WorldWideScience

Sample records for alloy-ehi 826

  1. 32 CFR 700.826 - Physical security.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Physical security. 700.826 Section 700.826... Commanding Officers in General § 700.826 Physical security. (a) The commanding officer shall take appropriate... officer shall take action to protect and maintain the security of the command against dangers from fire...

  2. 25 CFR 82.6 - Petition format.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Petition format. 82.6 Section 82.6 Indians BUREAU OF... REORGANIZED UNDER FEDERAL STATUTE AND OTHER ORGANIZED TRIBES § 82.6 Petition format. Petitions may consist of... of a petition must set forth at least a summary of the objectives of the petitioners and must show...

  3. 49 CFR 826.35 - Settlement.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Settlement. 826.35 Section 826.35 Transportation... Settlement. The applicant and agency counsel may agree on a proposed settlement of the award before final action on the application, either in connection with a settlement of the underlying proceeding, or after...

  4. 27 CFR 19.826 - Authorized operations.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Authorized operations. 19.826 Section 19.826 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Production of Vinegar by the Vaporizing Process...

  5. Dicty_cDB: AFL826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c

  6. 26 CFR 1.826-6 - Credit or refund.

    Science.gov (United States)

    2010-04-01

    ... consenting attorney-in-fact of a reciprocal making the election provided by section 826(a), such taxpayer... its reciprocal for such taxable year in the manner provided by § 1.826-5. The district director may...

  7. 26 CFR 1.826-5 - Attribution of tax.

    Science.gov (United States)

    2010-04-01

    ...) § 1.826-5 Attribution of tax. (a) In general. Section 826(e) provides that a reciprocal making the election allowed by section 826(a) shall be credited with so much of the tax paid by the attorney-in-fact as is attributable to the income received by the attorney-in-fact from the reciprocal in such taxable...

  8. 24 CFR 8.26 - Distribution of accessible dwelling units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Distribution of accessible dwelling units. 8.26 Section 8.26 Housing and Urban Development Office of the Secretary, Department of Housing... accessible dwelling units. Accessible dwelling units required by § 8.22, 8.23, 8.24 or 8.25 shall, to the...

  9. 50 CFR 82.6 - Submission of proposals.

    Science.gov (United States)

    2010-10-01

    ... (MARINE MAMMAL PROTECTION ACT OF 1972) Application for Grants § 82.6 Submission of proposals. (a) Preapplication forms may be submitted by any potential grantee in order to (1) establish communication between...

  10. 33 CFR 154.826 - Vapor compressors and blowers.

    Science.gov (United States)

    2010-07-01

    ...) Excessive shaft bearing temperature. (d) If a centrifugal compressor, fan, or lobe blower handles vapor in... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Vapor compressors and blowers....826 Vapor compressors and blowers. (a) Each inlet and outlet to a compressor or blower which handles...

  11. Fabrication of cold-rolled bands of the alloy-ehi 702 in rolls

    International Nuclear Information System (INIS)

    Zhuchin, V.N.; Gindin, A.Sh.; Shaburov, V.E.; Vladimirov, S.M.; Sokolov, V.A.; Shavkun, V.V.; Perepelitsa, I.V.; Markov, V.V.; Naymov, E.P.; Evstaf'ev, P.P.

    1977-01-01

    The questions are discussed, connected with the manufacture of cold-rolled strip of alloy EI702 in reels from strip blanks. It has been established that in the manufacture of hot-rolled stock from EI702 slabs it is necessary to use powerful rolling equipment because of high resistance to deformation. The reel method for manufacturing EI702 alloy improves the rolled stock and increases percentage of serviceable stock, as well as the output

  12. 26 CFR 1.826-1 - Election by reciprocal underwriters and interinsurers.

    Science.gov (United States)

    2010-04-01

    ... reciprocal. A reciprocal making the election is allowed a credit for the amount of tax paid by the attorney... attorney-in-fact with respect to which the election allowed by section 826(a) and this section is in effect; the district in which such attorney-in-fact filed its return for the taxable year; and a copy of the...

  13. 2-D and 3-D CFD Investigation of NREL S826 Airfoil at Low Reynolds Numbers

    International Nuclear Information System (INIS)

    Cakmakcioglu, S C; Sert, I O; Tugluk, O; Sezer-Uzol, N

    2014-01-01

    In this study CFD investigation of flow over the NREL S826 airfoil is performed. NREL S826 airfoil was designed for HAWTs of 10-15 meter diameters. However, it is used in the NTNU wind turbine rotor model and low Reynolds number flow characteristics become important in the validations with the test cases of this rotor model. The airfoil CFD simulations are carried out in 2-D and 3-D computational domains. The k-rn SST turbulence model with Langtry-Menter (γ-Re θ ) transition prediction model for turbulence closure is used in the calculations. The Delayed DES is also performed in the stall region for comparisons. The results are compared with the available METUWIND experimental data, and are shown to be in fair agreement. It is observed that 3-D CFD analysis provides increased accuracy at increased computational cost

  14. URANS simulations of separated flow with stall cells over an NREL S826 airfoil

    DEFF Research Database (Denmark)

    Sarlak Chivaee, Hamid; Nishino, T.; Sørensen, Jens Nørkær

    2016-01-01

    airfoil using unsteady Reynolds-averaged Navier-Stokes (URANS) approach. Results of the simulations are demonstrated in terms of mean flow velocity, lift and drag, as well as pressure distribution, and validated against available experimental data. The simulations are carried out with a wide computational......A series of wind tunnel measurements and oil flow visualization was recently carried out at the Technical University of Denmark in order to investigate flow characteristics over a 14% thick NREL S826 airfoil at low Reynolds numbers. This paper aims at presenting numerical simulations of the same...

  15. Aerodynamic behaviour of NREL S826 airfoil at Re=100,000

    DEFF Research Database (Denmark)

    Chivaee, Hamid Sarlak; Mikkelsen, Robert Flemming; Sarmast, Sasan

    2014-01-01

    This paper presents wind tunnel measurements of the NREL S826 airfoil at Reynolds number Re = 100,000 for angles of attack in a range of -10° to 25° the corresponding Large Eddy Simulation (LES) for selected angles of attack. The measurements have been performed at the low speed wind tunnel located...... at Fluid Mechanics laboratory of the Technical University of Denmark (DTU). Lift coefficient is obtained from the forge gauge measurements while the drag is measured according to the integration of the wake profiles downstream of the airfoil. The pressure distribution is measured by a set of pressure taps...... on the airfoil surface. The lift and drag polars are obtained from the LES computations using DTU's inhouse CFD solver, EllipSys3D, and good agreement is found between the measurement and the simulations. At high angles of attack, the numerical computations tend to over-predict the lift coefficients, however...

  16. Desarmamento no Brasil: Lei 9.437/97 x Lei 10.826/03

    Directory of Open Access Journals (Sweden)

    Márcio Santos Aleixo

    2015-02-01

    Full Text Available A segregação da sociedade brasileira, somada a histórica e farta disponibilidade de armas de fogo e munição, acarreta em elevados índices de criminalidade. Contudo, observa-se grande evolução na legislação brasileira relativa às armas de fogo visando restringir seu acesso, datando do início do século XVII aos dias atuais. Nesse sentido, o presente trabalho teve como objetivo discutir acerca do controle normativo das armas de fogo por parte do Estado, dando base para uma futura convalidação da eficiência de sua estratégia. Assim, por meio da revisão da literatura, levantou-se um breve histórico referente às normas que visam controlar o comércio e uso de armas de fogo no Brasil e teceu-se uma comparação entre as Leis 9.437/97 e 10.826/03. Por fim, fica claro que aumenta gradativamente a restrição à compra e ao porte de armas de fogo no Brasil, assim como a coerência ao tipificar e cominar penas diferentes frente a diferentes condutas por parte do agente.

  17. Aerodynamic behaviour of NREL S826 airfoil at Re=100,000

    International Nuclear Information System (INIS)

    Sarlak, H; Mikkelsen, R; Sarmast, S; Sørensen, J N

    2014-01-01

    This paper presents wind tunnel measurements of the NREL S826 airfoil at Reynolds number Re = 100,000 for angles of attack in a range of -10° to 25° the corresponding Large Eddy Simulation (LES) for selected angles of attack. The measurements have been performed at the low speed wind tunnel located at Fluid Mechanics laboratory of the Technical University of Denmark (DTU). Lift coefficient is obtained from the forge gauge measurements while the drag is measured according to the integration of the wake profiles downstream of the airfoil. The pressure distribution is measured by a set of pressure taps on the airfoil surface. The lift and drag polars are obtained from the LES computations using DTU's inhouse CFD solver, EllipSys3D, and good agreement is found between the measurement and the simulations. At high angles of attack, the numerical computations tend to over-predict the lift coefficients, however, there is a better agreement between the drag measurements and computations. It is concluded that LES computations are able to capture the lift and drag polars as well as the pressure distribution around the airfoil with an acceptable accuracy

  18. Localization and Broadband Follow-up of the Gravitational-wave Transient GW150914" (2016, ApJL, 826, L13)

    Czech Academy of Sciences Publication Activity Database

    Abbott, P.B.; Abbott, R.; Abbott, T.D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Jelínek, Martin; Kubánek, Petr; Hudec, René; Caballero-García, María Dolores

    2016-01-01

    Roč. 826, č. 1 (2016), L13/1-L13/8 ISSN 2041-8205 Institutional support: RVO:67985815 ; RVO:68378271 Keywords : gravitational waves * observational methods * electromagnetic counterparts Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics; BN - Astronomy, Celestial Mechanics, Astrophysics (FZU-D) Impact factor: 5.522, year: 2016

  19. Numerical simulation of flow around the NREL S826 airfoil at moderate Reynolds number using delayed detached Eddy simulation (DDES)

    Science.gov (United States)

    Prytz, Erik R.; Huuse, Øyvind; Müller, Bernhard; Bartl, Jan; Sætran, Lars Roar

    2017-07-01

    Turbulent flow at Reynolds numbers 5 . 104 to 106 around the NREL S826 airfoil used for wind turbine blades is simulated using delayed detached eddy simulation (DDES). The 3D domain is built as a replica of the low speed wind tunnel at the Norwegian University of Science and Technology (NTNU) with the wind tunnel walls considered as slip walls. The subgrid turbulent kinetic energy is used to model the sub-grid scale in the large eddy simulation (LES) part of DDES. Different Reynoldsaveraged Navier-Stokes (RANS) models are tested in ANSYS Fluent. The realizable k - ∈ model as the RANS model in DDES is found to yield the best agreement of simulated pressure distributions with the experimental data both from NTNU and the Technical University of Denmark (DTU), the latter for a shorter spanwise domain. The present DDES results are in excellent agreement with LES results from DTU. Since DDES requires much fewer cells in the RANS region near the wing surface than LES, DDES is computationally much more efficient than LES. Whereas DDES is able to predict lift and drag in close agreement with experiment up to stall, pure 2D RANS simulations fail near stall. After testing different numerical settings, time step sizes and grids for DDES, a Reynolds number study is conducted. Near stall, separated flow structures, so-called stall cells, are observed in the DDES results.

  20. Development of two series ingnitron based crowbar protection system for 42 GHz and 82.6 GHz gyroton in SST-1

    International Nuclear Information System (INIS)

    Dhorajiya, Pragnesh; Dalakoti, Shefali; Patel, Harshida; Ingle, Krunal; Patel, Jatin; Sathyanarayana, K.; Rajanbabu; Shukla, B.K.

    2013-01-01

    Gyrotrons are used to generate the high power at microwave frequency that is used to heat the plasma inside a Tokamak. A conventional high voltage power supply is used for the testing of 82.6 GHz, 200 kW/CW and 42 GHz, 500 kW/500ms gyrotrons at our institute. Its maximum operating cathode parameters are -55 kV DC, 20 A. Like any other High RF power tubes gyrotrons need to be protected against arc faults within the tube. If the energy dumped in such arc fault is more than the critical crater energy of the tube, irreparable damage can occur inside the RF tube or microwave tube and rendering it useless. The specified maximum fault energy for the 42 GHz and 82.6 GHz gyrotrons is 10 joules. When conventional HVDC power supplies feed high power RF tubes or microwave tubes, a reliable crowbar protection is required which is tested separately to limit the energy to the tube in case of any type of fault to assure the tube safety. Two series ignitron (NL-37248) based crowbar system developed in-house is used to limit the arc fault energy under the acceptance level by diverting the fault current from the load or Gyrotron. Fault current diversion and interruption are initiated by the sensing element and protection system. The required protection cards are designed and developed in-house and required performance is achieved. With this crowbar system the high voltage switch-off to the gyrotron is achieved within 5 μsec after occurrence of critical faults. The crowbar is tested for voltage hold-off up to 80 kV DC. This paper presents the critical requirement of the time delay for the fault sensing and crowbar trigger generation and necessary protections that are incorporated with the ignitron switch crowbar like over voltage, pulsed over current and continuous over current. The crowbar system developed in-house, tested at rated value. The results obtained during the stand-alone tests and commissioning tests are also mentioned. Using this crowbar system the high voltage power

  1. Peripheral phosphodiesterase 4 inhibition produced by 4-[2-(3,4-Bis-difluoromethoxyphenyl)-2-[4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)-phenyl]-ethyl]-3-methylpyridine-1-oxide (L-826,141) prevents experimental autoimmune encephalomyelitis

    DEFF Research Database (Denmark)

    Moore, Craig S.; Earl, Nathalie; Frenette, Richard

    2006-01-01

    Administration of phosphodiesterase 4 (PDE4) inhibitors suppresses the pathogenesis associated with experimental autoimmune encephalomyelitis (EAE), an animal model of multiple sclerosis (MS). In the present study, we compared the effects of rolipram and 4-[2-(3,4-bis-difluoromethoxyphenyl)-2...... observed. Only L-826,141 at a dose of 30 mg/kg p.o. significantly decreased the clinical severity of EAE compared with vehicle controls. Immunohistochemical detection of the neuronal activity marker Fos confirmed that L-826,141 did not reach concentrations in the central nervous system sufficient...

  2. Comparison of the amount of bioaccessible fumonisin B1 and B2 in maize and rice inoculated with Fusarium verticillioides (MRC 826) and determined by in vitro digestion-preliminary results.

    Science.gov (United States)

    Szabó-Fodor, J; Bors, I; Szabó, A; Kovács, M

    2016-08-01

    In this study the occurrence of hidden fumonisin B1 (FB1) and fumonisin B2 (FB2) was analysed, on two cereal substrates (maize and rice), inoculated with Fusarium verticillioides (MRC 826), in order to determine the ratio of hidden FB1 and FB2. Two parallel methods were applied: an in vitro human digestion sample pre-treatment and the routine extraction procedure, in both cases with subsequent LC-MS analysis. It was found that all samples showed higher concentration of total fumonisin B1 after digestion, as compared to that of free fumonisin analysed only after extraction. The percentage of the hidden form by maize was 18.8 % (±2.4) for FB1 and 36.8 % (±3.8) for FB2, while for rice it was 32.3 % (±11.3) and 58.0 (±6.8), respectively, expressed as the proportion to total fumonisin B1, for the total dataset. Significant differences were found in the FB1 and FB2 concentration measured after the different digestion phases (saliva, gastric and duodenal) in case of both matrixes. The results are useful for human risk assessment, since both humans and animals may be exposed to markedly higher toxin load, as determined merely by conventional analytical methods.

  3. 26 CFR 1.826-7 - Examples.

    Science.gov (United States)

    2010-04-01

    ... TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual Policies Or Premium Deposits) § 1... Underwriting gain 0 Mutual insurance company taxable income 0 Unused loss 22 Credit or refund for taxes paid 0...

  4. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8494 ... Open data leaders in government finally have a support network - each other ... CRIME PREVENTION SOUTH AFRICA MASCULINITY ... ORGANIZATIONAL CHANGE LEADERSHIP PARTICIPATORY RESEARCH ...

  5. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8494 ... A matched firm-employee data set is used to examine the ... MOTIVATION TRUST HEALTH SYSTEM JOB SATISFACTION SYSTEMS ANALYSIS TASK PERFORMANCE ... HUMAN GEOGRAPHY DATA MINING MOBILE PHONES ... retrieval, and processing limited the use of data to entities who ...

  6. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8491 ... Building Businesses with Small Producers: Successful Business Development Services in Africa, Asia, and Latin America. Building Businesses with Small Producers presents the findings and a comparative analysis of seven case studies that challenge current beliefs about good practice in the ...

  7. 826-IJBCS-Article-Dr Paulin Azokpota

    African Journals Online (AJOL)

    DR GATSING

    La force de la pâte de la farine F1 est plus élevée (W = 85.10-4 J) que celle des pâtes des farines F2, F3 et. F4. ..... chauffage à 97 °C ; Vfin : Viscosité après la phase de refroidissement ; V0 : Viscosité initiale ; Vmax-V97f: Indice de stabilité de l'amidon ; Ve : Viscosité de gonflement ;Vg : Viscosité de ..... AFNOR, Tour Europe.

  8. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8531 ... Assessment of the anti-counterfeiting trade agreement (ACTA) and its effects ... Labour market integration in ASEAN, and labour market reforms being undertaken ... Customs Union : implications for trade and WTO accession ... in the ECU include impacts of the common external tariff on its trade ...

  9. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8491 ... ... Internet 175 Apply Internet filter · WATER MANAGEMENT 174 Apply WATER .... has changed — scientifically, politically, and environmentally — since ... Building Businesses with Small Producers: Successful Business ... provision of business development services (BDS) to small and micro en.

  10. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8531 ... SME loan defaults in Bangladesh. Major factors contributing to a high default rate on SME loans in Bangladesh include general strikes and blockades, high competition, lack of business capital, slow seasonal sales, and issues such as fund diversion. Briefs.

  11. 43 CFR 4.826 - Discovery.

    Science.gov (United States)

    2010-10-01

    ... Review Under Part 17 of This Title-Nondiscrimination in Federally Assisted Programs of the Department of... the person from whom discovery is sought, and for good cause shown, the administrative law judge may make any order which justice requires to limit or condition discovery in order to protect a party or...

  12. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8491 ... Seeding Solutions Volume 2: Options for National Laws Governing Access To and Control Over Genetic Resources. Seeding Solutions brings readers up to date on what has changed — scientifically, politically, and environmentally — since the publication in 1994 of the landmark. Publication ...

  13. Search Results | Page 826 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8251 - 8260 of 8490 ... Mobile Nav Footer Links ... Gender (1314) Apply Gender filter · INFORMATION TECHNOLOGY (481) Apply INFORMATION TECHNOLOGY filter ... Filter by project status ... Large Mines and the Community: Socioeconomic and ... the findings and a comparative analysis of seven case studies that ...

  14. 26 CFR 1.826-4 - Allocation of expenses.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual Policies Or Premium Deposits...

  15. 21 CFR 172.826 - Sodium stearyl fumarate.

    Science.gov (United States)

    2010-04-01

    ... nonyeast-leavened bakery products in an amount not to exceed 1 percent by weight of the flour used. (4) As... maleate. (b) The additive is used or intended for use: (1) As a dough conditioner in yeast-leavened bakery products in an amount not to exceed 0.5 percent by weight of the flour used. (2) As a conditioning agent in...

  16. Dicty_cDB: SFD826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SLASINVNEASLIKLT FKQTDRTNEEVLPIIVSYQSPSTPTEFTNNNNNYYYYNYYQ*yn*rritknnkftnq*ri ln*ipkq*wfttisnnyfstnttinkf*cfnsnygh...DRTNEEVLPIIVSYQSPSTPTEFTNNNNNYYYYNYYQ*yn*rritknnkftnq*ri ln*ipkq*wfttisnnyfstnttinkf*cfnsnygh*ftis*kcrkitni*

  17. Dicty_cDB: SLJ826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 033B22f, mRNA sequence. 50 0.023 1 CB290319 |CB290319.1 UCRCS01_01ag06_g1 Washington Navel orange cold acclimate... mRNA sequence. 50 0.023 1 CB290210 |CB290210.1 UCRCS01_01aa11_g1 Washington Navel orange cold acclimated fl

  18. Dicty_cDB: VFG826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence ---LXXPLNXXTKXMXNXESXEKXKGGVMIXNVSKGALVXAXXAXVGLKSGKXXSLGXXX YENETXYFXQXPXGSIXKXXNXXLLIS*pnvmips...fxpxppxxxkkk Frame C: ---LXXPLNXXTKXMXNXESXEKXKGGVMIXNVSKGALVXAXXAXVGLKSGKXXSLGXXX YENETXYFXQXPXGSIXKXXNXXLLIS*pnvmips

  19. Dicty_cDB: VFE826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rmelon lambda zap library Citrullus lanatus cDNA clone WMLS336 5' similar to acetyl...of Vitis vinifera var. Chardonnay Vitis vinifera cDNA clone VVC055H06 5, mRNA sequence. 60 3e-08 2 AI563047 |AI563047.1 EST00171 wate

  20. Michigan Senate Bill 826: Replace Common Core with pre-2011 Massachusetts Standards

    Directory of Open Access Journals (Sweden)

    Sandra Stotsky

    2016-04-01

    Full Text Available Interested in academic standards and assessments proven to raise student achievement? You won’t get that from the Common Core Standards and their associated consortium tests, PARCC and SBAC. Despite the boisterous hype of higher, deeper, richer, more rigorous, and so on, there exists no valid evidence to support their claims of higher quality, achievement, or college readiness. There is a set of state standards and assessments, however, proven through actual experience to have raised academic achievement for students at all levels and in all curricular pathways: those used in Massachusetts from 2000 to 2011. So, why not use them? Such a proposal was recently proposed, and passed, by the Michigan Senate Education Policy Committee. Here, we provide links to Sandra Stotsky’s testimony before that committee, along with other relevant links. - See more at: http://nonpartisaneducation.org/Review/Resources/MichiganBill.htm

  1. 26 CFR 1.826-2 - Special rules applicable to electing reciprocals.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of... upon any increase in the mutual insurance company taxable income of a reciprocal which is attributable...

  2. 26 CFR 1.826-3 - Attorney-in-fact of electing reciprocals.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAX (CONTINUED) INCOME TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual...

  3. 13 CFR 120.826 - Basic requirements for operating a CDC.

    Science.gov (United States)

    2010-01-01

    ... Board of the American Institute of Certified Public Accountants (AICPA). The auditor must be independent.... The audit or review must be conducted by an independent certified public accountant who: (1) Is registered or licensed to practice as a public accountant, and is in good standing, under the laws of the...

  4. Desarmamento no Brasil: Lei 9.437/97 x Lei 10.826/03

    OpenAIRE

    Márcio Santos Aleixo; Guilherme Antônio Behr

    2015-01-01

    A segregação da sociedade brasileira, somada a histórica e farta disponibilidade de armas de fogo e munição, acarreta em elevados índices de criminalidade. Contudo, observa-se grande evolução na legislação brasileira relativa às armas de fogo visando restringir seu acesso, datando do início do século XVII aos dias atuais. Nesse sentido, o presente trabalho teve como objetivo discutir acerca do controle normativo das armas de fogo por parte do Estado, dando base para uma futura convalidação da...

  5. 77 FR 826 - Cantilever Capital, LLC and Cantilever Group, LLC; Notice of Application

    Science.gov (United States)

    2012-01-06

    ... connection with distribution of their investment products or as part of a wealth management business... (202) 551-6821 (Division of Investment Management, Office of Investment Company Regulation..., closed-end management investment company under the Act. The Company intends to elect to be treated as a...

  6. 42 CFR 8.26 - Preparation of the review file and written arguments.

    Science.gov (United States)

    2010-10-01

    ... GENERAL PROVISIONS CERTIFICATION OF OPIOID TREATMENT PROGRAMS Procedures for Review of Suspension or Proposed Revocation of OTP Certification, and of Adverse Action Regarding Withdrawal of Approval of an... adverse action regarding withdrawal of approval of the accreditation body is incorrect (appellant's brief...

  7. 9 CFR 82.6 - Interstate movement of dead birds and dead poultry from a quarantined area.

    Science.gov (United States)

    2010-01-01

    ... provided in paragraph (b) of this section for dressed carcasses, dead birds and dead poultry, including any... poultry at the destination listed on the permit required by paragraph (a)(1) of this section. (b) Dressed... quarantined area only if: (1) The dressed carcasses are from birds or poultry that were slaughtered in a...

  8. Supplement: “Localization and Broadband Follow-up of the Gravitational-wave Transient GW150914” (2016, ApJL, 826, L13)

    Science.gov (United States)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allocca, A.; Altin, P. A.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Barthelmy, S.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Behnke, B.; Bejger, M.; Bell, A. S.; Bell, C. J.; Berger, B. K.; Bergman, J.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, J.; Birney, R.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, G.; Bogan, C.; Bohe, A.; Bojtos, P.; Bond, C.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. C.; Callister, T.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. C.; Casentini, C.; Caudill, S.; Cavagliá, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. C.; Cerretani, G.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chen, H. Y.; Chen, Y.; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, S.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M., Jr.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dattilo, V.; Dave, I.; Daveloza, H. P.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; DeBra, D.; Debreczeni, G.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.; DeRosa, R. T.; De Rosa, R.; DeSalvo, R.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Dojcinoski, G.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Engels, W.; Essick, R. C.; Etzel, T.; Evans, M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fournier, J.-D.; Franco, S.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gatto, A.; Gaur, G.; Gehrels, N.; Gemme, G.; Gendre, B.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghosh, A.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; González, G.; Castro, J. M. G.; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Graef, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, J.; Hardwick, T.; Haris, K.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C.-J.; Haughian, K.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Hofman, D.; Hollitt, S. E.; Holt, K.; Holz, D. E.; Hopkins, P.; Hosken, D. J.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huang, S.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Idrisy, A.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J.-M.; Isi, M.; Islas, G.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jang, H.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kawazoe, F.; Kéfélian, F.; Kehl, M. S.; Keitel, D.; Kelley, D. B.; Kells, W.; Kennedy, R.; Key, J. S.; Khalaidovski, A.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, C.; Kim, J.; Kim, K.; Kim, N.; Kim, N.; Kim, Y.-M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koehlenbeck, S. M.; Kokeyama, K.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringel, V.; Królak, A.; Krueger, C.; Kuehn, G.; Kumar, P.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lange, J.; Lantz, B.; Lasky, P. D.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, K.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B. M.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Lockerbie, N. A.; Logue, J.; Lombardi, A. L.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lück, H.; Lundgren, A. P.; Luo, J.; Lynch, R.; Ma, Y.; MacDonald, T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña-Sandoval, F.; Magee, R. M.; Mageswaran, M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandel, I.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R. M.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merilh, E.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Muir, A. W.; Mukherjee, A.; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P. G.; Mytidis, A.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nedkova, K.; Nelemans, G.; Neri, M.; Neunzert, A.; Newton, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, R. J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palliyaguru, N.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Patrick, Z.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Phelps, M.; Piccinni, O.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powell, J.; Prasad, J.; Predoi, V.; Premachandra, S. S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Riles, K.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romanov, G.; Romie, J. H.; Rosińska, D.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sentenac, D.; Sequino, V.; Sergeev, A.; Serna, G.; Setyawati, Y.; Sevigny, A.; Shaddock, D. A.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shao, Z.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sigg, D.; Silva, A. D.; Simakov, D.; Singer, A.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, J. R.; Smith, N. D.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strauss, N. A.; Strigin, S.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Tomlinson, C.; Tonelli, M.; Torres, C. V.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Tringali, M. C.; Trozzo, L.; Tse, M.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Vass, S.; Vasúth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Viceré, A.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, X.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Worden, J.; Wright, J. L.; Wu, G.; Yablon, J.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, H.; Yvert, M.; Zadrożny, A.; Zangrando, L.; Zanolin, M.; Zendri, J.-P.; Zevin, M.; Zhang, F.; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.; LIGO Scientific Collaboration; Virgo Collaboration; Allison, J.; Bannister, K.; Bell, M. E.; Chatterjee, S.; Chippendale, A. P.; Edwards, P. G.; Harvey-Smith, L.; Heywood, Ian; Hotan, A.; Indermuehle, B.; Marvil, J.; McConnell, D.; Murphy, T.; Popping, A.; Reynolds, J.; Sault, R. J.; Voronkov, M. A.; Whiting, M. T.; Australian Square Kilometer Array Pathfinder (ASKAP Collaboration); Castro-Tirado, A. J.; Cunniffe, R.; Jelínek, M.; Tello, J. C.; Oates, S. R.; Hu, Y.-D.; Kubánek, P.; Guziy, S.; Castellón, A.; García-Cerezo, A.; Muñoz, V. F.; Pérez del Pulgar, C.; Castillo-Carrión, S.; Castro Cerón, J. M.; Hudec, R.; Caballero-García, M. D.; Páta, P.; Vitek, S.; Adame, J. A.; Konig, S.; Rendón, F.; Mateo Sanguino, T. de J.; Fernández-Muñoz, R.; Yock, P. C.; Rattenbury, N.; Allen, W. H.; Querel, R.; Jeong, S.; Park, I. H.; Bai, J.; Cui, Ch.; Fan, Y.; Wang, Ch.; Hiriart, D.; Lee, W. H.; Claret, A.; Sánchez-Ramírez, R.; Pandey, S. B.; Mediavilla, T.; Sabau-Graziati, L.; BOOTES Collaboration; Abbott, T. M. C.; Abdalla, F. B.; Allam, S.; Annis, J.; Armstrong, R.; Benoit-Lévy, A.; Berger, E.; Bernstein, R. A.; Bertin, E.; Brout, D.; Buckley-Geer, E.; Burke, D. L.; Capozzi, D.; Carretero, J.; Castander, F. J.; Chornock, R.; Cowperthwaite, P. S.; Crocce, M.; Cunha, C. E.; D'Andrea, C. B.; da Costa, L. N.; Desai, S.; Diehl, H. T.; Dietrich, J. P.; Doctor, Z.; Drlica-Wagner, A.; Drout, M. R.; Eifler, T. F.; Estrada, J.; Evrard, A. E.; Fernandez, E.; Finley, D. A.; Flaugher, B.; Foley, R. J.; Fong, W.-F.; Fosalba, P.; Fox, D. B.; Frieman, J.; Fryer, C. L.; Gaztanaga, E.; Gerdes, D. W.; Goldstein, D. A.; Gruen, D.; Gruendl, R. A.; Gutierrez, G.; Herner, K.; Honscheid, K.; James, D. J.; Johnson, M. D.; Johnson, M. W. G.; Karliner, I.; Kasen, D.; Kent, S.; Kessler, R.; Kim, A. G.; Carrasco Kind, M.; Kuehn, K.; Kuropatkin, N.; Lahav, O.; Li, T. S.; Lima, M.; Lin, H.; Maia, M. A. G.; Margutti, R.; Marriner, J.; Martini, P.; Matheson, T.; Melchior, P.; Metzger, B. D.; Miller, C. J.; Miquel, R.; Neilsen, E.; Nichol, R. C.; Nord, B.; Nugent, P.; Ogando, R.; Petravick, D.; Plazas, A. A.; Quataert, E.; Roe, N.; Romer, A. K.; Roodman, A.; Rosell, A. C.; Rykoff, E. S.; Sako, M.; Sanchez, E.; Scarpine, V.; Schindler, R.; Schubnell, M.; Scolnic, D.; Sevilla-Noarbe, I.; Sheldon, E.; Smith, N.; Smith, R. C.; Soares-Santos, M.; Sobreira, F.; Stebbins, A.; Suchyta, E.; Swanson, M. E. C.; Tarle, G.; Thaler, J.; Thomas, D.; Thomas, R. C.; Tucker, D. L.; Vikram, V.; Walker, A. R.; Wechsler, R. H.; Wester, W.; Yanny, B.; Zhang, Y.; Zuntz, J.; Dark Energy Survey Collaboration; Dark Energy Camera GW-EM Collaboration; Connaughton, V.; Burns, E.; Goldstein, A.; Briggs, M. S.; Zhang, B.-B.; Hui, C. M.; Jenke, P.; Wilson-Hodge, C. A.; Bhat, P. N.; Bissaldi, E.; Cleveland, W.; Fitzpatrick, G.; Giles, M. M.; Gibby, M. H.; Greiner, J.; von Kienlin, A.; Kippen, R. M.; McBreen, S.; Mailyan, B.; Meegan, C. A.; Paciesas, W. S.; Preece, R. D.; Roberts, O.; Sparke, L.; Stanbro, M.; Toelge, K.; Veres, P.; Yu, H.-F.; Blackburn, L.; Fermi GBM Collaboration; Ackermann, M.; Ajello, M.; Albert, A.; Anderson, B.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Barbiellini, G.; Bastieri, D.; Bellazzini, R.; Bissaldi, E.; Blandford, R. D.; Bloom, E. D.; Bonino, R.; Bottacini, E.; Brandt, T. J.; Bruel, P.; Buson, S.; Caliandro, G. A.; Cameron, R. A.; Caragiulo, M.; Caraveo, P. A.; Cavazzuti, E.; Charles, E.; Chekhtman, A.; Chiang, J.; Chiaro, G.; Ciprini, S.; Cohen-Tanugi, J.; Cominsky, L. R.; Costanza, F.; Cuoco, A.; D'Ammando, F.; de Palma, F.; Desiante, R.; Digel, S. W.; Di Lalla, N.; Di Mauro, M.; Di Venere, L.; Domínguez, A.; Drell, P. S.; Dubois, R.; Favuzzi, C.; Ferrara, E. C.; Franckowiak, A.; Fukazawa, Y.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Giglietto, N.; Giommi, P.; Giordano, F.; Giroletti, M.; Glanzman, T.; Godfrey, G.; Gomez-Vargas, G. A.; Green, D.; Grenier, I. A.; Grove, J. E.; Guiriec, S.; Hadasch, D.; Harding, A. K.; Hays, E.; Hewitt, J. W.; Hill, A. B.; Horan, D.; Jogler, T.; Jóhannesson, G.; Johnson, A. S.; Kensei, S.; Kocevski, D.; Kuss, M.; La Mura, G.; Larsson, S.; Latronico, L.; Li, J.; Li, L.; Longo, F.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Magill, J.; Maldera, S.; Manfreda, A.; Marelli, M.; Mayer, M.; Mazziotta, M. N.; McEnery, J. E.; Meyer, M.; Michelson, P. F.; Mirabal, N.; Mizuno, T.; Moiseev, A. A.; Monzani, M. E.; Moretti, E.; Morselli, A.; Moskalenko, I. V.; Negro, M.; Nuss, E.; Ohsugi, T.; Omodei, N.; Orienti, M.; Orlando, E.; Ormes, J. F.; Paneque, D.; Perkins, J. S.; Pesce-Rollins, M.; Piron, F.; Pivato, G.; Porter, T. A.; Racusin, J. L.; Rainò, S.; Rando, R.; Razzaque, S.; Reimer, A.; Reimer, O.; Salvetti, D.; Saz Parkinson, P. M.; Sgrò, C.; Simone, D.; Siskind, E. J.; Spada, F.; Spandre, G.; Spinelli, P.; Suson, D. J.; Tajima, H.; Thayer, J. B.; Thompson, D. J.; Tibaldo, L.; Torres, D. F.; Troja, E.; Uchiyama, Y.; Venters, T. M.; Vianello, G.; Wood, K. S.; Wood, M.; Zhu, S.; Zimmer, S.; Fermi LAT Collaboration; Brocato, E.; Cappellaro, E.; Covino, S.; Grado, A.; Nicastro, L.; Palazzi, E.; Pian, E.; Amati, L.; Antonelli, L. A.; Capaccioli, M.; D'Avanzo, P.; D'Elia, V.; Getman, F.; Giuffrida, G.; Iannicola, G.; Limatola, L.; Lisi, M.; Marinoni, S.; Marrese, P.; Melandri, A.; Piranomonte, S.; Possenti, A.; Pulone, L.; Rossi, A.; Stamerra, A.; Stella, L.; Testa, V.; Tomasella, L.; Yang, S.; GRAvitational Wave Inaf TeAm (GRAWITA); Bazzano, A.; Bozzo, E.; Brandt, S.; Courvoisier, T. J.-L.; Ferrigno, C.; Hanlon, L.; Kuulkers, E.; Laurent, P.; Mereghetti, S.; Roques, J. P.; Savchenko, V.; Ubertini, P.; INTEGRAL Collaboration; Kasliwal, M. M.; Singer, L. P.; Cao, Y.; Duggan, G.; Kulkarni, S. R.; Bhalerao, V.; Miller, A. A.; Barlow, T.; Bellm, E.; Manulis, I.; Rana, J.; Laher, R.; Masci, F.; Surace, J.; Rebbapragada, U.; Cook, D.; Van Sistine, A.; Sesar, B.; Perley, D.; Ferreti, R.; Prince, T.; Kendrick, R.; Horesh, A.; Intermediate Palomar Transient Factory (iPTF Collaboration); Hurley, K.; Golenetskii, S. V.; Aptekar, R. L.; Frederiks, D. D.; Svinkin, D. S.; Rau, A.; von Kienlin, A.; Zhang, X.; Smith, D. M.; Cline, T.; Krimm, H.; InterPlanetary Network; Abe, F.; Doi, M.; Fujisawa, K.; Kawabata, K. S.; Morokuma, T.; Motohara, K.; Tanaka, M.; Ohta, K.; Yanagisawa, K.; Yoshida, M.; J-GEM Collaboration; Baltay, C.; Rabinowitz, D.; Ellman, N.; Rostami, S.; La Silla-QUEST Survey; Bersier, D. F.; Bode, M. F.; Collins, C. A.; Copperwheat, C. M.; Darnley, M. J.; Galloway, D. K.; Gomboc, A.; Kobayashi, S.; Mazzali, P.; Mundell, C. G.; Piascik, A. S.; Pollacco, Don; Steele, I. A.; Ulaczyk, K.; Liverpool Telescope Collaboration; Broderick, J. W.; Fender, R. P.; Jonker, P. G.; Rowlinson, A.; Stappers, B. W.; Wijers, R. A. M. J.; Low Frequency Array (LOFAR Collaboration); Lipunov, V.; Gorbovskoy, E.; Tyurina, N.; Kornilov, V.; Balanutsa, P.; Kuznetsov, A.; Buckley, D.; Rebolo, R.; Serra-Ricart, M.; Israelian, G.; Budnev, N. M.; Gress, O.; Ivanov, K.; Poleshuk, V.; Tlatov, A.; Yurkov, V.; MASTER Collaboration; Kawai, N.; Serino, M.; Negoro, H.; Nakahira, S.; Mihara, T.; Tomida, H.; Ueno, S.; Tsunemi, H.; Matsuoka, M.; MAXI Collaboration; Croft, S.; Feng, L.; Franzen, T. M. O.; Gaensler, B. M.; Johnston-Hollitt, M.; Kaplan, D. L.; Morales, M. F.; Tingay, S. J.; Wayth, R. B.; Williams, A.; Murchison Wide-field Array (MWA Collaboration); Smartt, S. J.; Chambers, K. C.; Smith, K. W.; Huber, M. E.; Young, D. R.; Wright, D. E.; Schultz, A.; Denneau, L.; Flewelling, H.; Magnier, E. A.; Primak, N.; Rest, A.; Sherstyuk, A.; Stalder, B.; Stubbs, C. W.; Tonry, J.; Waters, C.; Willman, M.; Pan-STARRS Collaboration; Olivares E., F.; Campbell, H.; Kotak, R.; Sollerman, J.; Smith, M.; Dennefeld, M.; Anderson, J. P.; Botticella, M. T.; Chen, T.-W.; Della Valle, M.; Elias-Rosa, N.; Fraser, M.; Inserra, C.; Kankare, E.; Kupfer, T.; Harmanen, J.; Galbany, L.; Le Guillou, L.; Lyman, J. D.; Maguire, K.; Mitra, A.; Nicholl, M.; Razza, A.; Terreran, G.; Valenti, S.; Gal-Yam, A.; PESSTO Collaboration; Ćwiek, A.; Ćwiok, M.; Mankiewicz, L.; Opiela, R.; Zaremba, M.; Żarnecki, A. F.; Pi of Sky Collaboration; Onken, C. A.; Scalzo, R. A.; Schmidt, B. P.; Wolf, C.; Yuan, F.; SkyMapper Collaboration; Evans, P. A.; Kennea, J. A.; Burrows, D. N.; Campana, S.; Cenko, S. B.; Giommi, P.; Marshall, F. E.; Nousek, J.; O'Brien, P.; Osborne, J. P.; Palmer, D.; Perri, M.; Siegel, M.; Tagliaferri, G.; Swift Collaboration; Klotz, A.; Turpin, D.; Laugier, R.; TAROT Collaboration; Zadko Collaboration; Algerian National Observatory, Algerian Collaboration; C2PU Collaboration; Beroiz, M.; Peñuela, T.; Macri, L. M.; Oelkers, R. J.; Lambas, D. G.; Vrech, R.; Cabral, J.; Colazo, C.; Dominguez, M.; Sanchez, B.; Gurovich, S.; Lares, M.; Marshall, J. L.; DePoy, D. L.; Padilla, N.; Pereyra, N. A.; Benacquista, M.; TOROS Collaboration; Tanvir, N. R.; Wiersema, K.; Levan, A. J.; Steeghs, D.; Hjorth, J.; Fynbo, J. P. U.; Malesani, D.; Milvang-Jensen, B.; Watson, D.; Irwin, M.; Fernandez, C. G.; McMahon, R. G.; Banerji, M.; Gonzalez-Solares, E.; Schulze, S.; Postigo, A. de U.; Thoene, C. C.; Cano, Z.; Rosswog, S.; VISTA Collaboration

    2016-07-01

    This Supplement provides supporting material for Abbott et al. (2016a). We briefly summarize past electromagnetic (EM) follow-up efforts as well as the organization and policy of the current EM follow-up program. We compare the four probability sky maps produced for the gravitational-wave transient GW150914, and provide additional details of the EM follow-up observations that were performed in the different bands.

  9. Characterization of the Mamluk painting materials in Cairo, Egypt: El-Ashraf Bersbay Madrasa (826 A.H/ 1423 A.D a case study.

    Directory of Open Access Journals (Sweden)

    prof.Atef Brania

    2010-01-01

    Full Text Available The painting materials in the Islamic monuments in Cairo were variable and distinguished. The accurate identification and characterization of painting materials in an art object or in a paint layer is certainly an important step in the history of art, technology and conservation. The main objective of the present paper is to examine and investigate the different painting materials (pigments, gilding, binding media and painting ground employed in the decorated ceilings of Madrasa of Al-Ashraf Bersbay (Mamluk Jarkasy period. X-ray diffraction (X.R.D., scanning electron microscope SEM (EDAX, light optical microscope (LOM and fourier transform infrared spectroscopy (FTIR, together with determination of physical properties of the support (water content and density and microbiological study, adapted for analysis, investigation and evaluation of the current status. The study revealed the severe damage of painting materials. Gypsum, ultramarine, smalt, prussian blue, red ochre, emerald green, red lead (minium and gold leaves were identified in El-Ashraf Bersbay Madrasa decoration painting.

  10. Characterization of the Mamluk painting materials in Cairo, Egypt: El-Ashraf Bersbay Madrasa (826 A.H/ 1423 A.D) a case study.

    OpenAIRE

    prof.Atef Brania

    2010-01-01

    The painting materials in the Islamic monuments in Cairo were variable and distinguished. The accurate identification and characterization of painting materials in an art object or in a paint layer is certainly an important step in the history of art, technology and conservation. The main objective of the present paper is to examine and investigate the different painting materials (pigments, gilding, binding media and painting ground) employed in the decorated ceilings of Madrasa of Al-Ashraf...

  11. Supplement: “Localization And Broadband Follow-Up of the Gravitational-Wave Transient GW150914” (2016, Apjl, 826, L13)

    DEFF Research Database (Denmark)

    P. Abbott, B.; Abbott, R.; Abbott, T. D.

    2016-01-01

    This Supplement provides supporting material for Abbott et al. (2016a). We briefly summarize pastelectromagnetic (EM) follow-up efforts as well as the organization and policy of the current EM follow-upprogram. We compare the four probability sky maps produced for the gravitational-wave transient...... GW150914, andprovide additional details of the EM follow-up observations that were performed in the different bands....

  12. Supplement: "Localization and Broadband Follow-up of the Gravitational-wave Transient GW150914" (2016, ApJL, 826, L13)

    Czech Academy of Sciences Publication Activity Database

    Abbott, P.B.; Abbott, R.; Abbott, T.D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Jelínek, Martin; Kubánek, Petr; Hudec, René; Caballero-García, María Dolores

    2016-01-01

    Roč. 225, č. 1 (2016), 8/1-8/15 ISSN 0067-0049 Institutional support: RVO:67985815 ; RVO:68378271 Keywords : gravitational waves * observational methods * electromagnetic counterparts Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics; BN - Astronomy, Celestial Mechanics, Astrophysics (FZU-D) Impact factor: 8.955, year: 2016

  13. SUPPLEMENT: “LOCALIZATION AND BROADBAND FOLLOW-UP OF THE GRAVITATIONAL-WAVE TRANSIENT GW150914” (2016, ApJL, 826, L13)

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, B. P.; Abbott, R.; Abernathy, M. R.; Adhikari, R. X. [LIGO, California Institute of Technology, Pasadena, CA 91125 (United States); Abbott, T. D. [Louisiana State University, Baton Rouge, LA 70803 (United States); Acernese, F.; Addesso, P. [Università di Salerno, Fisciano, I-84084 Salerno (Italy); Ackley, K. [University of Florida, Gainesville, FL 32611 (United States); Adams, C. [LIGO Livingston Observatory, Livingston, LA 70754 (United States); Adams, T. [Laboratoire d’Annecy-le-Vieux de Physique des Particules (LAPP), Université Savoie Mont Blanc, CNRS/IN2P3, F-74941 Annecy-le-Vieux (France); Adya, V. B.; Affeldt, C.; Allen, B. [Albert-Einstein-Institut, Max-Planck-Institut für Gravitationsphysik, D-30167 Hannover (Germany); Agathos, M.; Agatsuma, K. [Nikhef, Science Park, 1098 XG Amsterdam (Netherlands); Aggarwal, N. [LIGO, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Aguiar, O. D. [Instituto Nacional de Pesquisas Espaciais, 12227-010 São José dos Campos, SP (Brazil); Aiello, L. [INFN, Gran Sasso Science Institute, I-67100 L’Aquila (Italy); Ain, A. [Inter-University Centre for Astronomy and Astrophysics, Pune 411007 (India); Ajith, P., E-mail: lsc-spokesperson@ligo.org, E-mail: virgo-spokesperson@ego-gw.eu, E-mail: Julie.E.McEnery@nasa.gov [International Centre for Theoretical Sciences, Tata Institute of Fundamental Research, Bangalore 560012 (India); Collaboration: LIGO Scientific Collaboration and the Virgo Collaboration; Australian Square Kilometer Array Pathfinder (ASKAP) Collaboration; BOOTES Collaboration; Dark Energy Survey and the Dark Energy Camera GW-EM Collaborations; Fermi GBM Collaboration; Fermi LAT Collaboration; GRAvitational Wave Inaf TeAm (GRAWITA); INTEGRAL Collaboration; Intermediate Palomar Transient Factory (iPTF) Collaboration; InterPlanetary Network; J-GEM Collaboration; La Silla–QUEST Survey; Liverpool Telescope Collaboration; Low Frequency Array (LOFAR) Collaboration; MASTER Collaboration; MAXI Collaboration; Murchison Wide-field Array (MWA) Collaboration; Pan-STARRS Collaboration; PESSTO Collaboration; Pi of the Sky Collaboration; SkyMapper Collaboration; Swift Collaboration; TAROT, Zadko, Algerian National Observatory, and C2PU Collaboration; TOROS Collaboration; VISTA Collaboration; and others

    2016-07-01

    This Supplement provides supporting material for Abbott et al. (2016a). We briefly summarize past electromagnetic (EM) follow-up efforts as well as the organization and policy of the current EM follow-up program. We compare the four probability sky maps produced for the gravitational-wave transient GW150914, and provide additional details of the EM follow-up observations that were performed in the different bands.

  14. SUPPLEMENT: “LOCALIZATION AND BROADBAND FOLLOW-UP OF THE GRAVITATIONAL-WAVE TRANSIENT GW150914” (2016, ApJL, 826, L13)

    International Nuclear Information System (INIS)

    Abbott, B. P.; Abbott, R.; Abernathy, M. R.; Adhikari, R. X.; Abbott, T. D.; Acernese, F.; Addesso, P.; Ackley, K.; Adams, C.; Adams, T.; Adya, V. B.; Affeldt, C.; Allen, B.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.

    2016-01-01

    This Supplement provides supporting material for Abbott et al. (2016a). We briefly summarize past electromagnetic (EM) follow-up efforts as well as the organization and policy of the current EM follow-up program. We compare the four probability sky maps produced for the gravitational-wave transient GW150914, and provide additional details of the EM follow-up observations that were performed in the different bands.

  15. SUPPLEMENT: "LOCALIZATION AND BROADBAND FOLLOW-UP OF THE GRAVITATIONAL-WAVE TRANSIENT GW150914" (2016, ApJL, 826, L13)

    NARCIS (Netherlands)

    Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Phythian-Adams, A.T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.T.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allocca, A.; Altin, P. A.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, R.D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Barthelmy, S.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Behnke, B.; Bejger, M.; Bell, A. S.; Bell, C. J.; Berger, B. K.; Bergman, J.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, M.J.; Birney, R.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, A.L.S.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, J.G.; Bogan, C.; Bohe, A.; Bojtos, P.; Bond, T.C; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Brooks, A. F.; Brown, A.D.; Brown, D.; Brown, N. M.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Bustillo, J. Calderon; Callister, T. A.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Diaz, J. Casanueva; Casentini, C.; Caudill, S.; Cavaglia, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Baiardi, L. Cerboni; Cerretani, G.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chan, M.; Chao, D. S.; Charlton, P.; Chassande-Mottin, E.; Chen, H. Y.; Chen, Y; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Qian; Chua, S. E.; Chung, E.S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P. -F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M., Jr.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, A.C.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J. -P.; Countryman, S. T.; Couvares, P.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, A.L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dattilo, V.; Dave, I.; Daveloza, H. P.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; Debra, D.; Debreczeni, G.; Degallaix, J.; De laurentis, M.; Deleglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.A.; DeRosa, R. T.; Rosa, R.; DeSalvo, R.; Dhurandhar, S.; Diaz, M. C.; Di Fiore, L.; Giovanni, M.G.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Dojcinoski, G.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H. -B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Engels, W.; Essick, R. C.; Etzel, T.; Evans, T. M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.M.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M; Fournier, J. -D.; Franco, S; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gatto, A.; Gaur, G.; Gehrels, N.; Gemme, G.; Gendre, B.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghosh, A.; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.P.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; Gonzalez, Idelmis G.; Castro, J. M. Gonzalez; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Lee-Gosselin, M.; Gouaty, R.; Graef, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.M.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Buffoni-Hall, R.; Hall, E. D.; Hammond, G.L.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, P.J.; Hardwick, T.; Haris, K.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C. -J.; Haughian, K.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Hofman, D.; Hollitt, S. E.; Holt, K.; Holz, D. E.; Hopkins, P.; Hosken, D. J.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huang, S.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Idrisy, A.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J. -M.; Isi, M.; Islas, G.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jang, D.H.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jimenez-Forteza, F.; Johnson, W.; Jones, I.D.; Jones, R.; Jonker, R. J. G.; Ju, L.; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.H.; Kanner, J. B.; Karki, S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kawazoe, F.; Kefelian, F.; Kehl, M. S.; Keitel, D.; Kelley, D. B.; Kells, W.; Kennedy, R.E.; Key, J. S.; Khalaidovski, A.; Khalili, F. Y.; Khan, I.; Khan., S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, C.; Kim, J.; Kim, K.; Kim, Namjun; Kim, Namjun; Kim, Y.M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koehlenbeck, S. M.; Kokeyama, K.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringel, V.; Krolak, A.; Krueger, C.; Kuehn, G.; Kumar, P.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lange, J.; Lantz, B.; Lasky, P. D.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C.H.; Lee, K.H.; Lee, M.H.; Lee, K.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B. M.; Libson, A.; Littenberg, T. B.; Lockerbie, N. A.; Logue, J.; Lombardi, A. L.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lueck, H.; Lundgren, A. P.; Luo, J.; Lynch, R.; Ma, Y.; MacDonald, T.T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magana-Sandoval, F.; Magee, R. M.; Mageswaran, M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandel, I.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Marka, S.; Marka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R.M.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merilh, E. L.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B.C.; Moore, J.C.; Moraru, D.; Gutierrez Moreno, M.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Muir, A. W.; Mukherjee, A.; Mukherjee, S.D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P.G.; Mytidis, A.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nedkova, K.; Nelemans, G.; Gutierrez-Neri, M.; Neunzert, A.; Newton-Howes, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E. N.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J.; Oh, S. H.; Ohme, F.; Oliver, M. B.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palliyaguru, N.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.S; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Patrick, Z.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Phelps, M.; Piccinni, O. J.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powell, J.; Prasad, J.; Predoi, V.; Premachandra, S. S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L. G.; Puncken, O.; Punturo, M.; Puppo, P.; Puerrer, M.; Qi, H.; Qin, J.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Riles, K.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romanov, G.; Romie, J. H.; Rosinska, D.; Rowan, S.; Ruediger, A.; Ruggi, P.; Ryan, K.A.; Sachdev, P.S.; Sadecki, T.; Sadeghian, L.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, J; Schmidt, P.; Schnabel, R.B.; Schofield, R. M. S.; Schoenbeck, A.; Schreiber, K.E.C.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, M.S.; Sellers, D.; Sentenac, D.; Sequino, V.; Sergeev, A.; Serna, G.; Setyawati, Y.; Sevigny, A.; Shaddock, D. A.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shao, Z.M.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sigg, D.; Silva, António Dias da; Simakov, D.; Singer, A; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, R. J. E.; Smith, N.D.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stone, J.R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strauss, N. A.; Strigin, S. E.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sutton, P. J.; Swinkels, B. L.; Szczepanczyk, M. J.; Tacca, M.D.; Talukder, D.; Tanner, D. B.; Tpai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, W.R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Tomlinson, C.; Tonelli, M.; Torres, C. V.; Torrie, C. I.; Tyr, D.; Travasso, F.; Traylor, G.; Trifiro, D.; Tringali, M. C.; Trozzo, L.; Tse, M.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; Van Beuzekom, Martin; van den Brand, J. F. J.; Van Den Broeck, C.F.F.; Vander-Hyde, D. C.; van der Schaaf, L.; van Heijningen, J. V.; van Veggel, A. A.; Vardaro, M.; Vass, S.; Vasuth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P.J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Vicere, A.; Vinciguerra, S.; Vine, D. J.; Vinet, J. -Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D. V.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, MT; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, X.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Weaver, B.; Wei, L. -W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.M.; Wessels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Williams, D.R.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Worden, J.; Wright, J.L.; Wu, G.; Yablon, J.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, H. -F.; Yvert, M.; Zadrozny, A.; Zangrando, L.; Zanolin, M.; Zendri, J. -P.; Zevin, M.; Zhang, F.; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.; Allison, J.; Bannister, K.; Bell, E.M.; Chatterjee, S.; Chippendale, A. P.; Edwards, P. G.; Harvey-Smith, L.; Heywood, Ian; Hotan, A.; Indermuehle, B.; Marvil, J.; McConnell, D.; Murphy, Michael T.; Popping, A.; Reynolds, J.; Sault, R. J.; Voronkov, M. A.; Whiting, M. T.; Castro-Tirado, A. J.; Cunniffe, R.; Jelinek, M.; Tello, J. C.; Oates, S. R.; Hu, Y. M.; Kubanek, P.; Guziy, S.; Castellon, A.; Garcia-Cerezo, A.; Munoz, V. F.; Perez del Pulgar, C.; Castillo-Carrion, S.; Castro Ceron, J. M.; Hudec, R.; Caballero-Garcia, M. D.; Pata, P.; Vitek, S.; Adame, J. A.; Konig, S.; Rendon, F.; Mateo Sanguino, T. de J.; Munoz-Fernandez, R.; Yock, P. C.; Rattenbury, N.; Allen, W. H.; Querel, R.; Jeong, S.; Park, I. H.; Bai, J.C.; Cui, Ch.; Fan, Y.; Wang, Ch.; Hiriart, D.; Lee, W. H.; Claret, A.; Sanchez-Ramirez, R.; Pandey, S. B.; Mediavilla, T.; Sabau-Graziati, L.; Abbott, T. M. C.; Abdalla, F. B.; Allam, S.; Annis, J.; Armstrong, R.; Benoit-Levy, A.; Berger, Charles E H; Bernstein, R. A.; Bertin, E.; Brout, D.; Buckley-Geer, E.; Burke, D. L.; Capozzi, D.; Carretero, J.; Castander, F. J.; Chornock, R.; Cowperthwaite, P. S.; Crocce, M.; Cunha, C. E.; D'Andrea, C. B.; da Costa, L. N.; Desai, S.; Diehl, H. T.; Dietrich, J. P.; Doctor, Z.; Drlica-Wagner, A.; Drout, M. R.; Eifler, T. F.; Estrada, J.; Evrard, A. E.; Fernandez, E.; Finley, D. A.; Flaugher, B.; Foley, R. J.; Fong, W. -F.; Fosalba, P.; Fox, D. B.; Frieman, J.; Fryer, C. L.; Gaztanaga, E.; Gerdes, D. W.; Goldstein, D. A.; Gruen, D.; Gruendl, R. A.; Gutierrez, A.G.; Herner, K.; Honscheid, K.; James, J.D.M.; Johnson, M.D.; Johnson, M. W. G.; Karliner, I.; Kasen, D.; Kent, S.; Kessler, R.; Kim, A. G.; Kind, M. C.; Kuehn, K.; Kuropatkin, N.; Lahav, O.; Li, T. G. F.; Lima, M.; Lin, H.H.; Maia, M. A. G.; Margutti, R.; Marriner, J.; San Martini, P.; Matheson, T.; Melchior, P.; Metzger, B. D.; Miller, C. J.; Miquel, R.; Neilsen, E.; Nichol, R. C.; Nord, B.; Nugent, P.; Ogando, R.; Petravick, D.; Plazas, A. A.; Quataert, E.; Roe, N. A.; Romer, A. K.; Roodman, A.; Rosell, A. C.; Rykoff, E. S.; Sako, M.; Sanchez, E.; Scarpine, V.; Schindler, R. H.; Schubnell, M.; Scolnic, D.; Sevilla-Noarbe, I.; Sheldon, E.; Smith, N.; Smith, R. C.; Soares-Santos, M.; Sobreira, F.; Stebbins, A.; Suchyta, E.; Swanson, M. E. C.; Tarle, G.; Thaler, J.; Thomas, D.; Thomas, C.R.; Tucker, D. L.; Vikram, V.; Walker, A. R.; Wechsler, R. H.; Wester, W.; Yanny, B.; Zhang, Y.; Zuntz, J.; Connaughton, V.; Burns, J.E.; Goldstein, A.; Briggs, M. S.; Zhang, B.; Hui, C. M.; Jenke, P.; Wilson-Hodge, C. A.; Bhat, P. N.; Bissaldi, E.; Cleveland, W.; Fitzpatrick, G.; Giles, M. M.; Gibby, M. H.; Greiner, J.; von Kienlin, A.; Kippen, R. M.; McBreen, S.; Mailyan, B.; Meegan, C. A.; Paciesas, W. S.; Preece, R. D.; Roberts, W.O.; Sparke, L.; Stanbro, M.; Toelge, K.; Veres, P.; Yu, H. -F.; Blackburn, L.; Ackermann, M; Ajello, M.; Albert, M.A.; Anderson, B.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Barbiellini, G.; Bastieri, D.; Bellazzini, R.; Bissaldi, E.; Blandford, R. D.; Bloom, E. D.; Bonino, R.; Bottacini, E.; Brandt, T. J.; Bruel, P.; Buson, S.; Caliandro, G. A.; Cameron, R. A.; Caragiulo, M.; Caraveo, P. A.; Cavazzuti, E.; Charles, E.; Chekhtman, A.; Chiang, J.; Chiaro, G.; Ciprini, S.; Cohen-Tanugi, J.; Cominsky, L. R.; Costanza, F.; Cuoco, A.; D'Ammando, F.; de Palma, F.; Desiante, R.; Digel, S. W.; Di Lalla, N.; Di Mauro, M.; Di Venere, L.; Dominguez, A.; Drell, P. S.; DuBois, RN; Favuzzi, C.; Ferrara, E. C.; Franckowiak, A.; Fukazawa, Y.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Giglietto, N.; Giommi, P.; Giordano, F.; Giroletti, M.; Glanzman, T.; Godfrey, G.; Gomez-Vargas, G. A.; Green, D.; Grenier, I. A.; Grove, J. E.; Guiriec, S.; Hadasch, D.; Harding, A. K.; Hays, E.; Hewitt, J. W.; Hill, A. B.; Horan, D.; Jogler, T.; Johannesson, G.; Johnson, A.S.; Kensei, S.; Kocevski, D.; Kuss, M.; La Mura, G.; Larsson, S.; Latronico, L.; Li, J.; Li, L.; Lopez-Longo, F.J.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Magill, J.; Maldera, S.; Manfreda, A.; Marelli, M.; Mayer, M.; Mazziotta, M. N.; McEnery, J. E.; Meyer, M.; Michelson, P. F.; Mirabal, N.; Mizuno, T.; Moiseev, A. A.; Monzani, M. E.; Moretti, E.; Morselli, A.; Moskalenko, I. V.; Negro, M.; Nuss, E.; Ohsugi, T.; Omodei, N.; Orienti, M.; Orlando, E.; Ormes, J. F.; Paneque, D.; Perkins, J. S.; Pesce-Rollins, M.; Piron, F.; Pivato, G.; Porter, T. A.; Racusin, J. L.; Raino, S.; Rando, R.; Razzaque, S.; Reimer, A.; op Reimer, W.S.; Salvetti, D.; Parkinson, P. M. Saz; Sgro, C.; Di Simone, D.; Siskind, E. J.; Spada, F.; Spandre, G.; Spinelli, P.; Suson, D. J.; Tajima, H.; Thayer, J. B.; Thompson, D.J.; Tibaldo, L.; Torres, D. F.; Troja, E.; Uchiyama, Y.; Venters, T. M.; Vianello, G.; Wood, K. S.; Wood, M.D.; Zhu, Y. S.; Zimmer, S.; Brocato, E.; Cappellaro, E.; Covino, S.; Grado, A.; Nicastro, L.; Palazzi, E.; Pian, E.; Amati, L.; Antonelli, L. A.; Capaccioli, M.; D'Avanzo, P.; D'Elia, V.; Getman, F.; Giuffrida, G.; Iannicola, G.; Limatola, L.; Lisi, M.; Marinoni, S.; Marrese, P.; Melandri, A.; Piranomonte, S.; Possenti, A.; Pulone, L.; Rossi, A.; Stamerra, A.; Stella, L.; Testa, V.; Tomasella, L.; Yang, S.; Bazzano, A.; Bozzo, E.; Brandt, K.S.; Courvoisier, T. J. -L.; Ferrigno, C.; Hanlon, L.; Kuulkers, E.; Laurent, P.; Mereghetti, S.; Roques, J. P.; Savchenko, V.; Ubertini, P.; Kasliwal, M. M.; Singer, L. P.; Cao, Y.; Duggan, G.; Kulkarni, S. R.; Bhalerao, V.; Miller, A. L.; Barlow, T.; Bellm, E.; Manulis, I.; Rana, J.; Laher, R.; Masci, F.; Surace, J.; Rebbapragada, U.; Cook, D.; Van Sistine, A.; Sesar, B.; Perley, D.; Ferreti, R.; Thivichon-Prince, Béatrice; Kendrick, R.; Horesh, A.; Hurley, K.; Golenetskii, S. V.; Aptekar, R. L.; Frederiks, D. D.; Svinkin, D. S.; Rau, A.; von Kienlin, A.; Zhang, X.; Smith, M.D.; Cline, T.; Krimm, H.; Abe, F.; Doi, Masao; Fujisawa, K.; Kawabata, K. S.; Morokuma, T.; Motohara, K.; Tanaka, M.; Ohta, K.; Yanagisawa, K.; Yoshida, M; Baltay, C.; Rabinowitz, J.D.; Ellman, N.; Rostami, S.; Bersier, D. F.; Bode, M. F.; Collins, C. A.; Copperwheat, C. M.; Darnley, M. J.; Galloway, D. K.; Gomboc, A.; Kobayashi, S.; Mazzali, P.; Mundell, C. G.; Piascik, A. S.; Pollacco, Don; Steele, I. A.; Ulaczyk, K.; Broderick, J. W.; Fender, R. P.; Jonker, P. G.; Rowlinson, A.; Stappers, B. W.; Wijers, R. A. M. J.; Lipunov, V.; Gorbovskoy, E.; Tyurina, N.; Kornilov, V.; Balanutsa, P.; Kuznetsov, Y.A.; Buckley, C.D.; Rebolo, R.; Serra-Ricart, M.; Israelian, G.; Budnev, N. M.; Gress, O.; Ivanov, M.K.; Poleshuk, V.; Tlatov, A.; Yurkov, V.; Kawai, N.; Serino, M.; Negoro, H.; Nakahira, S.; Mihara, T.; Tomida, H.; Ueno, S.; Tsunemi, H.; Matsuoka, M.; Croft, S.; Feng, L.; Franzen, T. M. O.; Gaensler, B. M.; Johnston-Hollitt, M.; Kaplan, D. L.; Morales, M. F.; Tingay, S. J.; Wayth, R. B.; Williams, A.; Smartt, S. J.; Chambers, K. C.; Smith, K. W.; Huber, M. E.; Young, D. R.; Wright, D.E.; Schultz, A.; Denneau, L.; Flewelling, H.; Magnier, E. A.; Primak, N.; Rest, A.; Sherstyuk, A.; Stalder, B.; Stubbs, C. W.; Tonry, J.; Waters, C.; Willman, M.; Olivares E, F.; Campbell, H.; Kotak, R.; Sollerman, J.; Smith, M.; Dennefeld, M.; Anderson, J. P.; Botticella, M. T.; Chen, T. -W.; Valle, M. D.; Elias-Rosa, N.; Fraser, R.M.; Inserra, C.; Kankare, E.; Kupfer, T.; Harmanen, J.; Galbany, L.; Le Guillou, L.; Lyman, J. D.; Maguire, K.; Mitra, A.; Nicholl, M.; Razza, A.; Terreran, G.; Valenti, S.; Gal-Yam, A.; Cwiek, A.; Cwiok, M.; Mankiewicz, L.; Opiela, R.; Zaremba, M.; Zarnecki, A. F.; Onken, C. A.; Scalzo, R. A.; Schmidt, B. P.; Wolf, C.; Yuan, F.; Evans, P.A.; Kennea, J. A.; Burrows, D. N.; Campana, S.; Cenko, S. B.; Giommi, P.; Marshall, F. E.; Nousek, J.; O'Brien, P.; Osborne, J. P.; Palmer, D.; Perri, L. M.; Siegel, M.J.; Tagliaferri, G.; Klotz, A.; Turpin, D.; Laugier, R.; Beroiz, M.; Penuela, T.; Macri, L. M.; Oelkers, R. J.; Lambas, D. G.; Vrech, R.; Cabral, J.; Colazo, C.; Dominguez, M.; Sanchez, B.; Gurovich, S.; Lares, M.; Marshall, J.L.; Depoy, D. L.; Padilla, N.D.; Pereyra, N. A.; Benacquista, M.; Tanvir, N. R.; Wiersema, K.; Levan, A. J.; Steeghs, D.; Hjorth, J.; Fynbo, J.P.U.; Malesani, D.; Milvang-Jensen, B.; Watson, D.; Irwin, M.; Fernandez, G.C.; McMahon, R. G.; Banerji, M.; Gonzalez-Solares, E.; Schulze-Topphoff, U.; Postigo, A. de U.; Thoene, C. C.; Cano, Z.; Rosswog, S.

