    Moreno, Oswaldo; Cardemil, Esteban

    2018-01-01

    In this study, we conducted a path analysis on data from the National Latino and Asian American Study to investigate the role of religious attendance on mental health among Mexican populations. Using data from 868 Latinos of Mexican origin, we further investigated the extent to which religious attendance mediated the direct path between generation status and lifetime prevalence rates of any substance use disorder, depressive disorder, and anxiety disorder. Results indicate that Mexican immigrants endorsed lower lifetime prevalence rates of depressive disorder, anxiety disorder, and substance use disorder and endorsed higher levels of religious attendance. Second, results indicate a significant negative relationship between religious attendance and prevalence rates for depressive disorder, anxiety disorder, and substance use disorder. Third, results indicate that religious attendance was a mediator for the relationship between generation status and the lifetime prevalence rates of substance use disorder only. These results provide a contribution toward the discussion of the immigrant health paradox and further highlight the role that religious attendance plays in the relationship between generational status and the lifetime prevalence rates of substance use disorder. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  17. The Incidence of Hepatocellular Carcinoma after Balloon-Occluded Retrograde Transvenous Obliteration

    Directory of Open Access Journals (Sweden)

    Keiji Yokoyama

    2015-01-01

    Full Text Available Balloon-occluded retrograde transvenous obliteration (BRTO is a highly effective therapy for gastric varices with liver cirrhosis. We have investigated the incidence of hepatocellular carcinoma (HCC after BRTO. We enrolled 71 patients with viral hepatitis in which HCC had not appeared with liver imaging findings at the time of BRTO. The overall survival rate after BRTO was 86.8%, 76.1%, and 50.5% at 1, 3, and 5 years. The occurrence rate of HCC after BRTO was 20.9%, 41.1%, and 60.7% at 1, 3, and 5 years, especially showing a higher occurrence of HCC at one year. Meanwhile, the occurrence rate of HCC after treatment which excluded BRTO for esophagogastric varices in patients was 6.3%, 19.2%, and 42.5% at 1, 3, and 5 years. The log-rank test revealed that the occurrence rate of HCC after treatment was significantly higher in the BRTO group compared with that in the non-BRTO group (P=0.0447. The recurrence rate of HCC after BRTO was 35.8% and 80.0% at 1 and 3 years. The present study demonstrated a high incidence of HCC after BRTO in liver cirrhosis patients with viral hepatitis infection. We have suggested the potential for BRTO to accelerate hepatocarcinogenesis.

  18. Circulating levels of vitamin D and colon and rectal cancer: the Physicians' Health Study and a meta-analysis of prospective studies.

    Science.gov (United States)

    Lee, Jung Eun; Li, Haojie; Chan, Andrew T; Hollis, Bruce W; Lee, I-Min; Stampfer, Meir J; Wu, Kana; Giovannucci, Edward; Ma, Jing

    2011-05-01

    It remains unknown whether increased risk with low levels of vitamin D is present for colon and/or rectal cancer. To investigate the association between circulating vitamin D levels and colon and rectal cancer, we examined the associations between plasma levels of 25-hydroxyvitamin D [25(OH)D] and 1,25-dihydroxyvitamin D [1,25(OH)2D] and colon and rectal cancer in the Physicians' Health Study and then conducted a meta-analysis of eight prospective studies of circulating levels of 25(OH)D and colon and rectal cancers, including the Physicians' Health Study. Study-specific ORs and 95% CIs were pooled by using a random-effects model. A total of 1,822 colon and 868 rectal cancers were included in the meta-analysis. We observed a significant inverse association for colorectal cancer (OR = 0.66; 95% CI, 0.54-0.81), comparing top versus bottom quantiles of circulating 25(OH)D levels. The inverse association was stronger for rectal cancer (OR = 0.50 for top versus bottom quantiles; 95% CI, 0.28-0.88) than colon cancer (OR = 0.77; 95% CI, 0.56-1.07; P value for difference between colon and rectal cancer = 0.20). These data suggest an inverse association between circulating 25(OH)D levels and colorectal cancer, with a stronger association for rectal cancer.