    This Supplement provides supporting material for Abbott et al. (2016a). We briefly summarize past electromagnetic (EM) follow-up efforts as well as the organization and policy of the current EM follow-up program. We compare the four probability sky maps produced for the gravitational-wave transient

  16. Comment to the sentence of the provincial audience of Valencia nº. 949/2011 826 23-11-2011: No registration in the civil register of the born minors by means of gestation by replacement Comentario a la sentencia de la audiencia provincial de Valencia núm. 949/2011 826 23-11/2011: No inscripción en el registro civil de los menores nacidos mediante gestación por sustitución

    Directory of Open Access Journals (Sweden)

    Yvette Velarde D'Amil

    2012-12-01

    Full Text Available The Judgement of the Provincial Court of Valencia is, currently, the latest link in a series of events which main issues are the willingness for paternage, the freedom of the parties to choose, the technology of human assissted reproduction (surrogacy and the legal status of children born by international surrogacy arrangements and its possible conflict with mandatory Spanish laws and with a series of general legal principles consecrated in the Spanish Constitution, such as the normative hierarchy, the non-commerciality of human being, the respect for their dignity, and the protection of the superior welfare of the minor, among others.La Sentencia de la Audiencia Provincial de Valencia es de momento, el último eslabón de una serie de hechos que tienen como cuestión de fondo el anhelo de la paternidad, la autonomía de la voluntad de las partes, la técnica de reproducción humana asistida denominada gestación por sustitución y la situación jurídica de los niños nacidos mediante acuerdos internacionales de maternidad subrogada y su posible contradicción con leyes imperativas españolas y con una serie de principios generales del Derecho consagrados por la Constitución Española, como la jerarquía normativa, la no comercialidad de la persona humana, el respeto a su dignidad, y la protección del interés superior del menor, entre otros.

  17. 49 CFR 571.216a - Standard No. 216a; Roof crush resistance; Upgraded standard.

    Science.gov (United States)

    2010-10-01

    ... (SAE) Standard J826 “Devices for Use in Defining and Measuring Vehicle Seating Accommodation,” SAE J826... Automotive Engineers, Inc., 400 Commonwealth Drive, Warrendale, PA 15096. Phone: 1-724-776-4841; Web: http... J826, revised July 1995, “Devices for Use in Defining and Measuring Vehicle Seating Accommodation...

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

  19. Pop / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2002-01-01

    Heliplaatidest Starsailor" Love is Here". Chicago Underground Quartet "Chicago Underground Quartet". Mower "Mower". Kim Wilde "The Very Best of". Mull Historical Society "Loss". Jill Scott "Experience: 826+"

  20. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    00) and at night (between 00:00 and 04:00), and found that participants reported lower levels of sleepiness and fatigue, pii: sp-00684-15 ht tp...Chief Psychologist, GovSource, Inc., U.S. Department of Defense (DoD) Contractor 8/08 Consulting Psychologist, The Brain Institute, University of

  1. 77 FR 825 - Notice of Applications for Deregistration Under Section 8(f) of the Investment Company Act of 1940

    Science.gov (United States)

    2012-01-06

    ... of Investment Management, Office of Investment Company Regulation, 100 F Street NE., Washington, DC... Investment Management, LLC, applicant's investment adviser. Filing Dates: The application was filed on... by Robeco [[Page 826

  2. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,826 views 5:21 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...

  3. Modelling discontinuous well log signal to identify lithological ...

    Indian Academy of Sciences (India)

    1Indian School of Mines (ISM), Dhanbad 826 004, India. ... new wavelet transform-based algorithm to model the abrupt discontinuous changes from well log data by taking care of ...... the 11th ACM International Conference on Multimedia,.

  4. Iron Test

    Science.gov (United States)

    ... 793, 826-827. Harmening D, Clinical Hematology and Fundamentals of Hemostasis, Fifth Edition, F.A. Davis Company, ... htm. Accessed June 2009. Henry's Clinical Diagnosis and Management by Laboratory Methods . 21st ed. McPherson RA and ...

  5. 78 FR 24775 - Certain Wireless Communication Devices, Portable Music and Data Processing Devices, Computers and...

    Science.gov (United States)

    2013-04-26

    ... Devices, Portable Music and Data Processing Devices, Computers and Components Thereof; Commission Decision... importation of certain wireless communication devices, portable music and data processing devices, computers... '826 patent''). The complaint further alleges the existence of a domestic industry. The Commission's...

  6. Constitutive Modeling of Epoxy Using the Mulliken-Boyce Model for Glassy Polymers

    National Research Council Canada - National Science Library

    Foley, Jason R; Jordan, Jennifer L; Siviour, Clive R

    2008-01-01

    .... Correspondingly, the high strain rate mechanical properties are of increasing importance. This paper gives results from an initial investigation of the properties of bisphenol-A/diethanolamine epoxy (Epon 826/DEA...

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 83; Issue 3. Elastic constants and Debye temperature of wz-AlN and wz-GaN semiconductors under high ... Department of Electronic Engineering, Indian School of Mines, Dhanbad 826 ...

  8. Thule AB, Greenland. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

    Science.gov (United States)

    1981-12-18

    97.S 97.6 97.6 98.3 800 90. 92.1 92. 96.0 96.1 96.4 96.9 97. 97.2 97.2 97.2 97.5 97.6 97.6 98.; S700 90. 92. 92. 96.0 96.1 96.4 96.9 97.0 97.2 97.2...82:1 82.2 82.6 82.6 82,6 83o1 83’ 83.5 83,8 83.9 85.0 85.5 Soo 12. 7:l 80. 80o 82.] 82.2 82.6 82.6 82.6 83’ 831 83.5 83.9 8’,1 85.1 85.6 S700 12...96o3 800 3r 831 87.9 88. 92.S 92.7 94.3 95.4 9S.4 95.6 95.8 95.8 96.5 96.5 96.9 97.1 S700 3:. 831 87.9 88. 92.5 92. 94.4 95.6 95o6 95o8 96.1 96.1 96o7

  9. U.S. Army Field Demonstration of the Single Common Powertrain Lubricant (SCPL)

    Science.gov (United States)

    2015-02-01

    826.8 1317.8 2396.6 3000.5 4140 Accum. - 177.8 709 1144.1 1865.5 2636.8 3136.3 3988.8...nominally SAE 0W20) SCPL is capable of providing adequate component protection when used in place of the higher viscosity 15W40 MIL-PRF-2104 lubricants...51934.8 52434.3 53286.8 Accum. - 61.1 302 826.8 1317.8 2396.6 3000.5 4140 Accum. - 177.8 709 1144.1 1865.5 2636.8 3136.3 3988.8 Hours - - - - - - - - Hours

  10. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 815-826 Research Articles. Soliton dynamics in a modified Yakushevich model · P C Dash M Panigrahi · More Details Fulltext PDF. pp 827-839 Research Articles. Shape change in Hf, W and Os-isotopes: A non-relativistic Hartree-Fock versus relativistic Hartree approximation · Z Naik B K Sharma T K Jha P Arumugam ...

  11. Prevalence and characteristics of chronic kidney disease among Danish adults with cystic fibrosis

    DEFF Research Database (Denmark)

    Berg, Kristina H; Ryom, Lene; Faurholt-Jepsen, Daniel

    2018-01-01

    median duration of chronic pulmonary infection (28.3 (20.0-35.8) vs. 20.0 (9.9-34.7) years; p=0.008) and with longer intravenous aminoglycosides use (606 (IQR, 455-917) vs. 273 (IQR, 91-826) days, p=0.005). CONCLUSIONS: The CKD prevalence is high and related to age, diabetes, chronic infection...

  12. 78 FR 8511 - RPA Energy, Inc.; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for...

    Science.gov (United States)

    2013-02-06

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER13-826-000] RPA Energy, Inc.; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for Blanket Section 204 Authorization This is a supplemental notice in the above-referenced proceeding, of RPA Energy, Inc...

  13. A novel FKRP-related muscular dystrophy founder mutation in South ...

    African Journals Online (AJOL)

    porphyria variegata, familial hypercholesterolaemia, Gaucher's dis- ease and autosomal recessive polycystic kidney disease.[7-11]. FKRP founder mutations have been described in a number of populations around the world, for example the c.826C>A. (p.Leu276Ile) FKRP mutation in 20 LGMD German patients[12].

  14. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil.

    Science.gov (United States)

    Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

    2015-03-26

    We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.

  15. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil

    OpenAIRE

    Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

    2015-01-01

    We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.

  16. Acoustic axes in weak triclinic anisotropy

    Czech Academy of Sciences Publication Activity Database

    Vavryčuk, Václav

    2005-01-01

    Roč. 163, č. 2 (2005), s. 629-638 ISSN 0956-540X R&D Projects: GA AV ČR IAA3012309 Institutional research plan: CEZ:AV0Z30120515 Keywords : elastic-wave theory * perturbation methods * seismic anisotropy Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.826, year: 2005

  17. 48 CFR 44.400 - Scope of subpart.

    Science.gov (United States)

    2010-10-01

    ... SUBCONTRACTING POLICIES AND PROCEDURES Subcontracts for Commercial Items and Commercial Components 44.400 Scope... required to apply to any subcontractors that are furnishing commercial items or commercial components in accordance with Section 8002(b)(2) of Public Law 103-355 and Section 826 of Public Law 110-181 (10 U.S.C...

  18. Forest fires within a temperate landscape: A decadal and millennial perspective from a sandstone region in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Adámek, Martin; Bobek, Přemysl; Hadincová, Věroslava; Wild, Jan; Kopecký, Martin

    2015-01-01

    Roč. 336, Jan 15 (2015), s. 81-90 ISSN 0378-1127 R&D Projects: GA ČR(CZ) GA14-22658S Institutional support: RVO:67985939 Keywords : wildfire * fire regima * pine forests Subject RIV: EH - Ecology, Behaviour Impact factor: 2.826, year: 2015

  19. Oni et al. (2)

    African Journals Online (AJOL)

    ±0.4C; ... Keywords: Bacteria, Fungal, Clarias gariepinus, Culture media ..... S.E. Water*. 5.20±0.78 6.08±0.70. 5.427**. Skin. 8.38±0.92 8.26±0.75. 0.098 .... epizootic ulcerative syndrome in India- an ... animal health emergencies in Asia. pp.

  20. CGP74514A Enhances TRAIL-induced Apoptosis in Breast Cancer Cells by Reducing X-linked Inhibitor of Apoptosis Protein

    Czech Academy of Sciences Publication Activity Database

    Park, S.; Shim, S.M.; Nam, S.H.; Anděra, Ladislav; Suh, N.; Kim, I.

    2014-01-01

    Roč. 34, č. 7 (2014), s. 3557-3562 ISSN 0250-7005 R&D Projects: GA MŠk LH12202 Institutional support: RVO:68378050 Keywords : TRAIL * Apoptosis * Breast carcinom Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.826, year: 2014

  1. Productivity CO2/O2 exchange and hydraulics in outdoor open high density microalgal (Chlorella sp.) photobioreactors operated in a Middle and Southern European climate

    Czech Academy of Sciences Publication Activity Database

    Doucha, Jiří; Lívanský, Karel

    2006-01-01

    Roč. 18,-, (2006), s. 811-826 ISSN 0921-8971 R&D Projects: GA ČR(CZ) GV104/97/S055; GA ČR(CZ) GA104/02/0410 Institutional research plan: CEZ:AV0Z50200510 Keywords : performance * photobioreactor * thin layer Subject RIV: EE - Microbiology, Virology Impact factor: 0.746, year: 2006

  2. 76 FR 44575 - Paper Clips From the People's Republic of China: Continuation of the Antidumping Duty Order

    Science.gov (United States)

    2011-07-26

    ..., butterfly clips, binder clips, or other paper fasteners that are not made wholly of wire of base metal and... DEPARTMENT OF COMMERCE International Trade Administration [A-570-826] Paper Clips From the People... the antidumping duty order on paper clips from the People's Republic of China (``PRC'') would likely...

  3. Early Regression of the Dental Lamina Underlies the Development of Diphyodont Dentitions

    Czech Academy of Sciences Publication Activity Database

    Buchtová, Marcela; Štembírek, J.; Glocová, K.; Matalová, Eva; Tucker, A.S.

    2012-01-01

    Roč. 91, č. 5 (2012), s. 491-498 ISSN 0022-0345 R&D Projects: GA AV ČR KJB601110910 Institutional research plan: CEZ:AV0Z50450515 Keywords : developmental biology * dental morphology * tooth development Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.826, year: 2012

  4. 50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...

  5. Role of Steric Hindrance in the Crystal Packing of Z′ = 4 Superstructure of Trimethyltin Hydroxide

    KAUST Repository

    Dey, S.; Schö nleber, A.; Mondal, S.; Ali, S. I.; van Smaalen, S.

    2018-01-01

    The roomerature crystal structure of trimethyltin hydroxide, (CH)SnOH, has been described by Anderson et al. [Cryst. Growth Des. 2011, 11, 820-826] as a 2a × 2b × 8c, 32-fold superstructure. We report a a × b × 8c, eight-fold superstructure

  6. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Stress discontinuity moves with non-uniform velocity and is impulsive in nature. The displacements are obtained in exact form by themethod ... D Mandal1 2 P C Pal2 S Kumar2. Government Engineering College, Chaibasa 833 215, India; Department of Applied Mathematics, Indian School of Mines, Dhanbad 826 004, India ...

  7. A new animal model for the imaging of melanoma: correlation of FDG PET with clinical outcome, macroscopic aspectand histological classification in Melanoblastoma-bearing Libechov Minipigs

    Czech Academy of Sciences Publication Activity Database

    Boisgard, R.; Naulleau, S. V.; Leplat, J. J.; Bouet, S.; Chalony, C.; Tricaud, Y.; Horák, Vratislav; Geffrotin, C.; Frelat, G.; Tavitian, B.

    2003-01-01

    Roč. 30, č. 6 (2003), s. 826-834 ISSN 1619-7070 R&D Projects: GA ČR GA524/01/0162 Institutional research plan: CEZ:AV0Z5045916 Keywords : melanoma * MeLiM swinw model Subject RIV: ED - Physiology Impact factor: 3.324, year: 2003

  8. Short Note Invasive Australian crayfish Cherax quadricarinatus in ...

    African Journals Online (AJOL)

    Most crayfish were between 50 and 59.9 mm carapace length. Males (average 82.6 g) were significantly heavier than females (37.2 g) and males were larger in carapace length, carapace width, chela length and chela width. A feral population of C. quadricarinatus is now established in the Sanyati Basin. Possible modes of ...

  9. Principles of RNA base pairing: Structures and energies of cis and trans-Watson-Crick/Sugar Edge base pairs revealed by quantum chemical calculations

    Czech Academy of Sciences Publication Activity Database

    Šponer, Judit E.; Leszczynski, J.; Šponer, Jiří

    2005-01-01

    Roč. 22, č. 6 (2005), s. 826 ISSN 0739-1102. [Albany 2005. Conversation /14./. 14.06.2005-18.06.2005, Albany] Institutional research plan: CEZ:AV0Z50040507 Keywords : RNA base pairing * DNA * Watson-Crick/Sugar Edge Subject RIV: BO - Biophysics

  10. Impact of air pollution and genotype variability on DNA damage in Prague policemen

    Czech Academy of Sciences Publication Activity Database

    Novotná, Božena; Topinka, Jan; Solanský, I.; Chvátalová, Irena; Lněničková, Zdena; Šrám, Radim

    2007-01-01

    Roč. 172, - (2007), s. 37-47 ISSN 0378-4274 R&D Projects: GA MŽP SL/5/160/05 Institutional research plan: CEZ:AV0Z50390512 Keywords : oxidative DNA damage * comet assay * carcinogenic polycyclic aromatic hydrocarbons Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 2.826, year: 2007

  11. Audit of stillbirths in a Nigerian teaching hospital

    African Journals Online (AJOL)

    reviewed in detail to determine the cause of death and identify gaps in the care. ... System. Remote contributors to fetal demise were assigned using a ... Antepartum death constituted 82.6% of SB among booked patients compared to 41.2% in ...

  12. Coppice abandonment and its implications for species diversity in forest vegetation

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Jana; Hédl, Radim; Szabó, Péter

    2015-01-01

    Roč. 343, May 1 (2015), s. 88-100 ISSN 0378-1127 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : conversation * forest management * history Subject RIV: EF - Botanics Impact factor: 2.826, year: 2015

  13. Inappropriate complementary feeding practice increases risk of stunting in children aged 12-24 months

    Directory of Open Access Journals (Sweden)

    Hijra Hijra

    2016-12-01

    Inappropriate complementary feeding practice increased the risk of stunting in 12-24 months old children by 8.26. This study confirms the need to scale up interventions during the first 2 years of life, including appropriate infant feeding practices.

  14. Numerical simulation of a passive twin-core fibre nonlinear coupler ring laser

    Czech Academy of Sciences Publication Activity Database

    Zhu, Y.; Hauderek, V. A.; Kaňka, Jiří; Rogers, A. J.

    1999-01-01

    Roč. 146, č. 4 (1999), s. 204-208 ISSN 1350-2433 Grant - others:EU COPERNICUS(XE) CIPA3510CT937882 Institutional research plan: CEZ:AV0Z2067918 Keywords : optical fibres * fibre lasers * optical solitons Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.826, year: 1999

  15. Chromospheric Heating By Acoustic Waves Compared To Radiative Cooling

    Czech Academy of Sciences Publication Activity Database

    Sobotka, Michal; Heinzel, Petr; Švanda, Michal; Jurčák, Jan; Del Moro, D.

    2016-01-01

    Roč. 826, č. 1 (2016), 49/1-49/8 ISSN 0004-637X R&D Projects: GA ČR(CZ) GA14-04338S Institutional support: RVO:67985815 Keywords : Sun * chromosphere * faculae, Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016

  16. A pig growth model for assessment of environmental footprint from swine operations: Effect of dietary energy and lysine

    DEFF Research Database (Denmark)

    Strathe, Anders Bjerring; Danfær, Allan Christian; Jørgensen, Henry

    2011-01-01

    can either be defined by the user or ad libitum intake may be simulated by means of an algorithm for metabolic regulation. The model was developed using the open source software R. The data of Bikker et al. (1994, 1995 and 1996) [J. Anim. Sci. 72:1744–1753, 73:2355–2363 and 74:817–826] was used...

  17. Examining Education and Newsroom Work Experience as Predictors of Communication Students' Perceptions of Journalism Ethics

    Science.gov (United States)

    Detenber, Benjamin H.; Cenite, Mark; Malik, Shelly; Neo, Rachel L.

    2012-01-01

    This study examines education and work experience in newsrooms as predictors of ethical perceptions among communication undergraduates at a large Singaporean university (N = 826). Results indicate that education is associated with ethical ideologies, perceived importance of journalism ethics codes, justifiability of using contentious news…

  18. Utilization of available water resources in the Northern Part of the ...

    African Journals Online (AJOL)

    While the general physico-chemical quality (e.g. ECw = 53 - 826 mS cm-1) of both surface and groundwater sources was considered good for domes-tic supply the results of bacteriological analysis showed extremely high levels of faecal and coliform counts, likely to cause health hazards. Journal of Applied Science ...

  19. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Period: 2002–2006. Shalivahan, Dr. Date of birth: 10 March 1971. Specialization: Nonlinear Inversion, Electrical & Electromagnetic Methods Address during Associateship: Department of Applied Geophysics, Indian School of Mines, Dhanbad 826 004. Contact: Email: sv@perl.ism.ac.in. YouTube; Twitter; Facebook; Blog ...

  20. Structure function measurements from HERA

    Indian Academy of Sciences (India)

    ZEUS Collaboration: abstract 630, paper submitted to EPS Conference on HEP 2001, Budapest. ZEUS Collaboration: abstract 631, paper submitted to EPS Conference on HEP 2001, Budapest. [8] ZEUS Collaboration: abstract 765, paper submitted to ICHEP02 Conference, Amsterdam. 826. Pramana – J. Phys., Vol. 61, No.

  1. Public attitudes to organ donation in South Africa | Pike | South ...

    African Journals Online (AJOL)

    Public attitudes to organ donation may be influenced by cultural beliefs as well as racial prejudices and superstitions. In South Africa we are able to examine these issues from both a Firstand a Third-World perspective. In this study the attitudes of 1 299 urban white, 625 rural black and 826 urban black South Africans were ...

  2. Polynomial stabilization of some dissipative hyperbolic systems

    Czech Academy of Sciences Publication Activity Database

    Ammari, K.; Feireisl, Eduard; Nicaise, S.

    2014-01-01

    Roč. 34, č. 11 (2014), s. 4371-4388 ISSN 1078-0947 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : exponential stability * polynomial stability * observability inequality Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2014 http://www.aimsciences.org/journals/displayArticlesnew.jsp?paperID=9924

  3. Survey of bacterial pathogens on leaves and seeds of red mangrove ...

    African Journals Online (AJOL)

    Bacterial pathogens of red mangrove (Rhizophora mangle) were investigated. 50 samples each of leaves and seeds (healthy and diseased) were randomly collected and used for the analysis. Mean bacterial counts obtained were: healthy and diseased leaves; 8.26 x 103 and 5.9 l x l03 cfu/ml respectively; healthy seeds ...

  4. Some properties of spectral binary stars

    International Nuclear Information System (INIS)

    Krajcheva, Z.T.; Popova, E.I.; Tutukov, A.V.; Yungel'son, L.R.; AN SSSR, Moscow. Astronomicheskij Sovet)

    1978-01-01

    Statistical investigations of spectra binary stars are carried out. Binary systems consisting of main sequence stars are considered. For 826 binary stars masses of components, ratios of component masses, semiaxes of orbits and orbital angular momenta are calculated. The distributions of these parameters and their correlations are analyzed. The dependences of statistical properties of spectral binary stars on their origin and evolution are discussed

  5. Paediatric HIV/AIDS in Tertiary Health Facility: Presentation and ...

    African Journals Online (AJOL)

    Symptoms at presentation were fever of more than four weeks was the most frequently occurring in 82.6% oral candidiasis (78.2%) and diarrhea for more than four weeks 60.9%. The most common signs were oral candidiasis (78.2%), pyrexia (60.9%), wasting and generalized lymphadenopathy (56%) each. Commonly ...

  6. Radiotherapy-Induced Toxic and Side Effects

    African Journals Online (AJOL)

    Myelosuppression, Leucopenia and Gastrointestinal Tract. Disturbances ... Results: In cyclophosphamide- and Co60-induced leucopenia assays, the mean white blood cell count. (82.6 and .... was diluted by water to get 1000 mL (pH = 5.0 -.

  7. Effect on School Language in Assessment of Achievement

    African Journals Online (AJOL)

    Eric Wilmot

    The participants for the study consist of 1,826 sports administrators and organisers who were .... period of time. Influence is described ... Management of attention through a set of intension, or a vision in a sense of outcome, goal or direction. b.

  8. Multiplex RT-PCR detection of four aphid-borne strawberry viruses in Fragaria spp. in combination with a plant mRNA specific internal control

    Czech Academy of Sciences Publication Activity Database

    Thompson, J. R.; Wetzel, S.; Klerks, M. M.; Vašková, Dana; Schoen, C. D.; Špak, Josef; Jelkmann, W.

    2003-01-01

    Roč. 111, - (2003), s. 85-93 ISSN 0166-0934 Grant - others:GA-(EU) QRLT-PL99-1553 Institutional research plan: CEZ:AV0Z5051902 Keywords : virus diseases * strawberry * detection methods Subject RIV: EE - Microbiology, Virology Impact factor: 1.826, year: 2003

  9. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Tanushree Choudhury1 Nirendra M Misra2. Department of Chemistry, School of Advanced Sciences, VIT University Chennai Campus, Vandalur- Kelambakkam Road, Chennai- 600048, India; Department of Applied Chemistry, Indian School of Mines University, Dhanbad 826 004, India ...

  10. Short-term environmental variability in cold-water coral habitat at Viosca Knoll, Gulf of Mexico

    NARCIS (Netherlands)

    Davies, Andrew J.; Duineveld, Gerard C.A.; van Weering, T.C.E.; Mienis, Furu; Quattrini, Andrea M.; Seim, Harvey E.; Bane, John M.; Ross, Steve W.

    2010-01-01

    The Lophelia pertusa community at Viosca Knoll (VK826) is the most extensive found to date in the Gulf of Mexico. As part of a multi-disciplinary study, the physical setting of this area was described using benthic landers, CTD transects and remotely operated vehicle observations. The site was

  11. 28 CFR 90.100 - What is the scope of the grant program?

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false What is the scope of the grant program... program? This Subpart implements the Higher Education Amendments of 1998, Part E, section 826 (Pub. L. 105... administrators, security personnel, and regional crisis centers affiliated with the institution for two broad...

  12. Ultrasound effects.

    Science.gov (United States)

    Martin, A O

    1985-07-19

    In a listing of the new foreign associates of the National Academy of Sciences (News and Comment, 17 May, p. 826), the name of Pierre Chambon, Biochemistry, Institut de Chimie Biologique, Faculté de Médecine, Strasbourg, France, was inadvertently omitted.

  13. Can reduced stocking rates and natural forage utilization produce market sized catfish from fingerlings in one growing season

    Science.gov (United States)

    The purpose of this study was to determine the feasibility of growing marketable channel catfish Ictalurus punctatus from pond-run fingerlings (15.9 g/fish) using low stocking densities (7,413 or 14,826 fish/ha) and electrified bug lights to enhance natural forage available to fish. Even at low sto...

  14. In some symmetric spaces monotonicity properties can be reduced to the cone of rearrangements

    Czech Academy of Sciences Publication Activity Database

    Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2016-01-01

    Roč. 90, č. 1 (2016), s. 249-261 ISSN 0001-9054 Institutional support: RVO:67985840 Keywords : symmetric spaces * K-monotone symmetric Banach spaces * strict monotonicity * lower local uniform monotonicity Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2016 http://link.springer.com/article/10.1007%2Fs00010-015-0379-6

  15. The South African Air Force, 1920–2012: A Review of its History and ...

    African Journals Online (AJOL)

    Uvp

    for any country to have a well-balanced air force, it is the purpose of this article to ... commanders during the Anglo-Boer War, 1899–1902), went to Europe to attend military ..... Japan, from whence they proceeded to South Korea. All in all, 826 ...

  16. A simple approach to unsymmetric atropoisomeric bipyridine N,N'-dioxides and their application in enantioselective allylation of aldehydes

    Czech Academy of Sciences Publication Activity Database

    Hrdina, R.; Valterová, Irena; Hodačová, Jana; Císařová, I.; Kotora, Martin

    2007-01-01

    Roč. 349, č. 6 (2007), s. 822-826 ISSN 1615-4150 R&D Projects: GA ČR(CZ) GA203/05/0102; GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40550506 Keywords : allylation * asymmetric catalysis * Lewis bases Subject RIV: CC - Organic Chemistry Impact factor: 4.977, year: 2007

  17. Thermal stability of PMMA–clay hybrids

    Indian Academy of Sciences (India)

    Administrator

    Thermal stability of PMMA–clay hybrids. TANUSHREE CHOUDHURY* and NIRENDRA M MISRA. Department of Applied Chemistry, Indian School of Mines University, Dhanbad 826 004, India. MS received 9 December 2008. Abstract. Materials with small particle size are being extensively used in composites and hybrid ...

  18. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. KARTHIK CHANDRAN. Articles written in Sadhana. Volume 42 Issue 6 June 2017 pp 817-826. Deterministic oscillatory search: a new meta-heuristic optimization algorithm · N ARCHANA R VIDHYAPRIYA ANTONY BENEDICT KARTHIK CHANDRAN · More Details Abstract Fulltext PDF.

  19. A single recessive gene controls fragrance in cucumber (Cucumis ...

    Indian Academy of Sciences (India)

    2013-04-10

    Apr 10, 2013 ... Genetic studies in rice (Sood and Siddiq 1978), soybean. (AVRDC .... difficulty, marker-assisted selection (MAS) is an alternative for breeding ... 31, 823–826. de Wilde W. J. J. O and Duyfjes B. E. E. 2010 Cucumis sativus.

  20. An interpolation problem for completely positive maps on matrix algebras: solvability and parametrization

    Czech Academy of Sciences Publication Activity Database

    Ambrozie, Calin-Grigore; Gheondea, A.

    2015-01-01

    Roč. 63, č. 4 (2015), s. 826-851 ISSN 0308-1087 R&D Projects: GA AV ČR IAA100190903 Institutional support: RVO:67985840 Keywords : Choi matrix * completely positive * density matrix Subject RIV: BA - General Mathematics Impact factor: 0.761, year: 2015 http://www.tandfonline.com/doi/abs/10.1080/03081087.2014.903253

  1. Diet and lifestyle: its association with cholesterol levels among ...

    African Journals Online (AJOL)

    ) and high cholesterol (>240) was 21.1 % and 9.4 % among select tribal populations. It was found that 71.7% were nonvegetarian and 28.3% were vegetarian out which 82.6% were males and 63.2% were females. It was observed that males ...

  2. Negotiating creation in imperial times (Rm 8:18−30)

    African Journals Online (AJOL)

    2013-02-26

    Feb 26, 2013 ... relations, all of which are appropriate and vital for the interpretation of this passage. .... Many examples of the ideological investment and claims ..... analogous to primal time (8:21), the Adam theme, divine intercession (8:26), 'he ... terms invoked for Israel: saints, those who love God, the called, firstborn ...

  3. 75 FR 36472 - Goodyear Tire and Rubber Company, Receipt of Petition for Decision of Inconsequential Noncompliance

    Science.gov (United States)

    2010-06-25

    ...-0080; Notice 1] Goodyear Tire and Rubber Company, Receipt of Petition for Decision of Inconsequential Noncompliance Goodyear Tire and Rubber Company, (Goodyear),\\1\\ has determined that approximately 14,826 passenger car tires manufactured between August of 2007 and May of 2009, do not fully comply with paragraph...

  4. 76 FR 71515 - Endangered Species; File No. 16174

    Science.gov (United States)

    2011-11-18

    ... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA826 Endangered... issued a permit to take green sea turtles (Chelonia mydas) for the purposes of scientific research... request for a scientific research permit to take green sea turtles had been submitted by the above-named...

  5. Carbon pools in a montane old-growth Norway spruce ecosystem in Bohemian Forest: Effects of stand age and elevation

    Czech Academy of Sciences Publication Activity Database

    Seedre, M.; Kopáček, Jiří; Janda, P.; Bače, R.; Svoboda, M.

    2015-01-01

    Roč. 346, June (2015), s. 106-113 ISSN 0378-1127 R&D Projects: GA ČR(CZ) GAP504/12/1218 Institutional support: RVO:60077344 Keywords : carbon dynamics * soil carbon * spruce biomass C * dead root C * unmanaged ecosystem Subject RIV: GK - Forestry Impact factor: 2.826, year: 2015

  6. Biodegradation of brominated aromatics by cultures and laccase of Trametes versicolor

    Czech Academy of Sciences Publication Activity Database

    Uhnáková, Bronislava; Petříčková, Alena; Biedermann, David; Homolka, Ladislav; Vejvoda, Vojtěch; Bednář, P.; Papoušková, B.; Šulc, Miroslav; Martínková, Ludmila

    2009-01-01

    Roč. 76, č. 6 (2009), s. 826-832 ISSN 0045-6535 R&D Projects: GA MŠk 2B06151 Institutional research plan: CEZ:AV0Z50200510 Keywords : Brominated phenols * Tetrabromobisphenol A * Laccase Subject RIV: CE - Biochemistry Impact factor: 3.253, year: 2009

  7. Vascular plants and a brief history of the Kiowa and Rita Blanca National Grasslands

    Science.gov (United States)

    Donald L. Hazlett; Michael H. Schiebout; Paulette L. Ford

    2009-01-01

    Administered by the USDA Forest Service, the Kiowa and Rita Blanca National Grasslands occupy 230,000 acres of public land extending from northeastern New Mexico into the panhandles of Oklahoma and Texas. A mosaic of topographic features including canyons, plateaus, rolling grasslands and outcrops supports a diverse flora. Eight hundred twenty six (826) species of...

  8. IN SEARCH OF THE ORIGINAL TEXT IN MARK 9:38

    African Journals Online (AJOL)

    “Teacher, we saw someone in your name driving out demons and we tried .... Luke.” Maybe Lagrange and Taylor and Cranfield deserve more attention. 5. ..... Justin). In the Revue Biblique (Hendriks 2007:266-271) I divided Mark 8:26 into five ...

  9. Dual Role of Host Par2 in a Murine Model of Spontaneous Metastatic B16 Melanoma

    Czech Academy of Sciences Publication Activity Database

    Olejár, Tomáš; Větvička, D.; Zadinová, M.; Poučková, P.; Kukal, J.; Ježek, Petr; Matěj, R.

    2014-01-01

    Roč. 34, č. 7 (2014), s. 3511-3515 ISSN 0250-7005 R&D Projects: GA ČR(CZ) GAP302/10/0346 Institutional support: RVO:67985823 Keywords : PAR2 * melanoma * metastasis * murine model Subject RIV: EA - Cell Biology Impact factor: 1.826, year: 2014

  10. Relaxation phenomena in ensembles of CoFe.sub.2./sub.O.sub.4./sub. nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Bittová, Barbara; Poltierová Vejpravová, Jana; Morales, M.P.; Roca, A.G.; Mantlíková, A.

    2012-01-01

    Roč. 324, č. 6 (2012), s. 1182-1188 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z10100520 Keywords : CoFe 2 O 4 * super-spin-glass * coprecipitation * decomposition * dynamic magnetic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.826, year: 2012

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. ANTONY BENEDICT. Articles written in Sadhana. Volume 42 Issue 6 June 2017 pp 817-826. Deterministic oscillatory search: a new meta-heuristic optimization algorithm · N ARCHANA R VIDHYAPRIYA ANTONY BENEDICT KARTHIK CHANDRAN · More Details Abstract Fulltext PDF. The paper ...

  12. Dissipative solutions and the incompressible inviscid limits of the compressible magnetohydrodynamic system in unbounded domains

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Novotný, A.; Sun, Y.

    2014-01-01

    Roč. 34, č. 1 (2014), s. 121-143 ISSN 1078-0947 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : compressible MHD system * inviscid limit * incompressible limit Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2014 http://aimsciences.org/journals/displayArticlesnew.jsp?paperID=8717

  13. Evaluation of the performance of the novel PapilloCheck HPV genotyping test by comparison with two other genotyping systems and the HC2 test

    DEFF Research Database (Denmark)

    Schopp, Betti; Holz, Barbara; Zago, Manola

    2010-01-01

    The novel PapilloCheck genotyping test was compared with SPF10 PCR LiPav1 and PGMY09/11 on hybrid capture 2 (HC2)-pretested samples. From results of 826 cervical samples detection rates and kappa values for the tests were calculated using a HPV type consensus definition. With PapilloCheck HPV typ...

  14. Coculture fermentation of banana agro-waste to ethanol by ...

    African Journals Online (AJOL)

    ONOS

    2010-03-29

    Mar 29, 2010 ... Scanning electron microscopic pictures clearly indicate cellulolysis and close interaction of ... This is the first report on anaerobic single step conversion ... the current trend, ethanol produced from biomass is the ... In co-culture system ..... enhanced cellulase production. Agric. Biol. Chem. 54: 825–826.

  15. Acces to Czech Social Survey Data

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich

    2002-01-01

    Roč. 38, č. 6 (2002), s. 809-826 ISSN 0038-0288 Institutional research plan: CEZ:AV0Z7028912 Keywords : social science data archives * research infrastructures * comparative surveys Subject RIV: AO - Sociology, Demography Impact factor: 0.113, year: 2002

  16. Restoration of Central-European mountain Norway spruce forest 15 years after natural and anthropogenic disturbance

    Czech Academy of Sciences Publication Activity Database

    Nováková, M. H.; Edwards-Jonášová, Magda

    2015-01-01

    Roč. 144, 15 May (2015), s. 120-130 ISSN 0378-1127 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : Picea abies forest * disturbance * bark beetle * salvage logging * natural regeneration * Herb-layer vegetation Subject RIV: GK - Forestry Impact factor: 2.826, year: 2015

  17. A comparative study on the flow over an airfoil using transitional turbulence models

    DEFF Research Database (Denmark)

    Lin, Mou; Sarlak Chivaee, Hamid

    2016-01-01

    This work addresses the simulation of the flow over NREL S826 airfoil under a relatively low Reynolds number (Re = 1 × 105 ) using the CFD solvers OpenFoam and ANSYS Fluent. The flow is simulated using two different transition models, γ − Reθ and k − kL − ω model, and the results are examined...

  18. Prospective studies exploring the possible impact of an ID3 polymorphism on changes in obesity measures

    DEFF Research Database (Denmark)

    Svendstrup, Mathilde; Appel, Emil V R; Sandholt, Camilla H

    2018-01-01

    increase over time in fat mass, BMI, waist circumference (WC), and waist-hip ratio (WHR) in humans. METHODS: The genotyped study populations included the Obesity Research Group - Genetics (ORGGEN) cohort, a cohort of men with obesity (N = 716) and of randomly selected men (N = 826) from the Danish draft...

  19. Armed reproductives: Evolution of the frontal gland in imagoes of Termitidae

    Czech Academy of Sciences Publication Activity Database

    Kutalová, Kateřina; Bourguignon, T.; Sillam-Dusses, D.; Hanus, Robert; Roisin, Y.; Šobotník, Jan

    2013-01-01

    Roč. 42, č. 4 (2013), s. 339-348 ISSN 1467-8039 R&D Projects: GA ČR GAP506/10/1570 Institutional support: RVO:61388963 Keywords : alate * defence * Isoptera * morphological evolution Subject RIV: CC - Organic Chemistry Impact factor: 1.826, year: 2013

  20. Nikkaji Dictionary: 3-クロロチロシン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term 3-クロロチロシン 名詞 一般 * * * * 3-クロロチロシン ... Nikkaji J278.826H 200906012909728988 C CA06 UNKNOWN_2 3 - クロロチロシン

  1. Nikkaji Dictionary: 3−クロロチロシン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term 3−クロロチロシン 名詞 一般 * * * * 3-クロロチロシン ... Nikkaji J278.826H 200906012909728988 C CA06 UNKNOWN_2 3 − クロロチロシン

  2. Research

    African Journals Online (AJOL)

    abp

    2017-09-12

    Sep 12, 2017 ... 5. Poirel L, Nordmann P. Carbapenem resistance in Acinetobacter baumannii: mechanisms and epidemiology. Clin Microbiol. Infect. 2006; 12(9): 826-36. PubMed | Google Scholar. 6. Gonzalez-Villoria AM, Valverde-Garduno V. Antibiotic-Resistant. Acinetobacter baumannii Increasing Success Remains a.

  3. Surface microstructure and magnetic behavior in FeSiB amorphous ribbons from magneto-optical Kerr effect

    Czech Academy of Sciences Publication Activity Database

    Životský, O.; Hendrych, A.; Klimša, L.; Jirásková, Yvonna; Buršík, Jiří; Gomez, J.A.M.; Janičkovič, D.

    2012-01-01

    Roč. 324, č. 4 (2012), s. 569-577 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z20410507 Keywords : Surface magnetism * Magnetooptic Kerr effect * Magneto-optical microscopy * ILEEMS * CEMS * Nanoscale phase separation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.826, year: 2012

  4. Fluvial geochemistry of Subarnarekha River basin, India

    Indian Academy of Sciences (India)

    41

    CSIR - Central Institute of Mining and Fuel Research, Barwa Road, Dhanbad - 826 .... by acid titration and molybdosilicate methods respectively (APHA 1998). .... from 85 to 5802 µM (Avg. 536 µM) and it accounts for 16% of the total anionic ...

  5. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 5. J. B. S. Haldane: the John Innes years. SARAH WILMOT. HALDANE AT 125 Volume 96 Issue 5 November 2017 pp 815-826. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jgen/096/05/0815-0826. Keywords. J. B. S. ...

  6. Polyphasic characterization of Westiellopsis prolifica (Hapalosiphonaceae, Cyanobacteria) from the El-Farafra Oasis (Western Desert, Egypt)

    Czech Academy of Sciences Publication Activity Database

    Saber, A. A.; Cantonati, M.; Mareš, Jan; Anesi, A.; Guella, G.

    2017-01-01

    Roč. 56, č. 6 (2017), s. 697-709 ISSN 0031-8884 Institutional support: RVO:60077344 Keywords : 16S rRNA * autecology * bio-organic screening * Egypt * polyphasic study Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.826, year: 2016

  7. Polyphasic characterization of Westiellopsis prolifica (Hapalosiphonaceae, Cyanobacteria) from the El-Farafra Oasis (Western Desert, Egypt)

    Czech Academy of Sciences Publication Activity Database

    Saber, A. A.; Cantonati, M.; Mareš, Jan; Anesi, A.; Guella, G.

    2017-01-01

    Roč. 56, č. 6 (2017), s. 697-709 ISSN 0031-8884 R&D Projects: GA ČR(CZ) GA15-11912S Institutional support: RVO:67985939 Keywords : 16S rRNA * Egypt * Westiellopsis Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.826, year: 2016

  8. Two-Dimensional Fourier Cosine Series Expansion Method for Pricing Financial Options

    NARCIS (Netherlands)

    Ruijter, M.J.; Oosterlee, C.W.

    2012-01-01

    The COS method for pricing European and Bermudan options with one underlying asset was developed in [F. Fang and C. W. Oosterlee, SIAM J. Sci. Comput., 31 (2008), pp. 826--848] and [F. Fang and C. W. Oosterlee, Numer. Math., 114 (2009), pp. 27--62]. In this paper, we extend the method to higher

  9. A Duty of Care: Non-Drinkers and Alcohol Related Harm among an Australian University Sample

    Science.gov (United States)

    Mikhailovich, Katja; George, Amanda; Rickwood, Debra; Parker, Rhian

    2011-01-01

    Studies documenting the harm associated with excessive drinking amongst university students are numerous. Fewer studies have explored the experience of non-drinkers in the university setting. In 2008, 826 students aged 18-29 years responded to an online survey aiming to investigate alcohol use and alcohol related harm at an Australian university.…

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 8. The Evolution of Compilers. Priti Shankar. General Article Volume 12 Issue 8 August 2007 pp 8-26 ... Author Affiliations. Priti Shankar1. Department of Computer Science and Automation, Indian Institute of Science, Bangalore 560 012, India ...

  11. Targeting the Synthetic Essential Kinases of Breast Cancers

    Science.gov (United States)

    2016-05-01

    engineering via Cas9. Science 2013, 339(6121):823-826. 31. Koike-Yusa H, Li Y, Tan EP, Velasco- Herrera MD, Yusa K: Genome-wide recessive genetic screening in...Yusa H, Li Y, Tan EP, Velasco- Herrera Mdel C, Yusa K: Genome-wide recessive genetic screening in mammalian cells with a lentiviral CRISPR-guide RNA

  12. The October 2008 Novy Kostel earthquake swarm and its gas geochemical precursor

    Czech Academy of Sciences Publication Activity Database

    Weinlich, F. H.; Gaždová, Renata; Teschner, M.; Poggenburg, J.

    2016-01-01

    Roč. 16, č. 5 (2016), s. 826-840 ISSN 1468-8115 Institutional support: RVO:67985891 Keywords : CO2 * earthquake precursor * earthquake swarm * gas monitoring * water table fluctuations Subject RIV: DD - Geochemistry Impact factor: 2.687, year: 2016

  13. Fate of 15N-urea and 15N-ammonium sulphate applied in different periods to cica-8 rice culture in greenhouse conditions

    International Nuclear Information System (INIS)

    Bastidas, O.G.; Alvarez, A.; Victoria, R.L.; Urquiaga C, S.; Muraoka, T.

    1984-01-01

    The fate of nitrogen fertilizers in rice cultivars (Cica-8) is studied. Urea (1.973% at of 15 N) and ammonium sulfate (1.826% at of 15 N) are used. The fertilizers are applied in four levels (0,100,200 and 300 Kg N/ha) in shadow coditions and after 30 days of germination. (M.A.C.) [pt

  14. 75 FR 63533 - Environmental Impact Statement: Cameron County, TX

    Science.gov (United States)

    2010-10-15

    ..., 300 East 8th Street, Room 826, Austin, Texas 78701, Telephone (512) 536-5960. SUPPLEMENTARY... intend to publish a new NOI in the future, which will describe the new project scope and limits. The... Engineer, Austin, Texas. [FR Doc. 2010-25972 Filed 10-14-10; 8:45 am] BILLING CODE 4910-22-P ...

  15. 75 FR 67806 - Environmental Impact Statement; Nueces County, TX

    Science.gov (United States)

    2010-11-03

    ... Street, Room 826, Austin, Texas 78701, Telephone (512) 536-5960. SUPPLEMENTARY INFORMATION: On April 6... Notice of Intent because of changes in the scope (managed toll lanes) and limits. We intend to publish a... this program.) Issued on: October 27, 2010. Gregory S. Punske, District Engineer, Austin, Texas. [FR...

  16. 76 FR 4412 - Notice To Rescind Notice of Intent To Prepare an Environmental Impact Statement: Multiple South...

    Science.gov (United States)

    2011-01-25

    ... January 15, 2004 was published in the Federal Register Volume 69, number 10 and on pages 2382-2383. The... Highway Administration, Texas Division, 300 East 8th Street, Room 826, Austin, Texas 78701. Telephone (512... Transportation (TxDOT), published a Notice of Intent in the Federal Register on January 15, 2004 (Volume 69, No...

  17. 78 FR 17281 - Notice To Rescind a Notice of lntent To Prepare an Environmental Impact Statement: Dallas and...

    Science.gov (United States)

    2013-03-20

    ... US 287 to IH 20. A NOI to prepare an EIS for proposed Loop 9 was published in the Federal Register on... published in the Federal Register on January 20, 2004 (Vol. 69, No. 12, Page 2809). FOR FURTHER INFORMATION... Division, 300 East 8th Street, Room 826, Austin, Texas 78701. Telephone: (512) 536-5950, Email: salvador...

  18. 78 FR 26690 - Notice To Rescind Notice of Intent To Prepare an Environmental Impact Statement: Loop 1604 From I...

    Science.gov (United States)

    2013-05-07

    ... proposed improvements to Loop 1604 from I-35 to US 90 is rescinded. The NOI was originally published in the Federal Register on July 31, 2009 (Volume 74, No. 146, Page 38260) and an amended NOI was published on... (FHWA), Texas Division, 300 East 8th Street, Rm. 826, Austin, Texas 78701, Telephone 512-536-5950...

  19. 75 FR 29976 - Certain Cut-to-Length Carbon-Quality Steel Plate Products From Italy: Extension of the Final...

    Science.gov (United States)

    2010-05-28

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-475-826] Certain Cut-to-Length Carbon-Quality Steel Plate Products From Italy: Extension of the Final Results of Antidumping Duty Administrative...-quality steel plate products from Italy. See Certain Cut-to-Length Carbon-Quality Steel Plate Products...

  20. Haemogregarines of freshwater turtles from Southeast Asia with a description of Haemogregarina sacaliae sp. n. and a redescription of Haemogregarina pellegrini Laveran and Pettit, 1910

    Czech Academy of Sciences Publication Activity Database

    Dvořáková, N.; Kvičerová, Jana; Hostovský, M.; Široký, P.

    2015-01-01

    Roč. 142, č. 6 (2015), s. 816-826 ISSN 0031-1820 R&D Projects: GA ČR(CZ) GAP506/11/1738 Institutional support: RVO:60077344 Keywords : Haemogregarines * Haemogregarina * Sacalia * Platysternon * Malayemys * phylogeny * 18S rDNA Subject RIV: EG - Zoology Impact factor: 3.031, year: 2015

  1. Electric Power Monthly, June 1988

    International Nuclear Information System (INIS)

    1988-06-01

    The data in this report are presented for a wide audience including Congress, Federal and State agencies, the electric utility industry, and the general public. The Energy Information Administration (EIA) collected the information in this report to fulfill its data collection and dissemination responsibilities as specified in the Federal Energy Administration Act of 1974 (Public Law 93-275) as amended. The Electric Power Monthly contains information from three data sources: the Form EIA-759, 'Monthly Power Plant Report'; the Federal Energy Regulatory Commission (FERC) Form 423, 'Monthly Report of Cost and Quality of Fuels for Electric Plants ; and the Form EIA-826, M onthly Electric Sales and Revenue Report with State Distributions'. The Form EIA-759 collects data from all operators of electric utility generating plants (except those having plants solely on standby), approximately 800 of the more than 3,200 electric utilities in the United States. To reduce the reporting burden for utilities, the FERC Form 423 and Form EIA-826 data are based on samples, which cover less than 100 percent of all central station generating utilities. The FERC Form 423 collects data from steam-electric power generating plants with a combined installed nameplate capacity of 50 megawatts or larger (approximately 230 electric utilities). The 50-megawatt threshold was established by FERC. The Form EIA-826 collects sales and revenue data in the residential, commercial, industrial, and other sectors of the economy. Other sales data collected include public street and highway lighting, other sales to public authorities, sales to railroads and railways, and interdepartmental sales. Respondents to the Form EIA-826 were statistically chosen and include approximately 225 privately and publicly owned electric utilities from a universe of more than 3,200 utilities. The sample selection for the Form EIA-826 is evaluated annually. Currently, the Form EIA-826 data account for approximately 83 percent

  2. Prevalence of ulnar-to-median nerve motor fiber anastomosis (Riché-Cannieu communicating branch) in hand: An electrophysiological study

    Science.gov (United States)

    Ahadi, Tannaz; Raissi, Gholam Reza; Yavari, Masood; Majidi, Lobat

    2016-01-01

    Background: Two main muscles studied in the hand for evaluation of median nerve injuries are opponens pollicis (OP) and abductor pollicis brevis (APB). However, Riché-Cannieu communicating branch (RCCB) may limit the use of these muscles in electrodiagnosis. This condition is confusing in the case of median nerve injuries. This study was conducted to evaluate the prevalence of RCCB. Methods: Twenty-three consecutive cases of complete median nerve injury were studied. Evoked responses via stimulation of median and ulnar nerves in the wrist and recording with needle in the thenar area were studied. Results: Of the patients, 82.6% exhibited RCCB. In 14 (60.8%) cases the OP and in 19(82.6%) cases APB was supplied by the ulnar nerve. Conclusion: RCCB was detected to be 60.8% in OP and 82.6% in APB, so OP is preferable to APB in the study of median nerve. PMID:27390694

  3. Blade couple connected by damping element with dry friction contacts

    Czech Academy of Sciences Publication Activity Database

    Pešek, Luděk; Půst, Ladislav

    2014-01-01

    Roč. 52, č. 3 (2014), s. 815-826 ISSN 1429-2955 R&D Projects: GA ČR GA101/09/1166 Institutional support: RVO:61388998 Keywords : dry friction * three masses system * damping of vibrations * irregular vibrations Subject RIV: BI - Acoustics Impact factor: 0.636, year: 2014 http://www.ptmts.org.pl/article.xsl?vol=52&no=3&page=815

  4. Asynchronous Inflammation and Myogenic Cell Migration Limit Muscle Tissue Regeneration Mediated by a Cellular Scaffolds

    Science.gov (United States)

    2015-02-11

    such as duchenne muscular dystrophy ) results in impaired regeneration, increased atrophy and fibrosis of skeletal muscle [24-27]. It has also been...2005; 122:289-301. 24. Cohn RDCampbell KP. Molecular basis of muscular dystrophies . Muscle Nerve 2000; 23:1456-1471. 25. Morgan JEZammit PS. Direct...et al. Early onset of inflammation and later involvement of TGFbeta in Duchenne muscular dystrophy . Neurology 2005; 65:826-834. 28. Lepper C

  5. Evolutionary relationships among cyst-forming coccidia Sarcocystis spp. (Alveolata: Apicomplexa: Coccidea) in endemic African tree vipers and perspective for evolution of heteroxenous life cycle

    Czech Academy of Sciences Publication Activity Database

    Šlapeta, Jan Roger; Modrý, David; Votýpka, Jan; Jirků, Milan; Lukeš, Julius; Koudela, Břetislav

    2003-01-01

    Roč. 27, č. 3 (2003), s. 464-475 ISSN 1055-7903 R&D Projects: GA ČR GA524/00/P015; GA AV ČR KSK6005114 Grant - others:GA FRVŠ(CZ) 1268/2001 Institutional research plan: CEZ:AV0Z6022909 Keywords : coccidia * Sarcocystis * evolution Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.826, year: 2003

  6. New River Dam Foundation Report. Gila River Basin: Phoenix, Arizona and Vicinity (Including New River).

    Science.gov (United States)

    1985-10-01

    further downstream before merging with the Agua Fria River. 6 Site Geology 2.08 The geological formations present within the project area consist...sampling and in- situ density testing using the sand displacement 11 or large-scale water displacement method. Dozer trenches TT82-1 and TT82-6 were excavated...underlying the valley or may, due to its pervasiveness, represent an in situ weathering product of the buried bedrock. 4.18 Because of the magnitude

  7. Aromatic Base Stacking in DNA: From ab initio Calculations to Molecular Dynamics Simulations

    Czech Academy of Sciences Publication Activity Database

    Šponer, Jiří; Berger, I.; Špačková, Naďa; Leszczynski, J.; Hobza, Pavel

    Conversation 11, č. 2 (2000), s. 383-407 ISSN 0739-1102 R&D Projects: GA AV ČR IAA4040903; GA AV ČR IAA4004702; GA ČR GA203/00/0633 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.826, year: 2000

  8. Areva reached its objectives in 2002

    International Nuclear Information System (INIS)

    Anon.

    2003-01-01

    In 2002 the turnover of the Areva group has fallen by 7,1 % from 8,90 milliard euros in 2001 to 8,26 milliard euros. This fall breaks up into -3,6 % for the nuclear sector and -20,7 % for connector engineering. The sharp drop for connector engineering is not surprising and is attributed to the fact that in 2002 there was no revival of business in the market of communication equipment. (A.C.)

  9. Shopping online and/or in-store? A structural equation model of the relationships between e-shopping and in-store shopping

    OpenAIRE

    Farag, Sendy; Schwanen, Tim; Dijst, Martin

    2005-01-01

    Searching product information or buying goods online is becoming increasingly popular and could affect shopping trips. However, the relationship between e-shopping and in-store shopping is currently unclear. The aim of this study is to investigate empirically how the frequencies of online searching, online buying, and non-daily shopping trips relate to each other, after controlling for sociodemographic, land use, behavioral, and attitudinal characteristics. Data were collected from 826 respon...

  10. Retained State Shareholding in Chinese PLCs: Does Government Ownership Reduce Corporate Value?

    OpenAIRE

    Estrin, Saul; Tian, Lihui

    2005-01-01

    The role of government shareholding in corporate performance is central to an understanding of China’s newly privatized large firms and the stock market. In this paper, we analyse shareholders as agents that can both harm and benefit companies. We examine the ownership structure of 826 listed corporations and find that government shareholding is surprisingly large. Its effect on corporate value is found to be negative, but non-monotonic. Up to a certain threshold, corporate value decreases as...

  11. Neolithic settlement in Bylany: taking a new look at old digs

    Czech Academy of Sciences Publication Activity Database

    Květina, Petr; Končelová, Markéta; Brzobohatá, Hana; Šumberová, Radka; Řídký, Jaroslav; Pavlů, Ivan

    Vol. 1, Suppl. 1 (2012), s. 61-64 ISSN 2047-4970. [International Conference on Cultural Heritage. Lemesos, 29.10.2012-03.11.2012] R&D Projects: GA MK(CZ) DF12P01OVV032 Keywords : Virtual museum * 3D optical scanning * Neolithic * Bylany (Czech Republic) Subject RIV: AC - Archeology, Anthropology, Ethnology http://multi-science.metapress.com/content/b7327l826r426667/fulltext.pdf

  12. Magnetic guns with cylindrical permanent magnets

    Czech Academy of Sciences Publication Activity Database

    Vokoun, David; Beleggia, M.; Heller, Luděk

    2012-01-01

    Roč. 324, č. 9 (2012), s. 1715-1719 ISSN 0304-8853 R&D Projects: GA ČR(CZ) GAP107/11/0391; GA AV ČR IAA100100920 Institutional research plan: CEZ:AV0Z10100520 Keywords : permanent magnet * cylindrical magnet * Earnshaw's theorem * magnetic gun * magnetostatic interaction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.826, year: 2012 http://www.sciencedirect.com/science/article/pii/S0304885311008997

  13. The Hanle and Zeeman Polarization Signals of the Solar Ca II 8542 angstromLine

    Czech Academy of Sciences Publication Activity Database

    Štěpán, Jiří; Trujillo Bueno, J.

    2016-01-01

    Roč. 826, č. 1 (2016), L10/1-L10/6 ISSN 2041-8205 R&D Projects: GA ČR(CZ) GA16-16861S Grant - others:COST Action(XE) MP1104 Institutional support: RVO:67985815 Keywords : line profiles * polarization * radiative transfer Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.522, year: 2016

  14. Prevention and Management of Infections Associated With Burns in the Combat Casualty

    Science.gov (United States)

    2008-03-01

    injury. Mil Med. 2006;171:826–829. 86. Boyce JM, Pittet D. Guideline for hand hygiene in health-care settings: Recommendations of the healthcare infection ...control practices advisory committee and the HICPAC/SHEA/APIC/IDSA Hand Hygiene Task Force. Infect Control Hosp Epi. 2002; 23(suppl):S3–S40. 87...resistant bacteria is primarily the result of nosocomial transmission via contaminated equipment or on the hands of health care workers.74 As a means of

  15. 2018-02-25T22:41:38Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    Totally, T1-P (629.757), Baghdadi (620.191), 4-4 (614.826), 110×32 (613.690), and 32 (611.407) showed higher evaluation index values and also 4-4 (5.343), 32 (5.260), 110×32 (5.226), Pink Khorasan (5.155), and T1-P (5.108) showed higher sub-ordinate function values. This study reveals the phylogenetic relationship of ...

  16. 40 CFR 437.21 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ....6 Metal Parameters Arsenic 2.95 1.33 Cadmium 0.0172 0.0102 Chromium 0.746 0.323 Cobalt 56.4 18.8 Copper 0.500 0.242 Lead 0.350 0.160 Mercury 0.0172 0.00647 Tin 0.335 0.165 Zinc 8.26 4.50 Organic...

  17. The fundamental solution of linearized nonstationary Navier-Stokes equations of motion around a rotating and translating body

    Czech Academy of Sciences Publication Activity Database

    Farwig, R.; Guenther, R.; Thomann, E.; Nečasová, Šárka

    2014-01-01

    Roč. 34, č. 2 (2014), s. 511-529 ISSN 1078-0947 R&D Projects: GA ČR(CZ) GAP201/11/1304; GA MŠk LC06052 Institutional support: RVO:67985840 Keywords : fundamental solution * linearized problem * Navier-Stokes problem Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2014 http://www.aimsciences.org/journals/displayArticlesnew.jsp?paperID=8831

  18. Recognition of Symmetric 3D Bodies

    Czech Academy of Sciences Publication Activity Database

    Suk, Tomáš; Flusser, Jan

    2014-01-01

    Roč. 6, č. 3 (2014), s. 722-757 ISSN 2073-8994 R&D Projects: GA ČR GAP103/11/1552 Institutional support: RVO:67985556 Keywords : rotation symmetry * reflection symmetry * 3D complex moments * 3D rotation invariants Subject RIV: JD - Computer Applications, Robotics Impact factor: 0.826, year: 2014 http://library.utia.cas.cz/separaty/2014/ZOI/suk-0431156.pdf

  19. Synthesis and Characterization of the Ternary Thiobismuthates A9Bi13S24 (A = K, Rb)

    KAUST Repository

    Davaasuren, Bambar; Alahmary, Fatimah S.; Dashjav, Enkhtsetseg; Khanderi, Jayaprakash; Rothenberger, Alexander

    2016-01-01

    .9072(9) Å, β = 105.826(3)° for KBiS (1) and a = 31.823(6) Å, b = 4.1177(8) Å, c = 21.086(4) Å, β = 105.62(3)° for RbBiS (2). The crystal structure of 1 contains a 3D [KBiS] polyanionic framework, whereas 2 consists of 2D [RbBiS] polyanionic slabs stacked

  20. Climate-induced landslide reactivation at the edge of the Most Basin (Czech Republic) – progress towards better landslide prediction

    Czech Academy of Sciences Publication Activity Database

    Burda, J.; Hartvich, Filip; Valenta, Jan; Smítka, V.; Rybář, Jan

    2013-01-01

    Roč. 13, č. 2 (2013), s. 361-374 ISSN 1561-8633 R&D Projects: GA MŠk LM2010008 Institutional support: RVO:67985891 Keywords : apparent resistivity pseudosections * Krušné hory mountains * electrode arrays * stability Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.826, year: 2013 http://www.nat-hazards- earth -syst-sci.net/13/361/2013/nhess-13-361-2013.pdf

  1. On the role of strong gravity in polarization from scattering of light in relativistic flows

    Czech Academy of Sciences Publication Activity Database

    Horák, Jiří; Karas, Vladimír

    2006-01-01

    Roč. 365, č. 3 (2006), s. 813-826 ISSN 0035-8711 R&D Projects: GA MŠk(CZ) LC06014; GA AV ČR(CZ) IAA300030510; GA ČR GA205/03/0902 Institutional research plan: CEZ:AV0Z10030501 Keywords : polarization * black hole physics * relativity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.057, year: 2006

  2. Observation of a Neutral Charmoniumlike State Z(c)(0) in e(+)e(-) -> (D*(D)over-bar*)(0)pi(0)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Eren, E. E.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kiese, P.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. N.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

    2015-01-01

    We report a study of the process e(+)e(-) -> (D*(D) over bar*)(0)pi(0) using e(+)e(-) collision data samples with integrated luminosities of 1092 pb(-1) at root s = 4.23 GeV and 826 pb(-1) at root s = 4.26 GeV collected with the BESIII detector at the BEPCII storage ring. We observe a new neutral

  3. KAJIAN PEMANFAATAN TEPUNG JAHE (Zingiber officinale Rose DALAM RANSUM TERHADAP LEMAK ABDOMINAL DAN KADAR KOLESTEROLDARAH ITIK BALI AFKIR

    Directory of Open Access Journals (Sweden)

    T. G. B. Yadnya

    2016-10-01

    Full Text Available Penelitian ini bertujuan untuk mengkaji pemanfaatan tepung jahe (Zingiber officinale Rose dalam ransumterhadap lemak abdominal dan kolesterol darah itik bali afkir. Menggunakan rancangan acak kelompok (RAK,dengan empat perlakuan, yaitu ransum tanpa tepung jahe (A, ransum mengandung 2,91% tepung jahe (B,ransum mengandung 5,66% tepung jahe (C, dan ransum mengandung 8,26% tepung jahe (D. Setiap perlakuanterdiri atas lima kelompok, dan setiap kelompok berisi empat ekor itik bali afkir. Variabel yang diamati meliputikonsumsi ransum dan serat kasar, kadar kolesterol darah, dan lemak abdominal. Hasil penelitian menunjukkanbahwa pemberian pemberian 2,91% dan 5,66% tepung jahe dalam ransum tidak berpengaruh terhadap konsumsiransum (P>0,05, namun dengan pemberian 8,26% dapat menurunkan konsumsi ransum secara nyata (P<0,05,jika dibandingkan dengan perlakuan yang lainnya dan disertai dengan penurunan konsumsi serat kasar (P<0,05.Pemberian 2,91%, 5,66%, dan 8,26% tepung jahe dalam ransum dapat menurunkan lemak abdominal dankolesterol darah secara nyata (P<0,05 dibandingkan dengan pemberian perlakuan kontrol. Dari hasil penelitiandapat disimpulkan bahwa pemberian tepung jahe dalam ransum dapat menurunkan jumlah lemak abdominal dankolesterol darah itik bali afkir.

  4. Impeller Submergence Depth for Stirred Tanks

    Directory of Open Access Journals (Sweden)

    Thiyam T. Devi

    2011-11-01

    Full Text Available Impeller submergence governs the performance of mixing tanks employed in oxygen transfer operation. Present work experimentally investigates the effect of impeller submergence depths on oxygen transfer and corresponding power consumption. It has been found that at higher range of impeller submergence, mixing tanks consume less power and gives higher values of oxygen transfer coefficient. Optimal range of submergence depth is 0.7 to 0.9 times the impeller diameter. Copyright ©2011 BCREC UNDIP. All rights reserved.(Received: 4th March 2011; Revised: 12nd July 2011; Accepted: 14th July 2011[How to Cite: T.T. Devi, A.P. Sinha, M. Thakre, and B. Kumar. (2011. Impeller Submergence Depth for Stirred Tanks. Bulletin of Chemical Reaction Engineering & Catalysis, 6 (2: 123-128. doi:10.9767/bcrec.6.2.826.123-128][How to Link / DOI: http://dx.doi.org/10.9767/bcrec.6.2.826.123-128 || or local: http://ejournal.undip.ac.id/index.php/bcrec/article/view/826] | View in 

  5. A novel FKRP-related muscular dystrophy founder mutation in South African Afrikaner patients with a phenotype suggestive of a dystrophinopathy

    Directory of Open Access Journals (Sweden)

    M M Mudau

    2017-01-01

    Full Text Available Background. Fukutin-related protein (FKRP muscular dystrophy is an autosomal recessive disorder caused by mutations in the FKRP gene. The condition is often misdiagnosed as a dystrophinopathy. A previously unreported mutation, c.1100T>C in exon 4 of FKRP, had been identified in homozygous form in two white South African (SA Afrikaner patients clinically diagnosed with a dystrophinopathy. Objectives. To investigate whether the c.1100T>C mutation and the common European FKRP mutation c.826C>A are present in other patients of Afrikaner origin with suspected dystrophinopathy, and whether a founder haplotype exists. Methods. The c.1100T>C mutation was initially tested for using an amplification refractory mutation system technique in 45 white SA Afrikaner patients who had tested negative using multiplex ligation probe amplification screening for exonic deletions/duplications in the dystrophin gene. Sequencing analysis was used to confirm the c.1100T>C mutation and screen for the c.826C>A mutation. Two cohorts (each numbering 100 of Afrikaans and other white controls were screened for the c.1100T>C and c.826C>A mutations, respectively. Results. Of the 45 patients, 8 patients (17.8% were homozygous for c.1100T>C, 2 (4.4% were compound heterozygotes for c.1100T>C and c.826C>A, and 1 (2.2% was heterozygous for c.1100T>C with a second unidentified mutation. The c.1100T>C mutation was found in 1/100 controls, but no heterozygotes for the c.826C>A mutation were identified. Linked marker analysis for c.1100T>C showed a common haplotype, suggesting a probable founder mutation in the SA Afrikaner population. Conclusion. FKRP mutations may be relatively common in Afrikaners, and screening should be considered in patients who have a suggestive phenotype and test negative for a dystrophinopathy. This test will be useful for offering diagnostic, carrier and prenatal testing for affected individuals and their families. As FKRP muscular dystrophy is autosomal

  6. La dimensión social del autoconcepto en el adulto y su relación con el rendimiento académico

    Directory of Open Access Journals (Sweden)

    Francisco MATEOS CLAROS

    2009-11-01

    Full Text Available RESUMEN: Este estudio, realizado con una muestra de 826 adultos, analiza la estructura del autoconcepto, para descubrir qué factor predomina en su configuración, y qué relación guarda con el rendimiento académico. Los resultados muestran que es la dimensión social la variable más relevante de las que conforman el autoconcepto. También se establece el perfil del adulto sociable. Finalmente, se comprueba que la relación entre el autoconcepto y el rendimiento académico, en el adulto, no guarda la estrecha vinculación que se ha encontrado en el caso de los niños.ABSTRACT: Extensive information about academics achievement can be found in the literature of the self concept. This research have been addressed involving the self concept and its factors and configurations. 826 adult students from different universities of Andalucía were evaluate whit the Tennese Self Concept Scale (TSCS, and the most important findings in our job refer to the relation between self concept and academics achievement in adult people. We conclude in a descriptions of the social style.RÉSUMÉ: Cet étude, réalisé avec un échantillonnage de 826 adultes, analyse la structure du AUTOCONCEPT, pour découvrir quel facteur prédomine dans son configuration, et quel relation garde avec le rendement académique. Les résultats montrent qui est la dimension social la variable plus eminent des qui conforment l'autoconcept. Aussi on établi le contour du adulte sociable. Finalement, il se constate que la relation entre l'autoconcept et le rendement académique, dans l'adulte, ne garde pas l'étroit lien qu'on a trouvé dans le cas des enfants.

  7. Culture-independent characterization of bacterial communities associated with the cold-water coral Lophelia pertusa in the northeastern Gulf of Mexico

    Science.gov (United States)

    Kellogg, C.A.; Lisle, J.T.; Galkiewicz, J.P.

    2009-01-01

    Bacteria are recognized as an important part of the total biology of shallow-water corals. Studies of shallow-water corals suggest that associated bacteria may benefit the corals by cycling carbon, fixing nitrogen, chelating iron, and producing antibiotics that protect the coral from other microbes. Cold-water or deep-sea corals have a fundamentally different ecology due to their adaptation to cold, dark, high-pressure environments and as such have novel microbiota. The goal of this study was to characterize the microbial associates of Lophelia pertusa in the northeastern Gulf of Mexico. This is the first study to collect the coral samples in individual insulated containers and to preserve coral samples at depth in an effort to minimize thermal shock and evaluate the effects of environmental gradients on the microbial diversity of samples. Molecular analysis of bacterial diversity showed a marked difference between the two study sites, Viosca Knoll 906/862 (VK906/862) and Viosca Knoll 826 (VK826). The bacterial communities from VK826 were dominated by a variety of unknown mycoplasmal members of the Tenericutes and Bacteroidetes, whereas the libraries from VK906/862 were dominated by members of the Proteobacteria. In addition to novel sequences, the 16S rRNA gene clone libraries revealed many bacterial sequences in common between Gulf of Mexico Lophelia corals and Norwegian fjord Lophelia corals, as well as shallow-water corals. Two Lophelia-specific bacterial groups were identified: a cluster of gammaproteobacteria related to sulfide-oxidizing gill symbionts of seep clams and a group of Mycoplasma spp. The presence of these groups in both Gulf and Norwegian Lophelia corals indicates that in spite of the geographic heterogeneity observed in Lophelia-associated bacterial communities, there are Lophelia-specific microbes. Copyright ?? 2009, American Society for Microbiology. All Rights Reserved.

  8. Study on the polarity, solubility, and stacking characteristics of asphaltenes

    KAUST Repository

    Zhang, Long-li

    2014-07-01

    The structure and transformation of fused aromatic ring system in asphaltenes play an important role in the character of asphaltenes, and in step affect the properties of heavy oils. Polarity, solubility and structural characteristics of asphaltenes derived from Tahe atmospheric residue (THAR) and Tuo-826 heavy crude oil (Tuo-826) were analyzed for study of their internal relationship. A fractionation method was used to separate the asphaltenes into four sub-fractions, based on their solubility in the mixed solvent, for the study of different structural and physical-chemical properties, such as polarity, solubility, morphology, stacking characteristics, and mean structural parameters. Transmission electron microscope (TEM) observation can present the intuitive morphology of asphaltene molecules, and shows that the structure of asphaltenes is in local order as well as long range disorder. The analysis results showed that n-heptane asphaltenes of THAR and Tuo-826 had larger dipole moment values, larger fused aromatic ring systems, larger mean number of stacking layers, and less interlayer spacing between stacking layers than the corresponding n-pentane asphaltenes. The sub-fractions that were inclined to precipitate from the mixture of n-heptane and tetrahydrofuran had larger polarity and less solubility. From the first sub-fraction to the fourth sub-fraction, polarity, mean stacking numbers, and average layer size from the TEM images follow a gradual decrease. The structural parameters derived from TEM images could reflect the largest fused aromatic ring system in asphaltene molecule, yet the parameters derived from 1H NMR data reflected the mean message of poly-aromatic ring systems. The structural parameters derived from TEM images were more consistent with the polarity variation of sub-fractions than those derived from 1H NMR data, which indicates that the largest fused aromatic ring system will play a more important role in the stacking characteristics of

  9. Metagenomic Sequencing for Detection of Non-Traditional Biological Agents: Synthetic Constructs, Genetically Modified Organisms, and Emerging Threats

    Science.gov (United States)

    2013-03-31

    76.7%) 3.23 188,706 109 505 2,826,567 691 19 28,278,215 24,014,335 (84.9%) 2.83 140,519 107 867 2,175,052 719 20 27,535,077 23,053,100 (83.7%) 2.77...10 Staph Crono nce analysi Genus enus nia bacterium tococcus erichia ylococcus bacter s of Sample identified 454 % 0.30 0.55 33.10 4.93...Strep 10 Esch 10 Staph Vibri Bacil nce analysi Genus enus nia bacterium tococcus erichia ylococcus o lus s of Sample identified 454 % 0.48

  10. Prenatal Polyunsaturated Fatty Acid Levels and Risk of Autism Spectrum

    Science.gov (United States)

    2017-10-01

    state birth certificates and matched by birth year (2011-2013), birth month, and sex , after excluding DDS clients. Using banked prenatal serum...of life. Examples include:  data or databases;  biospecimen collections;  audio or video products;  software;  models;  educational aids...Controls    N=500  N=502  Sex   n  (%)  n (%)    Male  413   (82.6)  416  (82.9)    Female  87  (17.4)  86 (17.1)        Maternal Race        White  371

  11. Acute Exposure Guideline Levels (AEGLs) for Time Varying Toxic Plumes

    Science.gov (United States)

    2014-09-12

    loading rates between the density values given as Arho(b-1,k) and Arho(b,k). The line labeled ‘ extrap .’above b = 1 in Table 3 records the derived...exposure times and an inverse quadratic law for densities lower than 8.26 mg/m3. The line labeled ‘ extrap .’ at the bottom of the table gives the...6 (labeled “ extrap .” above) are simply duplicated from the adjacent band b = 5. This exponent is also used to define the lowest density value Brho

  12. Testing Map Features Designed to Convey the Uncertainty of Cancer Risk: Insights Gained From Assessing Judgments of Information Adequacy and Communication Goals.

    Science.gov (United States)

    Severtson, Dolores J

    2015-02-01

    Barriers to communicating the uncertainty of environmental health risks include preferences for certain information and low numeracy. Map features designed to communicate the magnitude and uncertainty of estimated cancer risk from air pollution were tested among 826 participants to assess how map features influenced judgments of adequacy and the intended communication goals. An uncertain versus certain visual feature was judged as less adequate but met both communication goals and addressed numeracy barriers. Expressing relative risk using words communicated uncertainty and addressed numeracy barriers but was judged as highly inadequate. Risk communication and visual cognition concepts were applied to explain findings.

  13. Dicty_cDB: Contig-U15453-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available obic xylose ... 46 6e-14 4 ( FE846587 ) CAFI812.fwd CAFI Pichia stipitis aerobic dextrose... 46 6e-14 4 ( FE...CAFI996.rev CAFI Pichia stipitis aerobic dextrose... 46 7e-14 4 ( FE852631 ) CAFP...3014 ) CAFP2544.fwd CAFP Pichia stipitis aerobic xylose ... 46 7e-14 4 ( FE846134 ) CAFI568.fwd CAFI Pichia stipitis aerobic dextrose...937 ) CAFI996.fwd CAFI Pichia stipitis aerobic dextrose... 46 9e-13 4 ( BJ346855 ...e-09 3 ( FE842517 ) CAFG826.rev CAFG Pichia stipitis aerobic dextrose... 46 2e-09 3 ( FE851504 ) CAFP1749.re

  14. A special core liner for sub-sampling of aqueous sediments

    Digital Repository Service at National Institute of Oceanography (India)

    Valsangkar, A.B.

    , 29, 35–51. 13. Mahaney, W. C., Vortisch, W. and Julig, P., Relative differences between glacially crushed quartz transported by mountain and continental ice – some examples from North America and East Africa. Am. J. Sci., 1988, 288, 810–826. 14..., 30, 165–171. 17. Mazzullo, J. and Ritter, C., Influence of sediment source on shapes and surface textures of glacial quartz sand grains. Geology, 1991, 19, 384–388. 18. Rajesh, A. and Chaturvedi, A., The grain-size behaviour and mor- phoscopy...

  15. Electron impact study of molecular ions of some benzyl derivatives

    International Nuclear Information System (INIS)

    Selim, E.T.; Rabia, M.A.; Fahmy, M.A.

    1992-01-01

    The ionization energies at threshold and values of higher energy levels for the molecular ions of benzyl alcohol, benzyl amine and benzyl cyanide are reported using electron impact technique. The first ionization energy values are found to be 8.26 eV (benzyl alcohol), 8.49 eV(benzyl amine)and 9.32 eV (benzyl cyanide). Some of the reported higher energy levels for the molecular ions are tentatively explained. The differences in the relative abundances for the main fragment ions are discussed and attributed to the effect of the different substituents - OH, -NH2 and -CN groups

  16. Solid-state e.m.f. and calorimetric measurements on Cs2Cr2O7(I)

    International Nuclear Information System (INIS)

    Venugopal, V.; Iyer, V.S.; Agarwal, R.; Roy, K.N.; Prasad, R.; Sood, D.D.

    1987-01-01

    The standard molar Gibbs free energy of formation of Cs 2 Cr 2 O 7 (1) has been determined in the temperature range 797 to 874 K, using a solid-oxide-electrolyte galvanic cell. The melting and transition temperatures, molar enthalpies of fusion and of transition of the same caesium compound were determined in the temperature range 662 to 826 K, using a high temperature Calvet microcalorimeter. Results on the standard molar enthalpy of formation of Cs 2 Cr 2 O 7 at 298.15 K are in good agreement with those reported by other workers. (U.K.)

  17. Absorbed dose to ovaries or uterus during a 131I-therapeutic of cancer or hyperthyroidism: comparison between in vivo measurements by TLD and calculations

    International Nuclear Information System (INIS)

    Briere, J.; Philippon, B.

    1979-01-01

    An LiF dosimeter placed inside the uterus will only give an approximate value of the dose delivered to gonads during therapy by iodine-131. But it was easily demonstrated that the dose measured by LTD dosimeter does not significantly differ for uterus and for ovaries, because of the similar position of the source organs. Consequently a LiF dosimeter was placed in volunteer patients inside the uterus. Experimental results were compared to the dose calculated by Robertson and Gorman (J. Nucl. Med. 17, 826, (1976)) method for ovaries and for uterus. (author)

  18. Assessment of tannin variation in Tamarisk foliage across a latitudinal gradient

    Science.gov (United States)

    Hussey, A.M.; Kimball, B.A.; Friedman, J.M.

    2011-01-01

    Certain phenotypic traits of plants vary with latitude of origin. To understand if tannin concentration varies among populations of tamarisk (Tamarix spp.) according to a latitudinal gradient, an analytical method was adapted from an enological tannin assay. The tannin content (wet basis) of tamarisk foliage collected from 160 plants grown in a common garden ranged from 8.26 to 62.36 mg/g and was not correlated with the latitude of the original North American plant collection site. Tannins do not contribute to observed differences in herbivory observed among these tamarisk populations.

  19. Effects of stillbirth and dystocia on subsequent reproductive performance in Japanese Black cattle.

    Science.gov (United States)

    Sasaki, Yosuke; Uematsu, Mizuho; Kitahara, Go; Osawa, Takeshi; Sueyoshi, Masuo

    2014-06-01

    The objective of this study was to determine the effects of stillbirth and dystocia on subsequent reproductive performance in Japanese Black cattle. Data were collected for 34,763 calvings from 13,186 animals on 826 farms. Stillbirth was associated with a decreased first service conception rate compared to cows with a normal calving (44.4 versus 54.0%, respectively, P dystocia (P dystocia had inferior subsequent reproductive performance compared with those with a normal calving. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. In situ calibration of acoustic emission transducers by time reversal method

    Czech Academy of Sciences Publication Activity Database

    Kober, Jan; Převorovský, Zdeněk; Chlada, Milan

    2016-01-01

    Roč. 240, April (2016), s. 50-56 ISSN 0924-4247 Institutional support: RVO:61388998 Keywords : time reversed acoustic s * calibration * in situ * acoustic emission Subject RIV: BI - Acoustic s Impact factor: 2.499, year: 2016 http://ac.els-cdn.com/S0924424716300334/1-s2.0-S0924424716300334-main.pdf?_tid=0acf4736-ef6d-11e5-b826-00000aacb362&acdnat=1458568911_1c21eda9762b905a684ff939463ef3fe

  1. Phylogenetic trees and Euclidean embeddings.

    Science.gov (United States)

    Layer, Mark; Rhodes, John A

    2017-01-01

    It was recently observed by de Vienne et al. (Syst Biol 60(6):826-832, 2011) that a simple square root transformation of distances between taxa on a phylogenetic tree allowed for an embedding of the taxa into Euclidean space. While the justification for this was based on a diffusion model of continuous character evolution along the tree, here we give a direct and elementary explanation for it that provides substantial additional insight. We use this embedding to reinterpret the differences between the NJ and BIONJ tree building algorithms, providing one illustration of how this embedding reflects tree structures in data.

  2. Bremsstrahlung in the presence of a laser field

    International Nuclear Information System (INIS)

    Dondera, M.; Florescu, Viorica

    2006-01-01

    For the process of spontaneous one photon emission by an electron scattered on a potential in the presence of a monochromatic laser field, we review the formalism and the approximations on which the existing nonrelativistic calculations are based, in classical and quantum descriptions. In the case of the Coulomb potential, we give new numerical results for the radiation spectrum, using either the Born approximation [Karapetyan, P.V., Fedorov, M.V., 1978. Spontaneous electron bremmstrahlung in the field of an intense electromagnetic wave. Zh. Teor. Fiz. 75, 816-826 [Sov. Phys. JETP 48, 412 (1979)

  3. LA NUEVA VISIÓN DE DESARROLLO RURAL TERRITORIAL Y SU FORMULACIÓN EN EL PLAN DE DESARROLLO

    Directory of Open Access Journals (Sweden)

    Arturo E. Vega V

    2004-07-01

    Full Text Available Al despuntar el siglo XXI, en Colombia aún persistencondiciones de desigualdad y atraso en el medio rural,que se reflejan en el comportamiento de algunosindicadores sociales, entre los que se destacan: delos 12.2 millones de pobladores rurales, el 82.6%se encuentra por debajo de la línea de pobreza y deéstos el 43.4% vive en condiciones de pobrezaextrema; que contrastan con las áreas urbanas, dondeestos niveles se sitúan en el 51% y el 15.8%respectivamente.

  4. The exhalant jet of mussels Mytilus edulis

    DEFF Research Database (Denmark)

    Riisgard, Hans Ulrik; Jørgensen, Bo Hoffmann; Lundgreen, Kim

    2011-01-01

    shell lengths. Here, we present results of a detailed study of fully open mussels Mytilus edulis in terms of filtration rate, exhalant siphon aperture area, jet velocity, gill area and body dry weight, all as a function of shell length (mean +/- SD) over the range 16.0 +/- 0.4 to 82.6 +/- 2.9 mm...... detailed 2-component velocity distributions near the exhalant siphon in 5 planes parallel to the axis of the jet and the major axis of the oval aperture, and hence estimates of momentum and kinetic energy flows in addition to mean velocity. Data obtained on particles inside the exhalant jet of filtered...

  5. Competencias a desarrollar por los estudiantes de Medicina en la disciplina de Anatomía Humana en las universidades públicas españolas

    Directory of Open Access Journals (Sweden)

    Blanca Mompeó Corredera

    2017-04-01

    Las competencias a las que se ha hecho referencia debían desarrollarse en los módulos especificados en la Orden ECI/332/2008 como sigue: a morfología, estructura y función del cuerpo humano (82,6% de los casos; b medicina social habilidades de comunicación e iniciación a la investigación (4,34%; c formación clínica humana (4,34%, y d procedimientos diagnósticos y terapéuticos (0%.

  6. Isolation and characterization of microsatellite loci in the whale shark (Rhincodon typus)

    Science.gov (United States)

    Ramirez-Macias, D.; Shaw, K.; Ward, R.; Galvan-Magana, F.; Vazquez-Juarez, R.

    2009-01-01

    In preparation for a study on population structure of the whale shark (Rhincodon typus), nine species-specific polymorphic microsatellite DNA markers were developed. An initial screening of 50 individuals from Holbox Island, Mexico found all nine loci to be polymorphic, with two to 17 alleles observed per locus. Observed and expected heterozygosity per locus ranged from 0.200 to 0.826 and from 0.213 to 0.857, respectively. Neither statistically significant deviations from Hardy–Weinberg expectations nor statistically significant linkage disequilibrium between loci were observed. These microsatellite loci appear suitable for examining population structure, kinship assessment and other applications.

  7. Reproductive function of monkeys subjected to chronic irradiation

    International Nuclear Information System (INIS)

    Artem'eva, N.S.; Kosichenko, L.P.; Andreeva, A.V.; Zvereva, G.A.

    1976-01-01

    Marked functional disorders have been detected in reproductive glands of eight female monkeys (as compared to twelve control animals) subjected to protracted (up to eight years) irradiation (cumulative doses 826-3282 R). Irradiated monkeys exhibited a drastically decreased reproductive capacity, early menopause and sterility. Irradiation of preadolescent animals inhibited, in most cases, the puberty processes and disturbed sex cycles. Structural disorders in sex glands, inhibition of the processes of maturation and ovulation of folloculi, death of the mass of germ cells, atypical vegetations of the integmentary epithelium, sclerosing and cystic degeneration of the glandular tissue have been revealed

  8. Microtubule-severing ATPase spastin in glioblastoma: increased expression in human glioblastoma cell lines and inverse roles in cell motility and proliferation

    Czech Academy of Sciences Publication Activity Database

    Dráberová, Eduarda; Vinopal, Stanislav; Morfini, G.; Liu, P. S.; Sládková, Vladimíra; Sulimenko, Tetyana; Burns, M.R.; Solowska, J.; Kulandaivel, K.; De Chadarévian, J.P.; Legido, A.; Mork, S.J.; Janáček, Jiří; Baas, P.; Dráber, Pavel; Katsetos, C.D.

    2011-01-01

    Roč. 70, č. 9 (2011), s. 811-826 ISSN 0022-3069 R&D Projects: GA ČR GAP302/10/1701; GA ČR GA204/09/1777; GA ČR(CZ) GD204/09/H084; GA AV ČR KAN200520701; GA MŠk LC545 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50110509 Keywords : spastin * glioblastoma * cell motility Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.258, year: 2011

  9. 3-Adic Cantor function on local fields and its p-adic derivative

    International Nuclear Information System (INIS)

    Qiu Hua; Su Weiyi

    2007-01-01

    The problem of 'rate of change' for fractal functions is a very important one in the study of local fields. In 1992, Su Weiyi has given a definition of derivative by virtue of pseudo-differential operators [Su W. Pseudo-differential operators and derivatives on locally compact Vilenkin groups. Sci China [series A] 1992;35(7A):826-36. Su W. Gibbs-Butzer derivatives and the applications. Numer Funct Anal Optimiz 1995;16(5 and 6):805-24. [2,3

  10. Resultados de diferentes alternativas de manejo del riego superficial tecnificado en el cultivo de la papaya maradol roja plantada con marco extradenso

    OpenAIRE

    Ricardo, Pérez Hernández; Jiménez Espinosa, Esequiel; Montero San José, Lorenzo; Sarmiento García, Orlando; Guzmán Vizcaino, Joaquín

    2010-01-01

    El objetivo de este trabajo consistió en la realización de un estudio de diferentes manejos del riego por gravedad tecnificado, mediante evaluaciones de campo en el cultivo de referencia. El caudal de mejor comportamiento para el riego con flujo continuo con la variante de surcos abiertos de 130 m de longitud fue el de 1,56 L·s-1 , con eficiencia de aplicación 61,8%, eficiencia de almacenamiento 97% y distribución 82,6%. Las perdidas por escurrimiento superficial y percolación profunda fueron...

  11. Resultados de diferentes alternativas de manejo del riego superficial tecnificado en el cultivo de la papaya maradol roja plantada con marco extradenso

    OpenAIRE

    Ricardo Pérez Hernández; Esequiel Jiménez Espinosa; Lorenzo Montero San José; Orlando Sarmiento García; Joaquín Guzmán Vizcaino

    2010-01-01

    El objetivo de este trabajo consistió en la realización de un estudio de diferentes manejos del riego por gravedad tecnificado, mediante evaluaciones de campo en el cultivo de referencia. El caudal de mejor comportamiento para el riego con flujo continuo con la variante de surcos abiertos de 130 m de longitud fue el de 1,56 L¿s-1, con eficiencia de aplicación 61,8%, eficiencia de almacenamiento 97% y distribución 82,6%. Las perdidas por escurrimiento superficial y percolación profunda fueron ...

  12. [X-ray diagnosis of malignant non-epithelial tumors of the lung].

    Science.gov (United States)

    Arablinskiĭ, V M; Efimova, O Iu; Trakhtenberg, A Kh; Frank, G A; Korenev, S V

    1991-01-01

    The paper is devoted to analysis of the investigation and treatment of 137 patients with histologically verified lung sarcoma. X-ray was the chief method of primary detection. A classification, singling out 3 types, was developed: peripheral (82.6%), central (16%) and disseminated (1.4%). The first one included nodular (76%) and pneumonia-like (6.6%) types of changes, the second one--endobronchial changes (11%), peribronchial (2.9%) and exobronchial nodular (2.1%) changes. The developed roentgenosemeiotics made it possible to diagnose malignancy in 72% of the patients, indicating its nonepithelial nature in 36%.

  13. Bremsstrahlung in the presence of a laser field

    Energy Technology Data Exchange (ETDEWEB)

    Dondera, M. [Department of Physics, University of Bucharest, Bucharest-Magurele MG11, 76900 (Romania); Florescu, Viorica [Department of Physics, University of Bucharest, Bucharest-Magurele MG11, 76900 (Romania)]. E-mail: flor@barutu.fizica.unibuc.ro

    2006-10-15

    For the process of spontaneous one photon emission by an electron scattered on a potential in the presence of a monochromatic laser field, we review the formalism and the approximations on which the existing nonrelativistic calculations are based, in classical and quantum descriptions. In the case of the Coulomb potential, we give new numerical results for the radiation spectrum, using either the Born approximation [Karapetyan, P.V., Fedorov, M.V., 1978. Spontaneous electron bremmstrahlung in the field of an intense electromagnetic wave. Zh. Teor. Fiz. 75, 816-826 [Sov. Phys. JETP 48, 412 (1979)

  14. Joint Mental Health Advisory Team 7 (J-MHAT 7) Operation Enduring Freedom 2010 Afghanistan (REDACTED)

    Science.gov (United States)

    2011-02-22

    it doesn’tmake sense to them." ’We had a large white bo;ard in the. TOC for the purpose of writing down changes tothe miss.i6n... sexual assault. Areas where personnel felt decreased confidence included treatment of non-combatants, detainees, and host nation security force...evaluate and treat victims of sexual assault 82.6% 62.0% 10.3% perform clinical evaluation and treatment of detainees 26.0% 10.0% 26.2% COMBAT AND

  15. 3-Adic Cantor function on local fields and its p-adic derivative

    Energy Technology Data Exchange (ETDEWEB)

    Qiu Hua [Department of Mathematics, Nanjing University, Nanjing 210093 (China)]. E-mail: huatony@eyou.com; Su Weiyi [Department of Mathematics, Nanjing University, Nanjing 210093 (China)]. E-mail: suqiu@nju.edu.cn

    2007-08-15

    The problem of 'rate of change' for fractal functions is a very important one in the study of local fields. In 1992, Su Weiyi has given a definition of derivative by virtue of pseudo-differential operators [Su W. Pseudo-differential operators and derivatives on locally compact Vilenkin groups. Sci China [series A] 1992;35(7A):826-36. Su W. Gibbs-Butzer derivatives and the applications. Numer Funct Anal Optimiz 1995;16(5 and 6):805-24. [2,3

  16. Análise geoquímica-ambiental dos solos de veredas da Bacia do Rio do Formoso, município de Buritizeiro, Minas Gerais, Brasil

    OpenAIRE

    Priscilla Palmeiras de Freitas

    2010-01-01

    A Bacia do Rio do Formoso, importante tributário do Rio São Francisco. no norte do estado de Minas Gerais, está posicionada na porção sudoeste do município de Buritizeiro, drenando uma área de aproximadamente 826 km2. Inserida no Bioma Cerrado, esta bacia possui inúmeras veredas que são um tipo de ecossistema, que se desenvolve sob condições definidas de umidade em regiões deste bioma, sendo identificadas, em geral, como cabeceiras ou nascentes de rios. As veredas, áreas úmidas do Cerrado, so...

  17. Spatiotemporal variability in archaeal communities of tropical coastal waters

    Digital Repository Service at National Institute of Oceanography (India)

    Singh, S.K.

    properties on SST biases and the South Asian summer monsoon in a coupled GCM. Clim Dyn 39:811–826 Urakawa H, Martens-Habbena W, Stahl DA (2010) High abundance of ammonia-oxidizing archaea in coastal waters, determined using a modified DNA extraction method...- ments suggests that archaea play a major role in the global nitrification process (Francis et al. 2005; Prosser and Nicol 2008; Wuchter et al. 2006). Denaturing gradient gel electrophoresis (DGGE) is among the reliable techniques for microbial...

  18. Optimization of the Use of Selected Non-Phosphate Water Retention Additives in Minced Beef Using Response Surface Methodology

    Science.gov (United States)

    Shang, Xiaolan; Qiao, Jie; Liu, Yujie

    2017-12-01

    This study looked to determine what the optimum cooking loss for minced beef was when three different non-phosphate water retention additives (L-Arginine, sodium carbonate, and sodium citrate) were combined; the optimum value was determined using a Box-Behnken response surface design method. The optimum value was found to be 8.26%, and it was obtained when 0.29% L-Arginine, 0.45% sodium carbonate, and 0.24% sodium citrate were added to the beef.

  19. [The closure of forensic hospitals and the implications for nursing care].

    Science.gov (United States)

    Piccoli, Michele

    2015-01-01

    The closure of forensic hospitals and the implications for nursing care. The closure of forensic hospitals led to the opening of new wards to admit psychiatric patients who committed a crime and by Italian law, cannot be imprisoned. Over 826 residents of forensic hospitals, around 350 cannot be discharged because considered dangerous for the society. The new wards where these patients will be admitted raise some legal and ethical problems as health professionals (doctors and nurses) will be responsible not only of the patients health but also of their legal custody. The professional and ethical implications need a debate among professionals.

  20. David M. Malone - President Travel Expenses 2009-10

    International Development Research Centre (IDRC) Digital Library (Canada)

    test

    IDRC Programming & Ditchley Conference. 8,572.95. 2,639.79. 1,826.63. 1,569.01. 14,608.38. 14,608.38. TOTAL. 30,937.64. 1,675.05. 10,936.98. 8,226.89. 6,154.36. 57,930.92. 1,707.47. 56,223.45. Notes: 1) Includes minor expenses that do not fall in the other categories, such as but not limited to, taxis, visas, airport ...

  1. 7 CFR Appendix B to Subpart E of... - Federal Reserve Statistical Release

    Science.gov (United States)

    2010-01-01

    ... all outstanding bonds neither due nor callable in less than 10 years, including one very low yielding...) 14 8.29 8.26 8.29 8.27 8.15 8.25 8.28 8.33 Corporate bonds Moody's Seasoned AAA 9.03 9.01 9.00 8.99 8....83 State and local bonds 16 7.00 7.00 7.06 7.08 Conventional mortgages 17 9.56 9.56 9.61 9.64...

  2. Structural changes in chromosomes of peripheral blood lymphocytes in monkeys subjected to long-term daily irradiation

    International Nuclear Information System (INIS)

    Kosichenko, L.P.

    1976-01-01

    During the period that lasted from 4 to 11 years after the cessation of the long-term daily gamma-irradiation the frequency of chromosome rearrangements in peripheral blood lymphocytes of monkeys exceeded the control level. The number of rearrangements did not change significantly with different total irradiation doses (from 826 to 3677r). The main type of structural chromosome rearrangements were symmetrical chromosome exchanges. Abnormal cell clones in peripheral lymphocytes in monkeys irradiated with low doses exhibited no selective advantages during the periods of investigation

  3. Cross-Validation of Numerical and Experimental Studies of Transitional Airfoil Performance

    DEFF Research Database (Denmark)

    Frere, Ariane; Hillewaert, Koen; Sarlak, Hamid

    2015-01-01

    The aerodynamic performance characteristic of airfoils are the main input for estimating wind turbine blade loading as well as annual energy production of wind farms. For transitional flow regimes these data are difficult to obtain, both experimentally as well as numerically, due to the very high...... sensitivity of the flow to perturbations, large scale separation and performance hysteresis. The objective of this work is to improve the understanding of the transitional airfoil flow performance by studying the S826 NREL airfoil at low Reynolds numbers (Re = 4:104 and 1:105) with two inherently different...

  4. Opportunity Examining Composition of 'Cook Islands' Outcrop

    Science.gov (United States)

    2009-01-01

    This image taken by the front hazard-avoidance camera on NASA's Mars Exploration Rover Opportunity shows the rover's arm extended to examine the composition of a rock using the alpha particle X-ray spectrometer. Opportunity took this image during the 1,826th Martian day, or sol, of the rover's Mars-surface mission (March 13, 2009). The spectrometer is at a target called 'Penrhyn,' on a rock called 'Cook Islands.' As Opportunity makes its way on a long journey from Victoria Crater toward Endeavour Crater, the team is stopping the drive occasionally on the route to check whether the rover finds a trend in the composition of rock exposures.

  5. The association between adult drug abuse and childhood maltreatment in students attending seven universities in five countries in Latin America and one country in the Caribbean

    OpenAIRE

    Longman-Mills,Samantha; Williams,Yolanda Maria González; Rodriguez,Marlon Osman Melendez; Baquero,Monica Rosaura García; Rojas,Juan Daniel Gómez; Amaya,Cristina Juárez de; Diaz,Eduardo Alfredo Martínez; Corea,Sobeya Jose Peñalba; Baez,Enrique Miguel Pizzanelli; Tinoco,Lucia Isabel Solórzano

    2015-01-01

    Este estudio busca identificar la relación entre el maltrato durante la infancia y el abuso de drogas entre estudiantes de siete Universidad en cinco países de Latin America y uno país del Caribe. Este es un estudio hecho en varios países utilizando un diseño de corte para colectar los datos del abuso de drogas y un levantamiento retrospectivo sobre el maltrato en la infancia. La muestra fue constituida de 2.283 estudiantes universitarios, de los cuales 82,6% informaran maltrato en la infanci...

  6. Sonographic evaluation of thyroglossal duct cysts in children

    International Nuclear Information System (INIS)

    Ahuja, A.T.; King, A.D.; Metreweli, C.

    2000-01-01

    BACKGROUND AND AIMS: Thyroglossal duct cysts (TDC) in children have a variable sonographic appearance. Some reports have suggested that TDCs appear on ultrasound as well defined, cystic masses with thin walls and posterior enhancement, whereas others have documented a heterogeneous echopattern within these lesions. In our experience, although TDCs in children have a variable ultrasound appearance, the most common appearance is that of a pseudosolid mass closely related to the hyoid bone. In this study we report on 23 patients with thyroglossal duct cysts and document the ultrasonic patterns. PATIENTS AND METHODS: All patients in whom the diagnosis of TDC was made clinically (by at least two head and neck surgeons) and in whom ultrasound detected a cystic mass related to the hyoid bone, were included in this study. Sonograms of 23 children with TDCs were reviewed. The features evaluated included their location, internal echogenicity, posterior enhancement, the presence of septa, a solid component and a fistulous tract. The echopattern was not correlated with the biopsy results. RESULTS: Three patterns of TDCs were identified: anechoic (13%); pseudosolid (56.5%); and a heterogeneous pattern (30.5%). The majority were midline (82.6%), showed posterior enhancement (56.5%), and had thin walls (82.6%). CONCLUSION: On ultrasound, TDCs in children are not simple cysts but have a complex pattern ranging from a typical anechoic cyst to a pseudosolid appearance (most common). Ahuja, A.T. (2000)

  7. Gallstones Risk Factor and Prevalence in the Elderly in Jeju Island

    Energy Technology Data Exchange (ETDEWEB)

    Sim, Hyun Sun; Choi, Joon Lock; Park, Jae Jin; Lee, Su Yeon; Lee, Ji Min; Jung, Hong Ryang; Lim, Chung Hwan; Kim, Jung Gu [Dept. of Radiological Science, Hanseo University, Cheju (Korea, Republic of)

    2009-09-15

    Gallbladder stone is the most common disease of biliary tract. It is lead to acute abdominal pain. The cholecystitis which is caused by in gallbladder stone occurs frequently and the possibility of the gallbladder cancer comes to be high. Our study was designed to determine the prevalence and risk factors gallbladder stone in a population who community. We enrolled a total of 826 (male : 297, female : 529) persons who 60 or older in Jeju-do 10 places from 2008 July one months. The height, weight, liver function tests, lipid profile, fasting blood sugar, were all measurement. They had their gallbladder examined with using ultrasonography. Statistical significance was defined as a p-value less than 0.05. Among 826 persons, gallbladder stone was found in 49 persons (5.9%). The male is 6.1% and the female is 5.8%, the male 1.03 times appeared more highly the female. The body mass index above of 23.0 kg/m{sup 2} with the gallbladder stone was 69.3% (p<0.047). The gallbladder stone appeared highly according to age increases. The obesity is the risk factor of gallbladder stone. The weight management and diet control is a possibility of reducing a gallbladder stone creation.

  8. An investigation of the thermal conductivity of Cs2MoO4

    International Nuclear Information System (INIS)

    Ishii, T.; Mizuno, T.

    1997-01-01

    The thermal diffusivity of 82.6% TD and 89.3% TD Cs 2 MoO 4 was measured by the laser flash method and the thermal conductivity was calculated. The thermal conductivity of these Cs 2 MoO 4 ranged from 0.3 to 0.5 W m -1 K -1 . The density dependence of the thermal conductivity was correlated based on the experimental values of these two densities and on the 94.3% TD specimen from the preceding study. The correlation of the thermal conductivity of Cs 2 MoO 4 is k=(1.0-1.848 x P)/(1.0-1.848 x P ref ) x k ref , where k ref =132.56/T+0.03+3.2 x 10 -10 x T 3 , P ref =1.0-0.943=0.057 and k and k ref are the thermal conductivities (Wm -1 K -1 ) of Cs 2 MoO 4 with the porosities P and P ref , respectively, where P ref is the porosity for the 94.3% TD Cs 2 MoO 4 . T is the temperature (K). This correlation is applicable for 82.6 to 94.3% TD Cs 2 MoO 4 from 873 to 1023 K. (orig.)

  9. Diagnostic performance of whole-body MRI for the detection of persistent or relapsing disease in multiple myeloma after stem cell transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Bannas, Peter; Hentschel, Hannah B.; Bley, Thorsten A.; Derlin, Thorsten; Yamamura, Jin; Adam, Gerhard; Weber, Christoph [University Medical Center Hamburg-Eppendorf, Department of Diagnostic and Interventional Radiology, Hamburg (Germany); Treszl, Andras; Eulenburg, Christine [University Medical Center Hamburg-Eppendorf, Department of Medical Biometry and Epidemiology, Hamburg (Germany); Stuebig, Thomas; Kroeger, Nicolaus [University Medical Center Hamburg-Eppendorf, Department of Stem Cell Transplantation, Hamburg (Germany)

    2012-09-15

    To compare the diagnostic performance of whole-body MRI (WBMRI) with haematological parameters for detecting persistent or relapsing disease in patients with multiple myeloma after stem cell transplantation. Sixty-six WBMRI acquisitions were performed in 33 patients with multiple myeloma at two time points after stem cell transplantation. Extent of disease and inter-test dynamics of intra- and extramedullary myeloma manifestations were compared (kappa statistics) with Uniform Response Criteria, comprising haematological parameters. Using data from 66 sequential WBMRI acquisitions in 33 patients, 10 patients (30.3 %) were classified as having progressive disease and 23 (69.7 %) as being in remission. Eight (80 %) of the ten patients with progressive disease revealed intramedullary lesions, and two patients (20 %) had intra- and extramedullary lesions. WBMRI and laboratory tests were concordant in 26/33 (78.8 %) patients. We found an agreement of 51.2 %, 95 % confidence interval 19.8 %-82.6 %, between results from WBMRI and haematological parameters. WBMRI had a sensitivity of 63.6 %, specificity of 86.4 %, PPV of 70.0 %, NPV of 82.6 % and accuracy of 78.8 % for detection of remission. WBMRI allows the detection and exact localisation of intra- and extramedullary myeloma manifestations after stem cell transplantation, but shows only moderate agreement with routinely performed laboratory tests for determination of remission. (orig.)

  10. Immunization coverage among children in Al-Taizyah district, Taiz Governorate, Yemen

    Directory of Open Access Journals (Sweden)

    Nabil Ahmed Al-Rabeei

    2014-12-01

    Full Text Available Introduction: At least 2 million people die every year from diseases preventable by vaccines recommended by the World Health Organization. Objective: To assess the routine immunization coverage among children aged 12-23 month and to determine the reasons for unvaccinated. Methods: We conducted a community-based survey in Al-Taizyah district, Taiz governorate, Yemen. Information about vaccination status and related barriers was collected for 420 children from 1st March to 31st March 2012. Results: 49.8% of the children had vaccination cards. About 69.5% of the children were fully vaccinated by cards and by history, 15.5% were partially vaccinated and 15% not vaccinated. As a regards to crude vaccination coverage, 82.9% of children were received BCG vaccine. OPV1 vaccine was 82.6%. Pentavalent1 was 82.6%. Measles 1 represented for 71.7% and vitamin A1 was 46.4%. 91% was valid doses for OPV1 and 93% for pentavalent1. Only 76% of measles1 dose was valid. The high scores14% of drop-out rate was recorded between BCG and Measles. The main reasons for partially vaccinated and unvaccinated of children were the lack of information 61.7%. Conclusion: There is low vaccination coverage among children aged 12-23 months. There is a need to raise the awareness of community about vaccination and EPI services in Al-Taizyah district.

  11. Horizontal arrangement of anodes of microbial fuel cells enhances remediation of petroleum hydrocarbon-contaminated soil.

    Science.gov (United States)

    Zhang, Yueyong; Wang, Xin; Li, Xiaojing; Cheng, Lijuan; Wan, Lili; Zhou, Qixing

    2015-02-01

    With the aim of in situ bioremediation of soil contaminated by hydrocarbons, anodes arranged with two different ways (horizontal or vertical) were compared in microbial fuel cells (MFCs). Charge outputs as high as 833 and 762C were achieved in reactors with anodes horizontally arranged (HA) and vertically arranged (VA). Up to 12.5 % of the total petroleum hydrocarbon (TPH) was removed in HA after 135 days, which was 50.6 % higher than that in VA (8.3 %) and 95.3 % higher than that in the disconnected control (6.4 %). Hydrocarbon fingerprint analysis showed that the degradation rates of both alkanes and polycyclic aromatic hydrocarbons (PAHs) in HA were higher than those in VA. Lower mass transport resistance in the HA than that of the VA seems to result in more power and more TPH degradation. Soil pH was increased from 8.26 to 9.12 in HA and from 8.26 to 8.64 in VA, whereas the conductivity was decreased from 1.99 to 1.54 mS/cm in HA and from 1.99 to 1.46 mS/cm in VA accompanied with the removal of TPH. Considering both enhanced biodegradation of hydrocarbon and generation of charge in HA, the MFC with anodes horizontally arranged is a promising configuration for future applications.

  12. Determination of the seroprevalence of Newcastle disease virus (avian paramyxovirus type 1 in Zambian backyard chicken flocks

    Directory of Open Access Journals (Sweden)

    Chimuka Musako

    2012-02-01

    Full Text Available A cross-sectional study was conducted in five provinces and 11 districts of Zambia to determine the seroprevalence of Newcastle disease in Zambian backyard chicken flocks. Of the chickens sampled, 73.9% tested positive for avian paramyxovirus type 1 antibodies by means of an enzyme-linked immunosorbent assay. Seroprevalence varied amongst the five provinces sampled, ranging from 82.6% in the Eastern Province to 48.3% in Luapula Province. Seroprevalence also varied amongst the 11 districts sampled, ranging from 91.3% in Monze district of Southern Province to 22.8% in Mufulira district of the Copperbelt province. Overall, the seroprevalence of Newcastle disease in Zambian backyard chicken flocks has increased since the previous study conducted in 1994.

  13. Psychometric prediction of penitentiary recidivism.

    Science.gov (United States)

    Medina García, Pedro M; Baños Rivera, Rosa M

    2016-05-01

    Attempts to predict prison recidivism based on the personality have not been very successful. This study aims to provide data on recidivism prediction based on the scores on a personality questionnaire. For this purpose, a predictive model combining the actuarial procedure with a posteriori probability was developed, consisting of the probabilistic calculation of the effective verification of the event once it has already occurred. Cuestionario de Personalidad Situacional (CPS; Fernández, Seisdedos, & Mielgo, 1998) was applied to 978 male inmates classified as recidivists or non-recidivists. High predictive power was achieved, with the area under the curve (AUC) of 0.85 (p <.001; Se = 0.012; 95% CI [0.826, 0.873]. The answers to the CPS items made it possible to properly discriminate 77.3% of the participants. These data indicate the important role of the personality as a key factor in understanding delinquency and predicting recidivism.

  14. The Effect of Zingiber Officinale Rosc in The Diets of Performance in Culled Layer Ducks

    Directory of Open Access Journals (Sweden)

    Tjokorda Gede Belawa Yadnya

    2012-02-01

    Full Text Available The experiment was design using a completely randomized block design (CRBD with four treatments. Treatment were diets without Zingiber officinale rosc (A, diets contain 2,91% Zingiber officinale Rosc  (B, diets contain 5,66%. Zingiber officinale Rosc (C, and diets contain 8,26% Zingiber officinale Rosc (D. Each treatment with five replicates, and each replicate consist four culled layer ducks. Variable observed were feed conversation ratio, carcass physical composition, and meat quality. It was concluded that present  Zingiber officinale Rosc in the diets could be improved of performance in culled layer ducks.   Keywords : Zingiber officinale Rosc, Culled layer ducks, and  meat qualit

  15. Diferencias en las estadísticas e juego entre los equipos ganadores y perdedores de la Copa del Rey 2008 de balonmano masculino [Difference in the statistics of game between the winning and losing teams of the king’s cup 2008 of male handball

    Directory of Open Access Journals (Sweden)

    Francisco Javier Sáez Blázquez

    2010-03-01

    Full Text Available Resumen El objetivo de este estudio es analizar en que se diferencian los equipos ganadores y perdedores de la Copa del Rey 08 de balonmano masculino en función de las estadísticas de juego. Los datos de los partidos (n=7 fueron facilitados por la ASOBAL. Las variables empleadas en el estudio podemos dividirlas en primarias (goles marcados, goles de 9, 6, 7 m y contraataque, lanzamientos fallados de 9, 6, 7 m. y contraataque, lanzamientos totales, pases de gol, perdidas,  recuperaciones,  paradas de 9, 6, 7m., contraataque y paradas totales, exclusiones, descalificaciones directas y expulsiones y en secundarias (Posesiones, CEO, CRO, CED, CRD. Todos los datos de las estadísticas de juego fueron normalizadas a 100 posesiones. El análisis se realizó mediante el SPSS 17.0 para Windows, se empleo una prueba t para medidas independientes a través de la cual observamos que los equipos ganadores se diferencian de los perdedores en las siguientes variables: goles marcados (t100 =2.907; p≤ 0.05, lanzamientos fallados 6m (t100 = - 3.335; p≤ 0.01, goles contraataque (t100 =2.196; p≤ 0.05, paradas 6m (t100 = 2.406; p≤ 0.05, CEO (t100 = 2.907; p≤ 0.05 CRO (t100 = 3.826; p≤ 0.01, CED (t100 = -2.907; p≤ 0.05, CRD (t100 = 3.826; p≤ 0.01. Podemos concluir afirmando que tanto la fase defensiva como los contraataques son aspectos muy relevantes a la hora de alcanzar el éxito, este hecho debe ser tenido en cuenta por los entrenadores y preparadores físicos a la hora de elaborar su proceso de entrenamiento.  Palabras clave: Balonmano, Copa del Rey, Victoria, Derrota, Diferencias, Coeficientes del rendimiento.   Abstract The purpose of this study is to analyze the difference between the winning and losing teams of the King's Cup 08 of male handball depending on the statistics of game. The data was provided by the ASOBAL (n = 7. The variables used in the study were divided in two kind of variables: primary (goals scored, goals of 9, 6, 7 m

  16. LGMD2I in a North American population

    Directory of Open Access Journals (Sweden)

    White Alexander J

    2007-11-01

    Full Text Available Abstract Background There is a marked variation in clinical phenotypes that have been associated with mutations in FKRP, ranging from severe congenital muscular dystrophies to limb-girdle muscular dystrophy type 2I (LGMD2I. Methods We screened the FKRP gene in two cohorts totaling 87 patients with the LGMD phenotype. Results The c.826C>A, p.L276I mutation was present in six patients and a compound heterozygote mutation in a seventh patient. Six patients had a mild LGMD2I phenotype, which resembles that of Becker muscular dystrophy. The other patient had onset before the age of 3 years, and thus may follow a more severe course. Conclusion These findings suggest that LGMD2I may be common in certain North American populations. This diagnosis should be considered early in the evaluation of LGMD.

  17. New Physics at the LHC. A Les Houches Report Physics at TeV Colliders 2009 - New Physics Working Group

    CERN Document Server

    Brooijmans, G; Kribs, G D; Shepherd-Themistocleous, C; Agashe, K; Basso, L; Belanger, G; Belyaev, A; Black, K; Bose, T; Brunelière, R; Cacciapaglia, G; Carrera, E; Das, S P; Deandrea, A; De Curtis, S; Etienvre, A -I; Espinosa, J R; Fichet, S; Gauthier, L; Gopalakrishna, S; Gray, H; Gripaios, B; Guchait, M; Harper, S J; Henderson, C; Jackson, J; Karagöz, M; Kraml, S; Lane, K; Lari, T; Lee, S J; Lessard, J R; Maravin, Y; Martin, A; McElrath, B; Moreau, G; Moretti, S; Morrissey, D E; Mühlleitner, M; Poland, D; Pruna, G M; Pukhov, A; Raklev, A R; Robens, T; Rosenfeld, R; Rzehak, H; Salam, G P; Sekmen, S; Servant, G; Singh, R K; Smith, B C; Spira, M; Strassler, M J; Tomalin, I; Tytgat, M; Vos, M; Wacker, J G; Weitershausen, P v; Zurek, K M

    2010-01-01

    We present a collection of signatures for physics beyond the standard model that need to be explored at the LHC. First, are presented various tools developed to measure new particle masses in scenarios where all decays include an unobservable particle. Second, various aspects of supersymmetric models are discussed. Third, some signatures of models of strong electroweak symmetry are discussed. In the fourth part, a special attention is devoted to high mass resonances, as the ones appearing in models with warped extra dimensions. Finally, prospects for models with a hidden sector/valley are presented. Our report, which includes brief experimental and theoretical reviews as well as original results, summarizes the activities of the "New Physics" working group for the "Physics at TeV Colliders" workshop (Les Houches, France, 8-26 June, 2009).

  18. Coulomb effects in deuteron stripping reactions as a three-body problem

    International Nuclear Information System (INIS)

    Osman, A.

    1981-08-01

    Deuteron stripping nuclear reactions are reconsidered as a three-body problem. The Coulomb effects between the proton and the target nucleus are investigated. The mathematical formalism introduces three-body integral equations which can be exactly calculated for such simple models. These coupled integral equations suitably include the Coulomb effects due to replusive or attractive Coulomb potential. Numerical calculations of the differential cross-sections of the reactions 28 Si(d,p) 29 Si and 40 Ca(d,p) 41 Ca are carried out showing the importance of the Coulomb effects. The angular distributions of these reactions are theoretically calculated and fitted to the experimental data. From this fitting, reasonable spectroscopic factors are obtained. Inclusion of Coulomb force in the three-body model are found to improve the results by a percentage of about 6.826%. (author)

  19. Phd dissertation on: Effects of an expressive writing intervention in a nationwide sample of breast cancer patients

    DEFF Research Database (Denmark)

    Jensen-Johansen, Mikael Birkelund

    2010-01-01

    and cancer patients. EWI had been used in 10 of the studies (n=661) with number of participants ranging from 30 to 234 and an average sample size of 82.6. Across all available studies, EWI did not show the hypothesized therapeutic effect on either psychological or physical outcomes. However, when including...... at baseline with respect to the prevalence of somatic symptoms, depression, distress, and sociodemografic patterns, and to compare the present sample with a large Danish cohort of 3500 Danish women treated for breast cancer. Objective 4 – To investigate the impact of EWI on the outcomes of cancer related...... is a literature review and meta-analysis of studies of expressive writing intervention (EWI) focusing on health outcomes in samples of cancer patients. A list of randomized clinical trials (RCT) of EWI with cancer patients published before December 2009 was compiled using relevant search engines and previously...

  20. Electron capture by Ne3+ ions from atomic hydrogen

    International Nuclear Information System (INIS)

    Rejoub, R.; Bannister, M.E.; Havener, C.C.; Savin, D.W.; Verzani, C.J.; Wang, J.G.; Stancil, P.C.

    2004-01-01

    Using the Oak Ridge National Laboratory ion-atom merged-beam apparatus, absolute total electron-capture cross sections have been measured for collisions of Ne 3+ ions with hydrogen (deuterium) atoms at energies between 0.07 and 826 eV/u. Comparison to previous measurements shows large discrepancies between 50 and 400 eV/u. Previously published molecular-orbital close-coupling (MOCC) calculations were performed over limited energy ranges, but show good agreement with the present measurements. Here MOCC calculations are presented for energies between 0.01 and 1000 eV/u for collisions with both H and D. For energies below ∼1 eV/u, an enhancement in the magnitude of both the experimental and theoretical cross sections is observed which is attributed to the ion-induced dipole attraction between the reactants. Below ∼4 eV/u, the present calculations show a significant target isotope effect

  1. Electron capture by Ne3+ ions from atomic hydrogen

    Science.gov (United States)

    Rejoub, R.; Bannister, M. E.; Havener, C. C.; Savin, D. W.; Verzani, C. J.; Wang, J. G.; Stancil, P. C.

    2004-05-01

    Using the Oak Ridge National Laboratory ion-atom merged-beam apparatus, absolute total electron-capture cross sections have been measured for collisions of Ne3+ ions with hydrogen (deuterium) atoms at energies between 0.07 and 826 eV/u . Comparison to previous measurements shows large discrepancies between 50 and 400 eV/u . Previously published molecular-orbital close-coupling (MOCC) calculations were performed over limited energy ranges, but show good agreement with the present measurements. Here MOCC calculations are presented for energies between 0.01 and 1000 eV/u for collisions with both H and D. For energies below ˜1 eV/u , an enhancement in the magnitude of both the experimental and theoretical cross sections is observed which is attributed to the ion-induced dipole attraction between the reactants. Below ˜4 eV/u , the present calculations show a significant target isotope effect.

  2. Reglas que describen la deserción y permanencia en los estudiantes de la UAP Tianguistenco de la UAEM

    Directory of Open Access Journals (Sweden)

    Guillermo García Lambert

    2014-01-01

    Full Text Available Se pretende encontrar cuál es el conjunto de reglas de conocimiento que pueden extraerse de aquellos estudiantes que han desertado o que permanecen en sus estudios universitarios tres años después de su ingreso. Se utilizó una base de datos inicial con 206 factores y 305 estudiantes de cuatro licenciaturas de la uap Tianguistenco de la uaem . Mediante árboles de decisión, fue posible determinar que con sólo 12 factores en 19 reglas se puede saber, con un 82.6% de soporte, si un estudiante tiene riesgo de desertar o no de sus estudios en los tres años posteriores.

  3. Bioleaching of trace metals from coal ash using local isolate from coal ash ponds

    Directory of Open Access Journals (Sweden)

    Pangayao Denvert

    2018-01-01

    Full Text Available Bioleaching of chromium, copper, manganese and zinc from coal ash were investigated using isolates from coal ash ponds particularly Psuedomonas spp. Six (6 different coal ash ponds were examined however, after initial screening Psuedomonas spp. were only present in three (3 coal ash ponds. Among the three coal ash ponds, results showed that eight (8 putative Pseudomonas spp. isolates were present that were identified using the Polymerase Chain Reaction (PCR. Using the eight putative Pseudomonas spp. for bioleaching at optimum conditions and 15 days, the pH value ranges from 8.26 to 8.84 which was basic in nature. Moreover, the maximum metal leached were 8.04% Cr, 12.05% Cu, 4.34% Mn and 10.63% Zn.

  4. NOD2/CARD15 genotype and common gastrointestinal diseases in 43 600 individuals

    DEFF Research Database (Denmark)

    Yazdanyar, S.; Nordestgaard, B.G.

    2010-01-01

    heterozygotes. Cumulative incidences differed by genotype for appendicitis (log-rank P = 0.02), anal fissure, fistula and abscess (P = 0.003) and gastrointestinal cancer (P = 0.004), but not for any of the other endpoints. Compared with non-carriers, age and sex adjusted hazard ratios were 2.7 (95% CI 1...... appendicitis, 646 irritable bowel syndrome, 1301 infectious diseases of the gastrointestinal tract, 681 anal fissure, fistula and abscess, 826 gastrointestinal cancer and 161 developed cancer in liver and pancreas. Results. Some 89% were non-carriers, 11% heterozygotes, 0.15% homozygotes and 0.23% compound.......4-5.5) for appendicitis amongst compound heterozygotes, 3.2 (1.3-7.8) for anal fissure, fistula and abscess amongst compound heterozygotes, and 3.8 (1.6-9.2) for gastrointestinal cancer amongst homozygotes, whilst other genotypes did not have increased risk. The increased risk of gastrointestinal cancer amongst...

  5. Chronic procrastination among Turkish adults: exploring decisional, avoidant, and arousal styles.

    Science.gov (United States)

    Ferrari, Joseph R; Ozer, Bilge Uzun; Demir, Ayhan

    2009-06-01

    The authors examined the prevalence of chronic procrastination (decisional, avoidant, and arousal styles) as functions of demographic variables among 354 Turkish adults (148 men, 206 women; M age = 38.7 years, SD = 8.26 years). Prevalence analyses showed that among Turkish participants, 17.5% were indecisive procrastinators, 13.8% were avoidant procrastinators, and 14.7% were arousal procrastinators. Results did not yield significant differences for gender or age on any forms of procrastination, which is consistent with other international samples. However, significant differences emerged depending on the number of children such that Turkish adults who had more than 3 children claimed to be more indecisive than they claimed to be arousal or avoidant procrastinators. Respondents with less than a graduate degree reported higher rates of indecision than did respondents with at least a graduate degree.

  6. Transvaal Consolidated Land and Exploration Company, Limited

    International Nuclear Information System (INIS)

    Lawrence, R.S.

    1983-01-01

    The difficult economic circumstances with which almost the whole world had to contend, brought serious financial crisis in many countries. South Africa also had its own share of serious problems. Despite this situation, Transvaal Consolidated Land and Exploration Company, Limited, showed on increase in earnings of 24 per cent per share. The reason for this lies mainly in two areas. Firstly the company acquired the mining related business of Rand Mines, Limited. Included in the acquisition was a partfolio of shares mainly in the company's associated gold and uranium mining companies and additional shares in its listed coal mining subsidiaries. Secondly, the average gold price realised by producers in rand terms, was considerably higher than in the previous year. Consolidated profit attributable to members increased by 52 per cent to R82,6 million

  7. Características físico-químicas e sensoriais da carne de cordeiros terminados com dietas contendo cana-de-açúcar ou silagem de milho e dois níveis de concentrado Physic-chemical and sensorial characteristics of meat from lambs finished with diets containing sugar cane or corn silage and two levels of concentrate

    Directory of Open Access Journals (Sweden)

    André Gustavo Leão

    2012-05-01

    Full Text Available Com o objetivo de avaliar as características físico-químicas e sensoriais da carne de cordeiros terminados em confinamento com dietas contendo cana-de-açúcar ou silagem de milho em duas relações volumoso:concentrado, 60:40 ou 40:60, utilizaram-se 32 cordeiros Ile de France, não-castrados, com 15 kg de peso corporal. Os animais foram confinados em baias individuais e abatidos aos 32 kg. As dietas e os músculos estudados não influenciaram o pH aos 45 minutos (6,56 e 24 horas (5,62 após o abate nem a capacidade de retenção de água (58,38% e a perda de peso por cocção (34,04%. A cor da carne e da gordura subcutânea não diferiu entre as dietas, entretanto a cor da carne variou entre os músculos longissimus lumborum e triceps brachii. A força de cisalhamento (1,85 kgf/cm² não foi afetada pelas dietas, porém diferiu entre os músculos, com valores de 1,41 e 2,28 kgf/cm² para o longissimus lumborum e triceps brachii, respectivamente. Nas análises sensoriais do lombo e da paleta, foram obtidas para os cordeiros alimentados com cana-de-açúcar e maior quantidade de concentrado as maiores notas para sabor (8,07 e 8,26, textura (8,53 e 8,53, preferência (8,20 e 8,46 e aceitação (8,33 e 8,26, respectivamente. A cana-de-açúcar na alimentação de cordeiros em confinamento manteve a qualidade físicoquímica da carne, podendo ser utilizada nesta fase de produção e, quando associada a maior quantidade de concentrado na dieta, melhora a qualidade sensorial da carne de cordeiros.With the objective of evaluating physic-chemical and sensorial characteristics of meat from lambs finished in feedlot with diets containing sugar cane or corn silage at two roughage:concentrate ratios, 60:40 or 40:60, 32 non-castrated Ile de France lambs, with 15 kg body weight were used. Animals were confined in individual stalls and were slaughtered at 32 kg body weight. Studied diets and muscles did not affect pH at 45 minutes (6.56 and 24 hours (5

  8. Estimating spontaneous mutation rates at enzyme loci in Drosophila melanogaster

    International Nuclear Information System (INIS)

    Mukai, Terumi; Yamazaki, Tsuneyuki; Harada, Ko; Kusakabe, Shin-ichi

    1990-04-01

    Spontaneous mutations were accumulated for 1,620,826 allele-generations on chromosomes that originated from six stem second chromosomes of Drosophila melanogaster. Only null-electromorph mutations were detected. Band-electromorph mutations were not found. The average rate of null-electromorph mutations was 2.71 x 10 -5 per locus per generation. The 95% confidence interval (μ n ) was 1.97 x 10 -5 n -5 per locus per generation. The upper 95% confidence limit of the band-electromorph mutation rate (μ B ) was 2.28 x 10 -6 per locus per generation. It appeared that null mutations were induced by movable genetic elements and that the mutation rates were different from chromosome to chromosome. (author)

  9. 5-Chloro-2-methyl-3-phenylsulfonyl-1-benzofuran

    Directory of Open Access Journals (Sweden)

    Hong Dae Choi

    2008-07-01

    Full Text Available The title compound, C15H11ClO3S, was prepared by the oxidation of 5-chloro-2-methyl-3-phenylsulfanyl-1-benzofuran with 3-chloroperoxybenzoic acid. There are two symmetry-independent molecules in the asymmetric unit. The dihedral angles formed by the phenyl ring and the plane of the benzofuran system are 77.80 (8 and 78.34 (8°. The crystal structure is stabilized by aromatic π–π stacking interactions between the furan ring and the benzene rings of neighbouring benzofuran fragments from two symmetry-independent molecules; the centroid–centroid distances within the stacks are 3.689 (4, 3.702 (4, 3.825 (4 and 3.826 (4 Å. Additionally, the stacked molecules exhibit inter- and intramolecular C—H...O interactions.