  19. Mutational analysis of the mitochondrial 12S rRNA and tRNASer(UCN) genes in Tunisian patients with nonsyndromic hearing loss

    International Nuclear Information System (INIS)

    Mkaouar-Rebai, Emna; Tlili, Abdelaziz; Masmoudi, Saber; Louhichi, Nacim; Charfeddine, Ilhem; Amor, Mohamed Ben; Lahmar, Imed; Driss, Nabil; Drira, Mohamed; Ayadi, Hammadi; Fakhfakh, Faiza

    2006-01-01

    We explored the mitochondrial 12S rRNA and the tRNA Ser(UCN) genes in 100 Tunisian families affected with NSHL and in 100 control individuals. We identified the mitochondrial A1555G mutation in one out of these 100 families and not in the 100 control individuals. Members of this family harbouring the A1555G mutation showed phenotypic heterogeneity which could be explained by an eventual nuclear-mitochondrial interaction. So, we have screened three nuclear genes: GJB2, GJB3, and GJB6 but we have not found correlation between the phenotypic heterogeneity and variants detected in these genes. We explored also the entire mitochondrial 12S rRNA and the tRNA Ser(UCN) genes. We detected five novel polymorphisms: T742C, T794A, A813G, C868T, and C954T, and 12 known polymorphisms in the mitochondrial 12S rRNA gene. None of the 100 families or the 100 controls were found to carry mutations in the tRNA Ser(UCN) gene. We report here First mutational screening of the mitochondrial 12S rRNA and the tRNA Ser(UCN) genes in the Tunisian population which describes the second family harbouring the A1555G mutation in Africa and reveals novel polymorphisms in the mitochondrial 12S rRNA gene

  20. Effect of addition of Versagel on microbial, chemical, and physical properties of low-fat yogurt.

    Science.gov (United States)

    Ramchandran, L; Shah, N P

    2008-09-01

    The objective of this study was to examine the effect of Versagel on the growth and proteolytic activity of Streptococcus thermophilus 1275 and Lactobacillus delbrueckii ssp. bulgaricus 1368 and angiotensin-I converting enzyme inhibitory activity of the peptides generated thereby as well as on the physical properties of low-fat yogurt during a storage period of 28 d at 4 degrees C. Three different types of low-fat yogurts, YV0, YV1, and YV2, were prepared using Versagel as a fat replacer. The fermentation time of the low-fat yogurts containing Versagel was less than that of the control yogurt (YV0). The starter cultures maintained their viability (8.68 to 8.81 log CFU/g of S. thermophilus and 8.51 to 8.81 log CFU/g of L. delbrueckii ssp. bulgaricus) in all the yogurts throughout the storage period. There was some decrease in the pH of the yogurts during storage and an increase in the concentration of lactic acid. However, the proteolytic and ACE-inhibitory potential of the starter cultures was suppressed in the presence of Versagel. On the other hand, the addition of Versagel had a positive impact on the physical properties of the low-fat yogurt, namely, spontaneous whey separation, firmness, and pseudoplastic properties.

  1. COLOUR, PHENOLIC CONTENT AND ANTIOXIDANT ACTIVITY OF THE SLOVAK ALIBERNET RED WINE SAMPLES

    Directory of Open Access Journals (Sweden)

    Daniel Bajčan

    2015-02-01

    Full Text Available Sixteen Alibernet wine samples, originated from three most important Slovak vineyard regions, were evaluated spectrophotometrically for the content of total polyphenols, content of total anthocyanins, antioxidant activity and wine colour density. The determined total polyphenol contents in observed wines ranged from 2141 to 4274 mg gallic acid per liter (average content was 3057 mg gallic acid/L and total anthocyanin contents ranged from 73.4 to 791.2 mg/L (average content was 403.4 mg/L. Determined values of antioxidant activity were within the interval 54.8 – 86.8% (average value was 74.5% and the values of wine colour density varied between 0.944 and 4.592 (average value was 2.317. The statistical evaluation of the obtained results confirmed only weak linear correlation between total polyphenol content and total anthocyanin content, however strong linear correlations between total anthocyanin content and antioxidant activity, resp. wine colour density were observed. Our results also confirmed very highly significant linear relationship between wine colour density and total polyphenol content, resp. antioxidant activity and between antioxidant activity and total phenolic content.

  2. Economic Impacts Analysis of Shale Gas Investment in China

    Science.gov (United States)

    Han, Shangfeng; Zhang, Baosheng; Wang, Xuecheng

    2018-01-01

    Chinese government has announced an ambitious shale gas extraction plan, which requires significant investment. This has the potential to draw investment from other areas and may affect the whole China’s economy. There is few study to date has quantified these shale gas investment’s effects on Chinese economy. The aim of this paper is to quantify the economic effect and figures out whether shale gas investment in China is a good choice or not. Input-output analysis has been utilized in this study to estimate the economic impacts in four different Chinese regions. Our findings show that shale gas investment will result in approximately 868, 427, 115 and 42 Billion RMB economic impacts in Sichuan, Chongqing, Inner Mongolia and Guizhou, respectively. The total economic impact is only around 1453 Billion RMB, which is not significant compared to the economic impact of coalbed methane investment. Considering the potential risks of environmental issues, we suggest that it may be a better strategy for the government, at least in the current situation, to slow down shale gas development investment.