  10. Needs and priorities of women with endometrial and cervical cancer

    DEFF Research Database (Denmark)

    Jeppesen, Mette Moustgaard; Mogensen, Ole; Dehn, Pernille

    2015-01-01

    modality and marital status severely impacted on coping, suggesting that irradiated and single women are at higher risk of developing rehabilitation needs. Additionally, women younger than 55 years more often requested help dealing with sexual and psychological complications. DISCUSSION: Women......INTRODUCTION: Rehabilitation after cancer is important, and efficient rehabilitation requires knowledge of patient's needs. This study aimed to identify short-term rehabilitation needs of women with endometrial and cervical cancer. METHODS: Ninety-six women (82.6%) were included in an exploratory...... questionnaire study from Odense University Hospital from September 2011 to March 2012. Needs were assessed pre-treatment and 3 months later using the three-levels-of-needs questionnaire. Furthermore, 16 women participated in focus group interviews following the treatment. The interviews were audio...

  11. Surgical approach for minimal breast lesions in the material of the center, using preoperative insertion of metal identification wire

    International Nuclear Information System (INIS)

    Waltzer, I; Kroupa, K.; Cierny, R.; Palacka, P.; Puskarova, E.; Torok, A.; Osifova, O.; Laukova, T.; Bella, V.; Simova, A.

    2006-01-01

    In the pursuit of the detection of early subclinical forms of breast cancer, and with regard to the advancement in screening programs, the wire-guided excision is irreplaceable in the diagnostic and therapy of benign and malignant breast lesions. In the 15-year period (1. 1. 1991 - 31. 12. 2005) we have performed surgery on 21 826 patients. 7 845 (35,9 %) of them were surgically treated for breast disease, including patients (311 cases) with other operation (secondary suture, surgery for infection, debridement...). 3 383 patients were treated for benign, 4 151 for malignant lesions. Out of the total of 7 534 patients, 6 332 (84,0 %) were treated for palpable lesions, 1 202 (16,0 %) for non-palpable lesions, with the localization needle. In this article we present the analysis of clinical material of the Clinic of surgery of the National Oncological Institute (NOU). (author)

  12. Report from the Field: Psychological First Aid for Haiti's Storm Orphans.

    Science.gov (United States)

    Giraldo, Gloria

    2008-07-01

    In 2004, the final death toll in Haiti from Tropical Storm Jeanne was recorded at 3,006; of these, 2,826 in Gonaïves, a city floating in ruins. The road to Gonaïves was washed out, leaving the city and the department of Artibonite cut off for days from the rest of the country. Dr Juan Carlos Ch�vez, who headed the Cuban medical team in Haiti at the time, recalls that 17 Cuban health professionals were working in the area when the storm barrelled through, among the 400 already serving in the country. They were later joined by another 72 doctors, nurses, technicians and engineers sent directly from Cuba.

  13. From Semi- to Full-Two-Dimensional Conjugated Side-Chain Design: A Way toward Comprehensive Solar Energy Absorption

    Energy Technology Data Exchange (ETDEWEB)

    Chao, Pengjie [Department; School; Wang, Huan [Department; Qu, Shiwei [Department; Mo, Daize [Department; Meng, Hong [School; Chen, Wei [Materials; Institute; He, Feng [Department

    2017-12-05

    Two polymers with fully two-dimensional (2D) conjugated side chains, 2D-PTB-Th and 2D-PTB-TTh, were synthesized and characterized through simultaneously integrating the 2D-TT and the 2D-BDT monomers onto the polymer backbone. Resulting from the synergistic effect from the conjugated side chains on both monomers, the two polymers showed remarkably efficient absorption of the sunlight and improved pi-pi intermolecular interactions for efficient charge carrier transport. The optimized bulk heterojunction device based on 2D-PTB-Th and PC71BM shows a higher PCE of 9.13% compared to PTB7-Th with a PCE of 8.26%, which corresponds to an approximately 10% improvement in solar energy conversion. The fully 2D-conjugated side-chain concept reported here developed a new molecular design strategy for polymer materials with enhanced sunlight absorption and efficient solar energy conversion.

  14. Less Physician Practice Competition Is Associated With Higher Prices Paid For Common Procedures.

    Science.gov (United States)

    Austin, Daniel R; Baker, Laurence C

    2015-10-01

    Concentration among physician groups has been steadily increasing, which may affect prices for physician services. We assessed the relationship in 2010 between physician competition and prices paid by private preferred provider organizations for fifteen common, high-cost procedures to understand whether higher concentration of physician practices and accompanying increased market power were associated with higher prices for services. Using county-level measures of the concentration of physician practices and county average prices, and statistically controlling for a range of other regional characteristics, we found that physician practice concentration and prices were significantly associated for twelve of the fifteen procedures we studied. For these procedures, counties with the highest average physician concentrations had prices 8-26 percent higher than prices in the lowest counties. We concluded that physician competition is frequently associated with prices. Policies that would influence physician practice organization should take this into consideration. Project HOPE—The People-to-People Health Foundation, Inc.

  15. Monte Carlo simulation of ion-beam channeling in YBa2Cu3O7

    International Nuclear Information System (INIS)

    Khodyrev, V.A.; Chumanov, V.Ya.; Bourdelle, K.K.; Pokhil, G.P.

    1994-01-01

    A Monte Carlo program (UPIC) for the simulation of ion channeling in crystals with complex structure is described. The program is applied to simulate the channeling of 1.5 MeV He + and 1 MeV D + near the [001] axis of YBa 2 Cu 3 O 7 assuming strongly correlated atomic displacements along the [001] Cu-O rows in the superconducting state. The values for the abrupt change in the half-width of the channeling dip observed in experiments [R.P. Sharma et al., Phys. Rev. B 38 (1988) 9287] at the temperature of the superconducting transition, T c , are reproduced in the simulations with correlation coefficients of 0.8-0.9. The increase in the minimum channeling yield at T c found in measurements [T. Haga et al., Phys. Rev. B 41 (1990) 826] can be qualitatively explained by the increase in dechanneling rate due to correlations. ((orig.))

  16. Polimorfismo enzimático em populações de Melipona quadrifasciata anthidioides Lepeletier (Hymenoptera, Apidae, Meliponinae Enzymatic polymorphism in Melipona quadrifasciata anthidioides Lepeletier populations (Hymenoptera, Apidae, Meliponinae

    Directory of Open Access Journals (Sweden)

    Davi S. Aidar

    2001-06-01

    Full Text Available Them aim scope of this study is to characterize the enzymatic polymorphism found in the Melipona quadrifasciata Lepeletier, 1936 populations from Ribeirão Preto, São Paulo and Espírito Santo, Brazil and its hybrids. Samples from each colony (about 52 were prepared for starch gel electrophoresis in order to investigate the genetic variation of the following enzimes: esterase (EST, isocitrate dehydrogenase (IDH, malic enzyme (ME, phosphoglucomutase (PGM, superoxide desmutase (SOD, α-glycerophosphate dehydrogenase (αPGD, malate dehydrogenase (MDH, leucine aminopeptidase (LAP, hexokinase (HK and phosphoglucose isomerase (PGI. The analysis showed that LAP and HK did not show enzymatic activity and EST showed two alleles(est-sand and est-f while all the others were shown to be monomorphic. The allele EST-S showed a frequency of 82,6%.

  17. Sustainability Management Program for Industries- A Case Study

    Directory of Open Access Journals (Sweden)

    Long Su Weng Alwin

    2017-01-01

    Full Text Available This research studied the effectiveness of Sustainability Management Program in improving production efficiency of the manufacturing site with verified result using the regression analysis. For this study, a dairy manufacturing industry located in Malaysia was selected and major energy consuming equipment in the industryplant were identified. Sustainability Management Program (SMP was carried out for three years and energy consumption and product has improved regression coefficients of 0.625 in 2013, 0.826 in 2014, and 0.878 in 2015 as the manufacturing site becomes more energy efficient. This suggests that the energy management should be carried out in a continuous manner with energy management team responsible for energy saving practices.

  18. Unsteady behavior of a confined jet in a cavity at moderate Reynolds numbers

    International Nuclear Information System (INIS)

    Bouchet, G; Climent, E

    2012-01-01

    Self-sustained oscillations in the sinuous mode are observed when a jet impinges on a rigid surface. Confined jet instability is experimentally and numerically investigated here at moderate Reynolds numbers. When the Reynolds number is varied, the dynamic response of the jet is unusual in comparison with that of similar configurations (hole-tone, jet edge, etc). Modal transitions are clearly detected when the Reynolds number is varied. However, these transitions result in a reduction of the frequency, which means that the wavelength grows with Reynolds number. Moreover, the instability that sets in at low Reynolds number, as a subcritical Hopf bifurcation, disappears only 25% above the threshold. Then, the flow becomes steady again and symmetric. This atypical behavior is compared with our previous study on a submerged fountain (Bouchet et al 2002 Europhys. Lett. 59 826). (paper)

  19. Characterization of spatial and temporal variability in hydrochemistry of Johor Straits, Malaysia.

    Science.gov (United States)

    Abdullah, Pauzi; Abdullah, Sharifah Mastura Syed; Jaafar, Othman; Mahmud, Mastura; Khalik, Wan Mohd Afiq Wan Mohd

    2015-12-15

    Characterization of hydrochemistry changes in Johor Straits within 5 years of monitoring works was successfully carried out. Water quality data sets (27 stations and 19 parameters) collected in this area were interpreted subject to multivariate statistical analysis. Cluster analysis grouped all the stations into four clusters ((Dlink/Dmax) × 1001) that explained 82.6% of the total variance of the data set. Classification matrix of discriminant analysis assigned 88.9-92.6% and 83.3-100% correctness in spatial and temporal variability, respectively. Times series analysis then confirmed that only four parameters were not significant over time change. Therefore, it is imperative that the environmental impact of reclamation and dredging works, municipal or industrial discharge, marine aquaculture and shipping activities in this area be effectively controlled and managed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Effect of propellant morphology on acoustics in a planar rocket motor

    Energy Technology Data Exchange (ETDEWEB)

    Daimon, Y.; Jackson, T.L. [University of Illinois at Urbana-Champaign, Center for Simulation of Advanced Rockets, Urbana, IL (United States); Topalian, V. [University of Illinois at Urbana-Champaign, Mechanical Science and Engineering, Urbana, IL (United States); Freund, J.B. [University of Illinois at Urbana-Champaign, Mechanical Science and Engineering, Aerospace Engineering, Urbana, IL (United States); Buckmaster, J. [Buckmaster Research, Urbana, IL (United States)

    2009-03-15

    This paper reports the results of numerical simulations of the acoustics in a two-dimensional (plane) motor using a high-order accurate, low-dissipation numerical solver. For verification we compare solutions to Culick's (AIAA J 4(8):1462-1464, 1966) asymptotic solution for constant injection, and to recent results of Hegab and Kassoy (AIAA J 44(4):812-826, 2006) for a space- and time-dependent mass injection. We present results when the injection boundary condition is described by propellant morphology and by white noise. Morphology strongly affects the amplitude of the longitudinal acoustic modes, and in this connection white noise is not a suitable surrogate. (orig.)

  1. Effect of influent COD/SO4(2-) ratios on biodegradation behaviors of starch wastewater in an upflow anaerobic sludge blanket (UASB) reactor.

    Science.gov (United States)

    Lu, Xueqin; Zhen, Guangyin; Ni, Jialing; Hojo, Toshimasa; Kubota, Kengo; Li, Yu-You

    2016-08-01

    A lab-scale upflow anaerobic sludge blanket (UASB) has been run for 250days to investigate the influence of influent COD/SO4(2-) ratios on the biodegradation behavior of starch wastewater and process performance. Stepwise decreasing COD/SO4(2-) ratio enhanced sulfidogenesis, complicating starch degradation routes and improving process stability. The reactor exhibited satisfactory performance at a wide COD/SO4(2-) range ⩾2, attaining stable biogas production of 1.15-1.17LL(-1)d(-1) with efficient simultaneous removal of total COD (73.5-80.3%) and sulfate (82.6±6.4%). Adding sulfate favored sulfidogenesis process and diversified microbial community, invoking hydrolysis-acidification of starch and propionate degradation and subsequent acetoclastic methanogenesis; whereas excessively enhanced sulfidogenesis (COD/SO4(2-) ratios UASB technology in water industry from basic science. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Isolation and characterization of diesel degrading bacteria, Sphingomonas sp. and Acinetobacter junii from petroleum contaminated soil

    Science.gov (United States)

    Zhang, Qiuzhuo; Wang, Duanchao; Li, Mengmeng; Xiang, Wei-Ning; Achal, Varenyam

    2014-03-01

    Two indigenous bacteria of petroleum contaminated soil were characterized to utilize diesel fuel as the sole carbon and energy sources in this work. 16S rRNA gene sequence analysis identified these bacteria as Sphingomonas sp. and Acinetobacter junii. The ability to degrade diesel fuel has been demonstrated for the first time by these isolates. The results of IR analyses showed that Sphingomonas sp. VA1 and A. junii VA2 degraded up to 82.6% and 75.8% of applied diesel over 15 days, respectively. In addition, Sphingomonas sp. VA1 possessed the higher cellular hydrophobicities of 94% for diesel compared to 81% by A. junii VA2. The isolates Sphingomonas sp. VA1 and A. junii VA2 exhibited 24% and 18%, respectively emulsification activity. This study reports two new diesel degrading bacterial species, which can be effectively used for bioremediation of petroleum contaminated sites.

  3. TPX: Contractor preliminary design review. Volume 5, Manufacturing R ampersand D

    International Nuclear Information System (INIS)

    Roach, J.F.; Urban, W.M.; Hartman, D.

    1995-01-01

    TPX Insulation ampersand Impregnation R ampersand D test results are reported for 1x2 samples designed for screening candidate conduit insulation systems for TPX PF and TF coils. The epoxy/glass insulation system and three proposed alternate insulation systems employing Kapton, was evaluated in as received sample condition and after 10 thermal cycles in liquid nitrogen. Two DGBA impregnation systems, Shell 826 and CTD101K were investigated. Square incoloy 908 and 316 LN stainless hollow conduits were used for 1x2 sample fabrication. Capacitance, dielectric loss, and insulation resistance dielectric characteristics were measured for all samples. Partial discharge performance was measured for samples either in air, under silicon oil, or under liquid nitrogen up to 10kVrms at 60 Hz. Hipot screening was performed at 10 kVdc. The samples were cross sectioned and evaluated for impregnation quality. The implications of the test results on the TPX preliminary design decision are discussed

  4. Surface-enhanced Raman spectroscopy for differentiation between benign and malignant thyroid tissues

    Science.gov (United States)

    Li, Zuanfang; Li, Chao; Lin, Duo; Huang, Zufang; Pan, Jianji; Chen, Guannan; Lin, Juqiang; Liu, Nenrong; Yu, Yun; Feng, Shangyuan; Chen, Rong

    2014-04-01

    The aim of this study was to evaluate the potential of applying silver nano-particle based surface-enhanced Raman scattering (SERS) to discriminate different types of human thyroid tissues. SERS measurements were performed on three groups of tissue samples including thyroid cancers (n = 32), nodular goiters (n = 20) and normal thyroid tissues (n = 25). Tentative assignments of the measured tissue SERS spectra suggest interesting cancer specific biomolecular differences. The principal component analysis (PCA) and linear discriminate analysis (LDA) together with the leave-one-out, cross-validated technique yielded diagnostic sensitivities of 92%, 75% and 87.5%; and specificities of 82.6%, 89.4% and 84.4%, respectively, for differentiation among normal, nodular and malignant thyroid tissue samples. This work demonstrates that tissue SERS spectroscopy associated with multivariate analysis diagnostic algorithms has great potential for detection of thyroid cancer at the molecular level.

  5. Quantitative evaluation of a handheld light microscope for field diagnosis of soil-transmitted helminth infection.

    Science.gov (United States)

    Bogoch, Isaac I; Andrews, Jason R; Speich, Benjamin; Ame, Shaali M; Ali, Said M; Stothard, J Russell; Utzinger, Jürg; Keiser, Jennifer

    2014-12-01

    We evaluated the Newton Nm1, a commercially available handheld light microscope and compared it with conventional light microscopy for the diagnosis of soil-transmitted helminth infections. A total of 91 Kato-Katz thick smears were examined by experienced microscopists and helminth eggs were counted and expressed as eggs per gram of stool (EPG). Mean egg counts were significantly higher with the conventional light microscope (5,190 EPG versus 2,386 EPG for Ascaris lumbricoides; 826 versus 456 for Trichuris trichiura; both P Newton Nm1 microscope may be a useful tool for the detection and quantification of soil-transmitted helminth infection in clinical, epidemiologic, and public health settings. © The American Society of Tropical Medicine and Hygiene.

  6. Rotational spectroscopy and dynamics of carbonyl sulphide studied by terahertz free induction decays signals

    Science.gov (United States)

    Bigourd, D.; Mouret, G.; Cuisset, A.; Hindle, F.; Fertein, E.; Bocquet, R.

    2008-06-01

    A terahertz time domain spectroscopy experiment is used to study the coherent re-emission after exciting more than 60 energy rotational states of OCS molecules in gas phase. Due to the regular structure of the absorption spectrum of such linear molecules, a set of subsequent pulses separated by 82.6 ps is re-radiated from the vapour and recorded up to 450 ps. A model based on a linear response of the gas and by use of "Maxwell-Bloch" equations has permitted the re-emitted free induced decay to be investigated. Spectroscopic parameters, such as rotational constant, centrifugal distortion coefficient and relaxation times are responsible for the temporal shape and so can be evaluated. The influence of the optical thickness to access the relaxation times is discussed.

  7. High Efficiency InP Solar Cells from Low Toxicity Tertiarybutylphosphine

    Science.gov (United States)

    Hoffman, Richard W., Jr.; Fatemi, Navid S.; Wilt, David M.; Jenkins, Phillip P.; Brinker, David J.; Scheiman, David A.

    1994-01-01

    Large scale manufacture of phosphide based semiconductor devices by organo-metallic vapor phase epitaxy (OMVPE) typically requires the use of highly toxic phosphine. Advancements in phosphine substitutes have identified tertiarybutylphosphine (TBP) as an excellent precursor for OMVPE of InP. High quality undoped and doped InP films were grown using TBP and trimethylindium. Impurity doped InP films were achieved utilizing diethylzinc and silane for p and n type respectively. 16 percent efficient solar cells under air mass zero, one sun intensity were demonstrated with Voc of 871 mV and fill factor of 82.6 percent. It was shown that TBP could replace phosphine, without adversely affecting device quality, in OMVPE deposition of InP thus significantly reducing toxic gas exposure risk.

  8. [Analysis of barriers and legal-ethical opportunities for disclosure and apology for medical errors in Spain].

    Science.gov (United States)

    Giraldo, Priscila; Corbella, Josep; Rodrigo, Carmen; Comas, Mercè; Sala, Maria; Castells, Xavier

    2016-01-01

    To identify opportunities for disclosing information on medical errors in Spain and issuing an apology, as well as legal-ethical barriers. A cross-sectional study was conducted through a questionnaire sent to health law and bioethics experts (n=46). A total of 39 experts (84.7%) responded that health providers should always disclose adverse events and 38 experts (82.6%) were in favour of issuing an apology. Thirty experts (65.2%) reported that disclosure of errors would not lead to professional liability. The main opportunity for increasing disclosure was by enhancing trust in the physician-patient relationship and the main barrier was fear of the outcomes of disclosing medical errors. There is a broad agreement on the lack of liability following disclosure/apology on adverse events and the need to develop a strategy for disclosure among support for physicians. Copyright © 2015 SESPAS. Published by Elsevier Espana. All rights reserved.

  9. Optimum schedules of difficult-to-form heat-resistant alloys forging

    International Nuclear Information System (INIS)

    Majzengel'ter, V.A.; Shuvalov, A.A.; Perevozov, A.S.

    2000-01-01

    The process of manufacturing half finished discs for hydroturbine engines from heat resistant difficulty deformed nickel, iron-nickel and cobalt alloys (EI435, EI868, VZh145-ID, EK79-ID, EK152-ID, EI826, EP648-VI) is described. The recommendations on the modes of forging the single-phase nonaging and double phase aging alloys are developed. The conclusion is made, that the first compressions of ingots shoved be accomplished by small press runs. The subsequent compressions should constituted not less than 8% during one run. The total compression of the ingot during one heating should be within the concrete alloy properties. With the purpose of obtaining uniform fine-grain structure the ingot heating during the last manufacturing cycle should be accomplished within the range of 1100-1130 deg C for the majority of heat resistant alloys [ru

  10. The impact of common mental and physical health conditions on days out of role: costs for the individual and society.

    Directory of Open Access Journals (Sweden)

    Corina Benjet

    2013-05-01

    Full Text Available Objective. To estimate the individual and societal costs of common mental and physical health conditions in the Mexican population with regards to the number of days out of role. Materials and methods. 5 826 adults were evaluated in 2001-2002 with the Composite International Diagnostic Interview and the WHO Disability Assessment Schedule. General linear models were used to estimate individuallevel effects. Societal-level effects were estimated with the population attributable risk proportion which takes into account prevalence and comorbidity of disorders. Results. The conditions with the strongest individual-level effects were major depression, post-traumatic stress disorder and bipolar disorder. The strongest societal-level effects were associated with major depression, pain, insomnia and cardiovascular conditions. Conclusion. The findings suggest the importance of investing in mental health expenditure to a level commensurate with the costs to society of mental health disorders.

  11. Electric Power monthly, November 1995 with data for August 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-15

    This report presents monthly electricity statistics, with the purpose of providing energy decisionmakers with accurate, timely information that may be used in forming various perspectives on electric issues that lie ahead. EIA collected the information in this report to fulfill its data collection and dissemination responsibilities; the information are from six data sources: forms EIA-759, FERC Form 423, EIA-826, EIA-861, EIA-860, and Form OE-417R. An article on reclicensing and environmental issues affecting hydropower is included. Then the statistics are presented in: US electric power at a glance, utility net generation, utility consumption of fossil fuels, fossil-fuel stocks at utilities, fossil fuel receipts and costs, utility sales/revenue/average revenue per kWh, and monthly plant aggregates. Finally, nonutility power producer statistics, bibliography, technical notes, and a glossary are presented.

  12. FUTURES with Jaime Escalante

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-08-01

    The United States Department of Energy awarded the Foundation for Advancements in Science and Education (FASE) $826,000 as support to produce the second set of FUTURES segments consisting of 12, 15-minute programs. The programs provide motivation for students to study math by connecting math to the work place and real-life problem scenarios. The programs are broadcast in 50 states through PBS Elementary and Secondary Service (E/SS). The grant term ended on December 16, 1993 and this final report documents program and financial activity results. The 12 episodes are titled: Animal Care, Meteorology, Mass Communication, Advanced Energy, Oceanography, Graphic Design, Future Habitats, Environmental Science & Technology, Fitness & Physical Performance, Interpersonal Communications, Advanced Transportation and Product Design. Each program addresses as many as ten careers or job types within the broader field named. Minority and gender-balanced role models appear throughout the programs.

  13. Pubertal development in Danish children

    DEFF Research Database (Denmark)

    Juul, A; Teilmann, G; Scheike, Thomas Harder

    2006-01-01

    differences between USA and Denmark, as well as to look for possible secular trends in pubertal development. Healthy Caucasian children from public schools in Denmark participated in the study which was carried out in 1991-1993. A total number of 826 boys and 1,100 girls (aged 6.0-19.9 years) were included......, and pubertal stages were assessed by clinical examination according to methods of Tanner. In boys testicular volume was determined using an orchidometer. We found that age at breast development 2 (B2) was 10.88 years, and mean menarcheal age was 13.42 years. Girls with body mass index (BMI) above the median...... genetic polymorphisms, nutrition, physical activity or endocrine disrupting chemicals must therefore also be considered. Therefore, we believe it is crucial to monitor the pubertal development closely in Denmark in the coming decades....

  14. Influence of untreated and irradiated straw on the digestibility of the crude nitrients and amino acids in chickens and the recovery of the amino acids after irradiation of straw

    International Nuclear Information System (INIS)

    Hennig, A.; Zander, R.; Gruhn, K.; Baer, M.

    1986-01-01

    2 x 10 6 Gy γ-rays reduce the content of lysine, arginine, histidine, proline and glutamic acid in straw by more than 20%, that of other amino acids less or not at all. The supplementation of 30 g untreated or irradiated straw to the broiler hens rations on average reduces the digestibility of the crude protein from 82.6% +- 1.5% to 74.3% +- 1.6% and 72.5% +- 1.3%, resp. The digestibility of the amino acids in the rations was differently influenced by the straw supplement. The irradiation of the straw with 2 x 10 6 Gy reduced the content of crude cellulose and improved, however, its digestibility. (author)

  15. Pain and pain mechanisms in patients with inflammatory arthritis

    DEFF Research Database (Denmark)

    Rifbjerg-Madsen, S; Christensen, A W; Christensen, R

    2017-01-01

    completed the PDQ (RA: 3,826, PsA: 1,180, SpA: 1,093). 52% of all patients and 63% of PDQ-completers had VAS pain score ≥ 30 mm. The distribution of the PDQ classification-groups (18) were; RA: 56%/24%/20%. PsA: 45%/ 27%/ 28%. SpA: 55% / 24%/ 21%. More patients with PsA had PDQ score >18....... The objectives were to quantify and characterize pain phenotypes (non-neuropathic vs. neuropathic features) among Danish arthritis patients using the PDQ, and to assess the association with on-going inflammation. METHODS: The PDQ was included onto the DANBIO touch screens at 22 departments of Rheumatology......28-CRP and VAS pain but not with indicators of peripheral inflammation (CRP and SJC). Thus, pain classification by PDQ may assist in mechanism-based pain treatment....

  16. Treatment of Children and Adolescents With Hodgkin Lymphoma Without Radiotherapy for Patients in Complete Remission After Chemotherapy

    DEFF Research Database (Denmark)

    Dörffel, Wolfgang; Rühl, Ursula; Lüders, Heike

    2013-01-01

    1995 and 2001, 925 patients with classical HL (cHL) were registered from seven European countries in German Society of Pediatric Oncology and Hematology Hodgkin Lymphoma Trial 95. Patients in treatment group 1 (TG1; early stages) received two cycles of vincristine, prednisone, procarbazine......, and doxorubicin or vincristine, prednisone, etoposide, and doxorubicin chemotherapy; additional two or four cycles of cyclophosphamide, vincristine, prednisone, and procarbazine were added in TG2 (intermediate stages) or TG3 (advanced stages), respectively. Patients in CR (assessed by computed tomography...... results in TG3 (82.6% ± 5.4% v 88.7% ± 2.0%, P = .259). Reduction of the standard radiation dose from 25 to 20 Gy did not increase failure rate. CONCLUSION: RT can be omitted in early stage HL in so defined CR following this chemotherapy. RT with 20(-35) Gy proved to be sufficient in patients...

  17. Predictive Accuracy of the PanCan Lung Cancer Risk Prediction Model -External Validation based on CT from the Danish Lung Cancer Screening Trial

    DEFF Research Database (Denmark)

    Winkler Wille, Mathilde M.; van Riel, Sarah J.; Saghir, Zaigham

    2015-01-01

    Objectives: Lung cancer risk models should be externally validated to test generalizability and clinical usefulness. The Danish Lung Cancer Screening Trial (DLCST) is a population-based prospective cohort study, used to assess the discriminative performances of the PanCan models. Methods: From...... the DLCST database, 1,152 nodules from 718 participants were included. Parsimonious and full PanCan risk prediction models were applied to DLCST data, and also coefficients of the model were recalculated using DLCST data. Receiver operating characteristics (ROC) curves and area under the curve (AUC) were...... used to evaluate risk discrimination. Results: AUCs of 0.826–0.870 were found for DLCST data based on PanCan risk prediction models. In the DLCST, age and family history were significant predictors (p = 0.001 and p = 0.013). Female sex was not confirmed to be associated with higher risk of lung cancer...

  18. Effect of an Empowerment Intervention on Antiretroviral Drug Adherence in Thai Youth.

    Science.gov (United States)

    Kaihin, Ratchaneekorn; Kasatpibal, Nongyao; Chitreechuer, Jittaporn; Grimes, Richard M

    2015-01-01

    A pilot study was conducted to determine effects of an empowerment intervention on antiretroviral therapy (ART) adherence among Thai youth living with HIV/AIDS. It compared two groups of 23 young persons (15-24 years) who receive ART from AIDS clinics at two community hospitals. One hospital's patients served as the experimental group, and the other as a control group. The experimental groups attended five sessions that empowered them to take control of their own health. The control group received the standard of care. The data were analyzed using descriptive statistics and Chi-square statistics. Before the empowerment, no one from the experimental group or the control group had ART adherence ≥ 95%. After the intervention, the 82.6% of the experimental group had ≥ 95% adherence compared to the control group, which had 21.7% adherence (p < .0001). The empowerment intervention resulted in a significant increase in ART adherence among Thai youth.

  19. Effectiveness of Colorectal Cancer Screening in Detecting Earlier-stage Disease - a Nationwide Cohort Study in Denmark

    DEFF Research Database (Denmark)

    Larsen, Mette Bach; Njor, Sisse; Ingeholm, Peter

    2018-01-01

    program (March 1, 2014 through June 30, 2015). A total of 402,826 residents of Denmark (50-72 years old) were randomly invited to undergo CRC screening within the study period and 956,514 were invited thereafter. We obtained information on CRC diagnosis, date, and stage at diagnosis from the Danish.......6/100,000 not yet invited individuals. CRC incidence increased with age among invited and not yet invited individuals. For invited women compared to not yet invited women, the RR of being diagnosed with stage I CRC was 3.39 (95% CI, 2.61-4.39); with stage II CRC was 2.16 (95% CI, 1.71-2.72); with stage III CRC...

  20. High field superconducting beam transport in a BNL primary proton beam

    International Nuclear Information System (INIS)

    Allinger, J.; Brown, H.N.; Carroll, A.S.; Danby, G.; DeVito, B.; Glenn, J.W.; Jackson, J.; Keith, W.; Lowenstein, D.; Prodell, A.G.

    1979-01-01

    Construction of a slow external beam switchyard at the BNL AGS requires a rapid 20.4 0 bend in the upstream end of the beam line. Two curved superconducting window dipole magnets, operating at 6.0 T and about 80% of short sample magnetic field, will be utilized with two small superconducting sextupoles to provide the necessary deflection for a 28.5 GeV/c primary proton beam. Because the magnets will operate in a primary proton beam environment, they are designed to absorb large amounts of radiation heating from the beam without quenching. The field quality of the superconducting magnets is extremely good. Computer field calculations indicate a field error, ΔB/B 0 , equivalent to approx. = 1 x 10 -4 up to 75% of the 8.26 cm full aperture diameter in the magnet

  1. Genetically engineering Synechocystis sp. Pasteur Culture Collection 6803 for the sustainable production of the plant secondary metabolite p-coumaric acid.

    Science.gov (United States)

    Xue, Yong; Zhang, Yan; Cheng, Dan; Daddy, Soumana; He, Qingfang

    2014-07-01

    p-Coumaric acid is the precursor of phenylpropanoids, which are plant secondary metabolites that are beneficial to human health. Tyrosine ammonia lyase catalyzes the production of p-coumaric acid from tyrosine. Because of their photosynthetic ability and biosynthetic versatility, cyanobacteria are promising candidates for the production of certain plant metabolites, including phenylpropanoids. Here, we produced p-coumaric acid in a strain of transgenic cyanobacterium Synechocystis sp. Pasteur Culture Collection 6803 (hereafter Synechocystis 6803). Whereas a strain of Synechocystis 6803 genetically engineered to express sam8, a tyrosine ammonia lyase gene from the actinomycete Saccharothrix espanaensis, accumulated little or no p-coumaric acid, a strain that both expressed sam8 and lacked slr1573, a native hypothetical gene shown here to encode a laccase that oxidizes polyphenols, produced ∼82.6 mg/L p-coumaric acid, which was readily purified from the growth medium.

  2. Ramstein AB, Landstuhl, Germany. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F

    Science.gov (United States)

    1978-10-10

    hl KI A AR!TU SIl 1 Farstein AB Germany AB IMAR 52 MAR 63 N 49 25 E 007 35 789 ft 808 ft 24 2 Same APR 63 MAY 68 ISame Same Same 826 ft 24 3 sae Same...ffrmcenter of rj Sae aiD 1 f V& & 1407 ft from touchdown point of I rnwey 27 & 1300 ft from touch~down point of rnwy 09. ___ , ___ __ __,, USAF 52AC...1~ .c1 .±___ _____O b 9 4&4/ 43 .2 2.6- Z.7 1 .. 3o of ob o6- 4t2/ 41 - .0 2.1-1 L. 4-± *61 73i 6. 4140 / 39 L___ 503 -.2 *1 8:.4 351 -7 . 490 4.. 80

  3. Biphasic solid and liquid gastric emptying in normal control subjects and diabetic patients with continuous acquisition in the left anterior oblique view

    International Nuclear Information System (INIS)

    Ziessman, H.A.; Fahey, F.H.; Herring, C.D.; Deschner, W.K.; Collen, M.J.; Vigersky, R.A.

    1989-01-01

    This paper reports solid and liquid gastric emptying (GE) studied in 10 normal controls and 20 diabetics with symptoms of gastroparesis. After the ingestion of a Tc-99m SC egg sandwich and In-lll DTPA in water, 90 1-minute frames were acquired in the left anterior oblique view. Solid GE had a lag phase in all cases and then emptied linearly. Compared with normal controls, diabetics had delayed GE and delayed lag phase (P< .05). Liquid GE was exponential with no lag phase. Biexponential liquid emptying with an early fast component followed by a second slower one was seen in 60% of normal controls and 70% of diabetics. The slower component of liquid GE correlated with the solid GE rate (normal controls, r= .826; diabetics, r = .885)

  4. Fabrication of Spherical AlSi10Mg Powders by Radio Frequency Plasma Spheroidization

    Science.gov (United States)

    Wang, Linzhi; Liu, Ying; Chang, Sen

    2016-05-01

    Spherical AlSi10Mg powders were prepared by radio frequency plasma spheroidization from commercial AlSi10Mg powders. The fabrication process parameters and powder characteristics were investigated. Field emission scanning electron microscope, X-ray diffraction, laser particle size analyzer, powder rheometer, and UV/visible/infrared spectrophotometer were used for analyses and measurements of micrographs, phases, granulometric parameters, flowability, and laser absorption properties of the powders, respectively. The results show that the obtained spherical powders exhibit good sphericity, smooth surfaces, favorable dispersity, and excellent fluidity under appropriate feeding rate and flow rate of carrier gas. Further, acicular microstructures of the spherical AlSi10Mg powders are composed of α-Al, Si, and a small amount of Mg2Si phase. In addition, laser absorption values of the spherical AlSi10Mg powders increase obviously compared with raw material, and different spectra have obvious absorption peaks at a wavelength of about 826 nm.

  5. Search for the neutral Higgs bosons of the Standard Model and the MSSM in $e^{+}e^{-}$ collisions at $\\sqrt{s}$ = 189 GeV

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Alemany, R; Bravo, S; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Riu, I; Ruiz, H; Colaleo, A; Creanza, D; De Palma, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Boix, G; Buchmüller, O L; Cattaneo, M; Cerutti, F; Davies, G; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Greening, T C; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kado, M; Leroy, O; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Spagnolo, P; Tejessy, W; Teubert, F; Tournefier, E; Valassi, Andrea; Ward, J J; Wright, A E; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Pascolo, J M; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Kennedy, J; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Smith, D; Teixeira-Dias, P; Thompson, A S; Cavanaugh, R J; Dhamotharan, S; Geweniger, C; Hanke, P; Hepp, V; Kluge, E E; Leibenguth, G; Putzer, A; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Nowell, J; Przysiezniak, H; Sciabà, A; Sedgbeer, J K; Thompson, J C; Thomson, E; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bowdery, C K; Buck, P G; Clarke, D P; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Smizanska, M; Giehl, I; Hölldorfer, F; Jakobs, K; Kleinknecht, K; Kröcker, M; Müller, A S; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Payre, P; Rousseau, D; Tilquin, A; Aleppo, M; Antonelli, M; Gilardoni, S S; Ragusa, F; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Azzurri, P; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Bagliesi, G; Boccali, T; Bozzi, C; Calderini, G; Ciulli, V; Dell'Orso, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sguazzoni, G; Tenchini, Roberto; Venturi, A; Verdini, P G; Blair, G A; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Clifft, R W; Edgecock, T R; Norton, P R; Tomalin, I R; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Seager, P; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Loomis, C; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Grupen, Claus; Hess, J; Misiejuk, A; Prange, G; Sieler, U; Borean, C; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; Kile, J; McNamara, P A; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Von Wimmersperg-Töller, J H; Wu Sau Lan; Wu, X; Zobernig, G

    2000-01-01

    Neutral Higgs bosons of the Standard Model and of the \\MSSM\\ aresearched for in the data collected at a centre-of-mass energy of \\cme\\,\\G\\ by the \\ALEPH\\ experiment at \\LEP, with an integrated luminosity of \\lumabs\\,\\invpb. No evidence for a signal is found.A lower limit of \\lhSMobs\\,\\Gcs\\ at 95\\%~confidence level is set on the mass of the Standard Model Higgs boson.In the \\MSSM, for $\\tanb \\ge 0.7$ and for benchmark parameter choices, lower limits of \\lhobs\\,\\Gcs\\ and 82.6\\,\\Gcs\\ are derived for the masses of the neutral Higgs bosons \\h\\ and \\A, respectively.An update of the general \\MSSM\\ parameter scan is alsopresented.

  6. 1-Benzylimidazolium hexafluorophosphate–1-benzylimidazole (1/1

    Directory of Open Access Journals (Sweden)

    Qing-Xiang Liu

    2008-02-01

    Full Text Available In the title compound, C10H11N2+·PF6−·C10H10N2, the H atom involved in protonation is disordered equally between the cation and the neutral molecule. The dihedral angle between the phenyl and imidazole rings is 82.6 (2°. In the crystal structure, there are head-to-tail π–π stacking interactions between imidazole rings; the interplanar separation is 3.295 (1 Å and the centroid–centroid separation is 3.448 (3 Å. In the centrosymmetric anion, two F atoms are disordered over two positions; the refined site-occupancy factors are 0.855 (11 and 0.145 (11.

  7. Giant resonance spectroscopy of 40Ca with the (e,e'x) reaction (I): Experiments and overview of results

    International Nuclear Information System (INIS)

    Diesener, H.; Helm, U.; Neumann-Cosel, P. von; Richter, A.; Schrieder, G.; Stascheck, A.; Stiller, A.; Carter, J.

    2001-01-01

    The 40 Ca(e,e'x; x=p,α) reaction has been measured in the giant resonance excitation region for E x ≅8-26 MeV. The present article is the first out of three describing the experiments and giving an overview of the results. Data were taken at four momentum transfers in the range q=0.26-0.66 fm -1 . Angular correlations for decay to the ground state and low-lying states of 39 K and 36 Ar could be extracted as a function of excitation energy in 40 Ca. Excitation energy spectra integrated over the particle emission angle were generated for the various resolved decay channels. Comparisons of the giant resonance cross-section distributions with results using other electromagnetic or hadronic probes have been made and good agreement is found in most cases

  8. TPX: Contractor preliminary design review. Volume 5, Manufacturing R&D

    Energy Technology Data Exchange (ETDEWEB)

    Roach, J.F.; Urban, W.M.; Hartman, D. [Everson Electric Co., Bekthlehem, PA (United States)

    1995-08-04

    TPX Insulation & Impregnation R&D test results are reported for 1x2 samples designed for screening candidate conduit insulation systems for TPX PF and TF coils. The epoxy/glass insulation system and three proposed alternate insulation systems employing Kapton, was evaluated in as received sample condition and after 10 thermal cycles in liquid nitrogen. Two DGBA impregnation systems, Shell 826 and CTD101K were investigated. Square incoloy 908 and 316 LN stainless hollow conduits were used for 1x2 sample fabrication. Capacitance, dielectric loss, and insulation resistance dielectric characteristics were measured for all samples. Partial discharge performance was measured for samples either in air, under silicon oil, or under liquid nitrogen up to 10kVrms at 60 Hz. Hipot screening was performed at 10 kVdc. The samples were cross sectioned and evaluated for impregnation quality. The implications of the test results on the TPX preliminary design decision are discussed.

  9. Detection of eardrum abnormalities using ensemble deep learning approaches

    Science.gov (United States)

    Senaras, Caglar; Moberly, Aaron C.; Teknos, Theodoros; Essig, Garth; Elmaraghy, Charles; Taj-Schaal, Nazhat; Yua, Lianbo; Gurcan, Metin N.

    2018-02-01

    In this study, we proposed an approach to report the condition of the eardrum as "normal" or "abnormal" by ensembling two different deep learning architectures. In the first network (Network 1), we applied transfer learning to the Inception V3 network by using 409 labeled samples. As a second network (Network 2), we designed a convolutional neural network to take advantage of auto-encoders by using additional 673 unlabeled eardrum samples. The individual classification accuracies of the Network 1 and Network 2 were calculated as 84.4%(+/- 12.1%) and 82.6% (+/- 11.3%), respectively. Only 32% of the errors of the two networks were the same, making it possible to combine two approaches to achieve better classification accuracy. The proposed ensemble method allows us to achieve robust classification because it has high accuracy (84.4%) with the lowest standard deviation (+/- 10.3%).

  10. Solid-State FTIR Spectroscopic Study of Two Binary Mixtures: Cefepime-Metronidazole and Cefoperazone-Sulbactam

    Directory of Open Access Journals (Sweden)

    Hassan Refat H. Ali

    2017-01-01

    Full Text Available The structural information of the pharmaceuticals and insights on the modes of molecular interactions are very important aspects in drug development. In this work, two cephalosporins and antimicrobial combinations, cefepime-metronidazole and cefoperazone-sulbactam, were studied in the solid state using FTIR spectroscopy for the first time. Quantitation of the studied drugs and their binary mixtures was performed by integrating the peak areas of the characteristic well-resolved bands: υ (C=O band at 1773 cm−1 for cefepime and ring torsion band at 826 cm−1 for metronidazole and υ (C=O band at 1715 cm−1 for cefoperazone and ring torsion band at 1124 cm−1 for sulbactam. The results of this work were compared with the relevant spectrophotometric reported methods. This study provides data that can be used for the preparative process monitoring of the studied drugs in various dosage forms.

  11. Crystallization kinetics of the borax decahydrate

    Science.gov (United States)

    Ceyhan, A. A.; Sahin, Ö.; Bulutcu, A. N.

    2007-03-01

    The growth and dissolution rates of borax decahydrate have been measured as a function of supersaturation for various particle sizes at different temperature ranges of 13 and 50 °C in a laboratory-scale fluidized bed crystallizer. The values of mass transfer coefficient, K, reaction rate constant, kr and reaction rate order, r were determined. The relative importances of diffusion and integration resistance were described by new terms named integration and diffusion concentration fraction. It was found that the overall growth rate of borax decahydrate is mainly controlled by integration (reaction) steps. It was also estimated that the dissolution region of borax decahydrate, apart from other materials, is controlled by diffusion and surface reaction. Increasing the temperature and particle size cause an increase in the values of kinetic parameters ( Kg, kr and K). The activation energies of overall, reaction and mass transfer steps were determined as 18.07, 18.79 and 8.26 kJmol -1, respectively.

  12. Genome wide association studies for body conformation traits in the Chinese Holstein cattle population

    DEFF Research Database (Denmark)

    Wu, Xiaoping; Fang, Ming; Liu, Lin

    2013-01-01

    .Results: The Illumina BovineSNP50 BeadChip was used to identify single nucleotide polymorphisms (SNPs) that are associated with body conformation traits. A least absolute shrinkage and selection operator (LASSO) was applied to detect multiple SNPs simultaneously for 29 body conformation traits with 1,314 Chinese...... Holstein cattle and 52,166 SNPs. Totally, 59 genome-wide significant SNPs associated with 26 conformation traits were detected by genome-wide association analysis; five SNPs were within previously reported QTL regions (Animal Quantitative Trait Loci (QTL) database) and 11 were very close to the reported...... SNPs. Twenty-two SNPs were located within annotated gene regions, while the remainder were 0.6-826 kb away from known genes. Some of the genes had clear biological functions related to conformation traits. By combining information about the previously reported QTL regions and the biological functions...

  13. Gene discovery in Triatoma infestans

    Directory of Open Access Journals (Sweden)

    de Burgos Nelia

    2011-03-01

    Full Text Available Abstract Background Triatoma infestans is the most relevant vector of Chagas disease in the southern cone of South America. Since its genome has not yet been studied, sequencing of Expressed Sequence Tags (ESTs is one of the most powerful tools for efficiently identifying large numbers of expressed genes in this insect vector. Results In this work, we generated 826 ESTs, resulting in an increase of 47% in the number of ESTs available for T. infestans. These ESTs were assembled in 471 unique sequences, 151 of which represent 136 new genes for the Reduviidae family. Conclusions Among the putative new genes for the Reduviidae family, we identified and described an interesting subset of genes involved in development and reproduction, which constitute potential targets for insecticide development.

  14. Optimization of Fluorine Plasma Treatment for Interface Improvement on HfO2/In0.53Ga0.47As MOSFETs

    Directory of Open Access Journals (Sweden)

    Yen-Ting Chen

    2012-03-01

    Full Text Available This paper reports significant improvements in the electrical performance of In0.53Ga0.47As metal-oxide-semiconductor field-effect transistors (MOSFET by a post-gate CF4/O2 plasma treatment. The optimum condition of CF4/O2 plasma treatment has been systematically studied and found to be 30 W for 3–5 min. Approximately 5× reduction in interface trap density from 2.8 × 1012 to 4.9 × 1011 cm−2eV−1 has been demonstrated with fluorine (F incorporation. Subthreshold swing has been improved from 127 to 109 mV/dec. Effective channel mobility has been enhanced from 826 to 1,144 cm2/Vs.

  15. Trypanosoma brucei gambiense trypanosomiasis in Terego county, northern Uganda, 1996: a lot quality assurance sampling survey.

    Science.gov (United States)

    Hutin, Yvan J F; Legros, Dominique; Owini, Vincent; Brown, Vincent; Lee, Evan; Mbulamberi, Dawson; Paquet, Christophe

    2004-04-01

    We estimated the pre-intervention prevalence of Trypanosoma brucei gambiense (Tbg) trypanosomiasis using the lot quality assurance sampling (LQAS) methods in 14 parishes of Terego County in northern Uganda. A total of 826 participants were included in the survey sample in 1996. The prevalence of laboratory confirmed Tbg trypanosomiasis adjusted for parish population sizes was 2.2% (95% confidence interval =1.1-3.2). This estimate was consistent with the 1.1% period prevalence calculated on the basis of cases identified through passive and active screening in 1996-1999. Ranking of parishes in four categories according to LQAS analysis of the 1996 survey predicted the prevalences observed during the first round of active screening in the population in 1997-1998 (P LQAS were validated by the results of the population screening, suggesting that these survey methods may be useful in the pre-intervention phase of sleeping sickness control programs.

  16. The wet destruction of dry organic material in a closed quartz tube

    International Nuclear Information System (INIS)

    Faanhof, A.; Das, H.A.

    1977-01-01

    Quantitative, rapid destruction of dry organic materials is necessary in many cases. The application of wet mineralization in a closed quartz tube and the optimization of destruction conditions are described. The procedure takes approximately 3.5 hours for 20 samples. The method was checked by radiotracer and activation experiments. The ratio of the Hg-203 count-rates of spiked and destructed samples to that of standards is 0.991+-0.014. The results of the instrumental analysis for tobacco and standard kale are: tobacco (84+-13) ng.g -1 , standard kale (155+-7)ng.g -1 . The average of the data for kale, reported in literature, is (150+-8)ng.g -1 . Results after destruction are: tobacco (82+-6)ng.g -1 , standard kale (158+-16)ng.g -1 . (N.L.Gy.)

  17. CO{sub 2}-recycling by plants: how reliable is the carbon isotope estimation?

    Energy Technology Data Exchange (ETDEWEB)

    Siegwolf, R T.W.; Saurer, M [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Koerner, C [Basel Univ., Basel (Switzerland)

    1997-06-01

    In the study of plant carbon relations, the amount of the respiratory losses from the soil was estimated, determining the gradient of the stable isotope {sup 13}C with increasing plant canopy height. According to the literature 8-26% of the CO{sub 2} released in the forests by soil and plant respiratory processes are reassimilated (recycled) by photosynthesis during the day. Our own measurements however, which we conducted in grass land showed diverging results from no indicating of carbon recycling, to a considerable {delta}{sup 13}C gradient suggesting a high carbon recycling rate. The role of other factors, such as air humidity and irradiation which influence the {delta}{sup 13}C in a canopy as well, are discussed. (author) 3 figs., 4 refs.

  18. Optical High Harmonic Generation in C60

    Science.gov (United States)

    Zhang, Guoping

    2005-03-01

    C60 et al. Physical Review Letters Physical Review B High harmonic generation (HHG) requires a strong laser field, but in a relatively weak laser field is sufficient. Numerical results presented here show while its low order harmonics result from the laser field, its high order ones are mainly from the multiple excitations. Since high order harmonics directly correlate electronic transitions, the HHG spectrum accurately measures transition energies. Therefore, is not only a promising material for HHG, but may also present an opportunity to develop HHG into an electronic structure probing tool. References: G. P. Zhang, 91, 176801 (2003); G. P. Zhang and T. F. George, 68, 165410 (2003); P. B. Corkum, 71, 1994 (1993); G. P. Zhang and Thomas F. George, 93, 147401 (2004); H. Niikura ,ature 417, 917 (2002); ibid. 421, 826 (2003); Y. Mairesse ,cience 302, 1540 (2003); A. Baltuska ,ature 421, 611 (2003).

  19. Assessment of selenium and zinc status in Korean middle-aged male patients with coronary heart disease using neutron activation analysis method

    International Nuclear Information System (INIS)

    Lee, Ok Hee; Kim, Bo Ha; Moon, Jong Hwa; Chung, Yong Sam

    2005-01-01

    The presented study aimed to evaluate the selenium and zinc status of Korean middle -aged male patients with CHD. The serum concentration of zinc and selenium was measured by Neutron activation analysis method. The mean serum selenium and zinc concentrations of patients were 94.9 μg/l and 826.4 μg/l, respectively compared to the 97.8μg/l, 891.6 μg/l of control group, showing no any difference in selenium status, but showed significant difference for zinc status of middle -aged men. The deficiency of zinc in control group was 9.8%, but that was 31.3% in patient group. Conclusively, this study indicated that zinc status, which is associated with inflammatory reaction, is low in Korean male patients with CHD

  20. Polygons in Seasonal Frost

    Science.gov (United States)

    2004-01-01

    8 February 2004 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a summertime scene in the south polar region of the red planet. A patch of bright frost--possibly water ice--is seen in the lower third of the image. Polygon patterns that have developed in the ice as it sublimes away can be seen; these are not evident in the defrosted surfaces, so they are thought to have formed in the frost. This image is located near 82.6oS, 352.5oW. Sunlight illuminates this scene from the upper left; the image covers an area 3 km (1.9 mi) wide.

  1. Screening of 33 Medicinal Plants for the Microelements Content

    Directory of Open Access Journals (Sweden)

    Ducu Sandu Ştef

    2010-05-01

    Full Text Available The microelements content of 33 medicinal plants was analyzed. The analysed microelements were: Iron, copper, zinc, manganese, cobalt, chromium, nickel, cadmium and lead. Mineral contents were determinate by flame atomic absorption spectrometry (F-AAS with high resolution continuum source ContrAA 300 spectrometer. The contents in microelements for analysed samples were in range: 18.1 ppm (Symphytum officinale - 1.4 ppm (Rhamnus frangula, for Copper; 26,2 ppm (Valeriana officinalis – 4,3 ppm (Rhamnus frangula, for Zinc; 214 ppm. (Violae tricoloris herba - 18 ppm (Equisetum arvense, for Manganese; 826 ppm (Calendula officinalis - 23 ppm (Rhamnus frangula, for Iron. The microelements contents (Cu, Zn, Mn, Fe, Co, Cr, Ni, Cd and Pb have grouped the analyzed medicinal plants in two main clusters. First main cluster was formed by other two groups.

  2. Gunn's dots in retinal images of 2,286 adolescents

    DEFF Research Database (Denmark)

    Boberg-Ans, Lars C.; Munch, Inger C.; Larsen, Michael

    2017-01-01

    a 6 mm grid centered on the optic disc. Results: One or more Gunn's dots were seen in at least one eye in 82.6% of children. The median number of Gunn's dots per eye was 46 (range 0-482). Most Gunn's dots were found inferior and superior of the optic disc (49.3% and 45.8%, respectively, of the total...... number of Gunn's dots in the population). The odds for having 1 or more Gunn's dots were 3-fold greater in children with dark brown irides compared with children with blue irides (odds ratio 2.99, 95% CI 1.81 to 4.94, P, 0.0001 adjusted for age, sex, retinal nerve fiber layer thickness, refraction...

  3. Electric power annual 1997. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-07-01

    The Electric Power Annual presents a summary of electric power industry statistics at national, regional, and State levels. The objective of the publication is to provide industry decisionmakers, government policy-makers, analysts, and the general public with data that may be used in understanding US electricity markets. The Electric Power Annual is prepared by the Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. Volume 1 -- with a focus on US electric utilities -- contains final 1997 data on net generation and fossil fuel consumption, stocks, receipts, and cost; preliminary 1997 data on generating unit capability, and retail sales of electricity, associated revenue, and the average revenue per kilowatthour of electricity sold (based on a monthly sample: Form EIA-826, ``Monthly Electric Utility Sales and Revenue Report with State Distributions``). Additionally, information on net generation from renewable energy sources and on the associated generating capability is included in Volume 1 of the EPA.

  4. Fate of 15N-Urea and 15N-Ammonia sulfate applied in different times to rice crops, variety CICA-8, under greenhouse conditions

    International Nuclear Information System (INIS)

    Bastidas, O.G.; Alvarez, A.L.; Victoria, R.L.; Muraoka, T.; Urquiaga, S.

    1986-01-01

    This research project deals with the end use of two nitrogen fertilizers applied to a rice crop. The experiment was carried out in a greenhouse, using Urea(1.973% N 15 atom content)and Ammonia Sulfate(1.826% N 15 atom content). Fertilizers were applied in four levels (0 to 300 Kg/ha) at sowing and 30 days after budding on flower pots containing 30 Kg. of soil. Results indicate that production of dry vegetable material presents no significant differences in regard to application time or nitrogen source, but it does in relation to applied levels the efficiency in fertilizers use changed between 16 and 54%, showing differences highly significant, in relation to source, level and specially time of application. At the end of the experiment, in the plant-soil system, about 39% to 81% of the applied nitrogen was recuperated, given higher losses when Urea was as a source, and depending on the time of application. (author)

  5. Obstetric conditions and risk of first admission with schizophrenia: A Danish national register based study

    DEFF Research Database (Denmark)

    Byrne, Majella; Agerbo, Esben; Bennedsen, Birgit

    2007-01-01

    and 24, 826 individually matched controls. Adjusting for the other obstetric factors, family psychiatric history, and socio-economic and demographic factors, risk of schizophrenia was associated with maternal non-attendance at antenatal appointments (Incidence Rate Ratio (IRR) 2.08, 95% CI: 1.0, 4...... (IRR 2.15, 95% CI: 1.1, 4.4), and maternal sepsis of childbirth and the puerperium (IRR 2.91, 95% CI: 1.1, 7.9). There was no significant interaction between the obstetric factors and either sex or family psychiatric history. The data suggest a modest association between prematurity, indicators......-control study based on Danish longitudinal registers was conducted to investigate the risk of schizophrenia associated with exposure to a range of obstetric events. The sample included 1039 first admissions to, or contacts with Danish psychiatric services with an ICD-8 or ICD-10 diagnosis of schizophrenia...

  6. Porous silicon powder as an adsorbent of heavy metal (nickel)

    Science.gov (United States)

    Nabil, Marwa; Motaweh, Hussien A.

    2018-04-01

    New and inexpensive nanoporous silicon (NPS) powder was prepared by alkali chemical etching using sonication technique and was subsequently investigated as an adsorbent in batch systems for the adsorption Ni(II) ions in an aqueous solution. The optimum conditions for the Ni(II) ion adsorption capacity of the NPS powder were studied in detail by varying parameters such as the initial Ni(II) concentration, the solution pH value, the adsorption temperature and contact time. The results indicated that the maximum adsorption capacity and the maximum removal percent of Ni(II) reached 2665.33 mg/g and 82.6%, respectively, at an initial Ni(II) concentration of 100 mg/L, adsorption time of 30 min and no effect of the solution pH and adsorption temperature.

  7. Peningkatan Pengetahuan dan Sikap Kepala Keluarga tentang Pengelolaan Sampah Melalui Pemberdayaan Keluarga di Kelurahan Tamansari Kota Bandung

    Directory of Open Access Journals (Sweden)

    Tati Ruhmawati

    2017-03-01

    Full Text Available Judul: Peningkatan Pengetahuan dan Sikap Kepala Keluarga tentang Pengelolaan Sampah Melalui Pemberdayaan Keluarga di Kelurahan Tamansari Kota Bandung Latar belakang: Sungai Cikapundung merupakan tempat dimana masyarakat banyak membuang sampah ke dalamnya. Pemberdayaan keluarga merupakan alternatif model yang diharapkan merubah pengetahuan dan sikap menuju keluarga yang lebih baik. Penelitian ini bertujuan untuk menganalisis pengetahuan dan sikap keluarga sebelum dan sesudah pemberdayaan pengelolaan sampah. Materi dan Metode: Penelitian ini merupakan penelitian eksperimen semu dengan rancangan “pre and post design.” Intervensi yang dilakukan adalam pemberdayaan model keluarga mencakup konseling, pelatihan, dan pendampingan. Populasi penelitian ini adalah seluruh kepala keluarga atau wakilnya yang tinggal di sekitar aliran sungai Cikapundung di Rw 06 Kelurahan Tamansari Bandung Wetan. Pengambilan sampel diambil secara non random. Pengumpulan data dilakukan melalui wawancara dan observasi. Analisis ststistik untuk uji beda digunakan indepnden T test pada taraf signifikasi 5%. Hasil: Hasil penelitian ini menunjukkan bahwa sebanyak 82,6% responden berumur tidak produktif; 56,5% berpendidikan Sekolah Menengah Atas; 87% tidak bekerja; 56,5% berpenghasilan di bawah UMR; 100% muslim, telah tinggal lebih dari satu tahun, sebagian besar mempunyai 4 anggota keluarga. Fasilitas pendukung pengelolaan sampah yang ada di lingkungan mereka adalah tempat pembuangan sampah sementara (TPS, motor angkut sampah, dan ada lembaga bank sampah. Setelah intervensi pemberdayaan, pengetahuan dan sikap mereka sangat baik masing-masing 78,3% dan 82,6%. Hasil analisis statistik menunjukkan ada perbedaan pengetahuan dan sikap secara signifikan antara sebelum dan sesudah intervensi pemberdayaan keluarga  (p=0,001 dan p=0,005. Simpulan: Intervensi pemberdayaan mampu meningkatkan secara signifikan pengetahuan dan sikap keluarga dalam pengelolaan sampah. Abstact Title: The

  8. NOD2/CARD15 genotype and common gastrointestinal diseases in 43 600 individuals

    DEFF Research Database (Denmark)

    Yazdanyar, S.; Nordestgaard, B.G.

    2010-01-01

    appendicitis, 646 irritable bowel syndrome, 1301 infectious diseases of the gastrointestinal tract, 681 anal fissure, fistula and abscess, 826 gastrointestinal cancer and 161 developed cancer in liver and pancreas. Results. Some 89% were non-carriers, 11% heterozygotes, 0.15% homozygotes and 0.23% compound...... heterozygotes. Cumulative incidences differed by genotype for appendicitis (log-rank P = 0.02), anal fissure, fistula and abscess (P = 0.003) and gastrointestinal cancer (P = 0.004), but not for any of the other endpoints. Compared with non-carriers, age and sex adjusted hazard ratios were 2.7 (95% CI 1.......4-5.5) for appendicitis amongst compound heterozygotes, 3.2 (1.3-7.8) for anal fissure, fistula and abscess amongst compound heterozygotes, and 3.8 (1.6-9.2) for gastrointestinal cancer amongst homozygotes, whilst other genotypes did not have increased risk. The increased risk of gastrointestinal cancer amongst...

  9. Crater size-frequency distributions and a revised Martian relative chronology

    International Nuclear Information System (INIS)

    Barlow, N.G.

    1988-01-01

    A relative plotting technique is applied to Viking 1:2M photomosaics of 25,826 Martian craters of diameter greater than 8 km and age younger than that of the Martian surface. The size-frequency distribution curves are calculated and analyzed in detail, and the results are presented in extensive tables and maps. It is found that about 60 percent of the crater-containing lithologic units, including many small volcanoes and the ridged planes, were formed during the heavy-bombardment period (HBP), while 40 percent arose after the HBP. Wide region-to-region variation in the crater density is noted, and localized age estimates are provided. 42 references

  10. Comparison of three nonlinear filters for fault detection in continuous glucose monitors.

    Science.gov (United States)

    Mahmoudi, Zeinab; Wendt, Sabrina Lyngbye; Boiroux, Dimitri; Hagdrup, Morten; Norgaard, Kirsten; Poulsen, Niels Kjolstad; Madsen, Henrik; Jorgensen, John Bagterp

    2016-08-01

    The purpose of this study is to compare the performance of three nonlinear filters in online drift detection of continuous glucose monitors. The nonlinear filters are the extended Kalman filter (EKF), the unscented Kalman filter (UKF), and the particle filter (PF). They are all based on a nonlinear model of the glucose-insulin dynamics in people with type 1 diabetes. Drift is modelled by a Gaussian random walk and is detected based on the statistical tests of the 90-min prediction residuals of the filters. The unscented Kalman filter had the highest average F score of 85.9%, and the smallest average detection delay of 84.1%, with the average detection sensitivity of 82.6%, and average specificity of 91.0%.

  11. Does a minimal intervention approach threaten the biodiversity of protected areas? A multi-taxa short-term response to intervention in temperate oak-dominated forests

    Czech Academy of Sciences Publication Activity Database

    Šebek, Pavel; Bače, R.; Bartoš, Michael; Beneš, Jiří; Chlumská, Zuzana; Doležal, Jiří; Dvorský, Miroslav; Kovář, J.; Machač, O.; Mikátová, B.; Perlík, Michal; Plátek, Michal; Poláková, Simona; Škorpík, R.; Stejskal, R.; Svoboda, M.; Trnka, F.; Vlašín, M.; Zapletal, Michal; Čížek, Lukáš

    2015-01-01

    Roč. 358, Dec 15 (2015), s. 80-89 ISSN 0378-1127 R&D Projects: GA ČR GAP504/12/1952; GA ČR GAP505/10/2167 Grant - others:GA JU(CZ) 046/2014/P; European Social Fund(CZ) CZ.1.07/2.3.00/20.0064; European Social Fund(CZ) CZ.1.07/2.3.00/30.0040 Institutional support: RVO:60077344 ; RVO:67985939 Keywords : coppice * open woodlands * biodiversity conservation Subject RIV: EH - Ecology, Behaviour; EH - Ecology, Behaviour (BU-J) Impact factor: 2.826, year: 2015 http://www.sciencedirect.com/science/article/pii/S0378112715004764

  12. Characteristic of The RSG-Gas Oxide Fuel Element Temperature Under Forced Convection And Natural Convection Mode

    International Nuclear Information System (INIS)

    Sudarmono

    2000-01-01

    One of the methods used for fuel element plate temperature measurement in RSG-Gas is a direct measurement. Evaluation on the measurement results were done by using HEATHYDE and NATCON code, which was then compared to the safety margin criteria. Results of thermalhydraulic measurement on transitional core both under forced and natural convection were compared with the results of calculations using the two codes. Measurement result for maximum fuel element plate temperature at typical working core of 30 MW, was 121 o C. The deviation between calculation and measurement result was under 9.75 %. Under normal operation, safety margin on DNB and OFI are 3.56 and 2.60, respectively. Natcon calculation result showed that the typical working core under the natural circulation mode, an onset of nucleate boiling (ONB)occurred at a core power level of 826 kW (2.8% of the nominal power)

  13. Areva at March 31, 2016

    International Nuclear Information System (INIS)

    Lachaux, Manuel; Jugean, Anne-Sophie

    2016-01-01

    In the first quarter of 2016, AREVA generated consolidated revenue of 826 million euros, a decrease of 0.8% (-2.2% like for like) compared with the same period in 2015, due in particular to the schedule of uranium deliveries. Foreign exchange had a positive impact of 12 million euros over the period. At March 31, 2016, the group's backlog reached 33.6 billion euros, up sharply compared to December 31, 2015 (29 billion euros), and represented eight years of revenue. It reflects in particular multi-year commercial agreements signed with EDF in early 2016. The order intake for the first quarter of 2016 totaled 6.1 billion euros, a strong increase in relation to the first quarter of 2015 (0.3 billion euros)

  14. Pharmaceutical care education in Kuwait: pharmacy students’ perspectives

    Directory of Open Access Journals (Sweden)

    Katoue MG

    2014-09-01

    Full Text Available Background: Pharmaceutical care is defined as the responsible provision of medication therapy to achieve definite outcomes that improve patients’ quality of life. Pharmacy education should equip students with the knowledge, skills, and attitudes they need to practise pharmaceutical care competently. Objective: To investigate pharmacy students’ attitudes towards pharmaceutical care, perceptions of their preparedness to perform pharmaceutical care competencies, opinions about the importance of the various pharmaceutical care activities, and the barriers to its implementation in Kuwait. Methods: A descriptive, cross-sectional survey of pharmacy students (n=126 was conducted at Faculty of Pharmacy, Kuwait University. Data were collected via a pre-tested self-administered questionnaire. Descriptive statistics including percentages, medians and means Likert scale rating (SD were calculated and compared using SPSS, version 19. Statistical significance was accepted at a p value of 0.05 or lower. Results: The response rate was 99.2%. Pharmacy students expressed overall positive attitudes towards pharmaceutical care. They felt prepared to implement the various aspects of pharmaceutical care, with the least preparedness in the administrative/management aspects. Perceived pharmaceutical care competencies grew as students progressed through the curriculum. The students also appreciated the importance of the various pharmaceutical care competencies. They agreed/strongly agreed that the major barriers to the integration of pharmaceutical care into practice were lack of private counseling areas or inappropriate pharmacy layout (95.2%, lack of pharmacist time (83.3%, organizational obstacles (82.6%, and pharmacists’ physical separation from patient care areas (82.6%. Conclusion: Pharmacy students’ attitudes and perceived preparedness can serve as needs assessment tools to guide curricular change and improvement. Student pharmacists at Kuwait University

  15. Pharmaceutical care education in Kuwait: pharmacy students' perspectives.

    Science.gov (United States)

    Katoue, Maram G; Awad, Abdelmoneim I; Schwinghammer, Terry L; Kombian, Samuel B

    2014-07-01

    Pharmaceutical care is defined as the responsible provision of medication therapy to achieve definite outcomes that improve patients' quality of life. Pharmacy education should equip students with the knowledge, skills, and attitudes they need to practise pharmaceutical care competently. To investigate pharmacy students' attitudes towards pharmaceutical care, perceptions of their preparedness to perform pharmaceutical care competencies, opinions about the importance of the various pharmaceutical care activities, and the barriers to its implementation in Kuwait. A descriptive, cross-sectional survey of pharmacy students (n=126) was conducted at Faculty of Pharmacy, Kuwait University. Data were collected via a pre-tested self-administered questionnaire. Descriptive statistics including percentages, medians and means Likert scale rating (SD) were calculated and compared using SPSS, version 19. Statistical significance was accepted at a p value of 0.05 or lower. The response rate was 99.2%. Pharmacy students expressed overall positive attitudes towards pharmaceutical care. They felt prepared to implement the various aspects of pharmaceutical care, with the least preparedness in the administrative/management aspects. Perceived pharmaceutical care competencies grew as students progressed through the curriculum. The students also appreciated the importance of the various pharmaceutical care competencies. They agreed/strongly agreed that the major barriers to the integration of pharmaceutical care into practice were lack of private counseling areas or inappropriate pharmacy layout (95.2%), lack of pharmacist time (83.3%), organizational obstacles (82.6%), and pharmacists' physical separation from patient care areas (82.6%). Pharmacy students' attitudes and perceived preparedness can serve as needs assessment tools to guide curricular change and improvement. Student pharmacists at Kuwait University understand and advocate implementation of pharmaceutical care while also

  16. Duct-ectatic type of mucin producing tumor of the pancreas--new concept of pancreatic neoplasia.

    Science.gov (United States)

    Kimura, W; Sasahira, N; Yoshikawa, T; Muto, T; Makuuchi, M

    1996-01-01

    Although there have been recent reports of mucin-producing tumor of the pancreas, there has been no thorough clinicopathological analysis of a large number of cases. Two hundred forty four cases of mucin-producing tumor of the pancreas from Japanese, European and American reports, together with 15 cases of our own, were analyzed clinicopathologically. Mucin-producing tumor of the pancreas was found in 177 males and 82 females (M:F = 2.2:1). The mean age was 65.5 years. Jaundice, diabetes mellitus and a past history of pancreatitis were found in 15%-19% of the cases. The tumor was most frequently (62%) found in the head of the pancreas. Pathologically, hyperplasia or adenoma was found in 58 cases, and adenocarcinoma in 160 cases. Five-year-survival rate by the Kaplan-Meier method was 82.6% in all of the cases and postoperative survival curve was much better in cases with this type of carcinoma than in cases with ordinary pancreatic duct cell carcinoma (5-year-survival rate: 82.6% vs 17.3%). Serum tumor markers such as CEA or CA 19-9 were not effective in differentiating between benign and malignant, or in determining the degree of cancerous spread, while cytology of the pancreatic juice and biopsy of the tumor could contribute to the diagnosis. Mucin-producing tumor has unique clinicopathological characteristics, such as the dilated main pancreatic duct or branches, dilatation of the orifice of the papilla of Vater, or good prognosis. Since a diagnosis for benign or malignant is very difficult in some cases, methods for distinguishing benign from malignant lesions or for determining cancerous spread, such as molecular biological techniques, should be established.

  17. PENGARUH DEFATTING, FREKUENSI PENCUCIAN DAN JENIS DRYOPROTECTANT TERHADAP MUTU TEPUNG SURIMI IKAN LELE KERING BEKU [Effect of Defatting, Washing Cycle and Dryoprotectant Type on the Quality of Freeze Dried Catfish Surimi Powder

    Directory of Open Access Journals (Sweden)

    Wahyu Ramadhan*

    2014-06-01

    Full Text Available Freeze dried surimi powder is a surimi type processed by freeze drying. To utilize oversized catfish and to reduce surimi handling cost, oversized catfish has been used as raw material of surimi powder. The study aimed to determine the effect of defatting (NaHCO3 concentration and soaking duration, washingcycle,and dryoprotectant type on catfish surimi, as well as quality differences between surimi powder and wet surimi. With regard to defatting step, soaking in NaHCO3 0.75% for 10 minutes was found as the best treatment and resulting in a fat content of 1.52%. Moreover, one time of washing cycle was found as the most appropriate procedure to obtain a superior quality of surimi with whiteness value 57.21%, water holding capacity 73.28%, salts soluble protein 7.17%, pH 6.69, and gel strength 482.3 g/cm2, folding value of 4.84, and teeth cutting value of 8.26. Trehalose 6% was the most suitable dryoprotectant resulting in surimi powder with water holding capacity of 8.01 mL/g, gel strength 826.3 g/cm2, salt soluble protein 18.98%, density 4.06 mL/10 g, rehydration capacity 3.81, emulsion capacity 69.3%, emulsion stability 59.3%, foaming capacity 25.33% and foaming stability 9.40%. The microstructure profile of surimi powder added with trehalose had more compact tissues, without any damage and clots, than that treated with other dryoprotectants. However, surimi powder still had lower protein content than wet surimi, and lower physical and chemical properties, particularly in its teeth cutting and folding characteristics.

  18. Planificación familiar en el climaterio

    Directory of Open Access Journals (Sweden)

    Marianela de la C Prendes Labrada

    2000-01-01

    Full Text Available Se realizó un estudio descriptivo en la consulta de planificación familiar de Santos Suárez en el período de 1 año a partir de abril de 1998. La muestra la conformó el total de mujeres mayores de 35 años que acudieron por primera vez a la consulta de planificación familiar, a las que se les llenó un cuestionario. Los datos se procesaron con el cálculo porcentual. Se concluyó que la asistencia de las mujeres mayores de 35 años a la consulta de planificación familiar fue baja; predominaron las que tienen unión estable (82,6 %, nivel de escolaridad preuniversitario (60,9 % y trabajadoras (69,6 %; la presencia de otros factores de riesgo reproductivo preconcepcional diferentes a la edad fue baja (39,12 % y la mayoría seleccionó los dispositivos intrauterinos y los anticonceptivos hormonales inyectables sólo de progestina.A descriptive study was carried out in the family planning department of Santos Suárez for 1 year, since April 1998. The sample consisted in the total amount of women over 35 years old, who for the first time attended the family planning department and filled out a questionaire. Data were processed by the percentage calculation. It was concluded that the attendance of women over 35 years old to the family planning department was low. There was a predominance of those women with a stable union (82.6 %, pre-universitary educational level (60.9 %, and working women (69.6 %. The existence of other preconception reproductive risk factors different from age was low (39.12 % and the majority chose the intrauterine devices and the injectable contraceptives containing only progrestational hormones.

  19. Clinical and biochemical outcomes of men undergoing radical prostatectomy or radiation therapy for localized prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, David; Weiss, Jeffrey P.; Safdieh, Joseph; Weiner, Joseph; Rotman, Marvin; Schwartz, David [Veterans Affairs, New York Harbor Healthcare System, Brooklyn (United States); Rineer, Justin [University of Florida Health Cancer Center at Orlando Health, Orlando (United States)

    2015-03-15

    We analyzed outcomes of patients with prostate cancer undergoing either radical retropubic prostatectomy (RRP) +/- salvage radiation or definitive radiation therapy (RT) +/- androgen deprivation. From 2003-2010 there were 251 patients who underwent RRP and 469 patients who received RT (> or =7,560 cGy) for prostate cancer. Kaplan-Meier analysis was performed with the log-rank test to compare biochemical control (bCR), distant metastatic-free survival (DMPFS), and prostate cancer-specific survival (PCSS) between the two groups. The median follow-up was 70 months and 61.3% of the men were African American. For low risk disease the 6-year bCR were 90.3% for RT and 85.6% for RRP (p = 0.23) and the 6-year post-salvage bCR were 90.3% vs. 90.9%, respectively (p = 0.84). For intermediate risk disease the 6-year bCR were 82.6% for RT and 59.7% for RRP (p < 0.001) and 82.6% vs. 74.0%, respectively, after including those salvaged with RT (p = 0.06). For high risk disease, the 6-year bCR were 67.4% for RT and 41.3% for RRP (p < 0.001) and after including those salvaged with RT was 67.4% vs. 43.1%, respectively (p < 0.001). However, there were no significant differences between the two groups in regards to DMPFS or PCSS. Treatment approaches utilizing RRP +/- salvage radiation or RT +/- androgen deprivation yielded equivalent DMPFS and PCSS outcomes. Biochemical control rates, using their respective definitions, appeared equivalent or better in those who received treatment with RT.

  20. Integrative Reiki for cancer patients: a program evaluation.

    Science.gov (United States)

    Fleisher, Kimberly A; Mackenzie, Elizabeth R; Frankel, Eitan S; Seluzicki, Christina; Casarett, David; Mao, Jun J

    2014-01-01

    This mixed methods study sought to evaluate the outcomes of an integrative Reiki volunteer program in an academic medical oncology center setting. We used de-identified program evaluation data to perform both quantitative and qualitative analyses of participants' experiences of Reiki sessions. The quantitative data were collected pre- and postsession using a modified version of the distress thermometer. The pre- and postsession data from the distress assessment were analyzed using a paired Student's : test. The qualitative data were derived from written responses to open-ended questions asked after each Reiki session and were analyzed for key words and recurring themes. Of the 213 pre-post surveys of first-time sessions in the evaluation period, we observed a more than 50% decrease in self-reported distress (from 3.80 to 1.55), anxiety (from 4.05 to 1.44), depression (from 2.54 to 1.10), pain (from 2.58 to 1.21), and fatigue (from 4.80 to 2.30) with P Reiki, we found 176 (82.6%) of participants liked the Reiki session, 176 (82.6%) found the Reiki session helpful, 157 (73.7%) plan to continue using Reiki, and 175 (82.2%) would recommend Reiki to others. Qualitative analyses found that individuals reported that Reiki induced relaxation and enhanced spiritual well-being. An integrative Reiki volunteer program shows promise as a component of supportive care for cancer patients. More research is needed to evaluate and understand the impact that Reiki may have for patients, caregivers, and staff whose lives have been affected by cancer.

  1. Effect of Plate Curvature on Blast Response of Structural Steel Plates

    Science.gov (United States)

    Veeredhi, Lakshmi Shireen Banu; Ramana Rao, N. V.; Veeredhi, Vasudeva Rao

    2018-04-01

    In the present work an attempt is made, through simulation studies, to determine the effect of plate curvature on the blast response of a door structure made of ASTM A515 grade 50 steel plates. A door structure with dimensions of 5.142 m × 2.56 m × 10 mm having six different radii of curvatures is analyzed which is subjected to blast load. The radii of curvature investigated are infinity (flat plate), 16.63, 10.81, 8.26, 6.61 and 5.56 m. In the present study, a stand-off distance of 11 m is considered for all the cases. Results showed that the door structure with smallest radius of curvature experienced least plastic deformation and yielding when compared to a door with larger radius of curvature with same projected area. From the present Investigation, it is observed that, as the radius of curvature of the plate increases, the deformation mode gradually shifts from indentation mode to flexural mode. The plates with infinity and 16.63 m radius of curvature have undergone flexural mode of deformation and plates with 6.61 and 5.56 m radius of curvature undergo indentation mode of deformation. Whereas, mixed mode of deformation that consists of both flexural and indentation mode of deformations are seen in the plates with radius of curvature 10.81 and 8.26 m. As the radius of curvature of the plate decreases the ability of the plate to mitigate the effect the blast loads increased. It is observed that the plate with smaller radius of curvature deflects most of the blast energy and results in least indentation mode of deformation. The most significant observation made in the present investigation is that the strain energy absorbed by the steel plate gets reduced to 1/3 rd when the radius of curvature is approximately equal to the stand-off distance which could be the critical radius of curvature.

  2. Investigating tangible and mental resources as predictors of perceived household food insecurity during pregnancy among women in a South African birth cohort study.

    Science.gov (United States)

    Pellowski, Jennifer A; Barnett, Whitney; Kuo, Caroline C; Koen, Nastassja; Zar, Heather J; Stein, Dan J

    2017-08-01

    Food insecurity during pregnancy is concerning given the increased nutritional needs of the mother for proper fetal development. However, research is lacking within the South African context to investigate the association of economic and psychosocial factors and food insecurity among pregnant women, using comprehensive, conceptually driven models. This study applies the Network-Individual-Resource (NIR) Model to investigate individual, intimate dyadic, and family level predictors of perceived household food insecurity for pregnant women. 826 pregnant women enrolled in the Drakenstein Child Health Study (DCHS), a birth cohort in two communities in a peri-urban area of South Africa. Hierarchical logistic regressions were used to investigate the impact of household/family, intimate dyads, and individual tangible and mental resources on perceived household food insecurity during the critical period of pregnancy. Perceived household food insecurity was assessed through an adapted version of the USDA Household Food Security Scale - Short Form. Among 826 pregnant women in South Africa, individual-level tangible resources (e.g. income, social assistance, HIV status) and mental resources (e. g. depression, childhood trauma) predicted perceived household food insecurity and these predictors differed by community. Intimate dyadic and family level resources did not predict household food insecurity. Our findings of the economic and psychosocial predictors of perceived household food insecurity among pregnant women in South Africa, mirror findings in general populations. This study provides support for the extension of the NIR model to perceived household food insecurity, particularly regarding individual-level mental and tangible resources, as well as the impact of community-level factors. Future research should investigate the extent to which resource sharing occurs within networks. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Gastrointestinal and ectoparasites from urban stray dogs in Fortaleza (Brazil): high infection risk for humans?

    Science.gov (United States)

    Klimpel, Sven; Heukelbach, Jörg; Pothmann, David; Rückert, Sonja

    2010-08-01

    Dogs are important definite or reservoir hosts for zoonotic parasites. However, only few studies on the prevalence of intestinal parasites in urban areas in Brazil are available. We performed a comprehensive study on parasites of stray dogs in a Brazilian metropolitan area. We included 46 stray dogs caught in the urban areas of Fortaleza (northeast Brazil). After euthanization, dogs were autopsied. Ectoparasites were collected, and the intestinal content of dogs were examined for the presence of parasites. Faecal samples were collected and analysed using merthiolate iodine formaldehyde concentration method. A total of nine different parasite species were found, including five endoparasite (one protozoan, one cestode and three nematode species) and four ectoparasite species (two flea, one louse and one tick species). In the intestinal content, 3,162 specimens of four helminth species were found: Ancylostoma caninum (prevalence, 95.7%), Dipylidium caninum (45.7%), Toxocara canis (8.7%) and Trichuris vulpis (4.3%). A total of 394 ectoparasite specimens were identified, including Rhipicephalus sanguineus (prevalence, 100.0%), Heterodoxus spiniger (67.4%), Ctenocephalides canis (39.1%) and Ctenocephalides felis (17.4%). In the faeces, intestinal parasites were detected in 38 stray dogs (82.6%), including oocysts of Giardia sp. (2.2%) and eggs of the nematode A. caninum (82.6%). Neither eggs nor larval stages of D. caninum, T. canis or T. vulpis were detected in dog faeces. Sensitivity of faecal examination for A. caninum was 86.4% (95% confidence interval, 72.0-94.3) but zero percentage for the other intestinal helminth species. Our data show that stray dogs in northeast Brazil carry a multitude of zoonotic ecto- and endoparasites, posing a considerable risk for humans. With the exception of A. caninum, sensitivity of faecal examination was negligible.

  4. Predictive value of symptoms and demographics in diagnosing malignancy or peptic stricture

    Science.gov (United States)

    Murray, Iain A; Palmer, Joanne; Waters, Carolyn; Dalton, Harry R

    2012-01-01

    AIM: To determine which features of history and demographics predict a diagnosis of malignancy or peptic stricture in patients presenting with dysphagia. METHODS: A prospective case-control study of 2000 consecutive referrals (1031 female, age range: 17-103 years) to a rapid access service for dysphagia, based in a teaching hospital within the United Kingdom, over 7 years. The service consists of a nurse-led telephone triage followed by investigation (barium swallow or gastroscopy), if appropriate, within 2 wk. Logistic regression analysis of demographic and clinical variables was performed. This includes age, sex, duration of dysphagia, whether to liquids or solids, and whether there are associated features (reflux, odynophagia, weight loss, regurgitation). We determined odds ratio (OR) for these variables for the diagnoses of malignancy and peptic stricture. We determined the value of the Edinburgh Dysphagia Score (EDS) in predicting cancer in our cohort. Multivariate logistic regression was performed and P 73 years, OR 1.1-3.3, age 73 years 11.8%, P dysphagia (≤ 8 wk, OR 4.5-20.7, 16.6%, 8-26 wk 14.5%, > 26 wk 2.5%, P dysphagia (food or drink sticking within 5 s of swallowing than those who did not (15.1% vs 5.2% respectively, P dysphagia (pharyngeal level dysphagia 11.9% vs mid sternal or lower sternal dysphagia 12.4%). Peptic stricture was statistically more frequent in those with longer duration of symptoms (> 6 mo, OR 1.2-2.9, ≤ 8 wk 9.8%, 8-26 wk 10.6%, > 26 wk 15.7%, P 73 years 10.6%, P dysphagia. The predictive value for associated features could help determine need for fast track investigation whilst reducing service pressures. PMID:22969199

  5. Determination of thermal properties of Cs2Cr2O7(s,l) by high temperature Calvet calorimetry

    International Nuclear Information System (INIS)

    Prasad, R.; Agarwal, R.; Roy, K.N.; Iyer, V.S.; Venugopal, V.; Sood, D.D.

    1989-01-01

    Enthalpy increments have been determined for caesium dichromate in the temperature range 335 to 826 K using a high temperature Calvet micro calorimeter. A solid-solid transition has been observed at (620.5±1.5 K) and the melting temperature was found to be (657.0±1.0) K. The corresponding enthalpy values are 15.6±0.2) kJ/mol and 17.0±0.22) kJ/mol. The results thus obtained are utilised for the evaluation of molar heat capacities, standard entropies and free energy functions for Cs 2 Cr 2 O 7 (s,l). The enthalpy increment values were fitted to a polynomial and can be presented by eqs. (1) to (3), respectivley: (1) (H T 0 -H 0 298.15 )(Cs 2 Cr 2 O 7 ,s) (J/mol)=-6.410x10 4 +1.939x10 2 T(K)+7.441x10 -2 T(K) 2 (335 to 620.5 K), (2) (H T 0 -H 0 298.15 )(Cs 2 Cr 2 O 7 ,s) (J/mol)=1.313x10 6 -4.137x10 3 T(K)+3.517T(K) 2 (620.5 to 656 K), (3) (H T 0 -H 0 298.15 )(Cs 2 Cr 2 O 7 ,l) (J/mol)=-1.218x10 5 +3.890x10 2 T(K) (657 to 826 K). (orig.)

  6. Molecular characterization of three Hsp90 from Pieris and expression patterns in response to cold and thermal stress in summer and winter diapause of Pieris melete.

    Science.gov (United States)

    Wu, Yue-Kun; Zou, Chao; Fu, Dao-Meng; Zhang, Wan-Na; Xiao, Hai-Jun

    2018-04-01

    Heat shock proteins (Hsps) have been linked to stresses and winter diapause in insects, but whether they are components of summer diapause is still unknown. In this study, complementary DNAs of Hsp90 from Pieris melete, Pieris rapae and Pieris canidia named PmHsp90, PrHsp90 and PcHsp90, respectively, were cloned and sequenced. The deduced amino acid sequence consisted of 718 amino acid residues with a putative molecular mass of 82.6, 82.6 and 82.7 kDa, respectively. The amino acid sequences contained all of the five conserved signature motifs in the Hsp90 family and a bHLH protein folding activity region. The differential expression pattern of PmHsp90 in response to summer diapause and winter diapause, which are related to heat/cold stress, was investigated. Cold stress induced Hsp90 up-regulation in summer and winter diapause pupae, but not in non-diapause individuals. Heat shock up-regulated PmHsp90 gradually with an increase in temperature in summer diapause, and PmHsp90 was rapidly up-regulated in winter diapause. After 30 min heat shock at 39°C, substantial up-regulation of PmHsp90 transcript levels were observed both in summer and winter diapause. However, in non-diapause a relatively stable expression was found under different durations of 39°C heat shock. Compared to the optimal treatment of 18°C for diapause development, a high temperature acclimation of 31°C induced PmHsp90 up-regulation in summer diapause, whereas a low temperature acclimation of 4°C induced up-regulation in winter diapause. The current results indicate that Hsp90 may play an important role in response to heat/cold stress both in summer and winter diapause. © 2016 Institute of Zoology, Chinese Academy of Sciences.

  7. Estimation of Citation-Based Scholarly Activity Among Radiation Oncology Faculty at Domestic Residency-Training Institutions: 1996-2007

    International Nuclear Information System (INIS)

    Choi, Mehee; Fuller, Clifton D.; Thomas, Charles R.

    2009-01-01

    Purpose: Advancement in academic radiation oncology is largely contingent on research productivity and the perceived external influence of an individual's scholarly work. The purpose of this study was to use the Hirsch index (h-index) to estimate the research productivity of current radiation oncology faculty at U.S. academic institutions between 1996 and 2007. Methods and Materials: We performed bibliometric citation database searches for available radiation oncology faculty at domestic residency-training institutions (n = 826). The outcomes analyzed included the total number of manuscripts, total number of citations, and the h-index between 1996 and 2007. Analysis of overall h-index rankings with stratification by academic ranking, junior vs. senior faculty status, and gender was performed. Results: Of the 826 radiation oncologists, the mean h-index was 8.5. Of the individuals in the top 10% by the h-index, 34% were chairpersons, 88% were senior faculty, and 13% were women. A greater h-index was associated with a higher academic ranking and senior faculty status. Recursive partitioning analysis revealed an h-index threshold of 15 (p <0.0001) as an identified breakpoint between the senior and junior faculty. Overall, women had lower h-indexes compared with men (mean, 6.4 vs. 9.4); however, when stratified by academic ranking, the gender differential all but disappeared. Conclusion: Using the h-index as a partial surrogate for research productivity, it appears that radiation oncologists in academia today comprise a prolific group, however, with a highly skewed distribution. According to the present analysis, the h-index correlated with academic ranking. Thus, it potentially has utility in the process of promotion decisions. Overall, women in radiation oncology were less academically productive than men; the possible reasons for the gender differential are discussed.

  8. Prevalência de enteroparisitos na populaçao urbana de São Tomé - RN - estudo comparativo de um decênio

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Moreira Campos

    1982-12-01

    Full Text Available Objetivando a obtenção de variáveis relacionadas aos fatores sócio-econômicos e sanitários no período de dez (10 anos, os autores colheram resultados sobre a prevalência de enteroparasitas na população urbana de São Tomé, Rio Grande do Norte, cujos dados foram coletados entre 09 a 27 de julho de 1979, empregando o método da sedimentação espontânea (Hoffmann, Pons e Janer, através de exames realizados em 826 amostras de fezes, com uma positividade de565 para as diversas parasitoses intestinais e correspondendo a uma prevalência de 68,4% em função das condições ambientais que, embora melhoradas, concorrem no processo de disseminação de helmintoses e protozooses, além de outras patologias.In view of socio-economic and sanitary changes during ten (10 years, the authors gathered data on the prevaíence of enteroparasites in the urban population of São Tomé, Rio Grande do Norte. They collected from July 9 to July 27, 1979, 826 faecal samples which they examined using the spontaneous sedimentation method (Hoffmann, Pons, and Janer. 565 were positive for the various intestinal parasites, corresponding to a prevaíence of 68,4%. Although environmetal conditions have improved, they still contributed to the dissemination intestinal protozoal and helminthic infections.

  9. Mycobacterium leprae DNA in peripheral blood may indicate a bacilli migration route and high-risk for leprosy onset.

    Science.gov (United States)

    Reis, E M; Araujo, S; Lobato, J; Neves, A F; Costa, A V; Gonçalves, M A; Goulart, L R; Goulart, I M B

    2014-05-01

    Leprosy epidemiological studies have been restricted to Mycobacterium leprae DNA detection in nasal and oral mucosa samples with scarce literature on peripheral blood. We present the largest study applying quantitative real-time PCR (qPCR) for the detection of M. leprae DNA in peripheral blood samples of 200 untreated leprosy patients and 826 household contacts, with results associated with clinical and laboratory parameters. To detect M. leprae DNA a TaqMan qPCR assay targeting the M. leprae ML0024 genomic region was performed. The ML0024 qPCR in blood samples detected the presence of bacillus DNA in 22.0% (44/200) of the leprosy patients: 23.2% (16/69) in paucibacillary (PB), and 21.4% (28/131) in multibacillary (MB) patients. Overall positivity among contacts was 1.2% (10/826), with similar percentages regardless of whether the index case was PB or MB. After a follow-up period of 7 years, 26 contacts have developed leprosy. Comparing the results of healthy contacts with those that become ill, ML0024 qPCR positivity at the time of diagnosis of their index case represented an impressive 14.78-fold greater risk for leprosy onset (95% CI 3.6-60.8; p <0.0001). In brief, contacts with positive PCR in blood at diagnosis of index cases are at higher risk of later leprosy onset and this marker might be combined with other prognostic markers for management of contacts, which requires further studies. © 2013 The Authors Clinical Microbiology and Infection © 2013 European Society of Clinical Microbiology and Infectious Diseases.

  10. Inferring Smoking Status from User Generated Content in an Online Cessation Community.

    Science.gov (United States)

    Amato, Michael S; Papandonatos, George D; Cha, Sarah; Wang, Xi; Zhao, Kang; Cohn, Amy M; Pearson, Jennifer L; Graham, Amanda L

    2018-01-22

    User generated content (UGC) is a valuable but underutilized source of information about individuals who participate in online cessation interventions. This study represents a first effort to passively detect smoking status among members of an online cessation program using UGC. Secondary data analysis was performed on data from 826 participants in a web-based smoking cessation randomized trial that included an online community. Domain experts from the online community reviewed each post and comment written by participants and attempted to infer the author's smoking status at the time it was written. Inferences from UGC were validated by comparison with self-reported 30-day point prevalence abstinence (PPA). Following validation, the impact of this method was evaluated across all individuals and timepoints in the study period. Of the 826 participants in the analytic sample, 719 had written at least one post from which content inference was possible. Among participants for whom unambiguous smoking status was inferred during the 30 days preceding their 3-month follow-up survey, concordance with self-report was almost perfect (kappa = 0.94). Posts indicating abstinence tended to be written shortly after enrollment (median = 14 days). Passive inference of smoking status from UGC in online cessation communities is possible and highly reliable for smokers who actively produce content. These results lay the groundwork for further development of observational research tools and intervention innovations. © The Author(s) 2018. Published by Oxford University Press on behalf of the Society for Research on Nicotine and Tobacco. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  11. Effects of NFKB1 and NFKBIA gene polymorphisms on susceptibility to environmental factors and the clinicopathologic development of oral cancer.

    Directory of Open Access Journals (Sweden)

    Chiao-Wen Lin

    Full Text Available Oral cancer, which is the fourth most common cancer in Taiwanese men, is associated with environmental carcinogens. The possibility that genetic predisposition in nuclear factor-kappa B (NF-κB-signaling pathways activation is linked to the development of oral squamous cell carcinoma (OSCC requires investigation. The current study examines associations between polymorphisms within promoter regions of NFKB1 encoding NF-κB1 and NFKBIA encoding IkappaBalpha (IκBα with both the susceptibility to develop OSCC and the clinicopathological characteristics of the tumors.Genetic polymorphisms of NFKB1 and NFKBIA were analyzed by a real-time polymerase chain reaction (real-time PCR for 462 patients with oral cancer and 520 non-cancer controls. We found that NFKB1 -94 ATGG1/ATGG2, -94 ATGG2/ATGG2, and the combination of -94 ATGG1/ATGG2 and ATGG2/ATGG2 genotypes NFKBIA -826 T (CT+TT and -881 G (AG+GG allelic carriages, were more prevalent in OSCC patients than in non-cancer participants. Moreover, we found that NFKB1 or NFKBIA gene polymorphisms seem to be related to susceptibility to develop oral cancer linked to betel nut and tobacco consumption. Finally, patients with oral cancer who had at least one -519 T allele of the NFKBIA gene were at higher risk for developing distant metastasis (P<.05, compared with those patients CC homozygotes.Our results suggest that NFKB1 -94 ATTG2, NFKBIA -826 T, and -881 G alleles are associated with oral carcinogenesis. The combination of NFKB1 or NFKBIA gene polymorphisms and environmental carcinogens appears related to an increased risk of oral cancer. More importantly, the genetic polymorphism of NFKBIA -519 might be a predictive factor for the distal metastasis of OSCC in Taiwanese.

  12. BOVINE MASTITIS IN THE GOIÂNIA DAIRY BASIN MASTITE BOVINA NA BACIA LEITEIRA DE GOIÂNIA

    Directory of Open Access Journals (Sweden)

    Roberval Rodrigues da Costa

    2007-09-01

    Full Text Available

    This investigation was carried on in six counties of milk region around Goiânia city, state of Goiás. Seven hundred and one (701 cows in lactation were examined, from which 87 (12.41% showed c1inica1 and subclinical mastitis. The tests CMT/ Whiteside were dome on 2,717 samples of milk and from those 393 (41.46% were positive. The rnicroorganisms isolated from 701 lactocultures were: Staphilococcus aureus 172 (67.70%; Streptococcus spp. 38 (l4.96%; Corynebacterium spp. 42 (16.53%; Staphylococcu.s epidermides 38 (14.96%; Pseudomonas aeruginosa 21 (8.26%; Eschericheir coli 18 (7.08%; Serratia marceceus 12 (4.72%; Klebsiella spp 5 (1.96%; Proteus vulgaris 4 (1.57%; Candida spp 5 (1.96%; Candida spp 5 (1.96% and in 23 (9.05% there was no growing.

    Esta pesquisa foi realizada em seis municípios da bacia leiteira de Goiânia tendo sido examinadas 701 vacas lactantes, das quais 87 (12,41% apresentaram mastite clínica e subclínica. Os testes CMT/Whiteside foram realizados em 2.717 amostras de leite, sendo que 393 (14,46% resultaram positivas. Os microrganismos isolados das 701 lactoculturas foram: Staphilococcus aureus 172 (67,70%; Streptococcus spp. 38 (l4,96%; Corynebacterium spp. 42 (16 ,53%; Staphylococcu.s epidermides 38 (14 ,96%; Pseudomonas aeruginosa 21 (8,26%; Eschericheir coli 18 (7,08%; Serratia marceceus 12 (4,72%; Klebsiella spp 5 (1,96%; Proteus vulgaris 4 (1,57%; Candida spp 5 (1,96%; Candida spp 5 (1,96% e em 23 (9,05% não houve crescimento.

  13. The Quadrella: A novel approach to analyzing optimal outcomes after permanent seed prostate brachytherapy

    International Nuclear Information System (INIS)

    Tétreault-Laflamme, Audrey; Zilli, Thomas; Meissner, Aliza; Larrivée, Sandra; Sylvestre, Marie-Pierre; Delouya, Guila

    2014-01-01

    Background and purpose: To study a four-point combined analysis (Quadrella) of optimal outcome among patients treated with exclusive permanent seed prostate brachytherapy (PB), as defined by the likelihood of achieving disease control and preserving normal urinary, gastro-intestinal (GI) and sexual function. Materials and methods: 384 patients with localized prostate cancer underwent PB at our institution with 125 I at a dose level of 144 Gy. Subjects with erectile dysfunction who did not respond to medication were excluded. 281 patients with minimum 3-year follow-up were evaluated. Patients with concurrent biochemical progression-free survival (bPFS), absent urinary and GI toxicities (grade 0 toxicities according to CTCAE v 3.0) and preserved sexual potency (with our without medication) were classified as the Quadrella group. Results: Among the 281 patients analyzed, the Quadrella was achieved in 49.1%, 48.0%, 50.4%, 41.7% and 65.2% in years 3–7, respectively. bPFS rates were 82.6–96.1%, corresponding potency rates were 63.6–82.3%, and normal urinary and GI function rates were 64.8–82.6% and 95–100%, respectively. By multivariate analysis, significant predictors of Quadrella were age (p = 0.015), baseline IPSS (p = 0.03) and time since PB (p = 0.02). Conclusion: Urinary and sexual toxicity remained the most common reasons for excluding patients from a perfect outcome (Quadrella), defined by strict criteria. This analysis can be useful for subsequent comparison between treatment modalities

  14. Synthesis, structural and spectroscopic properties of acentric triple molybdate Cs{sub 2}NaBi(MoO{sub 4}){sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Savina, A.A. [Laboratory of Oxide Systems, Baikal Institute of Nature Management, SB RAS, Ulan-Ude 670047 (Russian Federation); Department of Chemistry, Buryat State University, Ulan-Ude 670000 (Russian Federation); Atuchin, V.V., E-mail: atuchin@isp.nsc.ru [Laboratory of Optical Materials and Structures, Rzhanov Institute of Semiconductor Physics, SB RAS, Novosibirsk 630090 (Russian Federation); Functional Electronics Laboratory, Tomsk State University, Tomsk 634050 (Russian Federation); Laboratory of Semiconductor and Dielectric Materials, Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Solodovnikov, S.F. [Laboratory of Crystal Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, Novosibirsk 630090 (Russian Federation); Department of Natural Sciences, Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Solodovnikova, Z.A. [Laboratory of Crystal Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, Novosibirsk 630090 (Russian Federation); Krylov, A.S. [Laboratory of Molecular Spectroscopy, Kirensky Institute of Physics, SB RAS, Krasnoyarsk 660036 (Russian Federation); Maximovskiy, E.A. [Laboratory of Epitaxial Layers, Nikolaev Institute of Inorganic Chemistry, SB RAS, Novosibirsk 630090 (Russian Federation); Laboratory of Research Methods of Composition and Structure of Functional Materials, Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Molokeev, M.S. [Laboratory of Crystal Structure, Kirensky Institute of Physics, SB RAS, Krasnoyarsk 660036 (Russian Federation); Oreshonkov, A.S [Laboratory of Molecular Spectroscopy, Kirensky Institute of Physics, SB RAS, Krasnoyarsk 660036 (Russian Federation); Department of Photonics and Laser Technology, Siberian Federal University, Krasnoyarsk 660079 (Russian Federation); Pugachev, A.M. [Laboratory of Condenced Matter Spectroscopy, Institute of Automation and Electrometry, SB RAS, Novosibirsk 90, 630090 (Russian Federation); and others

    2015-05-15

    New ternary molybdate Cs{sub 2}NaBi(MoO{sub 4}){sub 3} is synthesized in the system Na{sub 2}MoO{sub 4}–Cs{sub 2}MoO{sub 4}–Bi{sub 2}(MoO{sub 4}){sub 3}. The structure of Cs{sub 2}NaBi(MoO{sub 4}){sub 3} of a new type is determined in noncentrosymmetric space group R3c, a=10.6435(2), c=40.9524(7) Å, V=4017.71(13) Å{sup 3}, Z=12 in anisotropic approximation for all atoms taking into account racemic twinning. The structure is completely ordered, Mo atoms are tetrahedrally coordinated, Bi(1) and Bi(2) atoms are in octahedra, and Na(1) and Na(2) atoms have a distorted trigonal prismatic coordination. The Cs(1) and Cs(2) atoms are in the framework cavities with coordination numbers 12 and 10, respectively. No phase transitions were found in Cs{sub 2}NaBi(MoO{sub 4}){sub 3} up to the melting point at 826 K. The compound shows an SHG signal, I{sub 2w}/I{sub 2w}(SiO{sub 2})=5 estimated by the powder method. The vibrational properties are evaluated by Raman spectroscopy, and 26 narrow lines are measured. - Graphical abstract: - Highlights: • The crystal structure of Cs{sub 2}NaBi(MoO{sub 4}){sub 3} is defined. • The molybdate Cs{sub 2}NaBi(MoO{sub 4}){sub 3} is stable up to melting point at 826 K. • Vibrational properties of Cs{sub 2}NaBi(MoO{sub 4}){sub 3} are evaluated by Raman spectroscopy.

  15. Clinical and biochemical outcomes of men undergoing radical prostatectomy or radiation therapy for localized prostate cancer

    International Nuclear Information System (INIS)

    Schreiber, David; Weiss, Jeffrey P.; Safdieh, Joseph; Weiner, Joseph; Rotman, Marvin; Schwartz, David; Rineer, Justin

    2015-01-01

    We analyzed outcomes of patients with prostate cancer undergoing either radical retropubic prostatectomy (RRP) +/- salvage radiation or definitive radiation therapy (RT) +/- androgen deprivation. From 2003-2010 there were 251 patients who underwent RRP and 469 patients who received RT (> or =7,560 cGy) for prostate cancer. Kaplan-Meier analysis was performed with the log-rank test to compare biochemical control (bCR), distant metastatic-free survival (DMPFS), and prostate cancer-specific survival (PCSS) between the two groups. The median follow-up was 70 months and 61.3% of the men were African American. For low risk disease the 6-year bCR were 90.3% for RT and 85.6% for RRP (p = 0.23) and the 6-year post-salvage bCR were 90.3% vs. 90.9%, respectively (p = 0.84). For intermediate risk disease the 6-year bCR were 82.6% for RT and 59.7% for RRP (p < 0.001) and 82.6% vs. 74.0%, respectively, after including those salvaged with RT (p = 0.06). For high risk disease, the 6-year bCR were 67.4% for RT and 41.3% for RRP (p < 0.001) and after including those salvaged with RT was 67.4% vs. 43.1%, respectively (p < 0.001). However, there were no significant differences between the two groups in regards to DMPFS or PCSS. Treatment approaches utilizing RRP +/- salvage radiation or RT +/- androgen deprivation yielded equivalent DMPFS and PCSS outcomes. Biochemical control rates, using their respective definitions, appeared equivalent or better in those who received treatment with RT.

  16. Increased physical activity improves sleep and mood outcomes in inactive people with insomnia: a randomized controlled trial.

    Science.gov (United States)

    Hartescu, Iuliana; Morgan, Kevin; Stevinson, Clare D

    2015-10-01

    While high levels of activity and exercise training have been associated with improvements in sleep quality, minimum levels of activity likely to improve sleep outcomes have not been explored. A two-armed parallel randomized controlled trial (N=41; 30 females) was designed to assess whether increasing physical activity to the level recommended in public health guidelines can improve sleep quality among inactive adults meeting research diagnostic criteria for insomnia. The intervention consisted of a monitored program of ≥150 min of moderate- to vigorous-intensity physical activity per week, for 6 months. The principal end-point was the Insomnia Severity Index at 6 months post-baseline. Secondary outcomes included measures of mood, fatigue and daytime sleepiness. Activity and light exposure were monitored throughout the trial using accelerometry and actigraphy. At 6 months post-baseline, the physical activity group showed significantly reduced insomnia symptom severity (F(8,26) = 5.16, P = 0.03), with an average reduction of four points on the Insomnia Severity Index; and significantly reduced depression and anxiety scores (F(6,28) = 5.61, P = 0.02; and F(6,28) = 4.41, P = 0.05, respectively). All of the changes were independent of daily light exposure. Daytime fatigue showed no significant effect of the intervention (F(8,26) = 1.84, P = 0.18). Adherence and retention were high. Internationally recommended minimum levels of physical activity improve daytime and night-time symptoms of chronic insomnia independent of daily light exposure levels. © 2015 European Sleep Research Society.

  17. Combination of long noncoding RNA MALAT1 and carcinoembryonic antigen for the diagnosis of malignant pleural effusion caused by lung cancer.

    Science.gov (United States)

    Wang, Wan-Wei; Zhou, Xi-Lei; Song, Ying-Jian; Yu, Chang-Hua; Zhu, Wei-Guo; Tong, Yu-Suo

    2018-01-01

    Long noncoding RNAs (lncRNAs) are present in body fluids, but their potential as tumor biomarkers has never been investigated in malignant pleural effusion (MPE) caused by lung cancer. The aim of this study was to assess the clinical significance of lncRNAs in pleural effusion, which could potentially serve as diagnostic and predictive markers for lung cancer-associated MPE (LC-MPE). RNAs from pleural effusion were extracted in 217 cases of LC-MPE and 132 cases of benign pleural effusion (BPE). Thirty-one lung cancer-associated lncRNAs were measured using quantitative real-time polymerase chain reaction (qRT-PCR). The level of carcinoembryonic antigen (CEA) was also determined. The receiver operating characteristic (ROC) curves and the area under the ROC curve (AUC) were established to evaluate the sensitivity and specificity of the identified lncRNAs and other biomarkers. The correlations between baseline pleural effusion lncRNAs expression and response to chemotherapy were also analyzed. Three lncRNAs ( MALAT1 , H19 , and CUDR ) were found to have potential as diagnostic markers in LC-MPE. The AUCs for MALAT1 , H19 , CUDR , and CEA were 0.891, 0.783, 0.824, and 0.826, respectively. Using a logistic model, the combination of MALAT1 and CEA (AUC, 0.924) provided higher sensitivity and accuracy in predicting LC-MPE than CEA (AUC, 0.826) alone. Moreover, baseline MALAT1 expression in pleural fluid was inversely correlated with chemotherapy response in patients with LC-MPE. Pleural effusion lncRNAs were effective in differentiating LC-MPE from BPE. The combination of MALAT1 and CEA was more effective for LC-MPE diagnosis.

  18. Evaluation of Parathyroidectomy for Secondary and Tertiary Hyperparathyroidism by the Parathyroid Surgeons' Society of Japan.

    Science.gov (United States)

    Tominaga, Yoshihiro; Kakuta, Takatoshi; Yasunaga, Chikao; Nakamura, Michio; Kadokura, Yoshiyuki; Tahara, Hideki

    2016-02-01

    Secondary hyperparathyroidism (SHPT) remains a serious complication in patients with chronic kidney disease, and some patients require parathyroidectomy. The Parathyroid Surgeons' Society of Japan (PSSJ) evaluated parathyroidectomy for SHPT and tertiary hyperparathyroidism (THPT) in Japan. The annual numbers of parathyroidectomies between 2004 and 2013 were evaluated using questionnaires. Since 2010, the PSSJ has registered the patients. In total, 826 patients from 42 institutions were registered. The annual number of parathyroidectomies for SHPT and THPT in Japan increased from 2004 to 2007 and then decreased markedly after 2007, with 296 operations performed in 2013. The number of women and men was almost equal (397/427). Median (interquartile range) age of these patients was 59.0 (24-87) years, the duration of hemodialysis before parathyroidectomy was 10.83 (0.0-38.7) years, and diabetic nephropathy was 87/826 (10.5%). Of these patients 59.6% were treated with cinacalcet at undergoing parathyroidectomy. In 75.3% of patients, a total parathyroidectomy with forearm autograft was performed. In 77.7% of patients, four or more parathyroid glands were removed during the initial operation. The incidences of husky voice and wound hemorrhage were 2.9% and 1.1%, respectively. The number of parathyroidectomies for SHPT in Japan decreased markedly after the introduction of cinacalcet. Based on the evaluation of registered patients, parathyroidectomies have been successfully performed at the institutions participating in the PSSJ. © 2016 The Authors. Therapeutic Apheresis and Dialysis published by John Wiley & Sons Australia, Ltd on behalf of International Society for Apheresis, Japanese Society for Apheresis, and Japanese Society for Dialysis Therapy.

  19. The Bristol Stool Form Scale: its translation to Portuguese, cultural adaptation and validation Traducción, adaptación cultural y validación de la "Bristol Stool Form Scale" Tradução, adaptação cultural e validação da Bristol Stool Form Scale para a população brasileira

    Directory of Open Access Journals (Sweden)

    Anna Paula Martinez

    2012-06-01

    Full Text Available The Bristol Stool Form Scale is used for describing feces. The objective of this research was its translation, cultural adaptation and validation for Brazil. The methodology was translation, back-translation and discussion. Validation involved 85 nurses, 80 doctors, and 80 patients, who correlated images of seven types of feces with the descriptions. Results: there was a difference in sex distribution, with males predominating among the doctors and females among nurses and patients. In relation to concordance between definitions and pictures, the highest percentage was in type 5 in all three groups and the lowest was in types 6 and 7 for the doctors, in type 3 for the nurses, and type 6 for the patients. The general Kappa index was 0.826. Conclusion: the scale demonstrated high reliability for all the groups studied.La "Bristol Stool Form Scale" es usada para describir las heces. Objetivo: traducción, adaptación cultural y la validación para ser utilizada en Brasil. Metodología: Fue realizada la traducción, la traducción inversa y la discusión final. Para validar, se incluyeron 85 enfermeros y 80 médicos y pacientes que correlacionaron diseños de siete tipos de heces con descripciones. Resultados - Hubo diferencia en cuanto a la distribución del sexo con predominio masculino entre los médicos y femenino para los enfermeros y pacientes. Con respecto a la concordancia entre los conceptos y las imágenes, la mayor concordancia fue del tipo 5 en cuanto que el de menor correspondencia para los médicos fueron los tipos 6 y 7, para los enfermeros el 3 y el 6 para los pacientes. El índice de Kappa general fue de 0,826. Conclusión: Los valores obtenidos demuestran la alta confiabilidad de este cuestionario con respecto a los grupos estudiados.A Escala de Bristol para Consistência de Fezes é usada na descrição de fezes. O objetivo deste estudo foi realizar a tradução, adaptação cultural e validação para o Brasil, dessa escala. Como

  20. Reference Values for the Pediatric Quality of Life Inventory and the Multidimensional Fatigue Scale in Adolescent Athletes by Sport and Sex.

    Science.gov (United States)

    Snyder Valier, Alison R; Welch Bacon, Cailee E; Bay, R Curtis; Molzen, Eileen; Lam, Kenneth C; Valovich McLeod, Tamara C

    2017-10-01

    Effective use of patient-rated outcome measures to facilitate optimal patient care requires an understanding of the reference values of these measures within the population of interest. Little is known about reference values for commonly used patient-rated outcome measures in adolescent athletes. To determine reference values for the Pediatric Quality of Life Inventory (PedsQL) and the Multidimensional Fatigue Scale (MFS) in adolescent athletes by sport and sex. Cross-sectional study; Level of evidence, 3. A convenience sample of interscholastic adolescent athletes from 9 sports was used. Participants completed the PedsQL and MFS during one testing session at the start of their sport season. Data were stratified by sport and sex. Dependent variables included the total PedsQL score and the 5 PedsQL subscale scores: physical functioning, psychosocial functioning, emotional functioning, social functioning, and school functioning. Dependent variables for the MFS included 3 subscale scores: general functioning, sleep functioning, and cognitive functioning. Summary statistics were reported for total and subscale scores by sport and sex. Among 3574 males and 1329 female adolescent athletes, the PedsQL scores (100 possible points) generally indicated high levels of health regardless of sport played. Mean PedsQL total and subscales scores ranged from 82.6 to 95.7 for males and 83.9 to 95.2 for females. Mean MFS subscale scores (100 possible points) ranged from 74.2 to 90.9 for males and 72.8 to 87.4 for females. Healthy male and female adolescent athletes reported relatively high levels of health on the PedsQL subscales and total scores regardless of sport; no mean scores were lower than 82.6 points for males or 83.9 points for females. On the MFS, males and females tended to report low effect of general and cognitive fatigue regardless of sport; mean scores were higher than 83.5 points for males and 83.8 points for females. Clinically, athletes who score below the

  1. Multivariate statistical analysis of radioactive variables in two phosphate ores from Sudan

    International Nuclear Information System (INIS)

    Adam, Abdel Majid A.; Eltayeb, Mohamed Ahmed H.

    2012-01-01

    Multivariate statistical techniques are efficient ways to display complex relationships among many objects. An attempt was made to study the radioactive data in two types of Sudanese phosphate deposits; Kurun and Uro phosphate, using several multivariate statistical methods. Pearson correlation coefficient revealed that a U-238 distribution in Kurun phosphate is controlled by the variation of K-40 concentration, whereas in Uro phosphate it is controlled by the variation of U-235 and U-234 concentration. Histograms and normal Q–Q plots clearly show that the radioactive variables did not follow a normal distribution. This non-normality feature observed may be attributed to complicating influence of geological factors. The principal components analysis (PCA) gives a model of five components for representing the acquired data from Kurun phosphate, where 89.5% of the total variance is explained. A model of four components was sufficient to represent the acquired data from Uro phosphate, where 87.5% of the total data variance is explained. The hierarchical cluster analysis (HCA) indicates that U-238 behaves in the same manner in the two types of phosphates; it associated with a group of four radionuclides; U-234, Po-210, Ra-226, Th-230, which the most abundant radionuclides, and all belong to the uranium-238 decay series. Two parameters have been adapted for the direct differentiate between the two phosphates. Firstly, U-238 in Uro phosphate have shown higher degree of mobility (CV% = 82.6) than that in Kurun phosphate (CV% = 64.7), and secondly, the activity ratio of Th-230/Th-232 in Uro phosphate is nine times than that in Kurun phosphate. - Highlights: ► Multivariate statistical techniques were used to characterize radioactive data. ► U-238 in Uro phosphate shows higher degree of mobility (CV% = 82.6). ► U-238 in Kurun phosphate shows lower degree of mobility (CV% = 64.7). ► The radioactive variables did not follow a normal distribution. ► The ratio of Th

  2. Synthesis, characterization and application of electroless metal assisted silicon nanowire arrays

    Energy Technology Data Exchange (ETDEWEB)

    Sahoo, Sumanta Kumar [Centre for Nanoscience & Technology, Department of Mechanical Engineering, Mepco Schlenk Engineering College, Sivakasi 626 005, Tamilnadu (India); Marikani, Arumugam, E-mail: amari@mepcoeng.ac.in [Department of Physics, Mepco Schlenk Engineering College, Sivakasi 626 005, Tamilnadu (India)

    2015-12-01

    Highlights: • Preparation of Silicon nanowire arrays (SiNWs) by electroless metal deposition technique. • From analysis, it has been found that the as-prepared SiNWs are of 3.5–4.0 μm and 75 nm of length and diameter in average respectively. Further a characteristic Raman peak at 520 cm{sup −1} also has been observed. • It exhibits good electron field-emission properties with turn-on field (E{sub 0}) of about 8.26 V μm{sup −1} at current density (J) of 4.9 μA cm{sup −2}. • Functionalized SiNWs have been used for electrochemical detection bovine serum albumin protein bio-molecules. - Abstract: Vertically aligned silicon nanowire arrays (SiNWs) have been synthesized by electroless metal deposition process. The fabricated SiNWs have an average diameter of 75 nm and 3.5–4.0 μm length, as confirmed from scanning electron microscopy. A characteristic asymmetric peak broadening at 520 cm{sup −1} from Raman spectroscopy was obtained for the SiNWs as compared to the bulk silicon crystal due to phonon confinement. The as-prepared SiNWs exhibit good electron field-emission properties with turn-on field of about 8.26 V μm{sup −1} at a current density of 4.9 μA cm{sup −2}. The SiNWs was functionalized by coating with a thin gold metallic film for 60 s, and then used as bio-probe for the detection of bovine serum albumin (BSA) protein molecules. From the linear sweep voltammetry analysis, the Au coated SiNWs, exhibit linear response to the BSA analyte with increase in concentration. The minimum detection limit of the protein molecule was calculated of about 1.16 μM by the as-synthesized SiNWs probe.

  3. Acidentes do trabalho em pescadores artesanais da região do Médio Rio Araguaia, Tocantins, Brasil Work-related accidents in traditional fishermen from the Medium Araguaia River region, Tocantins, Brazil

    Directory of Open Access Journals (Sweden)

    Domingos Garrone Neto

    2005-06-01

    Full Text Available Este é um estudo transversal, com componente retrospectivo, investigando a ocorrência de acidentes do trabalho entre pescadores profissionais artesanais da região do médio Rio Araguaia, Tocantins, Brasil. Entre junho e agosto de 2002, foram entrevistados pescadores do Município de Araguacema, com respeito à organização de suas atividades de trabalho e à ocorrência de acidentes do trabalho nos últimos seis meses. Dos 92 pescadores que participaram do estudo, 56 relataram ter sofrido acidente. A proporção de incidência de acidentes obtida foi de 82,6% ao ano. Cerca de 95,7% dos entrevistados referiram não contribuir regularmente para a Previdência Social e não estarem cientes sobre seus direitos e deveres previdenciários. Entre os pescadores que referiram acidentes, essa proporção foi de 98,2%. Aproximadamente 23,0% dos pescadores estudados relataram possuir outra atividade laboral paralela, principalmente como pedreiro (47,6% e guia de pesca (23,9%. As injúrias por animais do ambiente aquático foram a principal causa de acidente relatada pelos pescadores, perfazendo cerca de 86,0% dos casos. Percebe-se, diante dos resultados, que os acidentes por animais do ambiente aquático são um importante agravo à saúde, provocando, em alguns casos, incapacidade temporária para o trabalho.This is a cross-sectional study of work-related accidents among traditional fishermen in the Medium Araguaia River region of Tocantins, Brazil. From June to August 2002, fishermen from the Municipality of Araguacema were interviewed about the organization of their work activities and work-related accidents during the previous six months. Of the 92 participating fishermen, 56 reported having suffered a work-related accident (annual incidence was 82.6%. Some 95.7% of those interviewed did not regularly pay social security insurance as self-employed workers and were not aware of their social rights and duties. For fishermen reporting accidents, this

  4. Value of fusion of PET and MRI in the detection of intra-pelvic recurrence of gynecological tumor: comparison with 18F-FDG contrast-enhanced PET/CT and pelvic MRI.

    Science.gov (United States)

    Kitajima, Kazuhiro; Suenaga, Yuko; Ueno, Yoshiko; Kanda, Tomonori; Maeda, Tetsuo; Makihara, Natsuko; Ebina, Yasuhiko; Yamada, Hideto; Takahashi, Satoru; Sugimura, Kazuro

    2014-01-01

    To evaluate the diagnostic value of retrospective image fusion from pelvic magnetic resonance imaging (MRI) and 18F-fluorodeoxyglucose positron emission tomography (PET) in detecting intra-pelvic recurrence of gynecological tumor. Thirty patients with a suspicion of recurrence of gynecological malignancy underwent inline contrast-enhanced PET/computed tomography (CT) and pelvic contrast-enhanced MRI for restaging. Diagnostic performance about the local recurrence, pelvic lymph node and bone metastasis and peritoneal lesion of PET/low-dose non-enhanced CT (PET/ldCT), PET/full-dose contrast-enhanced CT (PET/ceCT), contrast-enhanced MRI, and retrospective image fusion from PET and MRI (fused PET/MRI) were evaluated by two experienced readers. Final diagnoses were obtained by histopathological examinations, radiological imaging and clinical follow-up for at least 6 months. McNemar test was employed for statistical analysis. Documented positive locally recurrent disease, pelvic lymph node and bone metastases, and peritoneal dissemination were present in 53.3, 26.7, 10.0, and 16.7%, respectively. Patient-based sensitivity for detecting local recurrence, pelvic lymph node and bone metastasis and peritoneal lesion were 87.5, 87.5, 100 and 80.0%, respectively, for fused PET/MRI, 87.5, 62.5, 66.7 and 60.0%, respectively, for contrast-enhanced MRI, 62.5, 87.5, 66.7 and 80.0%, respectively, for PET/ceCT, and 50.0, 87.5, 66.7 and 60.0%, respectively, for PET/ldCT. The sensitivity of diagnosing local recurrence by fused PET/MRI was significantly better than that of PET/ldCT (p=0.041). The patient-based sensitivity, specificity and accuracy for the detection of intra-pelvic recurrence/metastasis were 91.3, 100 and 93.3% for fused PET/MRI, 82.6, 100 and 86.7% for contrast-enhanced MRI, 82.6, 100 and 86.7% for PET/ceCT and 78.3, 85.7 and 80.0% for PET/ldCT. Fused PET/MRI combines the individual advantages of MRI and PET, and is a valuable technique for assessment of intra

  5. Biodiversity and community composition of sediment macrofauna associated with deep-sea Lophelia pertusa habitats in the Gulf of Mexico

    Science.gov (United States)

    Demopoulos, Amanda W.J.; Bourque, Jill R.; Frometa, Janessy

    2014-01-01

    Scleractinian corals create three-dimensional reefs that provide sheltered refuges, facilitate sediment accumulation, and enhance colonization of encrusting fauna. While heterogeneous coral habitats can harbor high levels of biodiversity, their effect on the community composition within nearby sediments remains unclear, particularly in the deep sea. Sediment macrofauna from deep-sea coral habitats (Lophelia pertusa) and non-coral, background sediments were examined at three sites in the northern Gulf of Mexico (VK826, VK906, MC751, 350–500 m depth) to determine whether macrofaunal abundance, diversity, and community composition near corals differed from background soft-sediments. Macrofaunal densities ranged from 26 to 125 individuals 32 cm−2 and were significantly greater near coral versus background sediments only at VK826. Of the 86 benthic invertebrate taxa identified, 16 were exclusive to near-coral habitats, while 14 were found only in background sediments. Diversity (Fisher’s α) and evenness were significantly higher within near-coral sediments only at MC751 while taxon richness was similar among all habitats. Community composition was significantly different both between near-coral and background sediments and among the three primary sites. Polychaetes numerically dominated all samples, accounting for up to 70% of the total individuals near coral, whereas peracarid crustaceans were proportionally more abundant in background sediments (18%) than in those near coral (10%). The reef effect differed among sites, with community patterns potentially influenced by the size of reef habitat. Taxon turnover occurred with distance from the reef, suggesting that reef extent may represent an important factor in structuring sediment communities near L. pertusa. Polychaete communities in both habitats differed from other Gulf of Mexico (GOM) soft sediments based on data from previous studies, and we hypothesize that local environmental conditions found near L

  6. Compatibilidad entre nueve cepas de Biomphalaria glabrata de áreas endémicas y no endémicas y una cepa de Schistosoma mansoni venezolanas

    Directory of Open Access Journals (Sweden)

    Pino Luz A.

    1999-01-01

    Full Text Available Se infectaron experimentalmente 9 lotes de 32 caracoles B. glabrata (de 5 a 7mm de diámetro con miracidios de la cepa C5 de Schistosoma mansoni a razón de 5 miracidios por caracol, pertenecientes a las siguientes cepas: En el área endémica de transmisión de Esquistosomiasis mansoni a Sector Puerta Negra, Lago Valencia, b Cagua c Ingenio Bolívar (Estado Aragua d Mariara e Caserío El 25 f Güigüe (Estado Carabobo. Fuera del área endémica de transmisión g Anzoátegui (Estado Lara, h Chabasquén (Estado Portuguesa, i Sector La Elvira, Caripe (Estado Monagas. El período prepatente intramolusco, osciló entre 23 y 25 días, para las 9 cepas evaluadas. La duración total de la infección fue muy variable desde 20 días para la cepa Chabasquén, hasta 93 días para la de Güigüe.La producción total promedio de cercarias al tercer día de iniciada la emisión varió desde X = 74,4 para la cepa de Mariara, hasta X = 591,7 para la cepa de Chabasquén. Se evidenció la existencia de diferencias estadísticamente significativas (H = 97,4, P < 0,05 en la producción total de cercarias al tercer día de iniciada la emisión, detectándose diferencias estadísticamente significativas para casi todas las 36 combinaciones, excepto para las cuatro siguientes: Mariara/Ingenio Bolívar, Cagua/Caserío El 25, Lago de Valencia/Güigüe y Güigüe/Caripe.En lo que respecta al porcentaje de caracoles que presentaron cura espontánea, los valores mas elevados se obtuvieron en las cepas del Lago de Valencia (88,8%, Cagua (85,2%, Chabasquén (82,6%, Caripe (82,6% y Anzoátegui (80%. Mientras que el porcentaje mas bajo se obtuvo para la cepa de Güigüe (21,4%.

  7. Physico-chemical characteristics and nutraceutical distribution of crude palm oil and its fractions

    Directory of Open Access Journals (Sweden)

    Prasanth Kumar, P. K.

    2014-06-01

    Full Text Available Crude palm oil (CRPO was dry fractionated at 25 °C to get crude palm olein (CRPOL, 77% and crude palm stearin (CRPS, 23%. Low and high melting crude palm stearin (LMCRPS 14.3% and HMCRPS 8.7% were separated by further fractionation of CRPS with acetone. The physico-chemical parameters and nutraceutical distribution showed variation in different fractions. The CRPO contained 514.7 mg·Kg−1 of β-carotene and 82.6%, 16.1%, 12.5% and 3.1% of it was distributed in CRPOL, CRPS, LMCRPS and HMCRPS respectively. The distribution of phytosterols in fraction was 1870.2, 1996.8, 1190.9, 1290.4 and 115.4 mg·Kg−1 for CRPO, CRPOL, CRPS, LMCRPS and HMCRPS respectively. Total tocopherol composition was 535.5, 587.1, 308.0, 305.6 and 36.2 mg·Kg−1 for CRPO, CRPOL, CRPS, LMCRPS and HMCRPS respectively. The results show that the fractionation of CRPO may be helpful in the preparation of nutraceutical-rich fractions.Aceite de palma crudo (CRPO fue fraccionado en seco a 25 °C para obtener oleína de palma cruda (CRPOL, 77% y estearinas de palma cruda (CRPS, el 23%. Estearinas con bajo y alto punto de fusión (LMCRPS 14,3% y HMCRPS 8,7% se separan por fraccionamiento adicional de CRPS con acetona. Los parámetros físico- químicos y la distribución de nutracéuticos muestra diferencias entre las fracciones. El CRPO contenía 514,7 mg·Kg−1 de β-caroteno y el 82,6%, 16,1%, 12,5% y 3,1% de este se distribuye en CRPOL, CRPS, LMCRPS y HMCRPS respectivamente. Los fitosteroles en las fracciones fue de: 1870,2, 1996,8, 1190.9, 1290,4 y 115,4 mg·Kg−1 para CRPO, CRPOL, CRPS, LMCRPS y HMCRPS respectivamente. La composición total de tocoferol fue 535,5, 587,1 308,0, 305,6 y 36,2 mg·Kg−1, para CRPO, CRPOL, CRPS, LMCRPS y HMCRPS respectivamente. Los resultados mostraron que el fraccionamiento de CRPO puede ser útil en la preparación de fracciones ricas en nutracéuticos.