  3. Dietary, Lifestyle and Socio-Economic Correlates of Overweight, Obesity and Central Adiposity in Lebanese Children and Adolescents

    Science.gov (United States)

    Nasreddine, Lara; Naja, Farah; Akl, Christelle; Chamieh, Marie Claire; Karam, Sabine; Sibai, Abla-Mehio; Hwalla, Nahla

    2014-01-01

    The Eastern Mediterranean region is characterized by one of the highest burdens of paediatric obesity worldwide. This study aims at examining dietary, lifestyle, and socio-economic correlates of overweight, obesity, and abdominal adiposity amongst children and adolescents in Lebanon, a country of the Eastern Mediterranean basin. A nationally representative cross-sectional survey was conducted on 6–19-year-old subjects (n = 868). Socio-demographic, lifestyle, dietary, and anthropometric data (weight, height, waist circumference) were collected. Overweight and obesity were defined based on BMI z-scores. Elevated waist circumference (WC) and elevated waist to height ratio (WHtR) were used as indices of abdominal obesity. Of the study sample, 34.8% were overweight, 13.2% were obese, 14.0% had elevated WC, and 21.3% had elevated WHtR. Multivariate logistic regression analyses showed that male gender, maternal employment, residence in the capital Beirut, sedentarity, and higher consumption of fast food and sugar sweetened beverages were associated with increased risk of obesity, overweight, and abdominal adiposity, while regular breakfast consumption, higher intakes of milk/dairies and added fats/oils were amongst the factors associated with decreased risk. The study’s findings call for culture-specific intervention strategies for the promotion of physical activity, healthy lifestyle, and dietary practices amongst Lebanese children and adolescents. PMID:24618510

  4. Propiedades psicométricas de una herramienta de evaluación para las redes focales de adolescentes infractores de ley*

    Directory of Open Access Journals (Sweden)

    Jaime Muñoz Vidal

    2017-08-01

    Full Text Available El grupo de pares constituye uno de los espacios relacionales más importantes en la adolescencia. Si la red de pares con la que un adolescente cuenta, practica conductas riesgosas, se constituye en un factor de riesgo para que dicho adolescente también las realice. Este estudio tuvo por objetivo la validación de un instrumento de evaluación de las redes focales de adolescentes (Inventario de Recursos Sociocomunitarios centrado en las Redes Focales del/la adolescente o IRS-F. Constituye un estudio de tipo cuantitativo, y utiliza pruebas de correlación, comparación de medias y análisis de confiabilidad. La muestra fue de 138 adolescentes infractores de ley, entre 14 y 19 años, con una media de 16,4 (SD=1,10, residentes en el sur de Chile. Se indaga en la confiabilidad interjueces y consistencia interna (Alpha de Cronbach de 0,790 y 0,868 en sus dos escalas, y se obtienen indicadores adecuados de validez concurrente y discriminante. Los resultados, en general, son consistentes con los encontrados en la literatura internacional.

  5. A novel Xp22.13 microdeletion in Nance-Horan syndrome.

    Science.gov (United States)

    Accogli, Andrea; Traverso, Monica; Madia, Francesca; Bellini, Tommaso; Vari, Maria Stella; Pinto, Francesca; Capra, Valeria

    2017-07-03

    Nance-Horan syndrome (NHS) is a rare X-linked developmental disorder characterized by congenital cataract, dental anomalies and facial dysmorphisms. Notably, up to 30% of NHS patients have intellectual disability and a few patients have been reported to have congenital cardiac defects. Nance-Horan syndrome is caused by mutations in the NHS gene that is highly expressed in the midbrain, retina, lens, tooth, and is conserved across vertebrate species. Although most pathogenic mutations are nonsense mutations, a few genomic rearrangements involving NHS locus have been reported, suggesting a possible pathogenic role of the flanking genes. Here, we report a microdeletion of 170,6 Kb at Xp22.13 (17.733.948-17.904.576) (GRCh37/hg19), detected by array-based comparative genomic hybridization in an Italian boy with NHS syndrome. The microdeletion harbors the NHS, SCLML1, and RAI2 genes and results in a phenotype consistent with NSH syndrome and developmental delay. We compare our case with the previous Xp22.13 microdeletions and discuss the possible pathogenetic role of the flanking genes. Birth Defects Research 109:866-868, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  6. Weightlifting's risky new trend: a case series of 41 insulin users.

    Science.gov (United States)

    Ip, Eric J; Barnett, Mitchell J; Tenerowicz, Michael J; Perry, Paul J

    2012-01-01

    Use of performance-enhancing drugs (PEDs) is common among strength-trained individuals, and a growing concern is the misuse of insulin. A 99-item Internet-based survey was posted on discussion boards of various fitness, bodybuilding, weightlifting, and anabolic steroid Web sites between February and June 2009. A case series of 41 nondiabetic insulin users is described. The typical insulin user was 30.7 ± 9.2 years old, male (97.6%), and Caucasian/white (86.8%) who classified himself as a "recreational exerciser" (47.5%). The average insulin user also used anabolic steroids (95.1%) and practiced polypharmacy by incorporating 16.2 ± 5.6 PEDs in his or her yearly routine. Hypoglycemia was reported by most of the subjects (56.8%), and one individual reported unconsciousness. Insulin was obtained most commonly from local sources (e.g., friends, training partners, gym member/dealer; 40.5%) and community pharmacies (37.8%), with most (80.6%) finding it "easy" to acquire their insulin. Strategies aimed to prevent insulin misuse are needed.

  7. Management and adherence to VTE treatment guidelines in a national prospective cohort study in the Canadian outpatient setting. The Recovery Study.

    Science.gov (United States)

    Kahn, Susan R; Springmann, Vicky; Schulman, Sam; Martineau, Josée; Stewart, John A; Komari, Nelly; McLeod, Anne; Strulovitch, Carla; Blostein, Mark; Faucher, Jacques-Philippe; Gamble, Greg; Gordon, Wendy; Kagoma, Peter K; Miron, Marie-José; Laverdière, David; Game, Melaku; Mills, Allan

    2012-09-01

    Documenting patterns and outcomes of venous thromboembolism (VTE) management and degree of adherence by clinicians to treatment guidelines could help identify remediable gaps in patient care. Prospective, clinical practice-based data from Canadian outpatient settings on management of VTE, degree of adherence with treatment guidelines and frequency of recurrent VTE and bleeding during follow-up was obtained in a multicentre, prospective observational study. From 12 Canadian centres, we assessed 868 outpatients with acute symptomatic VTE who received the low-molecular-weight heparin (LMWH) enoxaparin alone or with vitamin K antagonists (VKA), at baseline and at six months (or at the end of treatment, whichever came first). Index VTE was limb deep venous thrombosis (DVT) in 583 (67.2%) patients, pulmonary embolism (PE) with or without DVT in 262 (30.2%) patients, and unusual site DVT in 23 (2.6%) patients. VTE was unprovoked in 399 (46.0%) patients, associated with cancer in 74 (8.5%) patients, transient risk factors in 327 (37.7%) patients and hormonal factors in 68 (7.8%) patients.With regard to guideline adherence, 58 (7.3%) patients received 3 months. Only 38.1% of patients with transient VTE risk factors had received thromboprophylaxis. Our study provides useful information on clinical presentation, management and related outcomes in Canadian outpatients with VTE. Our results suggest there may be important gaps in use of thromboprophylaxis to prevent VTE and use of LMWH monotherapy to treat cancer-related VTE.

  8. Do women with migraine have higher prevalence of temporomandibular disorders?

    Directory of Open Access Journals (Sweden)

    Maria C Gonçalves

    Full Text Available OBJECTIVES: The aim of this study was to assess the prevalence of Temporomandibular Disorders (TMD, using the Research Diagnostic Criteria for TMD (RDC/TMD in women with episodic and chronic migraine (M and CM, as well as in asymptomatic women. METHOD: Sample consisted of 61 women, being 38 with M and 23 with CM, identified from a headache outpatient center; we also investigated 30 women without headaches for at least 3 months (women without headache group - WHG. Assessment of TMD was conducted by a physical therapist who was blind to the headache status. RESULTS: The prevalence of TMD, assessed through the RDC, was 33.3% in the WHG, 86.8% in the M group and 91.3% of the CM group. Differences were significant when comparing M and CM groups with WHG (p0.05 as well as higher risk for TMD [odds ratio (OR=3.15, 95% confidence interval (CI 1.73-5.71 and OR=3.97, 95%CI 1.76-8.94]. CONCLUSION: Women with migraine are more likely to have muscular and articular TMD, suggesting that both disorders might be clinically associated, which demonstrate the importance of physical therapy assessment in the multidisciplinary team.

  9. [Results of a computerized vaccination database].