  8. PENGGUNAAN MEDIA PEMBELAJARAN GAMBAR FOTOGRAFI UNTUK MENINGKATKAN HASIL BELAJAR PADA MATA PELAJARAN ILMU PENGETAHUAN SOSIAL

    Directory of Open Access Journals (Sweden)

    Tustiyana Windiyani

    2018-03-01

    Full Text Available Abstrak Penelitian ini  bertujuan untuk meningkatkan hasil belajar mata pelajaran Ilmu Pengetahuan Sosial siswa kelas V  melalui penggunaan media pembelajaran gambar fotografi. Obyek penelitian ini adalah siswa Sekolah Dasar Negeri Semplak 2 Bogor kelas V yang terdiri dari 30 siswa, dengan komposisi 13 siswa, dan 17 siswi. Hasil penelitian menunjukan bahwa nilai proses pelaksanaan pembelajaran pada siklus pertama memperoleh nilai sebesar 73,5 dan pada siklus kedua meningkat menjadi 85,1. Hasil observasi sikap siswa menunjukan adanya peningkatan pada aktivitas siswa dengan memperoleh nilai pada siklus pertama 82,6 dan siklus kedua memperoleh nilai 89,3. Sementara nilai rata-rata hasil belajar mata pelajaran Ilmu Pengetahuan Sosial  pada siklus pertama memperoleh ketuntasan hasil belajar sebesar 63,3%,hasil belajar siklus kedua memperoleh ketuntasan hasil belajar sebesar 86,7%. Berdasarkan hasil penelitian dapat disimpulkan bahwa penggunaan media pembelajaran gambar fotografi  dapat meningkatkan hasil belajar siswa kelas V di Sekolah Dasar Negeri Semplak 2 Bogor. Selain itu penggunaan media gambar fotografi ini dapat meningkatkan keaktifan, kerjasama, dan kedisiplinan siswa dalam proses pembelajaran.Kata Kunci : Hasil Belajar IPS,  Media Gambar Fotografi.    Abstract     This research is to improve the learning outcomes of Social Science subjects of class V students through the use of photographic learning media. The object of this research is the students of Public Elementary School of Semplak 2 Bogor class V consisting of 30 students, with the composition of 13 students, and 17 female students. The results showed that the value of the learning process implementation in the first cycle obtained a value of 73.5 and in the second cycle increased to 85.1. The result of student attitude observation showed an increase in student activity by obtaining the value in first cycle 82,6 and second cycle get value 89,3. While the average score of

  9. Proceso de elaboración de yogur deslactosado de leche de cabra Processo para elaboração de iogurte deslactosado de leite de cabra

    Directory of Open Access Journals (Sweden)

    Virginia Antonieta Rodriguez

    2008-12-01

    Full Text Available El objetivo de este trabajo fue desarrollar un proceso para la elaboración de yogur deslactosado de leche de cabra, realizando en forma simultánea la hidrólisis de la lactosa y la fermentación. Se utilizaron tres dosis de una β-galactosidasa ácida de origen fúngico (Aspergillus oryzae: 1253, 2506 y 3759 unidades/L, usando como referente una muestra sin enzima. Luego de una incubación de 5 horas a 38 °C y posterior conservación durante 24 horas a 4 °C, se determinaron las concentraciones de glucosa, galactosa, lactosa, pH y acidez titulable. Teniendo en cuenta una concentración de lactosa en leche de 4,42 g.100 mL-1, el mayor porcentaje de hidrólisis obtenido en el yogur (82,6%, p O objetivo deste trabalho foi desenvolver um processo para a elaboração de iogurte deslactosado de leite de cabra, realizando de forma simultânea a hidrólise da lactose e a fermentação. Utilizaram-se três doses de uma β-galactosidase ácida de origem fúngica (Aspergillus oryzae: 1253, 2506 e 3759 unidades/L, usando como referente uma amostra sem enzima. Após uma incubação de 5 horas a 38 °C e posterior conservação durante 24 horas a 4 °C, determinaram-se as concentrações de glicose, galactose, lactose, pH e acidez titulável. Considerando uma concentração de lactose em leite de 4,42 g.100 mL-1, a maior porcentagem de hidrólise obtida no iogurte (82,6%, p < 0,0001 foi conseguida com 2506 unidades/L de enzima, enquanto que sem o agregado de enzima a porcentagem foi de 48,5%. Conclui-se que o processo utilizado permitiria, somente numa etapa, a elaboração de um iogurte que além de ter as propriedades hipoalergênicas e nutricionais próprias do leite de cabra, por seu baixo conteúdo de lactose, se converteria num alimento de características funcionais de grande utilidade para aquelas pessoas que padecem intolerância ao açúcar do leite.

  10. Biodiversity and community composition of sediment macrofauna associated with deep-sea Lophelia pertusa habitats in the Gulf of Mexico

    Science.gov (United States)

    Demopoulos, Amanda W. J.; Bourque, Jill R.; Frometa, Janessy

    2014-11-01

    Scleractinian corals create three-dimensional reefs that provide sheltered refuges, facilitate sediment accumulation, and enhance colonization of encrusting fauna. While heterogeneous coral habitats can harbor high levels of biodiversity, their effect on the community composition within nearby sediments remains unclear, particularly in the deep sea. Sediment macrofauna from deep-sea coral habitats (Lophelia pertusa) and non-coral, background sediments were examined at three sites in the northern Gulf of Mexico (VK826, VK906, MC751, 350-500 m depth) to determine whether macrofaunal abundance, diversity, and community composition near corals differed from background soft-sediments. Macrofaunal densities ranged from 26 to 125 individuals 32 cm-2 and were significantly greater near coral versus background sediments only at VK826. Of the 86 benthic invertebrate taxa identified, 16 were exclusive to near-coral habitats, while 14 were found only in background sediments. Diversity (Fisher's α) and evenness were significantly higher within near-coral sediments only at MC751 while taxon richness was similar among all habitats. Community composition was significantly different both between near-coral and background sediments and among the three primary sites. Polychaetes numerically dominated all samples, accounting for up to 70% of the total individuals near coral, whereas peracarid crustaceans were proportionally more abundant in background sediments (18%) than in those near coral (10%). The reef effect differed among sites, with community patterns potentially influenced by the size of reef habitat. Taxon turnover occurred with distance from the reef, suggesting that reef extent may represent an important factor in structuring sediment communities near L. pertusa. Polychaete communities in both habitats differed from other Gulf of Mexico (GOM) soft sediments based on data from previous studies, and we hypothesize that local environmental conditions found near L. pertusa

  11. Linking objects in the process of mourning for sons disappeared in war: Croatia 2001.

    Science.gov (United States)

    Jurcević, Slavica; Urlić, Ivan

    2002-04-01

    Mothers use linking object to externalize the complex aspects of their relationship to the loss of their child. We analyzed the linking objects that mothers kept in memory of their sons who disappeared in the 1991-1995 war in Croatia or whose remains were uncovered and identified long time after they had gone missing. The case study of disturbed mourning included 26 mothers of Croatian soldiers from Croatian Osijek-Baranja County who went missing in war or whose remains were recovered and identified long after they had gone missing. The mothers were selected independently by the president of the Association of Families of Missing and Detained Croatian Soldiers and agreed to participate in the study in 2001. They were interviewed in their homes, their testimonies were recorded, and photographs of the linking objects taken. Linking objects were classified according to the Volkan's four-group classification. Out of four Volkan's groups of linking objects, we identified the objects belonging to the first three. Those were 1) objects that had been worn by the deceased (clothes, wrist-watch, ring, or glasses), (6/26); 2) objects that could be viewed in the psychoanalytic sense as an extension of the body of the disappeared or dead person, such as a camera (4/26); and 3) objects with realistic or symbolic resemblance to the deceased, usually a photograph (8/26). None of the examined objects belonged to the fourth Volkan's group (objects at hand when the news of the death came or objects present at the funeral, things that could be considered last-minute objects, ie, related to the moment when the deceased was last seen alive). However, 8/26 objects formed a new hitherto undescribed group. Mothers used such objects to create a memorial shrine to their sons. A photograph of the missing person or person whose remains were identified long after he had gone missing occupied a central place at the shrine, and was surrounded by other symbols of the Catholic iconography (Virgin

  12. Francisella guangzhouensis sp. nov., isolated from air-conditioning systems.

    Science.gov (United States)

    Qu, Ping-Hua; Chen, Shou-Yi; Scholz, Holger C; Busse, Hans-Jürgen; Gu, Quan; Kämpfer, Peter; Foster, Jeffrey T; Glaeser, Stefanie P; Chen, Cha; Yang, Zhi-Chong

    2013-10-01

    Four strains (08HL01032(T), 09HG994, 10HP82-6 and 10HL1960) were isolated from water of air-conditioning systems of various cooling towers in Guangzhou city, China. Cells were Gram-stain-negative coccobacilli without flagella, catalase-positive and oxidase-negative, showing no reduction of nitrate, no hydrolysis of urea and no production of H2S. Growth was characteristically enhanced in the presence of l-cysteine, which was consistent with the properties of members of the genus Francisella. The quinone system was composed of ubiquinone Q-8 with minor amounts of Q-9. The polar lipid profile consisted of the predominant lipids phosphatidylethanolamine, diphosphatidylglycerol, phosphatidylglycerol, phosphatidylcholine, two unidentified phospholipids (PL2, PL3), an unidentified aminophospholipid and an unidentified glycolipid (GL2). The polyamine pattern consisted of the major compounds spermidine, cadaverine and spermine. The major cellular fatty acids were C10 : 0, C14 : 0, C16 : 0, C18 : 1ω9c and C18 : 1 3-OH. A draft whole-genome sequence of the proposed type strain 08HL01032(T) was generated. Comparative sequence analysis of the complete 16S and 23S rRNA genes confirmed affiliation to the genus Francisella, with 95 % sequence identity to the closest relatives in the database, the type strains of Francisella philomiragia and Francisella noatunensis subsp. orientalis. Full-length deduced amino acid sequences of various housekeeping genes, recA, gyrB, groEL, dnaK, rpoA, rpoB, rpoD, rpoH, fopA and sdhA, exhibited similarities of 67-92 % to strains of other species of the genus Francisella. Strains 08HL01032(T), 09HG994, 10HP82-6 and 10HL1960 exhibited highly similar pan-genome PCR profiles. Both the phenotypic and molecular data support the conclusion that the four strains belong to the genus Francisella but exhibit considerable divergence from all recognized Francisella species. Therefore, we propose the name Francisella guangzhouensis sp

  13. Hypertension Knowledge, Awareness, and Attitudes in a Hypertensive Population

    Science.gov (United States)

    Oliveria, Susan A; Chen, Roland S; McCarthy, Bruce D; Davis, Catherine C; Hill, Martha N

    2005-01-01

    OBJECTIVE Improved recognition of the importance of systolic blood pressure (SBP) has been identified as one of the major public health and medical challenges in the prevention and treatment of hypertension (HTN). SBP is a strong independent risk factor for cardiovascular disease but no information is available on whether patients understand the importance of their SBP level. The purpose of this study was to assess HTN knowledge, awareness, and attitudes, especially related to SBP in a hypertensive population. DESIGN/SETTING/PATIENTS We identified patients with HTN (N =2,264) in the primary care setting of a large midwestern health system using automated claims data (International Classification of Diseases, Ninth Revision [ICD-9] codes 401.0–401.9). We randomly selected 1,250 patients and, after excluding ineligible patients, report the results on 826 completed patient telephone interviews (72% response rate [826/1,151]). MAIN RESULTS Ninety percent of hypertensive patients knew that lowering blood pressure (BP) would improve health and 91% reported that a health care provider had told them that they have HTN or high BP. However, 41% of patients did not know their BP level. Eighty-two percent of all patients correctly identified the meaning of HTN as “high blood pressure.” Thirty-four percent of patients correctly identified SBP as the “top” number of their reading; 32% correctly identified diastolic blood pressure (DBP) as the “bottom” number; and, overall, only 30% of patients were able to correctly identify both systolic and diastolic BP measures. Twenty-seven percent of patients with elevated SBP and DBP (as indicated by their medical records) perceived that their BP was high. Twenty-four percent of patients did not know the optimal level for either SBP or DBP. When asked whether the DBP or SBP level was more important in the control and prevention of disease, 41% reported DBP, 13% reported SBP, 30% reported that both were important, and 17% did

  14. Epistatic interaction between haplotypes of the ghrelin ligand and receptor genes influence susceptibility to myocardial infarction and coronary artery disease.

    Science.gov (United States)

    Baessler, Andrea; Fischer, Marcus; Mayer, Bjoern; Koehler, Martina; Wiedmann, Silke; Stark, Klaus; Doering, Angela; Erdmann, Jeanette; Riegger, Guenter; Schunkert, Heribert; Kwitek, Anne E; Hengstenberg, Christian

    2007-04-15

    Data from both experimental models and humans provide evidence that ghrelin and its receptor, the growth hormone secretagogue receptor (ghrelin receptor, GHSR), possess a variety of cardiovascular effects. Thus, we hypothesized that genetic variants within the ghrelin system (ligand ghrelin and its receptor GHSR) are associated with susceptibility to myocardial infarction (MI) and coronary artery disease (CAD). Seven single nucleotide polymorphisms (SNPs) covering the GHSR region as well as eight SNPs across the ghrelin gene (GHRL) region were genotyped in index MI patients (864 Caucasians, 'index MI cases') from the German MI family study and in matched controls without evidence of CAD (864 Caucasians, 'controls', MONICA Augsburg). In addition, siblings of these MI patients with documented severe CAD (826 'affected sibs') were matched likewise with controls (n = 826 Caucasian 'controls') and used for verification. The effect of interactions between genetic variants of both genes of the ghrelin system was explored by conditional classification tree models. We found association of several GHSR SNPs with MI [best SNP odds ratio (OR) 1.7 (1.2-2.5); P = 0.002] using a recessive model. Moreover, we identified a common GHSR haplotype which significantly increases the risk for MI [multivariate adjusted OR for homozygous carriers 1.6 (1.1-2.5) and CAD OR 1.6 (1.1-2.5)]. In contrast, no relationship between genetic variants and the disease could be revealed for GHRL. However, the increase in MI/CAD frequency related to the susceptible GHSR haplotype was abolished when it coincided with a common GHRL haplotype. Multivariate adjustments as well as permutation-based methods conveyed the same results. These data are the first to demonstrate an association of SNPs and haplotypes within important genes of the ghrelin system and the susceptibility to MI, whereas association with MI/CAD could be identified for genetic variants across GHSR, no relationship could be revealed for GHRL

  15. Perfil linguístico, familial e do gênero de escolares com diagnóstico de dislexia de uma clínica escola

    Directory of Open Access Journals (Sweden)

    Nathane Sanches Marques Silva

    2014-04-01

    Full Text Available Objetivo traçar o perfil dos pacientes com diagnóstico de dislexia quanto ao gênero, recorrência familial para distúrbios da comunicação ou dificuldade escolar, presença de alteração de linguagem oral e quanto à presença de alteração nas habilidades de memória de trabalho fonológica, memória visual e consciência fonológica na primeira avaliação fonoaudiológica, por meio da análise de prontuários de indivíduos. Métodos foi realizado um estudo transversal retrospectivo por meio de análise de prontuários dos últimos dez anos, no período de 2001 a 2011, em que foram investigadas as histórias clínicas e a primeira avaliação interdisciplinar de pacientes diagnosticados com dislexia. Resultados por meio de uma amostra de 23 prontuários, foi verificado que 82% dos pacientes pertencem a indivíduos do gênero masculino; 60,9% possuíam recorrência familial quanto à presença de familiares com distúrbios da comunicação ou dificuldades escolares; 47,8% dos escolares com diagnóstico de dislexia relataram sofrer de algum tipo de alteração de linguagem oral; 82,6% dos pesquisados possuíam alteração de memória de trabalho fonológica; 82,6% de consciência fonológica e 39,1% de memória visual. Conclusão o perfil dos pacientes diagnosticados com dislexia, na Clínica Escola da instituição de origem, se caracteriza, preferencialmente pelo gênero masculino, pela presença de recorrência familial para distúrbios da comunicação ou dificuldades escolares e por apresentarem alteração de memória de trabalho fonológica e consciência fonológica durante a primeira avaliação fonoaudiológica.

  16. Petrochemical Results for Volcanic Rocks recovered from SHINKAI 6500 diving on the Bonin Ridge (27°15'N-28°25'N): submarine extension of Ogasawara forearc volcanism

    Science.gov (United States)

    Bloomer, S. H.; Kimura, J.; Stern, R. J.; Ohara, Y.; Ishii, T.; Ishizuka, O.; Haraguchi, S.; Machida, S.; Reagan, M.; Kelley, K.; Hargrove, U.; Wortel, M.; Li, Y. B.

    2004-12-01

    Four SHINKAI 6500 submersible dives (dive #823 to #826) were performed along the Bonin Ridge escarpment west of Ogasawara (Bonin) Islands in the West Pacific during May 2004, in the hopes of finding exposures of lower crust of the IBM forearc. The Ogasawara Islands are located on the Bonin ridge, exposing 48-40 Ma boninites on Chichi-jima and depleted arc tholeiite lavas of the same age on Haha-jima. These extremely depleted lavas are believed to have been generated when subduction began beneath the Izu-Bonin-Mariana oceanic arc system. Subsequent rifting (35-30 Ma) formed the Bonin Trough and a 350 km long N-S trending eastern escarpment (Bonin Ridge), where we concentrated our dives. We observed lavas and volcaniclastic sequences by the four SHINKAI dives along the escarpment, and 16 fresh basaltic to andesitic lava samples have been recovered. The first three dives appear to have sampled volcanic constructs, of presumed Oligocene age, along the escarpment, whereas the last dive sampled exposures similar to Eocene rocks of the Bonin islands, including nummulitic limestone. The lava samples were analyzed by ICP-MS at Shimane University for 30 incompatible trace elements. All samples show arc-like chemical signatures, including elevated concentrations of LIL elements, depletions in Ta and Nb, and spikes in Pb, Sr, and Li. All samples show modest enrichments in LREE. A lava sample from the northernmost dive #824 is identical with the depleted tholeiite from Haha-jima Islands at the southernmost end of the Bonin Ridge in terms of trace element characteristics. Other lava samples from northern three dives (#823, #824, #825) have tholeiitic affinities with more elevated highly incompatible elements. This suggests derivation of the series of lavas by different degree of partial melting of a similar source mantle. Samples from southernmost dive site #826, immediately northwest of Chichi-jima Islands, are boninites with U-shaped REE patterns and relatively enriched Zr and

  17. Fumador internado? – A intervenção apropriada

    Directory of Open Access Journals (Sweden)

    Paula Pamplona

    2007-11-01

    Full Text Available Resumo: O tabagismo é a causa de morte evitável mais frequente. Para além de provocar múltiplas doenças causadoras de internamentos, o tabagismo é também uma doença a tratar durante o internamento, não só para controlar a síndroma de abstinência do doente, sujeito a interrupção abrupta, mas também para cumprir a legislação que proíbe o uso de tabaco nos serviços de saúde, única forma eficaz de prevenir a exposição dos não fumadores ao fumo do tabaco presente no ambiente (FTA.Tratar o fumador internado de forma apropriada é também aproveitar a janela de oportunidade para promover a cessação tabágica e não apenas a abstinência temporária.Rev Port Pneumol 2007; XIII (6: 801-826 Abstract: Tobacco use is the most avoidable cause of death. Other than provoking multiple diseases requiring hospitalisation, Tobacco Use is also a disease requiring management in the hospital setting, not only in terms of controlling the withdrawal symptoms of the patient, who has been abruptly prohibited from smoking, but also for fulfilling legislation which prohibits tobacco use in the health services, the only efficient way of preventing exposure of non-smokers to environmental tobacco smoke.Treating the in-patient smoker in an appropriate way also provides a window of opportunity for promoting not just a temporary but a complete smoking cessation.Rev Port Pneumol 2007; XIII (6: 801-826 Palavras-chave: Cessação tabágica, internamento, serviço de saúde sem tabaco, Key-words: Smoking cessation, in-patient, smoke-free hospital

  18. Dynamic MR-mammography in invasive lobular breast cancer; Dynamische MR-Mammographie beim invasiv lobulaeren Mammakarzinom bei 1,0 T

    Energy Technology Data Exchange (ETDEWEB)

    Sittek, H.; Perlet, C.; Kessler, M.; Reiser, M. [Institut fuer Radiologische Diagnostik, Klinikum Grossenhadern, Ludwig-Maximilians-Univ., Muenchen (Germany); Untch, M. [Klinik und Poliklinik fuer Frauenheilkunde und Geburtshilfe, Klinikum Grossenhadern, Ludwig-Maximilians-Univ., Muenchen (Germany)

    1998-12-31

    Material and Methods: We carried out 1505 MR mammographoes in 1357 patients. Biopsy was indicated in 413 cases. Among the malignancies, 23/214 (10%) were ILC. MR-M was performed with a 1.0 T whole body MRI system with a dynamic FLASH-3D sequence. Relative signal enhancement within lesions detected and morphologic pattern of contrast enhancement (mep) were determined. Three types of mep were distinguished: type 1 without contrast enhancement, type 2 with focal contrast enhancement, and type 3 with diffuse contrast enhancement of the glandular body. Results: Within MR-M alone, 19/23 (82.6%) of ILC were detected due to a mep type 2. Four ILC were false negative on MR-M (2 cases show mep type 1 or mep type 3). The sensitivity of Mx alone was 86.9% (20/23). When both Mx and MR-M were combined, all 23 ILC were detected. The addition of MR-M to Mx may increase sensitivity to about 100% in the detection of ILC. (orig.) [Deutsch] Material und Methode: Im Zeitraum 05/1993 bis 06/1996 fuehrten wir bei 1357 Patientinnen 1505 MR-Mammographien durch. In 413 Faellen wurde eine Probeexzision indiziert. Die histologische Untersuchung ergab in 214 Faellen einen malignen Tumor. Darunter befanden sich 23 ILC. Die MR-M wurden an einem 1,0 T MRT-System (Impact, Siemens, Erlangen) mit einer dynamischen FLASH 3D Sequenz durchgefuehrt. Neben dem prozentualen Anstieg der Signalintensitaet innerhalb einer Laesion haben wir fuer die Diagnostik folgende morphologische Befundmuster (BM) unterschieden: Typ 1: Keine Aufnahme, Typ 2: Fokale Aufnahme, Typ 3: Diffuse Aufnahme des Druesenkoerpers in der MR-M. Ergebnisse: Mit der MR-M konnten 19/23 (82,6%) der ILC anhand einer fokalen Zunahme der Signalintensitaet richtig positiv erkannt werden (BM Typ 2). Vier der ILC waren in der MR-M falsch negativ. In zwei Faellen (2/23) war keine Zunahme der Signalintensitaet zu verzeichnen (BM Typ 1). In zwei weiteren Faellen (2/23) maskierte eine diffuse Signalintensitaetszunahme des Druesenkoerpers (BM Typ 3

  19. Operation and control of high power Gyrotrons for ECRH systems in SST-1 and Aditya

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, B.K., E-mail: shukla@ipr.res.in; Bora, D.; Jha, R.; Patel, Jatin; Patel, Harshida; Babu, Rajan; Dhorajiya, Pragnesh; Dalakoti, Shefali; Purohit, Dharmesh

    2016-11-15

    Highlights: • Operation and control of high power Gyrotrons. • Data acquisition and control (DAQ) for Gyrotron system. • Ignitron based crowbar protection. • VME and PXI based systems. - Abstract: The Electron Cyclotron Resonance Heating (ECRH) system is an important heating system for the reliable start-up of tokamak. The 42 GHz and 82.6 GHz ECRH systems are used in tokamaks SST-1 and Aditya to carry out ECRH related experiments. The Gyrotrons are high power microwave tubes used as a source for ECRH systems. The Gyrotron is a delicate microwave tube, which deliver megawatt level power at very high voltage ∼40–50 kV with the current requirement ∼10 A–50 A. The Gyrotrons are associated with the subsystems like: High voltage power supplies (Beam voltage and anode voltage), dedicated crowbar system, magnet, filament and ion pump power supplies, cooling, interlocks and a dedicated data acquisition & control (DAC) system. There are two levels of interlocks used for the protection of Gyrotron: fast interlocks (arcing, beam over current, dI/dt, anode voltage and anode over current etc.) operate within 10 μs and slow interlocks (cooling, filament, silence of Gyrotron, ion pump and magnet currents) operate within 100 ms. Two Gyrotrons (42 GHz/500 kW/500 ms and 82.6 GHz/200 kW/1000 s) have been commissioned on dummy load for full parameters. The 42 GHz ECRH system has been integrated with SST-1 & Aditya tokamak and various experiments have been carried out related to ECRH assisted breakdown and start-up of tokamak at fundamental and second harmonic. These Gyrotrons are operated with VME based data acquisition and control (DAC) system. The DAC system is capable to acquire 64 digital and 32 analog signals. The system is used to monitor & acquire the data and also used for slow interlocks for the protection of Gyrotron. The data acquired from the system are stored online on VME system and after the shot stored in a file in binary format. The MDSPlus, a set of

  20. Prevalence of Pressure Ulcer and Nutritional Factors Affecting Wound Closure Success in Thailand.

    Science.gov (United States)

    Auiwattanakul, Supakrit; Ungpinitpong, Winai; Yutthakasemsunt, Surakrant; Buranapin, Supawan; Chittawatanarat, Kaweesak

    2017-09-01

    The authors aimed to estimate the prevalence of pressure ulcers and to explore the nutritional effects of the prognostic factors on successful pressure ulcer closure in a public tertiary care hospital in Thailand. The study was a retrospective cohort analysis of seven-year census (2008 - 2014) at Surin hospital in Thailand. There were 424 of total 240,826 patients aged over than 15 years admitted to surgery, orthopedics and medicine wards during the study period with documented pressure ulcers (ICD 10TM). We analyzed four hundred and ten patients after excluding 14 patients with non-pressure ulcers (due to burning/ diabetic/ ischemic neuropathic ulcers, and less than 24 hours of admission) and loss medical record. We selected independent factors from demographic data, nutritional factors, pressure ulcer characteristics, and management data. The outcome of interest was successful pressure ulcer closure. The analysis method was the semi-parametric Cox regression model and reported as Hazard Ratios (HR) with 95% confidence interval (95% CI). The total hospital admission was 240,826 patients between 2008 - 2014. 410 patients were developing pressure ulcers, of these, 7% (28/410) success in ulcer closure, and 77% (314/410) failure in closure requiring for additional procedures (excisional debridement). The rest of patients (16%, 68/410) was non-operative care. The prevalence of pressure ulcers was 1.7 per 1,000 person-year. The multivariable model found that only the Nottingham Hospital Screening Tool (NS) score was a statistically significant nutritional variable, and additional subgroup analysis of two models of sepsis and spinal cord co-morbidities was also significant. Adjusted hazard ratios (HR) for NS score = 0.355 (95% CI: 0.187, 0.674), p=0.002), for sepsis = 0.312 (95% CI: 0.140, 0.695), p=0.004), and for spinal cord co-morbidity = 0.420 (95% CI: 0.184, 0.958), p=0.039). The annual prevalence was 1.7 per 1,000 persons. NS score was strongly associated with

  1. Comportamiento de los factores biosociales en la depresión del adulto mayor Behavior of the biosocial factors in the depression of the older adult

    Directory of Open Access Journals (Sweden)

    Víctor T. Pérez Martínez

    2008-09-01

    Full Text Available Se realizó un estudio descriptivo de corte transversal en ancianos de 60 años y más que asistieron, durante el primer cuatrimestre del presente año, a las consultas de psiquiatría del Policlínico "Ana Betancourt", dirigido a determinar la influencia de los factores biosociales en el estado depresivo de nuestros senescentes. Utilizamos la Escala de Hamilton para la Depresión, y se diagnosticó un total de 149 ancianos deprimidos, a los cuales se les aplicó una encuesta de valoración biosocial. Se constató que la depresión predominó en ancianos de 60 a 69 años, del sexo femenino, viudos, jubilados y con un bajo nivel de escolaridad. En un 82,6 % la depresión se presenta simultáneamente con otras enfermedades, destacándose las psicosomáticas, así como los trastornos de ansiedad y el abuso de sustancias desde el punto de vista psicopatológico. El 90,6 % señaló como responsables de su depresión acontecimientos vitales que se traducen en pérdidas para los senescentes. La mayoría de los adultos mayores muestra buenas condiciones de vida, sin embargo, su discreta incorporación a la vida social, así como el insuficiente apoyo socio-familiar contribuyeron notoriamente a su actual depresión.A descriptive cross-sectional study was conducted in individuals aged 60 and over that were attended at the psychiatrist's office in "Ana Betancourt" Policlinic during the first four months of this year in order to detemine the influence of the biosocial factor on the depressive state of our elderly under study. Hamilton's Scale for Depression was used and a total of 149 were diagnosed depression. A biosocial assessment survey was done, and it was confirmed that depression prevailed in the elderly aged 60-69, females, widows, retired and individuals with a low educational level. In 82.6 %, depression appears simultaneously with other diseases, mainly psychomatic, as well as anxiety disorders and the abuse of substances from the

  2. Variación estacional de lípidos en varios tejidos del cambute Strombus gigas (Mesogastropoda: Strombidae, en Quintana Roo, México

    Directory of Open Access Journals (Sweden)

    Nancy Brito Manzano

    1998-09-01

    Full Text Available Se determinó la variación mensual de lípidos en varios tejidos del cambute Strombus gigas (L., en Banco Chinchorro, Quintana Roo, México durante un año. La longitud de la heliconcha fue 209 ± 1 mm, la del cuerpo 137 ± 1 mm, la de la espira 100 ± 1 mm y el peso húmedo total 1 826 ± 7 g. La media del contenido de lípidos en la gónada-glándula digestiva fue 4.27 g% (machos 4.01 g% y hembras 4.50 g%. El contenido de lípidos en gónada-glándula digestiva mostró diferencias sexuales significativas (p Strombus gigas samples were collected in Banco Chinchorro, Quintana Roo, Mexico (18°47'-18°23' N; 87°14' W. Shell, body and spire lenght were measured. Fat content of gonad, digestive gland and meat of male and female conchs, was analyzed by the standard and microsoxhlet methods on a monthly basis for a year. Mean lenght for shell, body and spire were 209 ± 1 mm, 137 ±1 mm and 100 ± 1 mm, respectively. Total wet weigth was 1 826 ± 7 g. Fat content in gonad-digestive gland was 1.27-9.33 g% with a mean of 4.27 g% and in meat 0.41-5.03 g% with a mean of 2.15 g%. Fat content in female gonad-digestive gland was 1.27 g% at 8.57 g% with a mean of 4.50 g%; in male: 1.87 g% at 9.33 g% with a mean of 4.01 g%. Sexes differed (t student P < 0.05. Mean fat content in meat was 2.15 g%, (males 1.97 g%, females 2.3 g%. There was not significant sexual difference for meat fat content. There was a difference between gonad-digestive gland and meat (t student P < 0.05. However, from February to September meat lipid content exceeds the percentage recommended for human consumption by the FAO.

  3. Exame para detecção precoce do câncer cérvico-uterino: vivência de mulheres das cidades de Kobe e Kawasaki, Japão e São Paulo, Brasil Cervical cancer screening: experience of women from Kobe and Kawasaki cities, Japan and São Paulo city, Brazil

    Directory of Open Access Journals (Sweden)

    Rosa Yuka Sato Chubaci

    2005-12-01

    Full Text Available OBJETIVOS: estudar a vivência de mulheres japonesas e mulheres brasileiras descendentes de japoneses, quanto a exame precoce do câncer cérvico-uterino. MÉTODOS: estudo quantitativo, de caráter exploratório, das características das mulheres quanto ao exame Papanicolaou. Participaram do estudo 149 mulheres: 79 japonesas e 70 brasileiras descendentes de japoneses. RESULTADOS: a grande maioria das mulheres (82,6% realizou o exame Papanicolaou, e as brasileiras submeteram-se mais a esse tipo de exame que as japonesas. A maioria das brasileiras (64,6% foi incentivada a fazer o exame pelo seu ginecologista, enquanto 26,2% das japonesas foram motivadas por campanhas de prevenção; maior proporção de japonesas (53,6% teve dificuldade para realizar o exame que as brasileiras (10,8%, sendo a "vergonha" a principal dificuldade relatada pelas japonesas. 48,6% das brasileiras e 31,5% das japonesas atribuíram suas razões para realizar o exame à importância de evitar doenças ginecológicas. CONCLUSÕES: as razões apresentadas pelas mulheres deste estudo para não realizarem o exame de Papanicolaou sugerem aspectos importantes a serem reconsiderados pelos profissionais de saúde que atuam na área da saúde da mulher.OBJECTIVES: this work aimed at studying the experience of Japanese women and Brazilian women from Japanese descent submited theirselves to cervical cancer screening. METHODS: an exploratory quantitative study, was performed intending to know women's characteristics typical of their nationality and their attitude towards the Papanicolaou smear. The number of participants was 149 women, 79 Japanese and 70 Brazilian. RESULTS: the main results showed that the large majority of women (82.6% submitted themselves to the cervical cancer screening. The Brazilian women (92.9% showed a higher participation percentage than the Japanese (73.4% women. The majority of Brazilian women (64.6% were encouraged by their gynecologist to run the

  4. Trends in teenage termination of pregnancy and its risk factors: a population-based study in Finland, 1987-2009.

    Science.gov (United States)

    Leppälahti, S; Gissler, M; Mentula, M; Heikinheimo, O

    2012-09-01

    What are the current trends in teenage termination of pregnancy (TOP) and its risk factors? The incidence of teenage TOP fluctuated substantially during the study period and the incidence of repeat TOP among adolescents increased markedly in the 2000s. Teenage pregnancy is associated with difficulties in psychological, sexual and overall health. The proportion of teenage pregnancies resulting in termination varies by country and time, but only few countries have reliable statistics on TOPs. This nationwide retrospective register study included all the TOPs (n= 52 968) and deliveries (n= 58 882) in Finland between 1987 and 2009 among girls pregnancy. The cohorts were divided into three subgroups; 13-15- (n= 6087), 16-17- (n= 18 826) and 18-19- (n= 28 055) year-olds. After an initial steady decline, the incidence of teenage TOP increased by 44% between 1993 (8.0/1000) and 2003 (11.5/1000), and thereafter declined by 16% until 2009 (9.7/1000). The incidence was higher in older adolescents, but the trends were alike in all age groups. Early TOPs (performed at teenage TOP seems to rapidly reflect changes in national sexual and reproductive health services and policy. The rising rate of repeat TOP is alarming and may represent a sign of marginalization among these girls. All efforts to maintain a low rate of teenage pregnancy are welcomed.

  5. Needs of caregivers of cancer patients: validation of the Mexican version of the Support Person Unmet Needs Survey (SPUNS-SFM).

    Science.gov (United States)

    Doubova, Svetlana V; Aguirre-Hernandez, Rebeca; Infante-Castañeda, Claudia; Martinez-Vega, Ingrid; Pérez-Cuevas, Ricardo

    2015-10-01

    The purpose of this study was to validate the Mexican version of the Support Person Unmet Needs Survey (SPUNS-SFM). A cross-sectional survey that included 826 primary caregivers of cancer patients was conducted from June to December 2013 at the Oncology Hospital of the Mexican Institute of Social Security in Mexico City. The validation procedure comprised (1) content validity through a group of experts; (2) construct validity through an exploratory factor analysis based on the polychoric correlation matrix; (3) internal consistency using Cronbach's alpha; (4) convergent validity between SPUNS-SFM and quality of life, anxiety-and-depression scales by calculating Spearman's rank correlation coefficient;( 5) discriminative validity through the Wilcoxon rank-sum test; and (6) test-retest reliability using intraclass correlation coefficient. SPUNS-SFM has 23 items with six factors accounting for 65 % of the total variance. The domains were concerns about the future, access and continuity of healthcare, information, work and finance, and personal and emotional needs. Cronbach's alpha values ranged from 0.70 to 0.88 among factors. SPUNS-SFM had moderate convergent validity compared with quality of life and depression-and-anxiety scales and good discriminative validity, revealing high needs for younger caregivers and more emotional needs for caregivers of patients with advanced cancer stages. Intraclass correlation coefficient between SPUNS-SFM measurements was 0.78. SPUNS-SFM is a valid and reliable tool to identify needs of caregivers of cancer patients.

  6. Minimal incision surgery in strabismus: Modified fornix-based approach.

    Science.gov (United States)

    Pérez-Flores, I

    2016-07-01

    To evaluate the modified fornix-based technique as an approach for minimal incision surgery in strabismus. The medical records of all consecutive patients that underwent strabismus surgery with fornix-based conjunctival incision between 2007 and 2012 were retrospectively reviewed. As a primary variable, an analysis was made of the wound size depending on the number of stitches. A descriptive study was performed on the variables related to patients and to the type of strabismus and surgery. Out of 153patients identified, 138 with 294 surgeries were included. In 200 (68%) interventions, the incision was sutured with one stitch, in 77 (26.2%) with 2, in 13 (4.4%) with 3, and in 4 (1.4%) with 4, with the mean number of stitches being 1.39±0.64. The mean age of the patients was 39years (2-80), and 36 (26.1%) had previous strabismus surgery, with topical anaesthesia being used in 35 (25.4%) cases. At 3months after surgery deviation was ≤10DP in 114 (82.6%) patients. There were no wound-related complications. The modified fornix-based technique is an effective and safe approach for minimal incision surgery in strabismus, in patients at all ages, with previous history of strabismus surgery and with topical anaesthesia. Copyright © 2015 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.

  7. Milk and dairy consumption and risk of cardiovascular diseases and all-cause mortality

    DEFF Research Database (Denmark)

    Guo, Jing; Astrup, Arne; Lovegrove, Julie A

    2017-01-01

    to September 2016. Random-effect meta-analyses with summarised dose-response data were performed for total (high-fat/low-fat) dairy, milk, fermented dairy, cheese and yogurt. Non-linear associations were investigated using the spine models and heterogeneity by subgroup analyses. A total of 29 cohort studies...... (included sour milk products, cheese or yogurt; per 20 g/day) with mortality (RR 0.98, 95% CI 0.97-0.99; I(2) = 94.4%) and CVD risk (RR 0.98, 95% CI 0.97-0.99; I(2) = 87.5%). Further analyses of individual fermented dairy of cheese and yogurt showed cheese to have a 2% lower risk of CVD (RR 0.98, 95% CI 0.......95-1.00; I(2) = 82.6%) per 10 g/day, but not yogurt. All of these marginally inverse associations of totally fermented dairy and cheese were attenuated in sensitivity analyses by removing one large Swedish study. This meta-analysis combining data from 29 prospective cohort studies demonstrated neutral...

  8. Socioeconomic and Ecological Factors Influencing Aedes aegypti Prevalence, Abundance, and Distribution in Dhaka, Bangladesh

    Science.gov (United States)

    Dhar-Chowdhury, Parnali; Haque, C. Emdad; Lindsay, Robbin; Hossain, Shakhawat

    2016-01-01

    This study examined household risk factors and prevalence, abundance, and distribution of immature Aedes aegypti and Aedes albopictus, and their association with socioeconomic and ecological factors at urban zonal and household levels in the city of Dhaka, Bangladesh. During the 2011 monsoon, 826 households in 12 randomly selected administrative wards were surveyed for vector mosquitoes. Results revealed that the abundance and distribution of immature Ae. aegypti and Ae. albopictus, and pupae-per-person indices did not vary significantly among the zones with varied socioeconomic status. Of 35 different types of identified wet containers, 30 were infested, and among the 23 pupae-positive container types, nine were defined as the “most productive” for pupae including: disposable plastic containers (12.2% of 550), sealable plastic barrels (12.0%), tires (10.4%), abandoned plastic buckets (9.6%), flower tub and trays (8.5%), refrigerator trays (6.5%), plastic bottles (6.4%), clay pots (4.9%), and water tanks (1.6%). When the function of the containers was assessed, ornamental, discarded, and household repairing and reconstruction-related container categories were found significantly associated with the number of pupae in the households. The purpose of storing water and income variables were significant predictors of possession of containers that were infested by vector mosquitoes. PMID:27022149

  9. SRAP analysis of M3 lotus mutants induced by Fe+ ion implantation

    International Nuclear Information System (INIS)

    Jia Yanyan; Deng Chuanliang; Gao Jun; Ren Yingxue; Wang Ningna; Gao Wujun; Lu Longdou; Zhang Tao; Li Pengfei

    2011-01-01

    To examine and determine the lotus mutants induced by the same Fe + ion implantation at the molecular level, the SRAP technique was used, and the non denatured polyacrylamide gel electrophoresis was undertaken to analyze the PCR products. At the optimized SRAP reaction condition, of the 121 primer pairs tested, 10 primer pairs could amplify stable and remarkable specific bands, with primer polymorphism of 8.26%. This 10 primer pairs amplified a total of 215 bands, 83 of which were polymorphic, and the percent of polymorphic bands was 38.6%. A total of 141 bands were amplified for the mutant 1, 22 of which were different from the control with the variation ratio of 15.6%. However, the variation ratios of mutant 2 to 6 were 16.4%, 17.1%, 16.9%, 18.2% and 20.5% respectively. The results indicated that Fe + ion implantation into the seeds of Baiyangdian red lotus could induce random genetic DNA variations. (authors)

  10. Parameters of the CGCS 2000 Ellipsoid and Comparisons with GRS 80 and WGS 84

    Directory of Open Access Journals (Sweden)

    CHENG Pengfei

    2016-02-01

    Full Text Available According to the definition of China Geodetic Coordinate System 2000(CGCS 2000 and defined constants of the ellipsoid adopted by CGCS 2000,the other geometrical and physical parameters of this ellipsoid are derived and compared with that from GRS 80 and WGS 84,respectively.Meanwhile the coordinates and normal gravity on the CGCS 2000 ellipsoid are compared with that on WGS 84 and GRS 80.The difference between the normal gravity on CGCS 2000 ellipsoid and that on GRS 80 is about -143.54×10-8 m/s2,while it is 0.02×10-8 m/s2 compared to WGS 84.The longitudes of a point on these three ellipsoids are the same,but the maximum difference of latitude between CGCS 2000 and GRS 80 is 8.26×10-11 arc seconds,which is about 2.5×10-6 mm,and the maximum difference of latitude between CGCS 2000 and WGS 84 is 3.6×10-6 arc seconds,which is about 0.11 mm.

  11. [Social skills in emergency and critical care professionals of a regional public hospital].

    Science.gov (United States)

    Leal Costa, C; Luján Cebrián, I; Gascón García, J; Ferrer Villalonga, L; Van-der Hofstadt Román, C J

    2010-01-01

    To assess the social skills of health care professionals in the emergency and critical care units of the regional hospital Vega Baja and analyze the association between a series of sociodemographic and professionals variables and social skills. A cross-sectional, descriptive study. Two evaluation tools were used. These included a sociodemographic and professional variables questionnaire, and the Elena Gismero's Social Skills Scale (SSS). A response rate of 82.6% was obtained. Considering the standards made by the author in SSS validation, it can be seen that the sample has obtained a medium-high score in each one of the aspects. Significant differences have been found when considering the sociodemographic variable gender as an independent variable with the complete score of SSS (F=6.555; p=0.013), and with the scale dimensions, self-expression in social situations (F=4.468; p=0.039) and making a demand (F=7.982; p=0.007). In each one of the SSS dimensions, the sample has obtained a slightly higher score than the standard sample and it within the 50-69 percentile. This indicates the existence of a medium-high level of Social Skill. The doctors score higher than the nurses, although these differences are not statistically significant. Copyright © 2010 Elsevier España, S.L. y SEEIUC. All rights reserved.

  12. Aging-driven decomposition in zolpidem hemitartrate hemihydrate and the single-crystal structure of its decomposition products.

    Science.gov (United States)

    Vega, Daniel R; Baggio, Ricardo; Roca, Mariana; Tombari, Dora

    2011-04-01

    The "aging-driven" decomposition of zolpidem hemitartrate hemihydrate (form A) has been followed by X-ray powder diffraction (XRPD), and the crystal and molecular structures of the decomposition products studied by single-crystal methods. The process is very similar to the "thermally driven" one, recently described in the literature for form E (Halasz and Dinnebier. 2010. J Pharm Sci 99(2): 871-874), resulting in a two-phase system: the neutral free base (common to both decomposition processes) and, in the present case, a novel zolpidem tartrate monohydrate, unique to the "aging-driven" decomposition. Our room-temperature single-crystal analysis gives for the free base comparable results as the high-temperature XRPD ones already reported by Halasz and Dinnebier: orthorhombic, Pcba, a = 9.6360(10) Å, b = 18.2690(5) Å, c = 18.4980(11) Å, and V = 3256.4(4) Å(3) . The unreported zolpidem tartrate monohydrate instead crystallizes in monoclinic P21 , which, for comparison purposes, we treated in the nonstandard setting P1121 with a = 20.7582(9) Å, b = 15.2331(5) Å, c = 7.2420(2) Å, γ = 90.826(2)°, and V = 2289.73(14) Å(3) . The structure presents two complete moieties in the asymmetric unit (z = 4, z' = 2). The different phases obtained in both decompositions are readily explained, considering the diverse genesis of both processes. Copyright © 2010 Wiley-Liss, Inc.

  13. Fabrication of highly conductive graphene/ITO transparent bi-film through CVD and organic additives-free sol-gel techniques.

    Science.gov (United States)

    Hemasiri, Bastian Waduge Naveen Harindu; Kim, Jae-Kwan; Lee, Ji-Myon

    2017-12-19

    Indium tin oxide (ITO) still remains as the main candidate for high-performance optoelectronic devices, but there is a vital requirement in the development of sol-gel based synthesizing techniques with regards to green environment and higher conductivity. Graphene/ITO transparent bi-film was synthesized by a two-step process: 10 wt. % tin-doped ITO thin films were produced by an environmentally friendly aqueous sol-gel spin coating technique with economical salts of In(NO 3 ) 3 .H 2 O and SnCl 4 , without using organic additives, on surface free energy enhanced (from 53.826 to 97.698 mJm -2 ) glass substrate by oxygen plasma treatment, which facilitated void-free continuous ITO film due to high surface wetting. The chemical vapor deposited monolayer graphene was transferred onto the synthesized ITO to enhance its electrical properties and it was capable of reducing sheet resistance over 12% while preserving the bi-film surface smoother. The ITO films contain the In 2 O 3 phase only and exhibit the polycrystalline nature of cubic structure with 14.35 ± 0.5 nm crystallite size. The graphene/ITO bi-film exhibits reproducible optical transparency with 88.66% transmittance at 550 nm wavelength, and electrical conductivity with sheet resistance of 117 Ω/sq which is much lower than that of individual sol-gel derived ITO film.

  14. Tracking of ball and players in beach volleyball videos.

    Directory of Open Access Journals (Sweden)

    Gabriel Gomez

    Full Text Available This paper presents methods for the determination of players' positions and contact time points by tracking the players and the ball in beach volleyball videos. Two player tracking methods are compared, a classical particle filter and a rigid grid integral histogram tracker. Due to mutual occlusion of the players and the camera perspective, results are best for the front players, with 74,6% and 82,6% of correctly tracked frames for the particle method and the integral histogram method, respectively. Results suggest an improved robustness against player confusion between different particle sets when tracking with a rigid grid approach. Faster processing and less player confusions make this method superior to the classical particle filter. Two different ball tracking methods are used that detect ball candidates from movement difference images using a background subtraction algorithm. Ball trajectories are estimated and interpolated from parabolic flight equations. The tracking accuracy of the ball is 54,2% for the trajectory growth method and 42,1% for the Hough line detection method. Tracking results of over 90% from the literature could not be confirmed. Ball contact frames were estimated from parabolic trajectory intersection, resulting in 48,9% of correctly estimated ball contact points.

  15. A real-time prediction model for post-irradiation malignant cervical lymph nodes.

    Science.gov (United States)

    Lo, W-C; Cheng, P-W; Shueng, P-W; Hsieh, C-H; Chang, Y-L; Liao, L-J

    2018-04-01

    To establish a real-time predictive scoring model based on sonographic characteristics for identifying malignant cervical lymph nodes (LNs) in cancer patients after neck irradiation. One-hundred forty-four irradiation-treated patients underwent ultrasonography and ultrasound-guided fine-needle aspirations (USgFNAs), and the resultant data were used to construct a real-time and computerised predictive scoring model. This scoring system was further compared with our previously proposed prediction model. A predictive scoring model, 1.35 × (L axis) + 2.03 × (S axis) + 2.27 × (margin) + 1.48 × (echogenic hilum) + 3.7, was generated by stepwise multivariate logistic regression analysis. Neck LNs were considered to be malignant when the score was ≥ 7, corresponding to a sensitivity of 85.5%, specificity of 79.4%, positive predictive value (PPV) of 82.3%, negative predictive value (NPV) of 83.1%, and overall accuracy of 82.6%. When this new model and the original model were compared, the areas under the receiver operating characteristic curve (c-statistic) were 0.89 and 0.81, respectively (P real-time sonographic predictive scoring model was constructed to provide prompt and reliable guidance for USgFNA biopsies to manage cervical LNs after neck irradiation. © 2017 John Wiley & Sons Ltd.

  16. Estereotipos de género y evaluación de candidatos en Estados Unidos: evidencia de una encuesta-experimento

    Directory of Open Access Journals (Sweden)

    Christopher Martínez

    2018-05-01

    Full Text Available Este artículo utiliza un diseño experimental para poner a prueba los efectos de estereotipos de género sobre la evaluación de candidatos. Aleatoriamente, le solicitamos a 826 residentes de EE.UU. leer la descripción de un candidato ficticio: 391 participantes recibieron la descripción de una candidata, mientras 435 leyeron la misma descripción pero de un hombre. Nuestros resultados muestran que los participantes se mostraron más proclives a votar por la mujer, creer que ella comparte sus preocupaciones y creer que ella estaba más capacitada para manejar asuntos como la educación y salud que el hombre. También encontramos que la afinidad partidaria es consistentemente el predictor más importante de la evaluación de candidatos. Interesantemente, los efectos de los estereotipos de género se debilitan solo parcialmente cuando se incluye la variable afinidad partidaria en el análisis.

  17. Fabrikasi Sistem Alat Ukur Temperatur Lapisan Buah Mangga dengan Menggunakan Sensor Waterproof LM35

    Directory of Open Access Journals (Sweden)

    Muhammad Sarif

    2017-03-01

    Full Text Available Telah dibuat sistem alat ukur untuk memonitoring secara real time pada temperatur lapisan buah mangga dan temperatur lingkungan lemari pendingin. Ada tiga lapisan buah mangga yang dimonitoring dengan menggunakan sensor waterproof LM35. ketiga lapisan buah mangga yang dimaksud adalah lapisan 1 lapisan dekat dengan biji buah, lapisan 2 merupakan lapisan daging buah, dan lapisan 3 adalah lapisan di sekitar kulit buah mangga. Sinyal tegangan keluaran probe sensor LM35 dikondisikan dengan penguat tak mebalik yang mengaplikasikan IC OP07. Keluaran dari penguat tak membalik yang berupa data analog selanjutnya diolah menjadi data digital dengan modul mikrokontroler ATMega8535. Data digital hasil pengolahan mikrokontroler ATMega8535 di tampilkan ke unit penampil berupa liquid crystal display (LCD 20x4 karakter. Persamaan karakteristik yang diperoleh dari kalibrasi probe sensor LM35 menunjukkan performa yang sangat baik terlihat dari hasil karakterisasi yang memiliki linieritas tinggi. Persamaan karakteristik yang diperoleh dari masing masing probe sensor LM35 adalah probe sensor 1 dengan V = (9,663T – 6,054 milivolt, probe sensor 2 dengan V = (9,656 T – 2,517 milivolt, probe sensor 3 dengan V = (9,771T – 9,826 milivolt, dan probe sensor 4 dengan V = (9,782T – 8,092 milivolt.

  18. Influence of variable resistance loading on subsequent free weight maximal back squat performance.

    Science.gov (United States)

    Mina, Minas A; Blazevich, Anthony J; Giakas, Giannis; Kay, Anthony D

    2014-10-01

    The purpose of the study was to determine the potentiating effects of variable resistance (VR) exercise during a warm-up on subsequent free-weight resistance (FWR) maximal squat performance. In the first session, 16 recreationally active men (age = 26.0 ± 7.8 years; height = 1.7 ± 0.2 m; mass = 82.6 ± 12.7 kg) were familiarized with the experimental protocols and tested for 1 repetition maximum (1RM) squat lift. The subjects then visited the laboratory on 2 further occasions under either control or experimental conditions. During these conditions, 2 sets of 3 repetitions of either FWR (control) or VR (experimental) squat lifts at 85% of 1RM were performed; during the experimental condition, 35% of the load was generated from band tension. After a 5-minute rest, 1RM, 3D knee joint kinematics, and vastus medialis, vastus lateralis, rectus femoris, and semitendinosus electromyogram (EMG) signals were recorded simultaneously. No subject increased 1RM after FWR, however, 13 of 16 (81%) subjects increased 1RM after VR (mean = 7.7%; p 0.05) or EMG amplitudes (mean = 5.9%; p > 0.05) occurred. Preconditioning using VR significantly increased 1RM without detectable changes in knee extensor muscle activity or knee flexion angle, although eccentric and concentric velocities were reduced. Thus, VR seems to potentiate the neuromuscular system to enhance subsequent maximal lifting performance. Athletes could thus use VR during warm-up routines to maximize squat performance.

  19. Combination of microbial oxidation and biogenic schwertmannite immobilization: A potential remediation for highly arsenic-contaminated soil.

    Science.gov (United States)

    Yang, Zhihui; Wu, Zijian; Liao, Yingping; Liao, Qi; Yang, Weichun; Chai, Liyuan

    2017-08-01

    Here, a novel strategy that combines microbial oxidation by As(III)-oxidizing bacterium and biogenic schwertmannite (Bio-SCH) immobilization was first proposed and applied for treating the highly arsenic-contaminated soil. Brevibacterium sp. YZ-1 isolated from a highly As-contaminated soil was used to oxidize As(III) in contaminated soils. Under optimum culture condition for microbial oxidation, 92.3% of water-soluble As(III) and 84.4% of NaHCO 3 -extractable As(III) in soils were removed. Bio-SCH synthesized through the oxidation of ferrous sulfate by Acidithiobacillus ferrooxidans immobilize As(V) in the contaminated soil effectively. Consequently, the combination of microbial oxidation and Bio-SCH immobilization performed better in treating the highly As-contaminated soil with immobilization efficiencies of 99.3% and 82.6% for water-soluble and NaHCO 3 -extractable total As, respectively. Thus, the combination can be considered as a green remediation strategy for developing a novel and valuable solution for As-contaminated soils. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Predictive accuracy of the PanCan lung cancer risk prediction model - external validation based on CT from the Danish Lung Cancer Screening Trial

    International Nuclear Information System (INIS)

    Winkler Wille, Mathilde M.; Dirksen, Asger; Riel, Sarah J. van; Jacobs, Colin; Scholten, Ernst T.; Ginneken, Bram van; Saghir, Zaigham; Pedersen, Jesper Holst; Hohwue Thomsen, Laura; Skovgaard, Lene T.

    2015-01-01

    Lung cancer risk models should be externally validated to test generalizability and clinical usefulness. The Danish Lung Cancer Screening Trial (DLCST) is a population-based prospective cohort study, used to assess the discriminative performances of the PanCan models. From the DLCST database, 1,152 nodules from 718 participants were included. Parsimonious and full PanCan risk prediction models were applied to DLCST data, and also coefficients of the model were recalculated using DLCST data. Receiver operating characteristics (ROC) curves and area under the curve (AUC) were used to evaluate risk discrimination. AUCs of 0.826-0.870 were found for DLCST data based on PanCan risk prediction models. In the DLCST, age and family history were significant predictors (p = 0.001 and p = 0.013). Female sex was not confirmed to be associated with higher risk of lung cancer; in fact opposing effects of sex were observed in the two cohorts. Thus, female sex appeared to lower the risk (p = 0.047 and p = 0.040) in the DLCST. High risk discrimination was validated in the DLCST cohort, mainly determined by nodule size. Age and family history of lung cancer were significant predictors and could be included in the parsimonious model. Sex appears to be a less useful predictor. (orig.)

  1. Assessment of Domestic Pigs, Wild Boars and Feral Hybrid Pigs as Reservoirs of Hepatitis E Virus in Corsica, France

    Directory of Open Access Journals (Sweden)

    Ferran Jori

    2016-08-01

    Full Text Available In Corsica, extensive pig breeding systems allow frequent interactions between wild boars and domestic pigs, which are suspected to act as reservoirs of several zoonotic diseases including hepatitis E virus (HEV. In this context, 370 sera and 166 liver samples were collected from phenotypically characterized as pure or hybrid wild boars, between 2009 and 2012. In addition, serum and liver from 208 domestic pigs belonging to 30 farms were collected at the abattoir during the end of 2013. Anti-HEV antibodies were detected in 26% (21%–31.6% of the pure wild boar, 43.5% (31%–56.7% of hybrid wild boar and 88% (82.6%–91.9% of the domestic pig sera. In addition, HEV RNA was detected in five wild boars, three hybrid wild boars and two domestic pig livers tested. Our findings provide evidence that both domestic pig and wild boar (pure and hybrid act as reservoirs of HEV in Corsica, representing an important zoonotic risk for Corsican hunters and farmers but also for the large population of consumers of raw pig liver specialties produced in Corsica. In addition, hybrid wild boars seem to play an important ecological role in the dissemination of HEV between domestic pig and wild boar populations, unnoticed to date, that deserves further investigation.

  2. Gene flow and genetic diversity in cultivated and wild cacao (Theobroma cacao) in Bolivia.

    Science.gov (United States)

    Chumacero de Schawe, Claudia; Durka, Walter; Tscharntke, Teja; Hensen, Isabell; Kessler, Michael

    2013-11-01

    The role of pollen flow within and between cultivated and wild tropical crop species is little known. To study the pollen flow of cacao, we estimated the degree of self-pollination and pollen dispersal distances as well as gene flow between wild and cultivated cacao (Theobroma cacao L.). We studied pollen flow and genetic diversity of cultivated and wild cacao populations by genotyping 143 wild and 86 cultivated mature plants and 374 seedlings raised from 19 wild and 25 cultivated trees at nine microsatellite loci. A principal component analysis distinguished wild and cultivated cacao trees, supporting the notion that Bolivia harbors truly wild cacao populations. Cultivated cacao had a higher level of genetic diversity than wild cacao, presumably reflecting the varied origin of cultivated plants. Both cacao types had high outcrossing rates, but the paternity analysis revealed 7-14% self-pollination in wild and cultivated cacao. Despite the tiny size of the pollinators, pollen was transported distances up to 3 km; wild cacao showed longer distances (mean = 922 m) than cultivated cacao (826 m). Our data revealed that 16-20% of pollination events occurred between cultivated and wild populations. We found evidence of self-pollination in both wild and cultivated cacao. Pollination distances are larger than those typically reported in tropical understory tree species. The relatively high pollen exchange from cultivated to wild cacao compromises genetic identity of wild populations, calling for the protection of extensive natural forest tracts to protect wild cacao in Bolivia.

  3. Effect of flour particle size and damaged starch on the quality of cookies.

    Science.gov (United States)

    Barak, Sheweta; Mudgil, Deepak; Khatkar, B S

    2014-07-01

    Two wheat varieties 'C 306' and 'WH 542' were milled to obtain flour fractions of different particle sizes. Various physicochemical parameters such as wet and dry gluten, falling number, solvent retention capacity (SRC), alkaline water retention capacity (AWRC) and damaged starch content of the flour fractions were analyzed. The damaged starch values ranged from 5.14% to 14.79% for different flour fractions and increased significantly with decrease in particle size. AWRC and SRC of the flour fractions also increased with decrease in particle size. AWRC(r = 0.659) showed positive correlation and cookie spread ratio (r = -0.826) was strongly negatively correlated with the damaged starch levels. Hardness of the cookies in term of compression force showed increasing trend as damaged starch of the flour fractions increased. Spread ratio of the cookies ranged from 6.72 to 10.12. Wheat flour of particle size greater than 150 μm produced cookies with best quality.

  4. Assessment of the Effectiveness of Environmental Dredging in South Lake, China

    Science.gov (United States)

    Wang, Xiao Yu; Feng, Jiang

    2007-08-01

    Environmental dredging is a primary remedial option for removal of the contaminated material from aquatic environment. Of primary concern in environmental dredging is the effectiveness of the intended sediment removal. A 5-year field monitoring study was conducted to assess the effectiveness of the environmental dredging in South Lake, China. The concentrations of total nitrogen (TN), total phosphors, and heavy metals (Zn, Pb, Cd, Cu, Cr, Ni, Hg, and As) before and after dredging in sediment were determined and compared. Multiple ecological risk indices were employed to assess the contamination of heavy metals before and after dredging. Our results showed that the total phosphorus levels reduced 42% after dredging. Similar changes for Hg, Zn, As Pb, Cd, Cu, Cr, and Ni were observed, with reduction percentages of 97.0, 93.1, 82.6, 63.9, 52.7, 50.1, 32.0, and 23.6, respectively, and the quality of sediment improved based on the criterion of Sediment Quality Guidelines by USEPA and contamination degree values (Cd) decreased significantly (paired t-test, p heavy metals from South Lake. Nevertheless, the dredging was ineffective to remove total nitrogen from sediment. We conclude that the reason for the observed increase in TN after dredging was likely ammonia release from the sediment impairing the dredging effectiveness.

  5. Direct medical costs of motorcycle crashes in Ontario.

    Science.gov (United States)

    Pincus, Daniel; Wasserstein, David; Nathens, Avery B; Bai, Yu Qing; Redelmeier, Donald A; Wodchis, Walter P

    2017-11-20

    There is no reliable estimate of costs incurred by motorcycle crashes. Our objective was to calculate the direct costs of all publicly funded medical care provided to individuals after motorcycle crashes compared with automobile crashes. We conducted a population-based, matched cohort study of adults in Ontario who presented to hospital because of a motorcycle or automobile crash from 2007 through 2013. For each case, we identified 1 control absent a motor vehicle crash during the study period. Direct costs for each case and control were estimated in 2013 Canadian dollars from the payer perspective using methodology that links health care use to individuals over time. We calculated costs attributable to motorcycle and automobile crashes within 2 years using a difference-in-differences approach. We identified 26 831 patients injured in motorcycle crashes and 281 826 injured in automobile crashes. Mean costs attributable to motorcycle and automobile crashes were $5825 and $2995, respectively ( p motorcycle crashes compared with automobile crashes (2194 injured annually/100 000 registered motorcycles v. 718 injured annually/100 000 registered automobiles; incidence rate ratio [IRR] 3.1, 95% confidence interval [CI] 2.8 to 3.3, p motorcycles v. 12 severe injuries annually/100 000 registered automobiles; IRR 10.4, 95% CI 8.3 to 13.1, p motorcycle in Ontario costs the public health care system 6 times the amount of each registered automobile. Medical costs may provide an additional incentive to improve motorcycle safety. © 2017 Joule Inc. or its licensors.

  6. Effects of Bi(Zn2/3Nb1/3)O3 Modification on the Relaxor Behavior and Piezoelectricity of Pb(Mg1/3Nb2/3)O3-PbTiO3 Ceramics.

    Science.gov (United States)

    Liu, Zenghui; Wu, Hua; Paterson, Alisa; Ren, Wei; Ye, Zuo-Guang

    2017-10-01

    Relaxor lead magnesium niobate (PMN)-based materials exhibit complex structures and unusual properties that have been puzzling researchers for decades. In this paper, a new ternary solid solution of Pb(Mg 1/3 Nb 2/3 )O 3 -PbTiO 3 -Bi(Zn 2/3 Nb 1/3 )O 3 (PMN-PT-BZN) is prepared in the form of ceramics, and the effects of the incorporation of BZN into the PMN-PT binary system are investigated. The crystal structure favors a pseudocubic symmetry and the relaxor properties are enhanced as the concentration of BZN increases. The relaxor behavior and the related phase transformations are studied by dielectric spectroscopy. A phase diagram mapping out the characteristic temperatures and various states is established. Interestingly, the piezoelectricity of the PMN-PT ceramics is significantly enhanced by the BZN substitution, with an optimal value of d 33 reaching 826 pC/N for 0.96[0.7Pb(Mg 1/3 Nb 2/3 )O 3 -0.3PbTiO 3 ]-0.04Bi(Zn 2/3 Nb 1/3 )O 3 . This paper provides a better understanding of the relaxor ferroelectric behavior, and unveils a new relaxor-based ternary system as piezoelectric materials potentially useful for electromechanical transducer applications.

  7. Targeted next-generation sequencing at copy-number breakpoints for personalized analysis of rearranged ends in solid tumors.

    Directory of Open Access Journals (Sweden)

    Hyun-Kyoung Kim

    Full Text Available BACKGROUND: The concept of the utilization of rearranged ends for development of personalized biomarkers has attracted much attention owing to its clinical applicability. Although targeted next-generation sequencing (NGS for recurrent rearrangements has been successful in hematologic malignancies, its application to solid tumors is problematic due to the paucity of recurrent translocations. However, copy-number breakpoints (CNBs, which are abundant in solid tumors, can be utilized for identification of rearranged ends. METHOD: As a proof of concept, we performed targeted next-generation sequencing at copy-number breakpoints (TNGS-CNB in nine colon cancer cases including seven primary cancers and two cell lines, COLO205 and SW620. For deduction of CNBs, we developed a novel competitive single-nucleotide polymorphism (cSNP microarray method entailing CNB-region refinement by competitor DNA. RESULT: Using TNGS-CNB, 19 specific rearrangements out of 91 CNBs (20.9% were identified, and two polymerase chain reaction (PCR-amplifiable rearrangements were obtained in six cases (66.7%. And significantly, TNGS-CNB, with its high positive identification rate (82.6% of PCR-amplifiable rearrangements at candidate sites (19/23, just from filtering of aligned sequences, requires little effort for validation. CONCLUSION: Our results indicate that TNGS-CNB, with its utility for identification of rearrangements in solid tumors, can be successfully applied in the clinical laboratory for cancer-relapse and therapy-response monitoring.

  8. Targeted next-generation sequencing at copy-number breakpoints for personalized analysis of rearranged ends in solid tumors.