    Science.gov (United States)

    García Ramos, R; Ortiz Requena, M; Garrido Villoldo, A; Vera Chilet, M J

    2002-06-01

    To analyze vaccine coverage in children from Picassent in Valencia (Spain) and to evaluate the effectiveness of a new computerized vaccine registration program. A computer equipped with our self-made Babyvac-2000 program, based on Microsoft Access was used. The 2,514 entries on children in our database were examined. The results were compared with those in other population groups. Uptake was high: 100 % in 12 of the 15 age groups (according to year of birth). Coverage was as follows: diptheria-tetanus-pertussis (DTP)-oral polio vaccine was 100 % for 9 groups; the first dose of the triple virus vaccine was 100 % in 7 groups; full vaccination was between 96.2 % and 100 % for all age groups; vaccination at 6 years was between 91.6 % and 98.7 %, the second dose of the triple virus vaccine was between 72.2 % and 96.3 %; vaccination at 14 years was between 82.9 % and 87.7 %; hepatitis B vaccination in young children (from 1994 to 2000) was 100 % in 5 groups and was between 90 % and 98 % in teenagers; the Haemophilus influenzae type b vaccination rate was 100 % for children born between 1998 and 2001 and was between 74.3 % and 93.5 % for those born between 1994 and 1997; meningococcal group C conjugated vaccination was between 86.8 % and 100 % for children born between 1994 and 2001. This computer program considerably increases uptake and vaccine coverage among children.

  10. Stillbirth history and Toxoplasma gondii infection in women attending public health centers in a northern Mexican City

    Science.gov (United States)

    Alvarado-Esquivel, C.; Pacheco-Vega, S. J.; Salcedo-Jaquez, M.; Sánchez-Anguiano, L. F.; Hernández-Tinoco, J.; Rábago-Sánchez, E.; Centeno-Tinoco, M. M.; Flores-Garcia, I. D.; Ramos-Nevarez, A.; Cerrillo-Soto, S. M.; Guido-Arreola, C. A.; Beristain-García, I.; Liesenfeld, O.; Berumen-Segovia, L. O.; Saenz-Soto, L.; Sifuentes-Álvarez, A.

    2015-01-01

    Through a cross-sectional study design, 150 women attending public health centers with a history of stillbirths were examined for anti-Toxoplasma gondii IgG and IgM antibodies in Durango City, Mexico. Bivariate and multivariate analyses were used to assess the association of T. gondii seropositivity with the characteristics of the women with stillbirth history. Of the 150 women (mean age: 32.09 ± 9.16 years) studied, 14 (9.3%) had anti-T. gondii IgG antibodies and six (42.9%) of them were also positive for anti-T. gondii IgM antibodies. Multivariate analysis showed that T. gondii seropositivity was associated with high frequency (4–7 days a week) of eating meat (OR = 5.52; 95% CI: 1.48–20.59; P = 0.01), history of lymphadenopathy (OR = 4.52; 95% CI: 1.14–17.82; P = 0.03), and history of surgery (OR = 8.68; 95% CI: 1.04–72.15; P = 0.04). This is the first study on the seroepidemiology of T. gondii infection in women with a history of stillbirths in Mexico. The association of T. gondii exposure with a history of surgery warrants for further research. Risk factors for T. gondii infection found in the present survey may help to design optimal educational programs to avoid T. gondii infection. PMID:26185685

  11. Convergent validity between SF-36 and WHOQOL-BREF in older adults

    Directory of Open Access Journals (Sweden)

    Paula Costa Castro

    2014-02-01

    Full Text Available OBJECTIVE : To compare the reliability and convergent validity of instruments assessing quality of life in Brazilian older adults. METHODS : Cross-sectional study of 278 literate, community-dwelling older adults attending a municipal university for the elderly in Sao Carlos, SP, Southeastern Brazil between 2006 and 2008. The Brazilian versions of the SF-36 and WHOQOL-BREF instruments to assess quality of life were compared. Cronbach’s alpha coefficient was used to estimate reliability and Pearson’s correlation for comparison between the two scales. RESULTS : Most of participants were women (87.8% with a mean age of 63.83±7.22 years. Both scales showed an acceptable internal consistency – WHOQOL-BREF Cronbach’s alpha was 0.832 and SF-36 was 0.868. There was a weak (r ≤ 0.6 correlation between the related fields in the two questionnaires. CONCLUSIONS : The SF-36 and WHOQOL-BREF are reliable instruments for clinical and research uses in Brazilian older women. To select one, researchers should consider which aspects of quality of life they aim to capture because of weak convergent validity signs. This study’s results indicate that WHOQOL-BREF may be more relevant to evaluate changes in the quality of life of older women because it prioritizes responses to the aging process and avoids focusing on impairment.

  12. FDG PET/MR for lymph node staging in head and neck cancer

    Energy Technology Data Exchange (ETDEWEB)

    Platzek, Ivan, E-mail: ivan.platzek@uniklinikum-dresden.de [Dresden University Hospital, Department of Radiology, Fetscherstr. 74, 01307 Dresden (Germany); Beuthien-Baumann, Bettina, E-mail: bettina.beuthien-baumann3@uniklinikum-dresden.de [Dresden University Hospital, Department of Nuclear Medicine, Fetscherstr. 74, 01307 Dresden (Germany); Schneider, Matthias, E-mail: m.schneider@mkgdresden.de [Dresden University Hospital, Department of Oral and Maxillofacial Surgery, Fetscherstr. 74, 01307 Dresden (Germany); Gudziol, Volker, E-mail: volker.gudziol@uniklinikum-dresden.de [Dresden University Hospital, Department of Otolaryngology, Fetscherstr. 74, 01307 Dresden (Germany); Kitzler, Hagen H., E-mail: hagen.kitzler@uniklinikum-dresden.de [Dresden University Hospital, Department of Neuroradiology, Fetscherstr. 74, 01307 Dresden (Germany); Maus, Jens, E-mail: j.maus@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, Bautzner Landstr. 400, 01328 Dresden (Germany); Schramm, Georg, E-mail: g.schramm@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, Bautzner Landstr. 400, 01328 Dresden (Germany); Popp, Manuel, E-mail: manuel.popp@praxisklinik-dresden.de [Dresden University Hospital, Department of Nuclear Medicine, Fetscherstr. 74, 01307 Dresden (Germany); Laniado, Michael, E-mail: michael.laniado@uniklinikum-dresden.de [Dresden University Hospital, Department of Radiology, Fetscherstr. 74, 01307 Dresden (Germany); Kotzerke, Jörg, E-mail: Joerg.Kotzerke@uniklinikum-dresden.de [Dresden University Hospital, Department of Nuclear Medicine, Fetscherstr. 74, 01307 Dresden (Germany); Hoff, Jörg van den, E-mail: j.van_den_hoff@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, Institute of Radiopharmaceutical Cancer Research, Bautzner Landstr. 400, 01328 Dresden (Germany)

    2014-07-15

    Objective: To assess the diagnostic value of PET/MR (positron emission tomography/magnetic resonance imaging) with FDG (18F-fluorodeoxyglucose) for lymph node staging in head and neck cancer. Materials and methods: This prospective study was approved by the local ethics committee; all patients signed informed consent. Thirty-eight patients with squamous cell carcinoma of the head and neck region underwent a PET scan on a conventional scanner and a subsequent PET/MR on a whole-body hybrid system after a single intravenous injection of FDG. The accuracy of PET, MR and PET/MR for lymph node metastases were compared using receiver operating characteristic (ROC) analysis. Histology served as the reference standard. Results: Metastatic disease was confirmed in 16 (42.1%) of 38 patients and 38 (9.7%) of 391 dissected lymph node levels. There were no significant differences between PET/MR, MR and PET and MR (p > 0.05) regarding accuracy for cervical metastatic disease. Based on lymph node levels, sensitivity and specificity for metastatic involvement were 65.8% and 97.2% for MR, 86.8% and 97.0% for PET and 89.5% and 95.2% for PET/MR. Conclusions: In head and neck cancer, FDG PET/MR does not significantly improve accuracy for cervical lymph node metastases in comparison to MR or PET.

  13. Structural Constraints on Autoprocessing of the Human Nucleoporin Nup98

    Energy Technology Data Exchange (ETDEWEB)

    Sun,Y.; Guo, H.

    2008-01-01

    Nucleoporin Nup98, a 98-kDa protein component of the nuclear pore complex, plays an important role in both protein and RNA transport. During its maturation process, Nup98 undergoes post-translational autoproteolysis, which is critical for targeting to the NPC. Here we present high-resolution crystal structures of the C-terminal autoproteolytic domains of Nup98 (2.3 Angstroms for the wild type and 1.9 Angstroms for the S864A precursor), and propose a detailed autoproteolysis mechanism through an N-O acyl shift. Structural constraints are found at the autocleavage site, and could thus provide a driving force for autocleavage at the scissile peptide bond. Such structural constraints appear to be generated, at least in part, by anchoring a conserved phenylalanine side chain into a highly conserved hydrophobic pocket at the catalytic site. Our high-resolution crystal structures also reveal that three highly conserved residues, Tyr866, Gly867, and Leu868, provide most of the interactions between the autoproteolytic domain and the C-terminal tail. These results suggest that Nup98 may represent a new subtype of protein that utilizes autoprocessing to control biogenesis pathways and intracellular translocation.