    Science.gov (United States)

    Kim, Hyun-Kyoung; Park, Won Cheol; Lee, Kwang Man; Hwang, Hai-Li; Park, Seong-Yeol; Sorn, Sungbin; Chandra, Vishal; Kim, Kwang Gi; Yoon, Woong-Bae; Bae, Joon Seol; Shin, Hyoung Doo; Shin, Jong-Yeon; Seoh, Ju-Young; Kim, Jong-Il; Hong, Kyeong-Man

    2014-01-01

    The concept of the utilization of rearranged ends for development of personalized biomarkers has attracted much attention owing to its clinical applicability. Although targeted next-generation sequencing (NGS) for recurrent rearrangements has been successful in hematologic malignancies, its application to solid tumors is problematic due to the paucity of recurrent translocations. However, copy-number breakpoints (CNBs), which are abundant in solid tumors, can be utilized for identification of rearranged ends. As a proof of concept, we performed targeted next-generation sequencing at copy-number breakpoints (TNGS-CNB) in nine colon cancer cases including seven primary cancers and two cell lines, COLO205 and SW620. For deduction of CNBs, we developed a novel competitive single-nucleotide polymorphism (cSNP) microarray method entailing CNB-region refinement by competitor DNA. Using TNGS-CNB, 19 specific rearrangements out of 91 CNBs (20.9%) were identified, and two polymerase chain reaction (PCR)-amplifiable rearrangements were obtained in six cases (66.7%). And significantly, TNGS-CNB, with its high positive identification rate (82.6%) of PCR-amplifiable rearrangements at candidate sites (19/23), just from filtering of aligned sequences, requires little effort for validation. Our results indicate that TNGS-CNB, with its utility for identification of rearrangements in solid tumors, can be successfully applied in the clinical laboratory for cancer-relapse and therapy-response monitoring.

  9. Effects of different brazing and welding methods on the fracture load of various orthodontic joining configurations.

    Science.gov (United States)

    Bock, Jens J; Bailly, Jacqueline; Fuhrmann, Robert A

    2009-06-01

    The aim of this study was to compare the fracture load of different joints made by conventional brazing, tungston inert gas (TIG) and laser welding. Six standardized joining configurations of spring hard quality orthodontic wire were investigated: end-to-end, round, cross, 3 mm length, 9 mm length and 6.5 mm to orthodontic band. The joints were made by five different methods: brazing with universal silver solder, two TIG and two laser welding devices. The fracture loads were measured with a universal testing machine (Zwick 005). Data were analysed with the Mann-Whitney-Wilcoxon and Kruskal-Wallis tests. The significance level was set at Pwelding (Pwelding (826 N). No differences between the various TIG or laser welding devices were demonstrated, although it was not possible to join an orthodontic wire to an orthodontic band using TIG welding. For orthodontic purposes laser and TIG welding are solder free alternatives. TIG welding and laser welding showed similar results. The laser technique is an expensive, but sophisticated and simple method.

  10. The role of Effective Supervision on academic performance of Senior High Schools in Ghana

    Directory of Open Access Journals (Sweden)

    Vera Rosemary Ankoma-Sey

    2016-04-01

    Full Text Available In all facets of life, supervision has become a cross-cutting edge tool and a pivot around which performance revolves. There are widespread and on-going debates centred on the influence of effective supervision on academic performance in our academic institutions. This study examined the role of supervision on academic performance in Senior High Schools (SHS in Ghana. The study was based on the collegial model of educational management and the supervision model, Theory Y as proposed by Douglas McGregor. This study employed the descriptive research survey design. Through a questionnaire, data analysed was collected from 963 respondents who were purposively selected from randomised schools in each region comprising of headmasters, their assistants and heads of department of 155 SHSs across Ghana. The WAEC results (2006-2009 and 2011 of the sampled schools were analysed. Reliability coefficient of the questionnaire was Cronbach’s alpha (α = 0.826. The Statistical Product and Service Solutions (SPSS version 18 software was employed in the analyses of data using, mean, standard deviation, correlation and independent t-test. The study revealed that there was a positive weak significant relationship between supervision roles of heads and academic performance of students. Moreso, there was a positive weak significant relationship between gender of heads and their supervision roles. The study recommended that supervision should be intensified in SHS. Heads of SHS should be re-orientated in the new trends of supervision in schools.

  11. PENGGUNAAN MULTIMEDIA INTERAKTIF DALAM PEMBELAJARAN BAHASA INGGRIS (STUDI KASUS DI SDN 3 TARUBASAN KLATEN

    Directory of Open Access Journals (Sweden)

    Suryanti Galuh Pravitasari

    2018-01-01

    Full Text Available Penelitian ini bertujuan untuk mencari tahu apakah penggunaan multimedia interaktif memberikan pengaruh yang cukup signifikan terhadap keberhasilan proses pembelajaran Bahasa Inggris. Penelitian ini dilaksanakan di kelas III SDN 3 Tarubasan, Klaten. Penelitian ini termasuk ke dalam kelompok Penelitian Tindakan kelas yang dilaksanakan dalam dua siklus. Masing-masing siklus dilaksankan dalam lima kali pertemuan sesuai dengan jumlah materi yang harus diselesaikan pada semester genap 2015/2016. Sebelum penggunaan multimedia interaktif diberlakukan, subyek penelitian diberi sebuah pre-test untuk mengetahui bekal awal sebelum perlakuan. Nilai rata-rata dari pre-test adalah 68,7 dengan hanya 3 subyek penelitian yang sudah memenuhi batas minimal KKM yang sebesar 69. Pada akhir Siklus I diperoleh nilai rata-rata 70,7 dengan jumlah subyek yang memiliki nilai di atas  KKM sebesar 61.5% dari total subyek yang diteliti. Pada Siklus II nilai rata-rata meningkat ke angka 82,6 sehingga terjadi peningkatan sebesar 11,9 point dari Siklus I ke Siklus II dan sebesar 13,9 poin. Seluruh subyek penelitian di akhir pelaksanaan Siklus II mendapat nilai yang sudah melampaui batas KKM. Dengan demikian dapat disimpulkan bahwa penggunaan multimedia interaktf terbukti memberikan pengaruh yang positif terhadap keberhasilan proses pembelajaran.

  12. A Linguistic Inquiry and Word Count Analysis of the Adult Attachment Interview in Two Large Corpora.

    Science.gov (United States)

    Waters, Theodore E A; Steele, Ryan D; Roisman, Glenn I; Haydon, Katherine C; Booth-LaForce, Cathryn

    2016-01-01

    An emerging literature suggests that variation in Adult Attachment Interview (AAI; George, Kaplan, & Main, 1985) states of mind about childhood experiences with primary caregivers is reflected in specific linguistic features captured by the Linguistic Inquiry Word Count automated text analysis program (LIWC; Pennebaker, Booth, & Francis, 2007). The current report addressed limitations of prior studies in this literature by using two large AAI corpora ( N s = 826 and 857) and a broader range of linguistic variables, as well as examining associations of LIWC-derived AAI dimensions with key developmental antecedents. First, regression analyses revealed that dismissing states of mind were associated with transcripts that were more truncated and deemphasized discussion of the attachment relationship whereas preoccupied states of mind were associated with longer, more conflicted, and angry narratives. Second, in aggregate, LIWC variables accounted for over a third of the variation in AAI dismissing and preoccupied states of mind, with regression weights cross-validating across samples. Third, LIWC-derived dismissing and preoccupied state of mind dimensions were associated with direct observations of maternal and paternal sensitivity as well as infant attachment security in childhood, replicating the pattern of results reported in Haydon, Roisman, Owen, Booth-LaForce, and Cox (2014) using coder-derived dismissing and preoccupation scores in the same sample.

  13. Constraints on cold dark matter theories from observations of massive x-ray-luminous clusters of galaxies at high redshift

    Science.gov (United States)

    Luppino, G. A.; Gioia, I. M.

    1995-01-01

    During the course of a gravitational lensing survey of distant, X-ray selected Einstein Observatory Extended Medium Sensitivity Survey (EMSS) clusters of galaxies, we have studied six X-ray-luminous (L(sub x) greater than 5 x 10(exp 44)(h(sub 50)(exp -2))ergs/sec) clusters at redshifts exceeding z = 0.5. All of these clusters are apparently massive. In addition to their high X-ray luminosity, two of the clusters at z approximately 0.6 exhibit gravitationally lensed arcs. Furthermore, the highest redshift cluster in our sample, MS 1054-0321 at z = 0.826, is both extremely X-ray luminous (L(sub 0.3-3.5keV)=9.3 x 10(exp 44)(h(sub 50)(exp -2))ergs/sec) and exceedingly rich with an optical richness comparable to an Abell Richness Class 4 cluster. In this Letter, we discuss the cosmological implications of the very existence of these clusters for hierarchical structure formation theories such as standard Omega = 1 CDM (cold dark matter), hybrid Omega = 1 C + HDM (hot dark matter), and flat, low-density Lambda + CDM models.

  14. Frozen shoulder : long-term outcome following arthrographic distension.

    Science.gov (United States)

    Clement, Rhys G E; Ray, Andrew G; Davidson, Colin; Robinson, C Mike; Perks, Fergus J

    2013-08-01

    Arthrographic distension of the glenohumeral joint was adopted as a mainstream treatment for frozen shoulder before any randomised controlled trials were performed. Interpretation of the effectiveness of this procedure rests mostly on data from cohort studies of which there are few of high quality. Papers reporting long-term results have either excluded diabetic patients or failed to report patient orientated outcomes. The authors present a long-term prospective cohort study of 51 patients (12 diabetics and 39 non-diabetics), with 53 frozen shoulders, who had an arthrographic distension performed by a single radiologist as a primary intervention. Oxford shoulder score (OSS), visual analogue pain score (VAS), and range of movement (ROM) were recorded pre-distension, at 2 days and 1 month post-distension. OSS and VAS were recorded again at a mean of 14 months post distension (range : 8-26 months). OSS improved from a pre-distension mean of 22.3 by 16.9 points at final follow-up (p diabetic patients was the same as in non-diabetic patients. Arthrographic distension is a safe and effective treatment for frozen shoulder; it is also effective in diabetic patients. It gives long-term improvement. The authors believe that the low number of patients requiring a secondary procedure makes arthrographic distension preferable to manipulation under anaesthesia.

  15. Survey of cognitive rehabilitation practices in the state of Kuwait.

    Science.gov (United States)

    Manee, Fahad S; Nadar, Mohammed Sh; Jassem, Zainab; Chavan, Shashidhar Rao

    2017-03-01

    Background Rehabilitation professionals must be astute at recognizing, assessing, and treating individuals with cognitive deficits. No research is available to examine cognitive rehabilitation practices applied to individuals with neurological conditions in Kuwait. To identify the use of cognitive assessments, the availability of resources, and the barriers to cognitive rehabilitation practices in Kuwait. Methods Face-to-face interviews were conducted with health care professionals working with adult individuals with neurological conditions. These professionals included occupational therapists, speech-language pathologists, psychiatrists, and neurologists. Results The most commonly used cognitive based assessments are MMSE (41%), and MoCA and LOTCA (15.2%). The only clinical assessment used is the Line-Bisection Test (2.2%). The most used occupation-based assessments are FIM (6.5%), COPM (4.3%), the Interest Checklist (2.2%), and the Barthel Index (2.2%). Resources related to cognitive rehabilitation in Kuwait that are unavailable to practitioners include journal clubs (91%), special interest groups (89%), and continuing education programmes (82.6%). Barriers to cognitive rehabilitation practice included lack of sufficient funds for continuing education, lack of time, lack of standardized assessments, and lack of inter-professional teamwork. Conclusion Many adults in Kuwait live with cognitive impairment. There is a need to develop appropriate evidence-based cognitive rehabilitation clinical guidelines in Kuwait.

  16. An investigation into mechanical strength of exoskeleton of hydrothermal vent shrimp (Rimicaris exoculata) and shallow water shrimp (Pandalus platyceros) at elevated temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Verma, Devendra; Tomar, Vikas, E-mail: tomar@purdue.edu

    2015-04-01

    This investigation reports a comparison of the exoskeleton mechanical strength of deep sea shrimp species Rimicaris exoculata and shallow water shrimp species Pandalus platyceros at temperatures ranging from 25 °C to 80 °C using nanoindentation experiments. Scanning Electron Microscopy (SEM) observations suggest that both shrimp exoskeletons have the Bouligand structure. Differences in the structural arrangement and chemical composition of both shrimps are highlighted by SEM and EDX (Energy Dispersive X-ray) analyses. The variation in the elastic moduli with temperature is found to be correlated with the measured compositional differences. The reduced modulus of R. exoculata is 8.26 ± 0.89 GPa at 25 °C that reduces to 7.61 ± 0.65 GPa at 80 °C. The corresponding decrease in the reduced modulus of P. platyceros is from 27.38 ± 2.3 GPa at 25 °C to 24.58 ± 1.71 GPa at 80 °C. The decrease in reduced moduli as a function of temperature is found to be dependent on the extent of calcium based minerals in exoskeleton of both types of shrimp exoskeletons. - Highlights: • Shrimp species Pandalus platyceros and Rimicaris exoculata exoskeletons are analyzed. • Temperature dependent properties of shrimp exoskeleton are compared. • Mechanical properties are correlated with structure and composition of exoskeleton. • Mechanical properties reduce with increase in temperature. • Presence of biominerals gives better thermal stability to structure.

  17. Differences in Urinary Arsenic Metabolites between Diabetic and Non-Diabetic Subjects in Bangladesh

    Directory of Open Access Journals (Sweden)

    Tamie Nakajima

    2013-03-01

    Full Text Available Ingestion of inorganic arsenic (iAs is considered to be related to the development of diabetes mellitus. In order to clarify the possible differences in the metabolism in diabetics, we measured urinary iAs metabolites in diabetic cases and non-diabetic control subjects in Faridpur, an arsenic-contaminated area in Bangladesh. Physician-diagnosed type 2 diabetic cases (140 persons and non-diabetic controls (180 persons were recruited. Drinking water and spot urine samples were collected. Mean concentrations of total arsenic in drinking water did not differ between cases (85.1 μg/L and controls (85.8 μg/L. The percentage of urinary iAs (iAs% was significantly lower in cases (8.6% than in controls (10.4%, while that of dimethylarsinic acid (DMA% was higher in cases (82.6% than in controls (79.9%. This may have been due to the higher secondary methylation index (SMI in the former (11.6 rather than the latter (10.0. Adjusting for matching factors (sex and unions, and the additional other covariates (age and water arsenic significantly attenuated the differences in iAs%, SMI, and DMA%, respectively, though the difference in monomethylarsonic acid% was newly significant in the latter adjustment. Our study did not suggest any significant differences in urinary arsenic metabolites between diabetic and non-diabetic subjects.

  18. Relaxation dynamics of the LH2 complex from a photosynthetic purple bacterium Thiorhodospira sibirica studied by the near-IR femtosecond pump-probe method

    International Nuclear Information System (INIS)

    Razjivin, A P; Pishchal'nikov, R Yu; Kozlovskii, V S; Kompanets, V O; Chekalin, Sergei V; Moskalenko, A A; Makhneva, Z K

    2005-01-01

    Photoinduced changes in the absorption spectrum of the LH2 (B800-830-850) complex from a Thiorhodospira sibirica (Trs. sibirica) bacterium are studied by the pump-probe method. The complex has the anomalous absorption spectrum exhibiting three bands in the near-IR region at 793, 826.5, and 846.5 nm. At room temperature, the excitation energy transfer from the B800, B830, and B859 bands was detected with the time constants τ 1 ∼0.5 ps, τ 2 ∼2.5 ps, and τ 3 of the order of a few hundreds of picoseconds, respectively. A rapid energy transfer from the B830 band compared to energy transfer from the B850 band (τ 2 ||τ 3 ) suggests that all the three bands belong to the same complex (i.e., that the LH2 complex from Trs. sibirica is homogeneous). A slower energy transfer (by three - five times) from the B830 band of the LH2 complex from Trs. sibirica compared to energy transfer from the B800 band of the LH2 complexes (B800-850 and especially B800-820) from other purple bacteria suggests that the electronic structures of ensembles of bacteriochlorophyll molecules in these complexes are substantially different. (laser applications and other topics in quantum electronics)

  19. ECOLOGICAL STUDY IN TWO QUARRIED LIMESTONE KARST HILLS IN BOGOR WEST JAVA: VEGETATION STRUCTURE AND FLORISTIC COMPOSITION

    Directory of Open Access Journals (Sweden)

    ANNISA SATYANTI

    2010-10-01

    Full Text Available Many species extinctions have probably gone unnoticed on limestone that was destroyed before they could be sampled. Unless biodiversity surveys are intensified, the true magnitude of extinctions will never be ascertained. The objectives of this study were to determine tree species composition of limestone hills in Nyungcung and Ciampea; to determine quantitatively the dominant and less dominant species and to quantify floristic structure of the two limestone hills. Value of richness (Menhinick and evenness in Nyungcung were 3.28 and 0.826 whilst in Ciampea were 3.29 and 0.823, respectively. In term of diversity (Shannon Wiener, Nyungcung seems to be more diverse than Ciampea as indicated by the higher value of diversity index. Nyungcung has 3.225 of diversity (Shannon Wiener index while Ciampea has 2.859. The floristic composition of two sites was significantly different and mostly comprised Moraceae, Rubiaceae, and Euphorbiaceae. However, the highest presence of species were Antidesma montanum (Euphorbiaceae and Chrysophyllum lanceolatum (Sapotaceae, and Pandanus sp. (Pandanaceae in Nyungcung, whereas in Ciampea, Harpullia arborea (Sapindaceae, Ophiorhhiza canescens (Rubiaceae, and Allophyllus cobbe (Sapindaceae. Macaranga rhizinoides, O. canescens, A. montanum, and Turpinia montana , respectively , gained the highest importance values.

  20. Determining degree of roasting in cocoa beans by artificial neural network (ANN)-based electronic nose system and gas chromatography/mass spectrometry (GC/MS).

    Science.gov (United States)

    Tan, Juzhong; Kerr, William L

    2018-08-01

    Roasting is a critical step in chocolate processing, where moisture content is decreased and unique flavors and texture are developed. The determination of the degree of roasting in cocoa beans is important to ensure the quality of chocolate. Determining the degree of roasting relies on human specialists or sophisticated chemical analyses that are inaccessible to small manufacturers and farmers. In this study, an electronic nose system was constructed consisting of an array of gas sensors and used to detect volatiles emanating from cocoa beans roasted for 0, 20, 30 and 40 min. The several signals were used to train a three-layer artificial neural network (ANN). Headspace samples were also analyzed by gas chromatography/mass spectrometry (GC/MS), with 23 select volatiles used to train a separate ANN. Both ANNs were used to predict the degree of roasting of cocoa beans. The electronic nose had a prediction accuracy of 94.4% using signals from sensors TGS 813, 826, 822, 830, 830, 2620, 2602 and 2610. In comparison, the GC/MS predicted the degree of roasting with an accuracy of 95.8%. The electronic nose system is able to predict the extent of roasting, as well as a more sophisticated approach using GC/MS. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  1. /sup 201/Thallium scintimetry of the heart as a new method for functional assessment in coronary heart disease

    Energy Technology Data Exchange (ETDEWEB)

    Buell, U; Strauer, B E; Hast, B; Niendorf, H P [Muenchen Univ. (F.R. Germany). Klinik und Poliklinik fuer Radiologie; Muenchen Univ. (F.R. Germany). 1. Medizinische Klinik)

    1976-05-01

    /sup 201/Tl scintimetry of the heart was used for a statistical comparison between normal people (10 individuals) and those with acute anterior wall infarcts (5 patients), anterior wall hypokinesia (5 patients) and dyskinesia (8 patients). Numerical results were obtained by a computer and depended on the relative /sup 201/Tl storage in the left ventricular myocardium (64 mm/sup 2/ area) related to mediastinal background uptake. It was found that maximal myocardial uptake, compared with mediastinal activity (about 290%) did not differ between normals and patients with coronary heart disease. Aneurysms of the anterior ventricular wall showed a reduction (with the ventricle perpendicular to the collimator) of 45.8%; in hypokinesia and acute myocardial infarcts, it was 64.2% and 64.6% respectively (normal 82.6%). /sup 201/Tl uptake in aneurysms (42.4%) approached background activity (36%) if a projection parallel to the collimator was used. /sup 201/Tl scintimetry provides a means of defining function ability of the myocardium (depending on myocardial perfusion and mass). Aneurysms and hypokinetic portions of the myocardium can be differentiated statistically from normal /sup 201/Tl uptake.

  2. The human ACC2 CT-domain C-terminus is required for full functionality and has a novel twist

    Energy Technology Data Exchange (ETDEWEB)

    Madauss, Kevin P. [Department of Computational and Structural Chemistry, GlaxoSmithKline Inc., Five Moore Drive, Research Triangle Park, NC 27709 (United States); Burkhart, William A.; Consler, Thomas G. [Department of Biochemical Reagents and Assay Development, GlaxoSmithKline Inc., Five Moore Drive, Research Triangle Park, NC 27709 (United States); Cowan, David J. [Department of Chemistry in the Center for Excellence in Metabolic Pathways Drug Discovery, GlaxoSmithKline Inc., Five Moore Drive, Research Triangle Park, NC 27709 (United States); Gottschalk, William K. [Institute for Genome Sciences and Policy and Department of Medicine, Division of Neurology, Duke University, Durham, NC 27708 (United States); Miller, Aaron B. [Department of Computational and Structural Chemistry, GlaxoSmithKline Inc., Five Moore Drive, Research Triangle Park, NC 27709 (United States); Short, Steven A. [Department of Biochemical Reagents and Assay Development, GlaxoSmithKline Inc., Five Moore Drive, Research Triangle Park, NC 27709 (United States); Tran, Thuy B. [Department of Physiology, UNC School of Medicine, University of North Carolina, Chapel Hill, NC 27515 (United States); Williams, Shawn P., E-mail: shawn.p.williams@gsk.com [Department of Computational and Structural Chemistry, GlaxoSmithKline Inc., Five Moore Drive, Research Triangle Park, NC 27709 (United States)

    2009-05-01

    The use of biophysical assays permitted the identification of a specific human ACC2 carboxyl transferase (CT) domain mutant that binds inhibitors and crystallizes in their presence. This mutant led to determination of the human ACC2 CT domain–CP-640186 complex crystal structure, which revealed differences in the inhibitor conformation from the yeast protein complex that are caused by differing residues in the binding pocket. Inhibition of acetyl-CoA carboxylase (ACC) may prevent lipid-induced insulin resistance and type 2 diabetes, making the enzyme an attractive pharmaceutical target. Although the enzyme is highly conserved amongst animals, only the yeast enzyme structure is available for rational drug design. The use of biophysical assays has permitted the identification of a specific C-terminal truncation of the 826-residue human ACC2 carboxyl transferase (CT) domain that is both functionally competent to bind inhibitors and crystallizes in their presence. This C-terminal truncation led to the determination of the human ACC2 CT domain–CP-640186 complex crystal structure, which revealed distinctions from the yeast-enzyme complex. The human ACC2 CT-domain C-terminus is comprised of three intertwined α-helices that extend outwards from the enzyme on the opposite side to the ligand-binding site. Differences in the observed inhibitor conformation between the yeast and human structures are caused by differing residues in the binding pocket.

  3. Deliberate teaching tools for clinical teaching encounters: A critical scoping review and thematic analysis to establish definitional clarity.

    Science.gov (United States)

    Sidhu, Navdeep S; Edwards, Morgan

    2018-04-27

    We conducted a scoping review of tools designed to add structure to clinical teaching, with a thematic analysis to establish definitional clarity. Six thousand and forty nine citations were screened, 434 reviewed for eligibility, and 230 identified as meeting study inclusion criteria. Eighty-nine names and 51 definitions were identified. Based on a post facto thematic analysis, we propose that these tools be named "deliberate teaching tools" (DTTs) and defined as "frameworks that enable clinicians to have a purposeful and considered approach to teaching encounters by incorporating elements identified with good teaching practice." We identified 46 DTTs in the literature, with 38 (82.6%) originally described for the medical setting. Forty justification articles consisted of 16 feedback surveys, 13 controlled trials, seven pre-post intervention studies with no control group, and four observation studies. Current evidence of efficacy is not entirely conclusive, and many studies contain methodology flaws. Forty-nine clarification articles comprised 12 systematic reviews and 37 narrative reviews. The most number of DTTs described by any review was four. A common design theme was identified in approximately three-quarters of DTTs. Applicability of DTTs to specific alternate settings should be considered in context, and appropriately designed justification studies are warranted to demonstrate efficacy.

  4. C-reactive protein as a marker of infection in children with severe acute malnutrition in Khartoum state, Sudan

    Directory of Open Access Journals (Sweden)

    Abdelmoneim E.M. Kheir

    2017-08-01

    Full Text Available Severe acute malnutrition and acute systemic infection are often synergistic in children and lead to considerable mortality. The main aim of this research was to determine whether children with severe acute malnutrition can mount an acute phase reactant response measured by C-reactive protein. This was a descriptive, cross-sectional, hospital-based study that was carried out in the five main children hospitals in Khartoum state, from November 1st, 2012 to March 1st, 2013. 132 children with severe acute malnutrition were included in the study. Data collection included history, examination and C-reactive protein measurement. The data were analyzed using Statistical Package for Social Sciences (SPSS for descriptive and inferential statistics. The main results revealed that 93(70.5% children between 12-23 months of age and most of them had marasmus. Diarrhoea was the commonest presenting symptoms in 86.4%, followed by fever and vomiting. Most of the children (82.6% had positive C-reactive protein with variable levels. In conclusion malnourished children are able to synthesize C-reactive protein in response to an infectious process and the magnitude of this response is increased in those with severe infections.

  5. Co-digestion of pig slaughterhouse waste with sewage sludge.

    Science.gov (United States)

    Borowski, Sebastian; Kubacki, Przemysław

    2015-06-01

    Slaughterhouse wastes (SHW) are potentially very attractive substrates for biogas production. However, mono-digestion of these wastes creates great technological problems associated with the inhibitory effects of ammonia and fatty acids on methanogens as well as with the foaming in the digesters. In the following study, the co-digestion of slaughterhouse wastes with sewage sludge (SS) was undertaken. Batch and semi-continuous experiments were performed at 35°C with municipal sewage sludge and pig SHW composed of meat tissue, intestines, bristles and post-flotation sludge. In batch assays, meat tissue and intestinal wastes gave the highest methane productions of 976 and 826 dm(3)/kg VS, respectively, whereas the methane yield from the sludge was only 370 dm(3)/kg VS. The co-digestion of sewage sludge with 50% SHW (weight basis) provided the methane yield exceeding 600 dm(3)/kg VS, which was more than twice as high as the methane production from sewage sludge alone. However, when the loading rate exceeded 4 kg VS/m(3) d, a slight inhibition of methanogenesis was observed, without affecting the digester stability. The experiments showed that the co-digestion of sewage sludge with large amount of slaughterhouse wastes is feasible, and the enhanced methane production does not affect the digester stability. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Tuberculosis lymphadenitis in a southeastern region in Tunisia: Epidemiology, clinical features, diagnosis and treatment.

    Science.gov (United States)

    Smaoui, Salma; Mezghanni, Mohamed Amine; Hammami, Bousaima; Zalila, Neila; Marouane, Chema; Kammoun, Sana; Ghorbel, Abdelmonoom; Ben Jemaa, Mounir; Messadi-Akrout, Férièle

    2015-09-01

    To evaluate patients' profiles, demographics, clinical and therapeutic approaches and strategies in patients with tuberculous lymphadenitis (TBG). A retrospective study of all TBG-confirmed cases admitted in a tuberculosis-specific health care facility between 1 January 2009 and 16 June 2013. A total of 181 clinical files were examined. Mean age was 32years old; the female/male ratio was 1.78 to 1. Raw milk consumption was noted in 1/3 of patients. Most cases involved the head and neck region (83.4%), nodes involvement, including axillary (12 cases), and mediastinal (9 cases). Clinical symptoms were present in only 55.2%. Tuberculin skin test (TST) was conducted with 82.6% positive responses. Diagnostics confirmation was done with anatomical pathology in most of the patients; only 56 of them had any microbiology analysis done. Demonstration of acid-fast bacilli in microscopy from either fine-needle aspirates or biopsies was done in 17.5% of cases, and cultures yielded positive results in 27%. Treatment duration was varied. Paradoxical reactions were noted in 12% and persistent lymphadenopathy after treatment completion was noted in 10% of cases. TBG remains a disease of interest. Today, its diagnosis and management is still a problem despite its increasing worldwide incidence, and especially in this study area. Disease control should be strengthened in this country. Copyright © 2015 Asian-African Society for Mycobacteriology. Published by Elsevier Ltd. All rights reserved.

  7. Tuberculosis lymphadenitis in a southeastern region in Tunisia: Epidemiology, clinical features, diagnosis and treatment

    Directory of Open Access Journals (Sweden)

    Salma Smaoui

    2015-01-01

    Full Text Available Aim: To evaluate patients’ profiles, demographics, clinical and therapeutic approaches and strategies in patients with tuberculous lymphadenitis (TBG. Patients and methods: A retrospective study of all TBG-confirmed cases admitted in a tuberculosis-specific health care facility between 1 January 2009 and 16 June 2013. Results: A total of 181 clinical files were examined. Mean age was 32 years old; the female/male ratio was 1.78 to 1. Raw milk consumption was noted in 1/3 of patients. Most cases involved the head and neck region (83.4%, nodes involvement, including axillary (12 cases, and mediastinal (9 cases. Clinical symptoms were present in only 55.2%. Tuberculin skin test (TST was conducted with 82.6% positive responses. Diagnostics confirmation was done with anatomical pathology in most of the patients; only 56 of them had any microbiology analysis done. Demonstration of acid-fast bacilli in microscopy from either fine-needle aspirates or biopsies was done in 17.5% of cases, and cultures yielded positive results in 27%. Treatment duration was varied. Paradoxical reactions were noted in 12% and persistent lymphadenopathy after treatment completion was noted in 10% of cases. Conclusions: TBG remains a disease of interest. Today, its diagnosis and management is still a problem despite its increasing worldwide incidence, and especially in this study area. Disease control should be strengthened in this country.

  8. Estimate of body composition by Hume's equation: validation with DXA.

    Science.gov (United States)

    Carnevale, Vincenzo; Piscitelli, Pamela Angela; Minonne, Rita; Castriotta, Valeria; Cipriani, Cristiana; Guglielmi, Giuseppe; Scillitani, Alfredo; Romagnoli, Elisabetta

    2015-05-01

    We investigated how the Hume's equation, using the antipyrine space, could perform in estimating fat mass (FM) and lean body mass (LBM). In 100 (40 male ad 60 female) subjects, we estimated FM and LBM by the equation and compared these values with those measured by a last generation DXA device. The correlation coefficients between measured and estimated FM were r = 0.940 (p LBM were r = 0.913 (p LBM, though the equation underestimated FM and overestimated LBM in respect to DXA. The mean difference for FM was 1.40 kg (limits of agreement of -6.54 and 8.37 kg). For LBM, the mean difference in respect to DXA was 1.36 kg (limits of agreement -8.26 and 6.52 kg). The root mean square error was 3.61 kg for FM and 3.56 kg for LBM. Our results show that in clinically stable subjects the Hume's equation could reliably assess body composition, and the estimated FM and LBM approached those measured by a modern DXA device.

  9. Phenolic Compositions and Antioxidant Activities Differ Significantly among Sorghum Grains with Different Applications

    Directory of Open Access Journals (Sweden)

    Shuyu Shen

    2018-05-01

    Full Text Available Sorghum grains with different applications had different phenolic profiles, which were corresponded to various antioxidant capacities. In this study, total phenolic, proanthocyanidins and flavonoids contents, as well as contents of individual phenolic compounds from sorghum grains with various applications were determined, and their antioxidant capacities were evaluated. Total phenolic contents (TPC and total proanthocyanidins contents (TPAC showed strong correlation with antioxidant activities (r > 0.95, p < 0.01. Hongyingzi (S-1, one of the brewing sorghums, showed the highest level of TPC and TPAC, while white grain sorghum (S-8 had the lowest. Except for black grain sorghum (S-7, that contained the highest contents of ferulic acid, brewing sorghum grains contained the higher contents of the most individual phenolic compounds, especially the variety S-1. The correlation among individual phenolic compounds and antioxidant activities indicated that the free forms of protocatechuic acid (r = 0.982 of FRAPassay, p < 0.01 and taxifolin (r = 0.826 of FRAP assay, p < 0.01 may be the main functional compounds. These results indicate that brewing sorghum grains can also be utilized as effective materials for functional foods.

  10. Early 18F-FDG-PET/CT as a predictive marker for treatment response and survival in patients with metastatic colorectal cancer treated with irinotecan and cetuximab

    DEFF Research Database (Denmark)

    Skougaard, K; Nielsen, Dorte; Vittrup Jensen, Benny

    2016-01-01

    to RECIST 1.0. Results: By EORTC criteria, early metabolic response predicted partial metabolic response (PMR) with a high positive predictive value (PPV) of 0.875 and a high negative predictive value (NPV) of 0.714. Partial radiologic response was predicted with a low PPV of 0.368 but a high NPV of 1.......0. By PERCIST, PMR was predicted with a high PPV of 0.826 and an intermediate NPV of 0.667 and partial radiologic response was predicted with a low PPV of 0.5 but a high NPV of 1.0. Median OS was nearly the same with the two criteria sets; 14.1 months for early metabolic responders and 9.9 months for non......-responders using EORTC criteria and 13.5 and 10.1 months, respectively, using PERCIST. Conclusions: With both EORTC criteria and PERCIST, early reduction in FDG uptake was predictive of a later partial metabolic and partial radiologic response to treatment. It was also predictive of significantly longer survival...

  11. Analysis of Water Resources in Horqin Sandy Land Using Multisource Data from 2003 to 2010

    Directory of Open Access Journals (Sweden)

    Zhenzhen Zhao

    2016-04-01

    Full Text Available Over the past four decades, land use/land cover (LU/LC change, coupled with persistent drought, has resulted in the decline of groundwater levels in Horqin Sandy Land. Accordingly, this study quantifies changes in LU/LC and groundwater storage (GWS. Furthermore, it investigates the effects of LU/LC changes on GWS. GWS changes are estimated using Gravity Recovery and Climate Experiment (GRACE data and ground-based measurements obtained from July 2003 to December 2010. Soil moisture and snow water equivalent data derived from the Global Land Data Assimilation System (GLDAS are used to isolate GWS changes from GRACE-derived terrestrial water storage changes. The result shows that the groundwater depletion rate in Horqin Sandy Land is 13.5 ± 1.9 mm·year−1 in 2003–2010, which is consistent with the results of monitoring well stations. LU/LC changes are detected using bitemporal imageries (2003 and 2010 from Landsat Thematic Mapper through the post-classification comparison method. The result shows that LU/LC significantly changed during the aforementioned period. Bare soil and built-up land have increased by 76.6% and 82.2%, respectively, while cropland, vegetation, and water bodies have decreased by 14.1%, 74.5%, and 82.6%, respectively. The analysis of GWS and LU/LC changes shows that LU/LC changes and persistent drought are the main factors that affect groundwater resources.

  12. DETERMINACIÓN DE LAS PROPIEDADES ESTRUCTURALES, ELECTRÓNICAS Y ÓPTICAS DEL ÓXIDO DE ESTRONCIO MEDIANTE LA TEORÍA DE DENSIDAD FUNCIONAL

    Directory of Open Access Journals (Sweden)

    Gabriel A. Fonseca

    2012-01-01

    Full Text Available Se realizó un estudio de primeros principios de las propiedades estructurales, electrónicas y ópticas del SrO en la fase cristalina Fm-3m por medio de la teoría de densidad funcional ( DFT, utilizando el método de ondas planas aumentadas y linealizadas de potencial completo (FP-LAPW junto con la aproximación de gradiente generalizado (GGA para la energía de intercambio y correlación. Los parámetros estructurales optimizados se encuentran en gran acuerdo con los datos experimentales, constante de red a=9,826 Bohr, energía de cohesión E0 =-0,764 Ry, modulo de volumen B = 83 GPa y su derivada con la presión B’ = 4,71. Los cálculos de estructura electrónica revelan una brecha indirecta de 3,392 eV entre las direcciones y X en la zona de Brillouin, finalmente se obtuvo la absorción, constante dieléctrica e índice de refracción en función de la energía, por medio de la aproximación de fase aleatoria.

  13. Outcome of endoscopic transsphenoidal surgery in combination with somatostatin analogues in patients with growth hormone producing pituitary adenoma.

    Science.gov (United States)

    Zhou, Tao; Wang, Fuyu; Meng, Xianghui; Ba, Jianmin; Wei, Shaobo; Xu, Bainan

    2014-11-01

    To determine the efficacy of endoscopic surgery in combination with long-acting somatostatin analogues (SSAs) in treating patients with growth hormone (GH)-secreting pituitary tumor. We performed retrospective analysis of 133 patients with GH producing pituitary adenoma who underwent pure endoscopic transsphenoidal surgery in our center from January 2007 to July 2012. Patients were followed up for a range of 3-48 months. The radiological remission, biochemical remission and complication were evaluated. A total of 110 (82.7%) patients achieved radiological complete resection, 11 (8.2%) subtotal resection, and 12 (9.0%) partial resection. Eighty-eight (66.2%) patients showed nadir GH level less than 1 ng/mL after oral glucose administration. No mortality or severe disability was observed during follow up. Preoperative long-acting SSA successfully improved left ventricle ejection fraction (LVEF) and blood glucose in three patients who subsequently underwent success operation. Long-acting SSA (20 mg every 30 days) achieved biochemical remission in 19 out 23 (82.6%) patients who showed persistent high GH level after surgery. Endoscopic transsphenoidal surgery can biochemically cure the majority of GH producing pituitary adenoma. Post-operative use of SSA can improve biochemical remission.

  14. The clinical utility of multimodal MR image-guided needle biopsy in cerebral gliomas.

    Science.gov (United States)

    Yao, Chengjun; Lv, Shunzeng; Chen, Hong; Tang, Weijun; Guo, Jun; Zhuang, Dongxiao; Chrisochoides, Nikos; Wu, Jinsong; Mao, Ying; Zhou, Liangfu

    2016-01-01

    Our aim was to evaluate the diagnostic value of multimodal Magnetic Resonance (MR) Image in the stereotactic biopsy of cerebral gliomas, and investigate its implications. Twenty-four patients with cerebral gliomas underwent (1)H Magnetic Resonance Spectroscopy ((1)H-MRS)- and intraoperative Magnetic Resonance Imaging (iMRI)-supported stereotactic biopsy, and 23 patients underwent only the preoperative MRI-guided biopsy. The diagnostic yield, morbidity and mortality rates were analyzed. In addition, 20 patients underwent subsequent tumor resection, thus the diagnostic accuracy of the biopsy was further evaluated. The diagnostic accuracies of biopsies evaluated by tumor resection in the trial groups were better than control groups (92.3% and 42.9%, respectively, p = 0.031). The diagnostic yield in the trial groups was better than the control groups, but the difference was not statistically significant (100% and 82.6%, respectively, p = 0.05). The morbidity and mortality rates were similar in both groups. Multimodal MR image-guided glioma biopsy is practical and valuable. This technique can increase the diagnostic accuracy in the stereotactic biopsy of cerebral gliomas. Besides, it is likely to increase the diagnostic yield but requires further validation.

  15. A new BODIPY/nanoparticle/Ni affinity system for binding of cytochrome c

    Energy Technology Data Exchange (ETDEWEB)

    Maltas, Esra, E-mail: maltasesra@gmail.com [Selcuk University, Faculty of Science, Department of Chemistry, 42075 Konya (Turkey); Selcuk University, Faculty of Science, Department of Biochemistry, 42075 Konya (Turkey); Kursunlu, Ahmed Nuri [Selcuk University, Faculty of Science, Department of Chemistry, 42075 Konya (Turkey); Arslan, Gulsin [Selcuk University, Faculty of Science, Department of Biochemistry, 42075 Konya (Turkey); Selcuk University, Advanced Research Technology and Application Center, 42075 Konya (Turkey); Ozmen, Mustafa [Selcuk University, Faculty of Science, Department of Chemistry, 42075 Konya (Turkey); Selcuk University, Advanced Research Technology and Application Center, 42075 Konya (Turkey)

    2015-09-15

    Highlights: • BODIPY was synthesized, and then attached to magnetic nanoparticles. • Ni(II) ions were chelated on prepared material. • The binding of cytochrome c to obtained material was studied. - Abstract: In this study, 3,5-{Bis[4,4-difluoro, 8-(2,6-diethyl, 1,3,5,7-tetramethyl-4-bora-3a,4a-diaza-s-indacene)]}benzoylchloride (BODIPY) was synthesized for the improving of a new immobilized metal affinity supporting material. Firstly, the synthesized BODIPY was immobilized on iron oxide superparamagnetic nanoparticles (SPIONs) and then, Ni(II) ions were chelated with the active terminals of BODIPY on nanoparticles surfaces to prepare an immobilized metal affinity (IMA) adsorbent for protein adsorption. The amount of BODIPY coated on SPIONs was about 29.7 μM at 10 mg nanoparticles. 738 μmol of Ni(II) ions were loaded to 10 mg of the SPIONs/BODIPY. The binding amount of cytochrome c was found to be 170 μg to the SPIONs/BODIPY/Ni at pH 7.4. The binding amount of the molecules on SPIONs was analyzed by using UV–vis, fluorescence and atomic absorption spectroscopy. The characterization of the prepared surfaces was performed by FT-IR, SEM and TEM.

  16. Fate of /sup 15/N-Urea and /sup 15/N-Ammonia sulfate applied in different times to rice crops, variety CICA-8, under greenhouse conditions

    Energy Technology Data Exchange (ETDEWEB)

    Bastidas, O G; Alvarez, A L; Victoria, R L; Muraoka, T; Urquiaga, S

    1986-01-01

    This research project deals with the end use of two nitrogen fertilizers applied to a rice crop. The experiment was carried out in a greenhouse, using urea (1.973% N/sup 15/ atom content) and ammonia sulfate (1.826% N/sup 15/atom content). Fertilizers were applied in four levels (0 to 300 Kg/ha) at sowing and 30 days after budding on flower pots containing 30 Kg. of soil. Results indicate that production of dry vegetable material presents no significant differences in regard to application time or nitrogen source, but it does in relation to applied levels. The efficiency in fertilizers use changed between 16 and 54%, showing highly significant differences, in relation to source, level and time of application. At the end of the experiment, in the plant-soil system, about 39% to 81% of the applied nitrogen was recovered, given higher losses when urea was as a source, and depending on the time of application.

  17. Effects of nutrient and lime additions in mine site rehabilitation strategies on the accumulation of antimony and arsenic by native Australian plants.

    Science.gov (United States)

    Wilson, Susan C; Leech, Calvin D; Butler, Leo; Lisle, Leanne; Ashley, Paul M; Lockwood, Peter V

    2013-10-15

    The effects of nutrient and lime additions on antimony (Sb) and arsenic (As) accumulation by native Australian and naturalised plants growing in two contaminated mine site soils (2,735 mg kg(-1) and 4,517 mg kg(-1) Sb; 826 mg kg(-1) and 1606 As mgkg(-1)) was investigated using a glasshouse pot experiment. The results indicated an increase in soil solution concentrations with nutrient addition in both soils and also with nutrient+lime addition for Sb in one soil. Metalloid concentrations in plant roots were significantly greater than concentrations in above ground plant parts. The metalloid transfer to above ground plant parts from the roots and from the soil was, however, low (ratio of leaf concentration/soil concentration≪1) for all species studied. Eucalyptus michaeliana was the most successful at colonisation with lowest metalloid transfer to above ground plant parts. Addition of nutrients and nutrients+lime to soils, in general, increased plant metalloid accumulation. Relative As accumulation was greater than that of Sb. All the plant species studied were suitable for consideration in the mine soil phytostabilisation strategies but lime additions should be limited and longer term trials also recommended. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Evaluation of casing materials made from spent mushroom substrate and coconut fibre pith for use in production of Agaricus bisporus (Lange) Imbach

    Energy Technology Data Exchange (ETDEWEB)

    Pardo-Gimenez, A.; Pardo-Gonzalez, J. E.

    2008-07-01

    The agronomic performance of different proportions of mixtures of coconut fibre (CF) pith and spent mushroom substrate (SMS) was studied for their use as casing material in mushroom cultivation. After chemical and biological characterisation of the casing substrates qualitative and quantitative production parameters were evaluated in a cycle of Agaricus production. An increase in the proportion of SMS reduced the number of carpophores and overall yield; while the first flush was delayed, mushroom size tended to increase and the mushrooms had a higher dry matter content and a better texture, although their colour was worse. Combinations of CF pith and SMS of 4:1 and 3:2 (v/v) gave biological efficiencies of 92.9 and 82.6 kg 100 kg-1 compost, respectively. These values compare well with that obtained from the commercial casings used as a control. The high electrical conductivity of the mixture containing the highest proportion of SMS would limit its use. However, the results indicate the viability of reusing SMS as an ingredient of casing material for mushroom cultivation. This alternative could be considered to partially replace the organic substrates normally used for mushroom cultivation, with the double advantage of decreasing cost and reducing the environmental impact of waste disposal. Additional key words: alternative casing, compost reuse, mushroom cultivation. (Author) 31 refs.

  19. Energetic characterization of the husk of the castor bean fruits of the variety Guarani

    Energy Technology Data Exchange (ETDEWEB)

    Teramoto, Erico Tadao; Sousa, Frederico Faula; Castro Neto, Pedro [Universidade Federal de Lavras (DEG/UFLA), MG (Brazil). Dept. de Engenharia; Trugilho, Paulo Fernando [Universidade Federal de Lavras (DCF/UFLA), MG (Brazil). Dept. de Ciencias Florestais; Fraga, Antonio Carlos [Universidade Federal de Lavras (DAG/UFLA), MG (Brazil). Dept. de Agricultura; Nunes, Ramon Rachide [Universidade Federal de Lavras (DAG/UFLA), MG (Brazil). Dept. de Quimica

    2008-07-01

    The knowledge of the physical properties and of the calorific power and of the immediate chemical analysis certain products are interesting for the development of new technologies and equipment for your processing or use as fuel. This way, due to the scarce readiness of referring works for the husk of the castor bean fruits, the present study seeks complemental the available data in the literature. For such were certain the following properties of the husk of the castor bean fruits of variety Guarani: angle of repose, hectolitre weigh, moisture, ash content, volatile material content, fixed carbon content and superior calorific power and inferior calorific power. The following values were found: 42 deg for the angle of repose, 13.92 kg for the hectolitre weight, 4223.19 kcal/kg for the superior calorific power, 3829.92 kcal/kg for the inferior calorific power, 8.21% for the moisture, 9.86% for the ash content, 73.67% for the volatile material content and 8.26% for the fixed carbon content. (author)

  20. Analysis of international content of ranked nursing journals in 2005 using ex post facto design.

    Science.gov (United States)

    Dougherty, Molly C; Lin, Shu-Yuan; McKenna, Hugh P; Seers, Kate; Keeney, Sinead

    2011-06-01

    The purpose of this study was to examine articles in ISI-ranked nursing journals and to analyse the articles and journals, using definitions of international and article content. Growing emphasis on global health includes attention on international nursing literature. Contributions from Latin America and Africa have been reported. Attention to ranked nursing journals to support scholarship in global health is needed. Using an ex post facto design, characteristics of 2827 articles, authors and journals of 32 ranked nursing journals for the year 2005 were analysed between June 2006 and June 2007. Using definitions of international and of article content, research questions were analysed statistically. (a) 928 (32·8%) articles were international; (b) 2016 (71·3%) articles were empirical or scholarly; (c) 826 (89·3%) articles reflecting international content were scholarly or empirical; (d) among international articles more were empirical (66·3 % vs. 32·8 %; χ(2) ((1)) = 283·6, P international articles more were scholarly (29·2 % vs. 22·7 %; χ(2) ((1)) = 15·85, P international, based on author characteristics; (f) 20 (62·5 %) journals were led by an international editorial team; and (g) international journals had more international articles (3·6 % vs. 29·2 %; χ(2) ((1)) = 175·75, P international journals (t = -14·43, P international journals. Results indicate the need to examine the international relevance of the nursing literature. © 2011 Blackwell Publishing Ltd.

  1. Nagelbefall kann bei Patienten mit Psoriasis auf eine Enthesiopathie hinweisen.

    Science.gov (United States)

    Castellanos-González, Maria; Joven, Beatriz Esther; Sánchez, Julio; Andrés-Esteban, Eva María; Vanaclocha-Sebastián, Francisco; Romero, Pablo Ortiz; Díaz, Raquel Rivera

    2016-11-01

    Obwohl subklinische Enthesiopathie ein gut etabliertes diagnostisches Merkmal der Psoriasisarthritis (PsA) ist, wird sie häufig übersehen, da viele Patienten asymptomatisch sind. Gäbe es klinische Hinweise auf das Vorliegen einer Enthesiopathie, würde dies den Klinikern die Möglichkeit eröffnen, eine PsA frühzeitig zu diagnostizieren. Es wurde eine monozentrische prospektive Studie mit insgesamt 90 Psoriasis-Patienten durchgeführt, um mittels Ultraschall das Vorliegen von Enthesenanomalien zu untersuchen und eine Korrelation mit dem Befall der Nägel festzustellen. Enthesenanomalien wurden bei 23 Patienten (25,5 %) gefunden, von denen 19 (82,6 %) Nagelbefall aufwiesen. Bei 4 Patienten waren die Nägel nicht betroffen. Enthesiopathie lag bei 31,1 % (19/61) der Patienten mit Onychopathie vor, von den Patienten ohne Nagelbefall litten nur 13,8 % (4/29) an Enthesiopathie (p = 0,07). Zwischen dem Target-NAPSI-Score und dem Vorliegen einer Enthesiopathie bestand eine signifikante Korrelation. Eine signifikante Korrelation bestand darüber hinaus auch zwischen dem Vorliegen einer Enthesiopathie und der Anzahl der betroffenen Nägel (p = 0,035). Klinische Belege für eine Onychopathie können der Schlüssel für die frühe Diagnose einer Enthesiopathie bei Psoriasis-Patienten sein. © 2016 Deutsche Dermatologische Gesellschaft (DDG). Published by John Wiley & Sons Ltd.

  2. Imaging modalities for staging esophageal carcinoma

    International Nuclear Information System (INIS)

    Mattioli, S.; Pezzi, A.; Brusori, S.; Brusori, G.; Di Simone, M.P.; Gozzetti, G.; Gigli, F.

    1991-01-01

    Forty-four patients affected with thoracic esophageal carcinoma underwent preoperative CT to evaluate the value of this method in both staging and assessing the resectability of esophageal tumors. The authors compared the CTfindings with intraoperative macroscopei ones, pathologic, and bronchoscopic results in mid-high neoplasms. CT staging criteria were drawn from a careful review of literature and from personal experience. thirty-nine patients were submitted to surgery, and esophagectomy was possible in 34 of them. CT diagnostic accuracy was higher in proximal esophageal tumors than in sub-bronchial ones; as for the surgical choice, CT provided fundamental guidelines,especially if the choice was a blunt esophagectomy where it is important to exclude tumoral involvement of the airways (accuracy: 82.6%) or of the aorta (accuracy: 89.7%). CT staging accuracy was limited by the low sensitivity of the method in detecting lymphatic ( local: 66.6%, distant: 64.2%) and hepatic metastates. Combined thoraco-abdominal CT, tracheo-bronchoscopy and liver US, besides MR imgaging and endoscopic US, allow a better preoperative evaluation of esophageal carcinomas

  3. SPEECH EVALUATION WITH AND WITHOUT PALATAL OBTURATOR IN PATIENTS SUBMITTED TO MAXILLECTOMY

    Science.gov (United States)

    de Carvalho-Teles, Viviane; Pegoraro-Krook, Maria Inês; Lauris, José Roberto Pereira

    2006-01-01

    Most patients who have undergone resection of the maxillae due to benign or malignant tumors in the palatomaxillary region present with speech and swallowing disorders. Coupling of the oral and nasal cavities increases nasal resonance, resulting in hypernasality and unintelligible speech. Prosthodontic rehabilitation of maxillary resections with effective separation of the oral and nasal cavities can improve speech and esthetics, and assist the psychosocial adjustment of the patient as well. The objective of this study was to evaluate the efficacy of the palatal obturator prosthesis on speech intelligibility and resonance of 23 patients with age ranging from 18 to 83 years (Mean = 49.5 years), who had undergone inframedial-structural maxillectomy. The patients were requested to count from 1 to 20, to repeat 21 words and to spontaneously speak for 15 seconds, once with and again without the prosthesis, for tape recording purposes. The resonance and speech intelligibility were judged by 5 speech language pathologists from the tape recordings samples. The results have shown that the majority of patients (82.6%) significantly improved their speech intelligibility, and 16 patients (69.9%) exhibited a significant hypernasality reduction with the obturator in place. The results of this study indicated that maxillary obturator prosthesis was efficient to improve the speech intelligibility and resonance in patients who had undergone maxillectomy. PMID:19089242

  4. Serosurvey for Leishmania spp., Toxoplasma gondii, Trypanosoma cruzi and Neospora caninum in neighborhood dogs in Curitiba-Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Caroline Constantino

    Full Text Available Abstract Neighborhood dogs may act as reservoirs for several zoonotic protozoan infections, particularly in urban areas, thus constituting a potential public health threat. Accordingly, the aim of the present study was to evaluate the exposure of neighborhood dogs to four protozoan pathogens in public areas with high levels of human movement in Curitiba, southern Brazil. Blood samples from 26 neighborhood dogs were screened by means of the indirect immunofluorescent antibody test (IFAT for Leishmania spp., Toxoplasma gondii, Trypanosoma cruzi and Neospora caninum, and a questionnaire was answered by the respective keeper. A total of 8/26 dogs (30.7% seroreactive to T. gondii, 3/26 (11.5% to N. caninum and 2/26 (7.7% to both were identified. All the samples were seronegative for T. cruzi and Leishmania spp. Pathogen seroreactivity was not associated with the daily human movements or other epidemiological variables investigated (p > 0.05. In conclusion, the low seroprevalence for T. gondii and N. caninum indicated low environmental and food risk for animal infection and the seronegativity for Leishmania spp. and T. cruzi may reflect the absence of these pathogens in urban areas of Curitiba. Moreover, neighborhood dogs may be used as environmental sentinels for the presence of protozoan pathogens and their vectors.

  5. Ectodermal dysplasia: otolaryngologic evaluation of 23 cases.

    Science.gov (United States)

    Yildirim, Muzeyyen; Yorgancilar, Ediz; Gun, Ramazan; Topcu, Ismail

    2012-02-01

    The aim of this prospective study was to improve the quality of life of and reduce morbidity for patients with ectodermal dysplasia by assessing their actual and potential ENT pathologies, and offering methods of prevention and treatment. The study was conducted between 2006 and 2008 and included 23 patients diagnosed with ectodermal dysplasia. The major symptoms of ectodermal dysplasia were evaluated. Patient histories were obtained in all cases, and a complete head and neck examination was carried out. Of the 23 patients (11 males and 12 females, aged 5 to 45 years) diagnosed with ectodermal dysplasia, 22 had hypohidrotic ectodermal dysplasia and 1 had ectrodactyly-ectodermal dysplasia-clefting syndrome. In all patients diagnosed with hypohidrotic ectodermal dysplasia, the salivary glands were examined by ultrasonography and, when necessary, by scintigraphy. Hearing defects in patients with otologic problems were determined by audiometric examination: 39.1% of the patients had hearing loss, 43.5% had otitis media, and 39.1% had impacted cerumen. The most common rhinologic findings were saddle nose deformity in 56.5%, nasal obstruction and nasal dryness (52.2% each), and chronic rhinitis/rhinosinusitis (34.8%). The most common oral and oropharyngeal findings were difficulty chewing in 82.6% and dry mouth in 78.3%. All 23 patients had required dental work. Because this disorder affects several aspects of the body, its treatment requires a multidisciplinary approach, with the otolaryngologist being a vital part of the management team.

  6. Design and testing of a uniformly solar energy TIR-R concentration lenses for HCPV systems.

    Science.gov (United States)

    Shen, S C; Chang, S J; Yeh, C Y; Teng, P C

    2013-11-04

    In this paper, total internal reflection-refraction (TIR-R) concentration (U-TIR-R-C) lens module were designed for uniformity using the energy configuration method to eliminate hot spots on the surface of solar cell and increase conversion efficiency. The design of most current solar concentrators emphasizes the high-power concentration of solar energy, however neglects the conversion inefficiency resulting from hot spots generated by uneven distributions of solar energy concentrated on solar cells. The energy configuration method proposed in this study employs the concept of ray tracing to uniformly distribute solar energy to solar cells through a U-TIR-R-C lens module. The U-TIR-R-C lens module adopted in this study possessed a 76-mm diameter, a 41-mm thickness, concentration ratio of 1134 Suns, 82.6% optical efficiency, and 94.7% uniformity. The experiments demonstrated that the U-TIR-R-C lens module reduced the core temperature of the solar cell from 108 °C to 69 °C and the overall temperature difference from 45 °C to 10 °C, and effectively relative increased the conversion efficiency by approximately 3.8%. Therefore, the U-TIR-R-C lens module designed can effectively concentrate a large area of sunlight onto a small solar cell, and the concentrated solar energy can be evenly distributed in the solar cell to achieve uniform irradiance and effectively eliminate hot spots.

  7. PXIe based data acquisition and control system for ECRH systems on SST-1 and Aditya tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Jatinkumar J., E-mail: jatin@ipr.res.in [Institute for Plasma Research, Bhat, Gandhinagar (India); Shukla, B.K.; Rajanbabu, N.; Patel, H.; Dhorajiya, P.; Purohit, D. [Institute for Plasma Research, Bhat, Gandhinagar (India); Mankadiya, K. [Optimized Solutions Pvt. Ltd (India)

    2016-11-15

    Highlights: • Data Aquisition and control system (DAQ). • PXIe hardware–(PXI–PCI bus extension for Instrumention Express). • RHVPS–Regulated High Voltage Power supply. • SST1–Steady state superconducting tokamak. - Abstract: In Steady State Superconducting (SST-1) tokamak, various RF heating sub-systems are used for plasma heating experiments. In SST-1, Two Electron Cyclotron Resonance Heating (ECRH) systems have been installed for pre-ionization, heating and current drive experiments. The 42 GHz gyrotron based ECRH system is installed and in operation with SST-1 plasma experiments. The 82.6 GHz gyrotron delivers 200 kW CW power (1000 s) while the 42 GHz gyrotron delivers 500 kW power for 500 ms duration. Each gyrotron system consists of various auxiliary power supplies, the crowbar unit and the water cooling system. The PXIe (PCI bus extension for Instrumentation Express)bus based DAC (Data Acquisition and Control) system has been designed, developed and under implementation for safe and reliable operation of the gyrotron. The Control and Monitoring Software applications have been developed using NI LabView 2014 software with real time support on windows platform.

  8. [Analysis of resistant genes of beta-lactam antibiotics from Pseudomonas aeruginosa in pediatric patients].

    Science.gov (United States)

    Dong, Fang; Xu, Xi-wei; Song, Wen-qi; Lü, Ping; Yang, Yong-hong; Shen, Xu-zhuang

    2008-11-18

    To analyze the antibiotic resistance of the Pseudomonas aeruginosa (PA) isolated from pediatric patients and the resistant genes of beta-lactam antibiotics thereof. 146 PA strains were isolated from pediatric patients. Agar dilution method recommended by the Clinical and Laboratory Standards Institute was used to examine the minimum inhibitory concentrations (MICs) of 12 antimicrobial agents, including the penicillins, third and fourth genet ration cephalosporins, carbapenemase, Aztreonam, beta-lactamase inhibitors, quinolones, and aminoglycosides. PCR was used to detect the expression of the genes TEM, SHV, OXA, PER, GES, CTX-M, IMP, VIM, DHA, MIR, FOX, and oprD2. The multi-drug resistance rates against different antibiotic were high among the 146 PA strains. The rates of imipenem and meropenem resistance were 41.1% and 35.6% respectively. Among the 146 PA strains, 46 (31.5%) were positive for the MBL genotype; 38 (82.6%) carried the blaIMP gene, 8 (17.4%) carried the blaVIM gene, and 114 (78.1%) were oprD2 negative. The genes TEM, SHV, OXA, CTX-M, PER, VEB, GES, FOX, MIR, and DHA were not found in all strains. Many PA isolated from pediatric patients carry the genes IMP or VIM and losses oprD2 gene related to the expression of the outer membrane porin OprD2. The loss of the gene oprD2 is essential mechanism of beta-lactam antibiotics resistance in PA.

  9. The influence of combined oral contraceptives on female sexual desire: a systematic review.

    Science.gov (United States)

    Pastor, Zlatko; Holla, Katerina; Chmel, Roman

    2013-02-01

    To determine the relationship between the use of combined oral contraceptives (COCs) and sexual desire based on a systematic review of the literature. MEDLINE Complete, Google Scholar and the Cochrane Library were searched for articles published between 1975 and 2011, reporting the effects of oral contraceptives on sexual desire. Reports fully meeting all the predefined criteria were analysed and included in a final reference list. In addition, a review of the reference list of selected articles was carried out. We evaluated 36 studies (1978-2011; 13,673 women). Of the COC users (n = 8,422), 85% reported an increase (n = 1,826) or no change (n = 5,358) in libido and 15% reported a decrease (n = 1,238). We found no significant difference in sexual desire in the case of COCs with 20-35 μg ethinylestradiol; libido decreased only with pills containing 15 μg ethinylestradiol. The majority of COC users report no significant change in libido although in most studies a decline in plasma levels of free testosterone and an increase in those of sex hormone binding globulin were observed.

  10. Using high-technology to enforce low-technology safety measures: the use of third-party remote video auditing and real-time feedback in healthcare.

    Science.gov (United States)

    Armellino, Donna; Hussain, Erfan; Schilling, Mary Ellen; Senicola, William; Eichorn, Ann; Dlugacz, Yosef; Farber, Bruce F

    2012-01-01

    Hand hygiene is a key measure in preventing infections. We evaluated healthcare worker (HCW) hand hygiene with the use of remote video auditing with and without feedback. The study was conducted in an 17-bed intensive care unit from June 2008 through June 2010. We placed cameras with views of every sink and hand sanitizer dispenser to record hand hygiene of HCWs. Sensors in doorways identified when an individual(s) entered/exited. When video auditors observed a HCW performing hand hygiene upon entering/exiting, they assigned a pass; if not, a fail was assigned. Hand hygiene was measured during a 16-week period of remote video auditing without feedback and a 91-week period with feedback of data. Performance feedback was continuously displayed on electronic boards mounted within the hallways, and summary reports were delivered to supervisors by electronic mail. During the 16-week prefeedback period, hand hygiene rates were less than 10% (3933/60 542) and in the 16-week postfeedback period it was 81.6% (59 627/73 080). The increase was maintained through 75 weeks at 87.9% (262 826/298 860). The data suggest that remote video auditing combined with feedback produced a significant and sustained improvement in hand hygiene.

  11. Modeling compositional dynamics based on GC and purine contents of protein-coding sequences

    KAUST Repository

    Zhang, Zhang; Yu, Jun

    2010-01-01

    Background: Understanding the compositional dynamics of genomes and their coding sequences is of great significance in gaining clues into molecular evolution and a large number of publically-available genome sequences have allowed us to quantitatively predict deviations of empirical data from their theoretical counterparts. However, the quantification of theoretical compositional variations for a wide diversity of genomes remains a major challenge.Results: To model the compositional dynamics of protein-coding sequences, we propose two simple models that take into account both mutation and selection effects, which act differently at the three codon positions, and use both GC and purine contents as compositional parameters. The two models concern the theoretical composition of nucleotides, codons, and amino acids, with no prerequisite of homologous sequences or their alignments. We evaluated the two models by quantifying theoretical compositions of a large collection of protein-coding sequences (including 46 of Archaea, 686 of Bacteria, and 826 of Eukarya), yielding consistent theoretical compositions across all the collected sequences.Conclusions: We show that the compositions of nucleotides, codons, and amino acids are largely determined by both GC and purine contents and suggest that deviations of the observed from the expected compositions may reflect compositional signatures that arise from a complex interplay between mutation and selection via DNA replication and repair mechanisms.Reviewers: This article was reviewed by Zhaolei Zhang (nominated by Mark Gerstein), Guruprasad Ananda (nominated by Kateryna Makova), and Daniel Haft. 2010 Zhang and Yu; licensee BioMed Central Ltd.