  14. Adsorption of U(VI) ions from aqueous solutions by activated carbon prepared from Antep pistachio (Pistacia vera L.) shells

    Energy Technology Data Exchange (ETDEWEB)

    Donat, Ramazan [Pamukkale Univ., Denizli (Turkey). Dept. of Chemistry; Erden, Kadriye Esen [Pamukkale Univ., Kinikli-Denizli (Turkey). Denizli Vocational School of Technical Sciences

    2017-08-01

    Antep pistachio (Pistacia vera L.) shells an abundant and low cost natural resource in Turkey was used to prepare activated carbon by physiochemical activation and carbon dioxide (CO{sub 2}) atmosphere as the activating agents at 700 C for 2 h. The adsorption equilibrium of U(VI) from aqueous solutions on such carbon has been studied using a batch system. The parameters that affect the U(VI) adsorption, such as particle size of adsorbent, contact time, of pH of the solution, and temperature, have been investigated and conditions have also been optimized. The equilibrium data for U(VI) ions' adsorption onto activated carbon well fitted to the Langmuir equation, with a maximum monolayer adsorption capacity of 8.68 mg/g, The Freundlich and Dubinin-Radushkevich (D-R) isotherms have been applied and the data correlated well with Freundlich model and that the adsorption is physical in nature (E{sub a}=15.46 kJ/mol). Thermodynamic parameters [ΔH{sub s}=11.33 kJ/mol, ΔS=0.084 kJ/molK, ΔG (293.15 K)=-13.29 kJ/mol] showed the endothermic heat of adsorption and the feasibility of the process.

  15. Parental Socialization of Emotion: How Mothers Respond to their Children’s Emotions in Turkey

    Directory of Open Access Journals (Sweden)

    Ebru Ersay

    2014-04-01

    Full Text Available Several research studies suggest a link between parents’ emotion socialization and children’s social competence and behavior problems. Parents contribute to their children’s emotion socialization, more directly, through responses to their children’s emotions. Early emotion socialization experiences with parents establish patterns of emotion experience, expression, and regulation that children carry into their broader social circles. Few scales exist to document parents’ responses to children’s emotions. The aim of this study was to document mothers’ responses to their children’s sadness, anger, fear, and being overjoyed. A study sample of 868 mothers of preschoolers completed the questionnaire in Turkey. The validity and reliability properties of the Responses to Children’s Emotions (RCE Questionnaire were also examined. We found that mothers in Turkey preferred to respond differently to children’s different emotions. Mothers’ responses generally did not differ according to the gender of their children; the only difference was found for sadness. Mothers’ responses to their children’s emotions related to the children’s and mothers’ ages, monthly family income, levels of mothers’ education, mothers’ employment status, birth order of children, and the city they lived in. This study is important in that it is the first to document mothers’ emotion socialization strategies for their children in terms of one positive and three negative emotions.

  16. Comparative Effect of Massage Therapy versus Kangaroo Mother Care on Body Weight and Length of Hospital Stay in Low Birth Weight Preterm Infants

    Directory of Open Access Journals (Sweden)

    Priya Singh Rangey

    2014-01-01

    Full Text Available Background. Massage therapy (MT and kangaroo mother care (KMC are both effective in increasing the weight and reducing length of hospital stay in low birth weight preterm infants but they have not been compared. Aim. Comparison of effectiveness of MT and KMC on body weight and length of hospital stay in low birth weight preterm (LBWPT infants. Method. 30 LBWPT infants using convenience sampling from Neonatal Intensive Care Unit, V.S. hospital, were randomly divided into 2 equal groups. Group 1 received MT and Group 2 received KMC for 15 minutes, thrice daily for 5 days. Medically stable babies with gestational age < 37 weeks and birth weight < 2500 g were included. Those on ventilators and with congenital, orthopedic, or genetic abnormality were excluded. Outcome measures, body weight and length of hospital stay, were taken before intervention day 1 and after intervention day 5. Level of significance was 5%. Result. Data was analyzed using SPSS16. Both MT and KMC were found to be effective in improving body weight (P = 0.001, P = 0.001. Both were found to be equally effective for improving body weight (P = 0.328 and reducing length of hospital stay (P = 0.868. Conclusion. MT and KMC were found to be equally effective in improving body weight and reducing length of hospital stay. Limitation. Long term follow-up was not taken.

  17. Properties of plasma flames sustained by microwaves and burning hydrocarbon fuels

    International Nuclear Information System (INIS)

    Hong, Yong Cheol; Uhm, Han Sup

    2006-01-01

    Plasma flames made of atmospheric microwave plasma and a fuel-burning flame were presented and their properties were investigated experimentally. The plasma flame generator consists of a fuel injector and a plasma flame exit connected in series to a microwave plasma torch. The plasma flames are sustained by injecting hydrocarbon fuels into a microwave plasma torch in air discharge. The microwave plasma torch in the plasma flame system can burn a hydrocarbon fuel by high-temperature plasma and high atomic oxygen density, decomposing the hydrogen and carbon containing fuel. We present the visual observations of the sustained plasma flames and measure the gas temperature using a thermocouple device in terms of the gas-fuel mixture and flow rate. The plasma flame volume of the hydrocarbon fuel burners was more than approximately 30-50 times that of the torch plasma. While the temperature of the torch plasma flame was only 868 K at a measurement point, that of the diesel microwave plasma flame with the addition of 0.019 lpm diesel and 30 lpm oxygen increased drastically to about 2280 K. Preliminary experiments for methane plasma flame were also carried out, measuring the temperature profiles of flames along the radial and axial directions. Finally, we investigated the influence of the microwave plasma on combustion flame by observing and comparing OH molecular spectra for the methane plasma flame and methane flame only

  18. EMI Shielding Performance For Varies Frequency by Metal Plating on Mold Compound

    Directory of Open Access Journals (Sweden)

    Min Fee Tai

    2017-07-01

    Full Text Available Conformal metalization on mold compound offers new possibility for IC package design to improve features such as rigidization of the flexible core, heat sink capability, 3D-circuit patterning and the electromagnetic interference (EMI shielding. With the unique processes, the fabrication technology had enabled to achieve the high reliable performance and had passed the electrical test. Following research after the reliability concern, this paper further study the shielding effectiveness of varying coating thickness with respect to laboratory simulated EMI condition, using radio frequency from 10MHz to 5.8 GHz. Different metal namely pure nickel, nickel-phosphorous and pure plated copper are studied for their effectiveness of EMI sheilding. Our first result showed over 35-40dB of shielding effectiveness is achievable on high frequency 868-5800MHz. Nevertheless on low frequency of 10MHz, the shielding effectiveness achievement is below than 25dB. To overcome the shielding need for lower frequency, we further expanded our test by choosing ferromagentic material Nicke/Ironl-alloy in combination with thick copper plating. With this new metal combination, EMI shielding effectiveness for lower frequency is improved to 40dB.

  19. Quantification of urbanization in relation to chronic diseases in developing countries: a systematic review.

    Science.gov (United States)

    Allender, Steven; Foster, Charlie; Hutchinson, Lauren; Arambepola, Carukshi

    2008-11-01

    During and beyond the twentieth century, urbanization has represented a major demographic shift particularly in the developed world. The rapid urbanization experienced in the developing world brings increased mortality from lifestyle diseases such as cancer and cardiovascular disease. We set out to understand how urbanization has been measured in studies which examined chronic disease as an outcome. Following a pilot search of PUBMED, a full search strategy was developed to identify papers reporting the effect of urbanization in relation to chronic disease in the developing world. Full searches were conducted in MEDLINE, EMBASE, CINAHL, and GLOBAL HEALTH. Of the 868 titles identified in the initial search, nine studies met the final inclusion criteria. Five of these studies used demographic measures (such as population density) at an area level to measure urbanization. Four studies used more complicated summary measures of individual and area level data (such as distance from a city, occupation, home and land ownership) to define urbanization. The papers reviewed were limited by using simple area level summary measures (e.g., urban rural dichotomy) or having to rely on preexisting data at the individual level. Further work is needed to develop a measure of urbanization that treats urbanization as a process and which is sensitive enough to track changes in "urbanicity" and subsequent emergence of chronic disease risk factors and mortality.

  20. Disparate rates of persistent smoking and drug use during pregnancy of women of Hawaiian ancestry.

    Science.gov (United States)

    Wright, Tricia E; Tam, Elizabeth

    2010-01-01

    Significant disparity in smoking rates has been previously reported in pregnant and non-pregnant women of Native Hawaiian ancestry. Disparities in drug use rates have also been reported in non-pregnant women of Native Hawaiian ancestry. We undertook this study to compare rates of smoking and drug use during pregnancy among women in Hawaii to see if these differences are associated with disparities in pregnancy complications among Native Hawaiian women. Women were enrolled in the Pacific Research Center on Early Human Development study from July 2007 to January 2008, according to approved protocols. Persistent smoking was defined as self-reported smoking within 1 week of admission for labor. Drug use data was assessed by self-report, or if available, toxicology tests at the time of labor. There were 868 women enrolled in the study during this period. Women of Hawaiian/part-Hawaiian ancestry comprised 22% of the study population. Rates of persistent smoking and drug use among Hawaiian women were significantly higher than the remainder of the study population (21% and 8.3% vs. 7.8% and 2.1%, respectively, P Women of Hawaiian ancestry continue to smoke and use illicit drugs during pregnancy at significantly higher rates than women of other ethnic groups in Hawaii. In addition to the immediate effects on pregnancy, long-term adverse outcomes of in utero exposures of the offspring remain an important health disparity.