  12. Clinical and Imaging Findings in Childhood Posterior Reversible Encephalopathy Syndrome

    Science.gov (United States)

    GUNGOR, Serdal; KILIC, Betul; TABEL, Yilmaz; SELIMOGLU, Ayse; OZGEN, Unsal; YILMAZ, Sezai

    2018-01-01

    Objective Posterior reversible encephalopathy syndrome (PRES) is characterized by typical radiologic findings in the posterior regions of the cerebral hemispheres and cerebellum. The symptoms include headache, nausea, vomiting, visual disturbances, focal neurologic deficits, and seizures. The aim of this study is to evaluate the clinical and radiological features of PRES in children and to emphasize the recognition of atypical features. Materials & Methods We retrospectively examined 23 children with PRES from Mar 2010-Apr 2015 in Inonu University Turgut Ozal Medical Center in Turkey. We compared the clinical features and cranial MRI findings between underlying diseases of PRES. Results The most common precipitating factors were hypertension (78.2%) and medications, namely immunosuppressive and antineoplastic agents (60.8%). Manifestations included mental changes (100%), seizures (95.6%), headache (60.8%), and visual disturbances (21.7%) of mean 3.6 (range 1-10) days' duration. Cranial magnetic resonance imaging (MRI) showed bilateral occipital lesions in all patients, associated in 82.6% with less typical distribution of lesions in frontal, temporal or parietal lobes, cerebellum, corpus callosum, basal ganglia, thalamus, and brain stem. Frontal involvement was predominant, observed in 56.5% of patients. Clinical recovery was followed by radiologic resolution in all patients. Conclusion PRES is often unsuspected by the clinician, thus radiologists may be the first to suggest this diagnosis on an MRI obtained for seizures or encephalopathy. Atypical MRI finding is seen quite often. Rapid diagnosis and treatment are required to avoid a devastating outcome. PMID:29379559

  13. High microbial loads found in minimally-processed sliced mushrooms from Italian market

    Directory of Open Access Journals (Sweden)

    Haiyang Jiang

    2018-04-01

    Full Text Available There is an increased consumer interest in minimally processed vegetables that has led to the development of products, such as pre-cut sliced mushrooms. Few data are available on the hygienic condition and the presence of foodborne pathogens in such products. Therefore, the current study aimed to evaluate the safety and hygienic characteristics of both ready-to-eat and ready-to-cook, pre-cut sliced mushrooms obtained from a local Italian market. For the evaluation of the hygienic condition, the aerobic mesophilic bacteria, aerobic psychrotrophic bacteria and Escherichia coli enumerations were performed. Salmonella spp., Listeria monocytogenes and Campylobacter spp. were considered in the assessment of the foodborne pathogens. High microbial loads were detected, including counts higher than 5 log CFU/g for E. coli and 6 log CFU/g for the other bacteria counts considered, but no pathogens were found. Ready-to-eat and ready-to-cook products differed only for aerobic mesophilic counts (7.87 and 8.26 log CFU/g, respectively, P=0.003. Strategies to enhance the hygienic level of the mushrooms, particularly the ready-to-eat products, are needed.

  14. A study on the chemical stability and electrode performance of modified NiO cathodes for molten carbonate fuel cells

    International Nuclear Information System (INIS)

    Kim, Seung-Goo; Yoon, Sung Pil; Han, Jonghee; Nam, Suk Woo; Lim, Tae Hoon; Oh, In-Hwan; Hong, Seong-Ahn

    2004-01-01

    The chemical stabilities of modified NiO cathodes doped with 1.5 mol% CoO and 1.5 mol% LiCoO 2 fabricated by a conventional tape casting method were evaluated through the real MCFC single cell operation. The heat-treated samples before oxidation had proper porosities and microstructures for a MCFC cathode. At 150 mA cm -2 in current density, the MCFC single cell using a CoO-doped NiO cathode showed stable cell voltages in the range of 0.833-0.843 V for 1000 h. In contrast, the cell using a LiCoO 2 -doped NiO cathode with a maximum of 0.836 V at 500 h degraded to 0.826 V at 1000 h due to a wet seal breakdown at the cathode side. The amounts of nickel precipitated in the electrolytes of the cells using modified NiO cathodes doped with CoO and LiCoO 2 after the operation for 1000 h were 1.2 and 1.4 wt.%, respectively, which were about 60% lower than that of the standard cells using pure NiO cathodes. The enhanced chemical stability of modified NiO cathodes seems to be attributed to the fact that the presence of cobalt increases the lithium content in the cathodes by converting Ni 2+ to Ni 3+ , resulting in stabilizing the layered crystal structure

  15. No more broken hearts: weight loss after bariatric surgery returns patients' postoperative risk to baseline following coronary surgery.

    Science.gov (United States)

    Baimas-George, Maria; Hennings, Dietric L; Al-Qurayshi, Zaid; Emad Kandil; DuCoin, Christopher

    2017-06-01

    The obesity epidemic is associated with a rise in coronary surgeries because obesity is a risk factor for coronary artery disease. Bariatric surgery is linked to improvement in cardiovascular co-morbidities and left ventricular function. No studies have investigated survival advantage in postoperative bariatric patients after coronary surgery. To determine if there is a benefit after coronary surgery in patients who have previously undergone bariatric surgery. National Inpatient Sample. We performed a retrospective, cross-sectional analysis of the National Inpatient Sample database from 2003 to 2010. We selected bariatric surgical patients who later underwent coronary surgery (n = 257). A comparison of postoperative complications and mortality after coronary surgery were compared with controls (n = 1442) using χ 2 tests, linear regression analysis, and multivariate logistical regression models. A subset population was identified as having undergone coronary surgery (n = 1699); of this population, 257 patients had previously undergone bariatric surgery. They were compared with 1442 controls. The majority was male (67.2%), white (82.6%), and treated in an urban environment (96.8%). Patients with bariatric surgery assumed the risk of postoperative complications after coronary surgery that was associated with their new body mass index (BMI) (BMI999.9, 95% CI .18 to>999.9, P = .07). Length of stay was significantly longer in postbariatric patients (BMIbariatric patients have a return to baseline risk of morbidity and mortality after coronary surgery. Copyright © 2017 American Society for Bariatric Surgery. Published by Elsevier Inc. All rights reserved.

  16. Tissues and hair residues and histopathology in wild rats (Rattus rattus L.) and Algerian mice (Mus spretus Lataste) from an abandoned mine area (Southeast Portugal)

    International Nuclear Information System (INIS)

    Pereira, R.; Pereira, M.L.; Ribeiro, R.; Goncalves, F.

    2006-01-01

    Data gathered in this study suggested the exposure of rats and Algerian mice, living in an abandoned mining area, to a mixture of heavy metals. Although similar histopathological features were recorded in the liver and spleen of both species, the Algerian mouse has proved to be the strongest bioaccumulator species. Hair was considered to be a good biological material to monitor environmental contamination of Cr in rats. Significant positive associations were found between the levels of this element in hair/kidney (r = 0.826, n = 9, p < 0.01) and hair/liver (r = 0.697, n = 9, p = 0.037). Although no association was found between the levels of As recorded in the hair and in the organs, the levels of this element recorded in the hair, of both species, were significantly higher in animals captured in the mining area, which met the data from the organs analysed. Nevertheless, more studies will be needed to reduce uncertainty about cause-effect relationships. - The bioaccumulation of As and Cd and signs of renal histopathological injury proved the value of Algerian mice as a bioindicator species in the risk assessment of contaminated sites

  17. [Translation and validation of the Quebec User Evaluation of Satisfaction with Assistive Technology (QUEST 2.0) into Portuguese].

    Science.gov (United States)

    de Carvalho, Karla Emanuelle Cotias; Gois Júnior, Miburge Bolívar; Sá, Katia Nunes

    2014-01-01

    To translate and validate the Quebec User Evaluation of Satisfaction with Assistive Technology (QUEST 2.0) into Brazilian Portuguese. Certified translators translated and back-translated Quest. Content validity (CVI) was determined by 5 experts and, after the final version of B-Quest, a pre-test was applied to users of manual wheelchairs, walkers and crutches. The psychometric properties were tested to assure the validity of items and the reliability and stability of the scale. Data were obtained from 121 users of the above-mentioned devices. Our study showed a CVI of 91.66% and a satisfactory factor analysis referent to the two-dimensional structure of the instrument that ensured the representativeness of the items. The Cron-bach's alpha of the items device, service and total score of B-Quest were 0.862, 0.717 and 0.826, respectively. Test-retest stability conducted after a time interval of 2 months was analyzed using Spearman's correlation test, which showed high correlation (ρ >0.6) for most items. The study suggests that the B-Quest is a reliable, representative, and valid instrument to measure the satisfaction of users of assistive technology in Brazil. Copyright © 2014 Elsevier Editora Ltda. All rights reserved.

  18. Ocean variability over the Agulhas Bank and its dynamical connection with the southern Benguela upwelling system

    CSIR Research Space (South Africa)

    Blanke, B

    2009-12-01

    Full Text Available .8 4.9 South 1.97 �36.86 0.23 �228.5 212.4 35.08 0.20 14.7 4.6 West 0.79 �36.47 0.61 �129.3 149.9 35.10 0.17 15.3 3.7 North 0.35 �36.20 0.73 �78.6 82.6 35.13 0.11 15.9 2.7 Benguela 0.38 �35.84 0.75 �75.9 71.2 35.13 0.11 14.8 2.4 aSD, standard... the shelf edge but excursions into the open ocean do occur, either to the southwest of the Agulhas Bank or west of the Benguela upwelling system. Cross-shore movements take place as eddying pathways, because of capture by coherent structures...

  19. Total body calcium by neutron activation analysis in normals and osteoporotic populations: a discriminator of significant bone mass loss

    International Nuclear Information System (INIS)

    Ott, S.M.; Murano, R.; Lewellen, T.K.; Nelp, W.B.; Chesnut, C.M.

    1983-01-01

    Measurements of total body calcium by neutron activation (TBC) in 94 normal individuals and 86 osteoporotic patients are reported. The ability of TBC to discriminate normal from osteoporotic females was evaluated with decision analysis. Bone mineral content (BMC) by single-photon absorptiometry was also measured. TBC was higher in males (range 826 to 1363 gm vs 537 to 1054 in females) and correlated with height in all normals. In females over age 55 there was a negative correlation with age. Thus, for normals an algorithm was derived to allow comparison between measured TBC and that predicted by sex, age, and height (TBCp). In the 28 normal females over age 55, the TBC was 764 +/- 115 gm vs. 616 +/- 90 in the osteoporotics. In 63 of the osteoporotic females an estimated height, from tibial length, was used to predict TBC. In normals the TBC/TBCp ratio was 1.00 +/- 0.12, whereas in osteoporotic females it was 0.80 +/- 0.12. A receiver operating characteristic curve showed better discrimination of osteoporosis with TBC/TBCp than with wrist BMC. By using Bayes' theorem, with a 25% prevalence of osteoporosis (estimate for postmenopausal women), the posttest probability of disease was 90% when the TBC/TBCp ratio was less than 0.84. The authors conclude that a low TBC/TBCp ratio is very helpful in determining osteoporosis

  20. St. Louis demonstration final report: refuse processing plant equipment, facilities, and environmental evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Fiscus, D.E.; Gorman, P.G.; Schrag, M.P.; Shannon, L.J.

    1977-09-01

    The results are presented of processing plant evaluations of the St. Louis-Union Electric Refuse Fuel Project, including equipment and facilities as well as assessment of environmental emissions at both the processing and the power plants. Data on plant material flows and operating parameters, plant operating costs, characteristics of plant material flows, and emissions from various processing operations were obtained during a testing program encompassing 53 calendar weeks. Refuse derived fuel (RDF) is the major product (80.6% by weight) of the refuse processing plant, the other being ferrous metal scrap, a marketable by-product. Average operating costs for the entire evaluation period were $8.26/Mg ($7.49/ton). The average overall processing rate for the period was 168 Mg/8-h day (185.5 tons/8-h day) at 31.0 Mg/h (34.2 tons/h). Future plants using an air classification system of the type used at the St. Louis demonstration plant will need an emissions control device for particulates from the large de-entrainment cyclone. Also in the air exhaust from the cyclone were total counts of bacteria and viruses several times higher than those of suburban ambient air. No water effluent or noise exposure problems were encountered, although landfill leachate mixed with ground water could result in contamination, given low dilution rates.

  1. VizieR Online Data Catalog: Chemical properties of red MSX sources (RMSs) (Yu+, 2016)

    Science.gov (United States)

    Yu, N.; Xu, J.

    2017-05-01

    Our molecular line data come from the Millimetre Astronomy Legacy Team Survey at 90GHz (MALT90) (e.g., Foster+ 2011, J/ApJS/197/25; Jackson+ 2013PASA...30...57J). This project is performed with Mopra, a 22m single-dish radio telescope located near Coonabarabran in New South Wales, Australia. The angular resolution of Mopra is 38", with a beam efficiency between 0.49 at 86GHz and 0.42 at 115GHz. The pointing accuracy of the main MALT90 maps is about 8", and the absolute flux uncertainty is in the range of 10%-17% depending on the transition in question. The target clumps of this survey are selected from the 870um Atacama Pathfinder Experiment (APEX) Telescope Large Area Survey of the Galaxy (ATLASGAL; Schuller+ 2009A&A...504..415S; Contreras+ 2013, J/A+A/549/A45; superseded by J/A+A/568/A41). Using Australia Telescope Compact Array (ATCA), Urquhart+ (2007, J/A+A/461/11) observed radio emissions of 826 Red Midcourse Space Experiment (MSX) Sources (RMSs) in the southern sky. We also have checked our sources with the data taken from the Sydney University Molonglo Sky Survey (SUMSS) carried out at 843MHz with the Molonglo Observatory Synthesis Telescope (MOST; Mauch+ 2003, VIII/81). See section 2 for further explanations. (5 data files).

  2. [Work-related accidents in traditional fishermen from the Medium Araguaia River region, Tocantins, Brazil].

    Science.gov (United States)

    Garrone Neto, Domingos; Cordeiro, Ricardo Carlos; Haddad, Vidal

    2005-01-01

    This is a cross-sectional study of work-related accidents among traditional fishermen in the Medium Araguaia River region of Tocantins, Brazil. From June to August 2002, fishermen from the Municipality of Araguacema were interviewed about the organization of their work activities and work-related accidents during the previous six months. Of the 92 participating fishermen, 56 reported having suffered a work-related accident (annual incidence was 82.6%). Some 95.7% of those interviewed did not regularly pay social security insurance as self-employed workers and were not aware of their social rights and duties. For fishermen reporting accidents, this proportion was 98.2%. Approximately 23.0% had another work activity, mainly as construction workers (47.6%) or sport-fishing guides (23.9%). Injuries inflicted by aquatic animals were the main form of accidents (about 86.0%). From these results, it is apparent that accidents from aquatic animals are an important health hazard, in some cases causing temporary work incapacity.

  3. Adults with Attention Deficit Hyperactivity Disorder Report High Symptom Levels of Troubled Sleep, Restless Legs, and Cataplexy

    Directory of Open Access Journals (Sweden)

    Bjørn Bjorvatn

    2017-09-01

    Full Text Available Objective: To compare the occurrence of a spectrum of different self-reported sleep problems in adults with ADHD and a control group, and to study the impact of current ADHD medication use and clinical ADHD subtype.Method: Cross-sectional study of 268 clinically ascertained adult ADHD patients (DSM-IV criteria and 202 randomly selected controls. Sleep problems were self-reported using validated questions, partly from Global Sleep Assessment Questionnaire.Results: ADHD patients reported more sleep problems than controls: Lifetime occurrence of sleep problems (82.6 vs. 36.5%, hypnotics use (61.4 vs. 20.2%, current sleep duration below 6 h (26.6 vs. 7.6%, and symptoms/signs during the past 4 weeks of excessive daytime sleepiness, cataplexy, loud snoring, breathing pauses during sleep, restless legs, and periodic limb movements in sleep (significant odds ratios ranged from 1.82 to 14.55. Current ADHD medication use was associated with less cataplexy compared with not using medication. Patients with inattentive subtype reported better sleep quality and less restless legs than patients with hyperactive/impulsive subtypes.Conclusions: Adults with ADHD reported a very high occurrence of many different self-reported sleep problems, underlining the importance of screening for sleep disorders. Among the ADHD patients, medication use was not associated with more sleep-related symptoms, but in fact less cataplexy. When comparing ADHD subtypes, the inattentive subtype was associated with less sleep problems.

  4. Physical Activity, Sedentary Behavior and the Risk of Overweight and Obesity in School-Aged Children.

    Science.gov (United States)

    Keane, Eimear; Li, Xia; Harrington, Janas M; Fitzgerald, Anthony P; Perry, Ivan J; Kearney, Patricia M

    2017-08-01

    Globally, public health policies are targeting modifiable lifestyle behaviors. We explore the independent association of moderate-to-vigorous physical activity (MVPA) and sedentary behavior on the risk of childhood overweight/obesity. A cross-sectional survey of children aged 8-11 years (N = 826). Objective body mass index was used to classify children as normal weight or overweight/obese. Children wore wrist-worn Geneactiv accelerometers for 7-days and thresholds were applied to categorize MVPA and sedentary time. Screen time (ST) was parent reported. Poisson regression examined the independent association of (1) MVPA (2), objective sedentary time and (3) ST on the risk of overweight/obesity. Overall, 23.7% (95% CI, 20.8-26.6%) of children were overweight/obese. On average, children spent 10.8% of waking time at MVPA and 61.3% sedentary. One-fifth (22.1%, 95% CI, 19.3-25.0%) of children achieved MVPA recommendations (≥ 60 min each day) and 17.5% (95% CI, 14.9-20.1%) met ST recommendations (overweight/obese independent of total sedentary time. Total time spent sedentary was not associated with overweight/obese independent of MVPA. ST was associated with an increased risk of overweight/obese independent of physical activity. Few schoolchildren met physical activity and screen time recommendations suggesting population based measures are needed.

  5. Preparation and Characterization of Biochars from Eichornia crassipes for Cadmium Removal in Aqueous Solutions.

    Directory of Open Access Journals (Sweden)

    Feng Li

    Full Text Available The study investigated the preparation and characterization of biochars from water hyacinth at 300°C to 700°C for cadmium (Cd removal from aqueous solutions. The adsorption process was dominated by oxygen-containing functional groups with irregular surfaces via esterification reactions. Furthermore, the mineral components in the biochars also contributed to Cd absorption through precipitation. Parameters such as the effects of solution pH, contact time, and initial concentration were studied. The optimum pH value was observed at 5.0, in which nearly 90% of Cd was removed. The maximum Cd adsorption capacities based on the Langmuir isotherm were calculated at 49.837, 36.899, and 25.826 mg g(-1. The adsorption processes of the biochars followed the pseudo-second-order kinetics, with the equilibrium achieved around 5 h. The biochar from E. crassipes is a promising adsorbent for the treatment of wastewater, which can in turn convert one environmental problem to a new cleaning Technology.

  6. Preparation and Characterization of Biochars from Eichornia crassipes for Cadmium Removal in Aqueous Solutions.

    Science.gov (United States)

    Li, Feng; Shen, Kaixuan; Long, Xiaolin; Wen, Jiasheng; Xie, Xiaojie; Zeng, Xiangyun; Liang, Yanyan; Wei, Yansha; Lin, Zefeng; Huang, Wenrou; Zhong, Ruida

    2016-01-01

    The study investigated the preparation and characterization of biochars from water hyacinth at 300°C to 700°C for cadmium (Cd) removal from aqueous solutions. The adsorption process was dominated by oxygen-containing functional groups with irregular surfaces via esterification reactions. Furthermore, the mineral components in the biochars also contributed to Cd absorption through precipitation. Parameters such as the effects of solution pH, contact time, and initial concentration were studied. The optimum pH value was observed at 5.0, in which nearly 90% of Cd was removed. The maximum Cd adsorption capacities based on the Langmuir isotherm were calculated at 49.837, 36.899, and 25.826 mg g(-1). The adsorption processes of the biochars followed the pseudo-second-order kinetics, with the equilibrium achieved around 5 h. The biochar from E. crassipes is a promising adsorbent for the treatment of wastewater, which can in turn convert one environmental problem to a new cleaning Technology.

  7. Decreased total antioxidant capacity and increased oxidative stress in passive smoker infants and their mothers.

    Science.gov (United States)

    Aycicek, Ali; Erel, Ozcan; Kocyigit, Abdurrahim

    2005-12-01

    Smoking has many adverse health effects in infants and adults. The purpose of the study was to study the effect of passive cigarette smoking on oxidative and antioxidative status of plasma in passive smoker infants and their mothers and to compare with those of non-smokers. Subjects were randomly chosen from infants aged 8-26 weeks and their mothers aged 20-34 years. Passive smoker infants (n = 29) and their mothers (n = 29) were defined as having other family members who smoked six or more cigarettes per day continually for at least 8 weeks. Non-smokers were defined as infants (n = 30) and their mothers (n = 24) who had never been exposed to passive smoking. The antioxidative status of plasma were perused by measuring the total antioxidant capacity. Oxidative status was evaluated by predicating total peroxide level, oxidative stress index, protein oxidation and lipid peroxidation. Plasma concentrations of total antioxidant capacity were significantly lower in passive smoker infants and their mothers than non-passive smoker infants and their mothers. However, lipid peroxidation and oxidative stress index were remarkably higher in passive smoker infants and their mothers than those of non-passive smoker infants and their mothers. There were significant correlations between the oxidative and antioxidative parameters of the passive smoker infants and their mothers. Oxidants are increased and antioxidants are decreased in passive smoker infants and their mothers than those of non-smokers. Passive smoker infants and their mothers are exposed to potent oxidative stress.

  8. Cumulative Effect of Racial Discrimination on the Mental Health of Ethnic Minorities in the United Kingdom.

    Science.gov (United States)

    Wallace, Stephanie; Nazroo, James; Bécares, Laia

    2016-07-01

    To examine the longitudinal association between cumulative exposure to racial discrimination and changes in the mental health of ethnic minority people. We used data from 4 waves (2009-2013) of the UK Household Longitudinal Study, a longitudinal household panel survey of approximately 40 000 households, including an ethnic minority boost sample of approximately 4000 households. Ethnic minority people who reported exposure to racial discrimination at 1 time point had 12-Item Short Form Health Survey (SF-12) mental component scores 1.93 (95% confidence interval [CI] = -3.31, -0.56) points lower than did those who reported no exposure to racial discrimination, whereas those who had been exposed to 2 or more domains of racial discrimination, at 2 different time points, had SF-12 mental component scores 8.26 (95% CI = -13.33, -3.18) points lower than did those who reported no experiences of racial discrimination. Controlling for racial discrimination and other socioeconomic factors reduced ethnic inequalities in mental health. Cumulative exposure to racial discrimination has incremental negative long-term effects on the mental health of ethnic minority people in the United Kingdom. Studies that examine exposure to racial discrimination at 1 point in time may underestimate the contribution of racism to poor health.

  9. Evaluating Midwives Communication Skills from the Perspective of Parturient Women Attending to Hospitals for Delivery

    Directory of Open Access Journals (Sweden)

    Maryam Sadat Katebi

    2017-04-01

    Full Text Available Background & aim: Communication is a fundamental human need. Medical students and healthcare professionals must be attuned to the needs of patients using effective communication skills. With regards to medical training, currently the focus is on theoretical matters and communication skills are taken for granted. This problem has caused miscommunication with patients referred to teaching hospitals. We conducted this study to assess communication skills of midwives from the perspective of parturient women. Methods: In this descriptive study, we evaluated 50 midwives working in maternity wards of Ghaem, Imam Reza, Omolbanin, and Hasheminejad hospitals in Mashhad, Iran. Three parturient women were selected per one midwife in a maternity ward. The parturient women participating in this study were in labor, delivery, admission or postpartum stages and completed the Interpersonal Communication Skills inventory by interview. To analyze the data, descriptive statistics, t-test, ANOVA, and Pearson product-moment correlation were performed, using SPSS 16. Results: The mean scores of communication behaviors of midwives with parturient in delivery, admission, and postpartum stages were 92.61±10.81, 93.31±10.59, and 94.19±8.26, respectively. Between the previous delivery of parturient, with communication behavior of midwives in the stage of admiss­ion or post-partum (P=0.015 and satisfaction of pregnancy with communication behavior of midwife in labor stage (P

  10. THE SLOAN DIGITAL SKY SURVEY QUASAR LENS SEARCH. V. FINAL CATALOG FROM THE SEVENTH DATA RELEASE

    International Nuclear Information System (INIS)

    Inada, Naohisa; Oguri, Masamune; Kayo, Issha; Fukugita, Masataka; Shin, Min-Su; Strauss, Michael A.; Bahcall, Neta A.; Morokuma, Tomoki; Rusu, Cristian E.; Kochanek, Christopher S.; Richards, Gordon T.; Schneider, Donald P.; York, Donald G.; Frieman, Joshua A.; Hall, Patrick B.; White, Richard L.

    2012-01-01

    We present the final statistical sample of lensed quasars from the Sloan Digital Sky Survey (SDSS) Quasar Lens Search (SQLS). The well-defined statistical lens sample consists of 26 lensed quasars brighter than i = 19.1 and in the redshift range of 0.6 < z < 2.2 selected from 50,826 spectroscopically confirmed quasars in the SDSS Data Release 7 (DR7), where we restrict the image separation range to 1'' < θ < 20'' and the i-band magnitude differences in two images to be smaller than 1.25 mag. The SDSS DR7 quasar catalog also contains 36 additional lenses identified with various techniques. In addition to these lensed quasars, we have identified 81 pairs of quasars from follow-up spectroscopy, 26 of which are physically associated binary quasars. The statistical lens sample covers a wide range of image separations, redshifts, and magnitudes, and therefore is suitable for systematic studies of cosmological parameters and surveys of the structure and evolution of galaxies and quasars.

  11. Effectiveness of an intervention on uptake of maternal care in four counties in Ningxia, China.

    Science.gov (United States)

    Zhou, Hong; Zhao, Chun-Xia; Wang, Xiao-Li; Xv, Yi-Chong; Shi, Ling; Wang, Yan

    2012-12-01

    To understand the utilisation of prenatal care and hospitalised delivery among pregnant Muslim women in Ningxia, China, and to explore the effectiveness of the integrated interventions to reduce maternal mortality. Cross-sectional surveys before and after the intervention were carried out. Using multistage sampling, 1215 mothers of children <5 years old were recruited: 583 in the pre-intervention survey and 632 in the post-intervention study. Data on prenatal care and delivery were collected from face-to-face interviews. Maternal mortality ratio (MMR) data were obtained from the local Maternal and Child Mortality Report System. After the intervention, the MMR significantly decreased (45.5 deaths per 100,000 live births to 32.7 deaths). Fewer children were born at home after the intervention than before the intervention (OR, 0.11; 95% CI, 0.08-0.15). The proportion of women who attended prenatal care at least once increased from 78.2% to 98.9% (OR, 24.55; 95% CI, 11.37-53.12). The proportion of women who had prenatal visit(s) in the first trimester of pregnancy increased from 35.1% to 82.6% (OR, 8.77; 95% CI, 6.58-11.69). The quality of prenatal care was greatly improved. Effects of the intervention on the utilisation of maternal care remained significant after adjusting for education level and household possessions. The findings suggest that integrated strategies can effectively reduce maternal mortality. © 2012 Blackwell Publishing Ltd.

  12. Tracking of Ball and Players in Beach Volleyball Videos

    Science.gov (United States)

    Gomez, Gabriel; Herrera López, Patricia; Link, Daniel; Eskofier, Bjoern

    2014-01-01

    This paper presents methods for the determination of players' positions and contact time points by tracking the players and the ball in beach volleyball videos. Two player tracking methods are compared, a classical particle filter and a rigid grid integral histogram tracker. Due to mutual occlusion of the players and the camera perspective, results are best for the front players, with 74,6% and 82,6% of correctly tracked frames for the particle method and the integral histogram method, respectively. Results suggest an improved robustness against player confusion between different particle sets when tracking with a rigid grid approach. Faster processing and less player confusions make this method superior to the classical particle filter. Two different ball tracking methods are used that detect ball candidates from movement difference images using a background subtraction algorithm. Ball trajectories are estimated and interpolated from parabolic flight equations. The tracking accuracy of the ball is 54,2% for the trajectory growth method and 42,1% for the Hough line detection method. Tracking results of over 90% from the literature could not be confirmed. Ball contact frames were estimated from parabolic trajectory intersection, resulting in 48,9% of correctly estimated ball contact points. PMID:25426936

  13. Effects of Beetroot Juice Supplementation on a 30-s High-Intensity Inertial Cycle Ergometer Test

    Directory of Open Access Journals (Sweden)

    Raul Domínguez

    2017-12-01

    Full Text Available Background: Beetroot juice (BJ is rich in inorganic nitrates and has proved effective at increasing blood nitric oxide (NO levels. When used as a supplement BJ has shown an ergogenic effect on cardiorespiratory resistance exercise modalities, yet few studies have examined its impact on high intensity efforts. Objective: To assess the effects of BJ intake on anaerobic performance in a Wingate test. Methods: Fifteen trained men (age 21.46 ± 1.72 years, height 1.78 ± 0.07 cm and weight 76.90 ± 8.67 kg undertook a 30-s maximum intensity test on an inertial cycle ergometer after drinking 70 mL of BJ (5.6 mmol NO3− or placebo. Results: Despite no impacts of BJ on the mean power recorded during the test, improvements were produced in peak power (6% (p = 0.034, average power 0–15 s (6.7% (p = 0.048 and final blood lactate levels (82.6% (p < 0.001, and there was a trend towards a shorter time taken to attain peak power (−8.4% (p = 0.055. Conclusions: Supplementation with BJ has an ergonomic effect on maximum power output and on average power during the first 15 s of a 30-s maximum intensity inertial cycle ergometer test.

  14. Value of 3D-Volume Rendering in the Assessment of Coronary Arteries with Retrospectively Ecg-Gated Multislice Spiral CT

    International Nuclear Information System (INIS)

    Mahnken, A.H.; Wildberger, J.E.; Dedden, K.; Schmitz-Rode, T.; Guenther, R.W.; Sinha, A.M.; Hoffmann, R.; Stanzel, S.

    2003-01-01

    Purpose: To assess the diagnostic value and measurement precision of 3D volume rendering technique (3D-VRT) from retrospectively ECG-gated multislice spiral CT (MSCT) data sets for imaging of the coronary arteries. Material and Methods: In 35 patients, retrospectively ECG-gated MSCT of the heart using a four detector row MSCT scanner with a standardized examination protocol was performed as well as quantitative X-ray coronary angiography (QCA). The MSCT data was assessed on segmental basis using 3D-VRT exclusively. The coronary artery diameters were measured at the origin of each main coronary branch and 1 cm, 3 cm and 5 cm distally. The minimum, maximum and mean diameters were determined from MSCT angiography and compared to QCA. Results: A total of 353 of 525 (67.2%) coronary artery segments were assessable by MSCT angiography. The proximal segments were more often assessable when compared to the distal segments. Stenoses were detected with a sensitivity of 82.6% and a specificity of 92.8%. According to the Bland-Altman method the mean differences between QCA and MSCT ranged from 0.55 to 1.07 mm with limits of agreement from 2.2 mm to 2.7 mm. Conclusion: When compared to QCA, the ability of 3D-VRT to quantitatively assess coronary artery diameters and coronary artery stenoses is insufficient for clinical purposes

  15. Modification of cassava starch using combination process lactic acid hydrolysis and micro wave heating to increase coated peanut expansion quality

    Science.gov (United States)

    Sumardiono, Siswo; Pudjihastuti, Isti; Jos, Bakti; Taufani, Muhammad; Yahya, Faad

    2017-05-01

    Modified cassava starch is very prospective products in the food industry. The main consideration of this study is the increasing volume of imported wheat and the demand for modified cassava starch industry. The purpose of this study is the assessing of lactic acid hydrolysis and microwave heating impact to the physicochemical and rheological properties of modified cassava starch, and test applications of modified cassava starch to coated peanut expansion quality. Experimental variables include the concentration of lactic acid (0.5% w/w, 1% w/w; 2% w/w), a time of hydrolysis (15, 30, 45 minutes), a time of microwave heating (1, 2, 3 hours). The research step is by dissolving lactic acid using aquadest in the stirred tank reactor, then added cassava starch. Hydrolysed cassava starch was then heated by microwave. Physicochemical properties and rheology of the modified cassava starch is determined by the solubility, swelling power, and test congestion. The optimum obtained results indicate that solubility, swelling power, congestion test, respectively for 19.75%; 24.25% and 826.10% in the hydrolysis treatment for 15 minutes, 1% w lactic acid and microwave heating 3 hours. The physicochemical and rheological properties of modified cassava starch have changed significantly when compared to the native cassava starch. Furthermore, these modified cassava starch are expected to be used for the substitution of food products.

  16. Self-transcendence in older men attending a prostate cancer support group.

    Science.gov (United States)

    Chin-A-Loy, S S; Fernsler, J I

    1998-10-01

    Self-transcendence has been shown to be related to well-being in older adults, women with breast cancer, women with AIDS, gay men with AIDS, and a healthy population. The purpose of this descriptive pilot study was to examine self-transcendence in another high-priority population: older men with prostate cancer. A convenience sample of 23 men, age 60 and older (M = 69), from three prostate cancer support groups completed Reed's Self-Transcendence Scale (STS) and a demographic data form. The men were predominantly white (82.6%), of the Catholic faith (56.5%), married (78.3%), and not working (87.0%). Over half (65.2%) had a college degree or higher; most viewed their health as good (69.6%) or excellent (21.7%); and the majority (56.5%) viewed their prostate cancer as affecting some of their daily activities. These men scored high on the STS (M = 50.07), which was consistent with previous findings in other populations. Findings of this study contribute to Reed's middle-range theory of self-transcendence. The discovery that self-transcendence is relevant to this group of older men with prostate cancer provides a basis for nurses to investigate the phenomenon in this population and help their clients explore the benefits of the self-transcendence resource.

  17. Three-Dimensional Modeling May Improve Surgical Education and Clinical Practice.

    Science.gov (United States)

    Jones, Daniel B; Sung, Robert; Weinberg, Crispin; Korelitz, Theodore; Andrews, Robert

    2016-04-01

    Three-dimensional (3D) printing has been used in the manufacturing industry for rapid prototyping and product testing. The aim of our study was to assess the feasibility of creating anatomical 3D models from a digital image using 3D printers. Furthermore, we sought face validity of models and explored potential opportunities for using 3D printing to enhance surgical education and clinical practice. Computed tomography and magnetic resonance images were reviewed, converted to computer models, and printed by stereolithography to create near exact replicas of human organs. Medical students and surgeons provided feedback via survey at the 2014 Surgical Education Week conference. There were 51 respondents, and 95.8% wanted these models for their patients. Cost was a concern, but 82.6% found value in these models at a price less than $500. All respondents thought the models would be useful for integration into the medical school curriculum. Three-dimensional printing is a potentially disruptive technology to improve both surgical education and clinical practice. As the technology matures and cost decreases, we envision 3D models being increasingly used in surgery. © The Author(s) 2015.

  18. Taxonomic survey of Drosophilidae (Diptera) from mangrove forests of Santa Catarina Island, Southern Brazil.

    Science.gov (United States)

    Schmitz, Hermes J; Valente, Vera L S; Hofmann, Paulo R P

    2007-01-01

    Assemblages of drosophilids have been characterised in several environments of the Brazilian territory, like the Atlantic Rain Forest, urban areas, cerrados, the Amazon Forest, and others. The present survey is the first attempt to characterise the fauna of Drosophilidae in mangrove forests, an environment typical of tropical coasts worldwide. Twenty-eight samples were collected from the three main mangrove forests of Santa Catarina Island, southern Brazil, using banana-baited traps hung in trees. Samples were taken in January (summer), April (autumn), July (winter) and October (spring) between July 2002 and July 2005. In total, 82,942 specimens of drosophilids were caught, belonging to 69 species of six genera - Amiota Loew, Drosophila Fallén, Leucophenga Mik, Scaptodrosophila Duda, Zaprionus Coquillett and Zygothrica Wiedemann. The high abundance of D. simulans Sturtevant was remarkable, with some notable peaks of D. malerkotliana Parshad & Paika in autumn samples. Other common species were Zaprionus indianus Gupta, D. mediostriata Duda and D. willistoni Sturtevant. We also collected 45,826 flies of family Curtonotidae, the sister-group of Drosophilidae virtually absent in other environments. The assemblages of drosophilids were very similar in the three mangrove forests surveyed, despite the different surrounding environments. In general, the species sampled in the mangroves were the same as those observed in the surrounding environments, but in varying abundances. This suggests that drosophilids are differently affected by environmental pressures operating in mangroves.

  19. Subureteral Injection with Small-Size Dextranomer/Hyaluronic Acid Copolymer: Is It Really Efficient?

    Directory of Open Access Journals (Sweden)

    Iyimser Üre

    2016-01-01

    Full Text Available The aim of this study was to evaluate the clinical results of patients with vesicoureteral reflux, which were treated with subureteral injection of small-size (80–120 μm dextranomer/hyaluronic acid copolymer (Dx/HA. Data of 75 children (105 renal units who underwent STING procedure with small-size Dx/HA for the treatment of vesicoureteral reflux (VUR in our clinic between 2008 and 2012 were retrospectively analyzed. Preoperative reflux grade and side, injection indication, postoperative urinary infections and urinary symptoms, voiding cystourethrogram, and renal scintigraphy results were evaluated. The success rate of the procedure was 100% in patients with grades 1 and 2 reflux, 91% in patients with grade 3 reflux, and 82.6% in patients with grade 4. Overall success rate of the treated patients was 97%. Endoscopic subureteric injection with Dx/HA procedure has become a reasonable minimally invasive alternative technique to open surgery, long-term antibiotic prophylaxis, and surveillance modalities in treatment of VUR in terms of easy application, low costs and complication rates, and high success rates. Injection material composed of small-size dextranomer microspheres seems superior to normal size Dx/HA, together with offering similar success with low cost.

  20. Effect of probiotics on vaginal health in pregnancy. EFFPRO, a randomized controlled trial.

    Science.gov (United States)

    Gille, Christian; Böer, Bettina; Marschal, Matthias; Urschitz, Michael S; Heinecke, Volker; Hund, Verena; Speidel, Sarah; Tarnow, Inge; Mylonas, Ioannis; Franz, Axel; Engel, Corinna; Poets, Christian F

    2016-11-01

    Preterm delivery is a leading cause of neonatal morbidity and death. It often results from chorioamnionitis, which is a complication of bacterial vaginosis. Probiotics are effective in the treatment of bacterial vaginosis in women who were not pregnant; studies in pregnant woman are missing. The purpose of this study was to evaluate whether an oral probiotic food supplement supports the maintenance or restoration of a normal vaginal microbiota during pregnancy. We conducted a randomized, placebo-controlled, triple-blind, parallel group trial. Oral Lactobacillus rhamnosus GR-1and L reuteri RC-14 (10 9 colony-forming units) or placebo were administered for 8 weeks to women with Vaginal swabs were taken before and after intervention and analyzed according to the Nugent scoring system. Telephone interviews were performed before and after intervention and after delivery. Primary outcome was the proportion of swabs with normal Nugent score (Vaginal swabs were analyzed from 290 women before and 271 women after intervention. The proportion of normal vaginal microbiota decreased from 82.6 to 77.8% in the treatment group and from 79.1 to 74.3% in the placebo group, with no significant difference across groups after intervention (P=.297). Oral probiotics may be suitable for implementation in antenatal care but, as administered here, had no effect on vaginal health during mid gestation. Other application routes or probiotic preparations may be more effective in supporting vaginal microbiota during pregnancy. Copyright © 2016 Elsevier Inc. All rights reserved.

  1. Is complementary and alternative medicine effective in job satisfaction among dentists with musculoskeletal disorders? A cross sectional study.

    Science.gov (United States)

    Gupta, Devanand; Bhaskar, Dara John; Gupta, Rajendra Kumar; Jain, Ankita; Yadav, Priyanka; Dalai, Deepak Ranjan; Singh, Rajeshwar; Singh, Nisha; Chaudhary, Varunjeet; Singh, Ankit; Yadav, Ankit; Karim, Bushra

    2014-01-01

    Musculoskeletal disorders have serious impact on the profession of dentistry. There is common occurrence of pain due to incorrect posture in dental professionals. Complementary and alternative medicine (CAM) therapies may cast a new light on preventing and intercepting musculoskeletal disorders (MSD). An epidemiological study was conducted in an effort to contribute to the prevention of musculoskeletal disorders in dentistry. The purpose of this study was to determine the prevalence of MSD at dentists using CAM as a treatment and preventive modality for MSD and to compare job/career satisfaction between dentists who use CAM and conventional therapy (CT). Dentists registered in Uttrakhand state, India, under the Dental Council of India and registered members of the Indian Dental Association, Uttrakhand branch (N = 1496) were surveyed. Statistical analysis was conducted using SPSS 17. A response rate of 84% (N = 1257) was obtained, revealing that 90% (N = 1131) had the problem of MSD. Seventy three percentage (N = 826) of dentists with MSD reported the use of CAM and CT. Complementary and alternative medicine users reported greater overall health (72.7% vs. 51%, p alternative medicine therapies may improve quality of life, reduce work interruption and enhance job satisfaction for dentists who suffers from MSD. Through the course of their studies, dentists should be equipped with knowledge on ergonomics and CAM therapies, such as yoga and others, to help them prevent musculoskeletal disorders more effectively.

  2. Use of Dietary Supplements among Professional Athletes in Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Sulaiman O. Aljaloud

    2013-01-01

    Full Text Available The objective of this study was to understand the usage patterns of dietary supplements among professional athletes in Saudi Arabia. The survey consisted of sixteen questions divided into four categories: use of supplements, reason for consumption of supplements, personal beliefs about supplements, and behavior. The questionnaires were given to the three teams residing in Riyadh: Al Hilal, Al Nasr, and Al-Shabab. Out of the 105 athletes surveyed, we found that only 98 are currently taking dietary supplements and the mean age and standard deviation were 25.74±2.90. The survey results showed a high percentage of athletes (93.3%; n=98 using different dietary supplements throughout the season, 43.8% (n=43 reported using supplements for performance, and 32.6% (n=32 believed in health benefits as a reason for using dietary supplements. Our results showed that a total of 87 (88.7%, 81 (82.6%, and 51 (52.0% athletes are consuming sports drinks, vitamin C, and multivitamins, respectively. Meanwhile, those supplements ranking among the least used included omega 6 (18.6%, creatine (16.3%, and Ginkgo biloba (10.2%. A majority of athletes indicated that their use of supplements was for the purpose of improving their health and performance.

  3. Endoscopic Retrograde Cholangiopancreatography Using a Dual-Lumen Endogastroscope for Patients with Billroth II Gastrectomy

    Directory of Open Access Journals (Sweden)

    Wei Yao

    2013-01-01

    Full Text Available Objective. To evaluate the safety and efficacy of a dual-lumen forward-viewing endoscope for ERCP in patients with prior Billroth II gastrectomy. Methods. The records of 46 patients treated with ERCP by a dual-lumen forward-viewing endoscope after Billroth II gastrectomy from 2007 to 2012 were reviewed. Results. The success rate of selective cannulation was 82.6% (38/46. Of the 38 cases with successful selective cannulation, endoscopic sphincterotomy was achieved in 23 cases by placing the needle knife through the 2nd lumen, while endoscopic papillary balloon dilatation was conducted in the other 15 cases. Of the 8 failed cases of selective cannulation, 6 had failed afferent loop intubation, and 3 of these 6 patients had Braun’s anastomosis. The safety and efficacy of catheter-assisted endoscopic sphincterotomy were increased by placing the needle knife through the 2nd lumen without altering the conventional endoscopic sphincterotomy procedure. Conclusions. A dual-lumen forward-viewing endoscope can be safely and effectively used to perform ERCP in patients with a Billroth II gastrectomy, except for patients with additional Braun’s anastomosis.

  4. PERBANDINGAN MAINTAINABILITY, FLEKSIBILITY, TESTABILITY PADA CMS OPEN SOURCE E-COMMERCE

    Directory of Open Access Journals (Sweden)

    Rini Anggrainingsih

    2017-09-01

    Full Text Available Content Management System (CMS open source banyak digunakan dalam website e-commerce. CMS open source e-commerce tumbuh semakin canggih dan lebih kompetitif. Artikel ini berisi perbandingan kualitas software dari top three CMS open sourece e-commerce yaitu Magento, Woocomerce,dan OpenCart. perbandingan dilakukan terhadap kualitas revision software yaitu maintainability, fleksibility, dan testability. Kualitas revison diuji sebab maintenance dan testing merupakan proses yang sangat penting dalam pembuatan sebuah software dan memerlukan banyak resource. Pengukuran dilakukan dengan menggunakan phpmetric untuk menghitung maintainability index, afferent coupling, efferent couping, lack of cohesion method, cyclomatic complexity. Tujuan dari penulisan artikel ini adalah untuk menentukkan open source e-commerce terbaik dalam proses maintenance, adaptasi, dan modifikasi. Hasil menunjukkan bahwa magento memiliki kemampuan terbaik untuk maintenance, testing, dan perubahan kode dibandingkan Woocommerce dan Opencart, dimana nilai maintainaility indenxnya 111,36, afferent coupling 0,826, efferent coupling 1,83, Lack of cohesion method 2,10 dan Cyclomatic Complexity 11,02.

  5. Relationship between soybean yield/quality and soil quality in a major soybean-producing area based on a 2D-QSAR model

    Science.gov (United States)

    Gao, Ming; Li, Shiwei

    2017-05-01

    Based on experimental data of the soybean yield and quality from 30 sampling points, a quantitative structure-activity relationship model (2D-QSAR) was established using the soil quality (elements, pH, organic matter content and cation exchange capacity) as independent variables and soybean yield or quality as the dependent variable, with SPSS software. During the modeling, the full data set (30 and 14 compounds) was divided into a training set (24 and 11 compounds) for model generation and a test set (6 and 3 compounds) for model validation. The R2 values of the resulting models and data were 0.826 and 0.808 for soybean yield and quality, respectively, and all regression coefficients were significant (P test set were 0.961 and 0.956, respectively, indicating that the models had a good predictive ability. Moreover, the Mo, Se, K, N and organic matter contents and the cation exchange capacity of soil had a positive effect on soybean production, and the B, Mo, Se, K and N contents and cation exchange coefficient had a positive effect on soybean quality. The results are instructive for enhancing soils to improve the yield and quality of soybean, and this method can also be used to study other crops or regions, providing a theoretical basis to improving the yield and quality of crops.

  6. The impact of low-dose aspirin on preterm birth: secondary analysis of a randomized controlled trial.

    Science.gov (United States)

    Allshouse, A A; Jessel, R H; Heyborne, K D

    2016-06-01

    The objective of this study is to determine whether low-dose aspirin (LDA) reduced the rate of preterm birth (PTB) in a cohort of women at high risk for preeclampsia. Secondary analysis of the Maternal-Fetal Medicine Units High-Risk Aspirin trial. Preterm births were categorized by phenotype: indicated, spontaneous or due to preterm premature rupture of membranes (PPROMs). Of 1789 randomized women, 30.5% delivered before 37 weeks (18.5% indicated, 5.8% spontaneous and 6.2% following preterm PPROMs). Among women randomized to LDA, we observed a trend favoring fewer PTBs due to spontaneous preterm labor and preterm PPROMs, odds ratio (OR: 0.826 (0.620, 1.099)); the incidence of indicated PTBs appeared unchanged, OR: 0.999 (0.787, 1.268). Although not reaching significance, we observed an effect size similar to other studies of both low- and high-risk women. These results support findings from other studies assessing LDA as a PTB prevention strategy.

  7. Sugarcane bagasse hydrolysate as a potential feedstock for red pigment production by Monascus ruber.

    Science.gov (United States)

    Terán Hilares, Ruly; de Souza, Rebeca Andrade; Marcelino, Paulo Franco; da Silva, Silvio Silvério; Dragone, Giuliano; Mussatto, Solange I; Santos, Júlio César

    2018-04-15

    Sugarcane bagasse (SCB) hydrolysate could be an interesting source for red pigment production by Monascus ruber Tieghem IOC 2225. The influence of different wavelength of light-emitting diode (LED) at 250 μmol.m -2 .s -1 of photon flux density on red pigment production by M. ruber in glucose-based medium was evaluated. Then, SCB hydrolysate was used as carbon source under the previously selected light incidence conditions. In glucose-based medium, the highest pigment production was achieved in fermentation assisted with orange LED light (8.28 UA 490nm ), white light (8.26 UA 490nm ) and under dark condition (7.45 UA 490nm ). By using SCB hydrolysate-based medium, the highest red pigment production (18.71 AU 490nm ) was achieved under dark condition and the glucose and cellobiose present in the hydrolysate were metabolized. SCB enzymatic hydrolysate was demonstrated to be a promising carbon source for high thermal stability red pigment production (activation energy of 10.5 kcal.mol -1 ), turning an interesting alternative for implementation in biorefineries. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Application of foam column as green technology for concentration of saponins from sisal (Agave sisalana and Juá (Ziziphus joazeiro

    Directory of Open Access Journals (Sweden)

    B. D. Ribeiro

    2013-12-01

    Full Text Available Saponins, molecules classified as triterpenic or steroidal glycosides, are metabolites distributed in all the plant kingdom that can be used for the production of foods, cosmetics, and pharmaceuticals, as well as in soil bioremediation. Saponins are normally extracted from natural resources with water, ethanol and/or methanol, and then concentrated by liquid-liquid partitioning with n-butanol. An alternative concentration method is with a foam column, by which the saponins can be concentrated via preferential adsorption at a gas-liquid interface. Therefore, the objective of this work was the use of a foam column for the concentration of saponins from juá and sisal, evaluating parameters such as: initial working volume in the column, saponin concentration in the extracts from juá and sisal, air flow rate, pH, Raschig rings loading and operation time. When a gradient air flow rate and 25 g of Raschig rings were used, 82.6% of the jua saponins loaded onto the system were recovered in a 3.46-fold concentrated solution after 9 h of operation. Regarding sisal saponins, a concentration factor of 1.98 was observed with 90.5% of saponin recovery during 4.5 h of operation.

  9. Governmental guarantee responsibility and the provision of security of connection and supply in the energy sector.; Staatliche Gewaehrleistungsverantwortung und die Sicherstellung von Anschluss und Versorgung im Bereich der Energiewirtschaft

    Energy Technology Data Exchange (ETDEWEB)

    Schiller, Marcus

    2012-07-01

    The present study is confined to an investigation of the regulations of the Energy Economy Law regarding connection and supply. Other possible contractual claims pursuant to Art. 826 of the German Civil Code or the prohibition of monopoly abuse under anti-trust law are only addressed cursorily on account of their low practical relevance to household customers' supply connection and energy supply. The study comes to the conclusion that the provisions of the Energy Economy Law (EnWG) on final consumers' supply connection and energy supply sufficiently implement the state's guarantee responsibility in energy supply matters as required by welfare state principles. The author argues that the state's guarantee responsibility primarily obliges it to ensure an energy supply that is available to everyone at an affordable price at any time and any place. These requirements are met by the regulations on supply connection and energy supply contained in Articles 17 f. and 36 ff. EnWG. A coherent regulatory system on connection and supply is established in particular by the provisions of Art. 18 EnWG on the general connection obligation and of Art. 36 EnWG on the basic supply obligation. This system secures the supply of final consumers with grid-bound energy even under the present altered framework conditions, meaning the compulsory separation of connection and supply, and does so to the constitutionally required extent.

  10. A Registration Method Based on Contour Point Cloud for 3D Whole-Body PET and CT Images

    Directory of Open Access Journals (Sweden)

    Zhiying Song

    2017-01-01

    Full Text Available The PET and CT fusion image, combining the anatomical and functional information, has important clinical meaning. An effective registration of PET and CT images is the basis of image fusion. This paper presents a multithread registration method based on contour point cloud for 3D whole-body PET and CT images. Firstly, a geometric feature-based segmentation (GFS method and a dynamic threshold denoising (DTD method are creatively proposed to preprocess CT and PET images, respectively. Next, a new automated trunk slices extraction method is presented for extracting feature point clouds. Finally, the multithread Iterative Closet Point is adopted to drive an affine transform. We compare our method with a multiresolution registration method based on Mattes Mutual Information on 13 pairs (246~286 slices per pair of 3D whole-body PET and CT data. Experimental results demonstrate the registration effectiveness of our method with lower negative normalization correlation (NC = −0.933 on feature images and less Euclidean distance error (ED = 2.826 on landmark points, outperforming the source data (NC = −0.496, ED = 25.847 and the compared method (NC = −0.614, ED = 16.085. Moreover, our method is about ten times faster than the compared one.

  11. An expert botanical feature extraction technique based on phenetic features for identifying plant species.

    Directory of Open Access Journals (Sweden)

    Hoshang Kolivand

    Full Text Available In this paper, we present a new method to recognise the leaf type and identify plant species using phenetic parts of the leaf; lobes, apex and base detection. Most of the research in this area focuses on the popular features such as the shape, colour, vein, and texture, which consumes large amounts of computational processing and are not efficient, especially in the Acer database with a high complexity structure of the leaves. This paper is focused on phenetic parts of the leaf which increases accuracy. Detecting the local maxima and local minima are done based on Centroid Contour Distance for Every Boundary Point, using north and south region to recognise the apex and base. Digital morphology is used to measure the leaf shape and the leaf margin. Centroid Contour Gradient is presented to extract the curvature of leaf apex and base. We analyse 32 leaf images of tropical plants and evaluated with two different datasets, Flavia, and Acer. The best accuracy obtained is 94.76% and 82.6% respectively. Experimental results show the effectiveness of the proposed technique without considering the commonly used features with high computational cost.

  12. [Epidemiological, clinical, cytologic and immunophenotypic aspects of acute leukemia in children: the experience at the hematology laboratory of IBN SINA University Hospital Center].

    Science.gov (United States)

    Doumbia, Mariam; Uwingabiye, Jean; Bissan, Aboubacar; Rachid, Razine; Benkirane, Souad; Masrar, Azlarab

    2016-01-01

    The aim of this study was to describe epidemiological, cytologic and immunophenotypic aspects of acute leukemias (AL) in children diagnosed at IBN SINA University Hospital Center and to determine the concordance between cytology and immunophenotyping results. This is a cross-sectional study conducted in the hematology laboratory of IBN SINA University Hospital Center between June 2012 and May 2014. Among the 104 cases with diagnosed AL, 52% were boys with a sex-ratio H/F= 1.32, the average age was 5.7 years. The distribution of different types of AL was: lymphoid AL (LAL) (74%), myeloid (AML) (20.2%), biphenotypic AL (BAL) (65.8%). Among the LALs, 78% were classified as B LAL and 22% as T LAL. Clinical signs were mainly presented with tumor syndrome (73.1%), fever (61%) and hemorrhagic syndrome (50%). The most common blood count abnormalities were: thrombopenia (89.4%), anemia (86.5%), hyperleukocytosis (79.8%). The rate of peripheral and bone marrow blasts was statistically higher for LAL than for AML and BAL (p <0.001). The rate of relapse and mortality was 21.2% and 16. 3% respectively. Concordance rate between the results of cytology and of immunophenotyping was 92.7% for LAL and 82.6% for AML. Diagnosis of AL is always based primarily on cytology. Immunophenotyping allowed us to make a better distinction between acute leukemias. The management of paediatric AL is a major health problem which requires specialized care centers.

  13. Development of nuclear technology for improving quality and shelf-life on food commodities

    International Nuclear Information System (INIS)

    Zubaidah Irawati

    2007-01-01

    The availability and sustain ability food regarding safety, nutritive, and remaining good palatability are the basic needs of human in order to stay alive and keep healthy. The process must follow the existing standard-guidelines (Good Manufacturing Practices/GMP and Good Irradiation Practices/GIP) if ionizing radiation will be implemented for such purposes because of its effectiveness, efficient, and practical in comparison with conventional methods. Nevertheless application of nuclear technique for improving the safety and extending the shelf-life of foods for human consumption, a proper regulation and legalization from the local government is needed. Commercialization of irradiated food in Indonesia has been stipulated under decree of PERMENKES No. 826/MENKES /PER/XII/1987, No.152/MENKES/SK/II/1995 and Food Law of the Republic of Indonesia No.7/1996. Commercially, besides Indonesia, other countries within Asia and the Pacific region such as India, Thailand, and Vietnam have implemented nuclear technique on food commodities for quarantine, sanitation and sterilization purposes both for local consumption and export to European Countries, USA and Australia. Public education should be more conducted in some effective ways and keep on going to avoid misconception about the technology itself. (author)

  14. Single-particle density matrix and superfluidity in the two-dimensional Bose Coulomb fluid

    International Nuclear Information System (INIS)

    Minguzzi, A.; Tosi, M.P.; Davoudi, B.

    2002-01-01

    A study by Magro and Ceperley [Phys. Rev. Lett. 73, 826 (1994)] has shown that the ground state of the two-dimensional fluid of charged bosons with logarithmic interactions is not Bose condensed, but exhibits algebraic off-diagonal order in the single-particle density matrix ρ(r). We use a hydrodynamic Hamiltonian expressed in terms of density and phase operators, in combination with an f-sum rule on the superfluid fraction, to reproduce these results and to extend the evaluation of the density matrix to finite temperature T. This approach allows us to treat the liquid as a superfluid in the absence of a condensate. The algebraic decay of the one-body density matrix is due to correlations between phase fluctuations, and we find that the exponent in the power law is determined by the superfluid density n s (T). We also find that the plasmon gap in the single-particle energy spectrum at long wavelengths decreases with increasing T and closes at the critical temperature for the onset of superfluidity

  15. Drying of mint leaves in a solar dryer and under open sun: Modelling, performance analyses

    International Nuclear Information System (INIS)

    Akpinar, E. Kavak

    2010-01-01

    In this study was investigated the thin-layer drying characteristics in solar dryer with forced convection and under open sun with natural convection of mint leaves, and, performed energy analysis and exergy analysis of solar drying process of mint leaves. An indirect forced convection solar dryer consisting of a solar air collector and drying cabinet was used in the experiments. The drying data were fitted to ten the different mathematical models. Among the models, Wang and Singh model for the forced solar drying and the natural sun drying were found to best explain thin-layer drying behaviour of mint leaves. Using the first law of thermodynamics, the energy analysis throughout solar drying process was estimated. However, exergy analysis during solar drying process was determined by applying the second law of thermodynamics. Energy utilization ratio (EUR) values of drying cabinet varied in the ranges between 7.826% and 46.285%. The values of exergetic efficiency were found to be in the range of 34.760-87.717%. The values of improvement potential varied between 0 and 0.017 kJ s -1 . Energy utilization ratio and improvement potential decreased with increasing drying time and ambient temperature while exergetic efficiency increased.

  16. A Prospective Cohort Study on Radiation-induced Hypothyroidism: Development of an NTCP Model

    International Nuclear Information System (INIS)

    Boomsma, Marjolein J.; Bijl, Hendrik P.; Christianen, Miranda E.M.C.; Beetz, Ivo; Chouvalova, Olga; Steenbakkers, Roel J.H.M.; Laan, Bernard F.A.M. van der; Wolffenbuttel, Bruce H.R.; Oosting, Sjoukje F.; Schilstra, Cornelis; Langendijk, Johannes A.

    2012-01-01

    Purpose: To establish a multivariate normal tissue complication probability (NTCP) model for radiation-induced hypothyroidism. Methods and Materials: The thyroid-stimulating hormone (TSH) level of 105 patients treated with (chemo-) radiation therapy for head-and-neck cancer was prospectively measured during a median follow-up of 2.5 years. Hypothyroidism was defined as elevated serum TSH with decreased or normal free thyroxin (T4). A multivariate logistic regression model with bootstrapping was used to determine the most important prognostic variables for radiation-induced hypothyroidism. Results: Thirty-five patients (33%) developed primary hypothyroidism within 2 years after radiation therapy. An NTCP model based on 2 variables, including the mean thyroid gland dose and the thyroid gland volume, was most predictive for radiation-induced hypothyroidism. NTCP values increased with higher mean thyroid gland dose (odds ratio [OR]: 1.064/Gy) and decreased with higher thyroid gland volume (OR: 0.826/cm 3 ). Model performance was good with an area under the curve (AUC) of 0.85. Conclusions: This is the first prospective study resulting in an NTCP model for radiation-induced hypothyroidism. The probability of hypothyroidism rises with increasing dose to the thyroid gland, whereas it reduces with increasing thyroid gland volume.

  17. Multidetector CT Assessment of Lymph Node Size for Nodal Staging in Patients with Potentially Operable Squamous Esophageal Cancer and the 18F-FDG Positron Emission Tomography CT Correlation

    International Nuclear Information System (INIS)

    Yoom, Soo Kyung; Jung, Jung Im; Ahn, Myeong Im; Park, Jae Gil; Yoo, Ie Ryung; Park, Seog Hee; Park, Mi Jung; Park, Hyun Jin

    2010-01-01

    To investigate the size criteria of multidetector computed tomography (MDCT) for the evaluation metastatic lymph nodes (LNs) for potentially operable squamous esophageal cancer, and to compare this information with the results of positron emission tomography-CT (PET-CT). Twenty-four patients who underwent radical esophagectomy for esophageal cancer were studied. All patients had preoperative MDCT and PET-CT. The MDCT findings were compared with those of PET-CT and were correlated with the surgical records. The receiver operating characteristic (ROC) curve method was used to determine the appropriate cut-off value to distinguish benign from metastatic LNs. The size of metastatic LNs (9.35 ± 3.41 mm) was significantly larger than that of benign LNs (5.74 ± 1.64 mm) (p<0.001). The best cut-off value was 7 mm (81.8% sensitivity, 80.8% specificity). PET-CT detected all metastatic LNs except for four in the peritumoral region. The sensitivity and specificity of metastatic LN evaluation on PET-CT were 82.6% and 99.4%, respectively. Only one LN without metastasis showed increased fluoro-2-deoxy-D-glucose uptake on PET-CT. Size of metastatic LNs can typically be < 10 mm. For MDCT, the short diameter of 7 mm may be the optimal criterion. PET-CT is very accurate for the assessment of metastatic LNs except for those in the peritumoral region

  18. Cannabis Withdrawal in Adults With Attention-Deficit/Hyperactivity Disorder.

    Science.gov (United States)

    Chauchard, Emeline; Hartwell, Karen J; McRae-Clark, Aimee L; Sherman, Brian J; Gorelick, David A

    2018-02-22

    Cannabis withdrawal has not been studied in adults with attention-deficit/hyperactivity disorder (ADHD) who have high rates of cannabis use. We aimed to describe cannabis withdrawal, motivations to quit, and strategies to quit cannabis use in cannabis-dependent adults with ADHD. Twenty-three adults with ADHD enrolled in a controlled clinical trial of pharmacotherapy (atomoxetine) for cannabis dependence (DSM-IV criteria) completed the Marijuana Quit Questionnaire (MJQQ) to provide information on their "most serious" quit attempt made without formal treatment. The study was conducted between November 2005 and June 2008. Participants were predominantly male (82.6%, n = 19), with a mean (SD) age of 27.4 (8.5) years (range, 18-53) at the start of their index quit attempt. The most common motive for quitting cannabis was "to save money" (87%, n = 20); the most common strategy to maintain abstinence was "stopped associating with people who smoke marijuana" (43%, n = 10). Almost all (96%, n = 22) subjects reported ≥ 1 cannabis withdrawal symptom; 7 (30%) met DSM-5 diagnostic criteria for cannabis withdrawal syndrome. Participants with comorbid ADHD and cannabis dependence reported withdrawal symptoms similar to other samples of non-treatment-seeking cannabis-dependent adults with no psychiatric comorbidity. These findings suggest that ADHD does not influence cannabis withdrawal in the way that it does tobacco (nicotine) withdrawal. Data used in this secondary analysis came from ClinicalTrials.gov identifier: NCT00360269. © Copyright 2018 Physicians Postgraduate Press, Inc.

  19. Design and testing of data analysis tool for ECRH systems in labview

    International Nuclear Information System (INIS)

    Patel, Jatinkumar; Patel, H.; Purohit, D.; Rajanbabu, N.; Mistry, H.; Shukla, B.K.

    2017-01-01

    Electron Cyclotron Resonance Heating (ECRH) is one of the essential RF heating sub systems used for pre-ionization and current drive experiments in SST1. In SST-1, Gyrotron based two ECRH systems are installed. 42 GHz gyrotron system capable of delivering 500kW RF power for 500ms and the 82.6 GHz gyrotron capable of delivering 200kW continuously for 1000 second. VME based Data acquisition and control (DAC) system is installed with the gyrotron systems and is under operation with SST-1. This paper explains the basic features of PXI DAC and the data analysis tool designed in labview 2014 and the problems faced during design and testing of different lengths of data plot. It has various features of plotting data in different categories i.e. plotting of fast acquisition signals data to decide the sequence of gyrotron interlocks happened during the gyrotron operations, conversion of main binary file into 32 .text files and all the 32 analog signals data plot in a single plot, auto update of selected important signals plot at the end of the shot

  20. Ultrahigh relaxivity and safe probes of manganese oxide nanoparticles for in vivo imaging.

    Science.gov (United States)

    Xiao, J; Tian, X M; Yang, C; Liu, P; Luo, N Q; Liang, Y; Li, H B; Chen, D H; Wang, C X; Li, L; Yang, G W

    2013-12-05

    Mn-based nanoparticles (NPs) have emerged as new class of probes for magnetic resonance imaging due to the impressive contrast ability. However, the reported Mn-based NPs possess low relaxivity and there are no immunotoxicity data regarding Mn-based NPs as contrast agents. Here, we demonstrate the ultrahigh relaxivity of water protons of 8.26 mM(-1) s(-1) from the Mn3O4 NPs synthesized by a simple and green technique, which is twice higher than that of commercial gadolinium (Gd)-based contrast agents (4.11 mM(-1) s(-1)) and the highest value reported to date for Mn-based NPs. We for the first time demonstrate these Mn3O4 NPs biocompatibilities both in vitro and in vivo are satisfactory based on systematical studies of the intrinsic toxicity including cell viability of human nasopharyngeal carcinoma cells, normal nasopharyngeal epithelium, apoptosis in cells and in vivo immunotoxicity. These findings pave the way for the practical clinical diagnosis of Mn based NPs as safe probes for in vivo imaging.

  1. The Knowledge of Radiation and the Attitude Towards Radio-Protection among Urology Residents in India.

    Science.gov (United States)

    Jindal, Tarun

    2015-12-01

    Exposure to radiation is a hazard and precautions are necessary to limit it. This study was done to assess the knowledge of radiation and the attitude towards radio-protection among urology residents in India. A questionnaire was administered to assess the knowledge and attitude of urology residents who came from all over the country to attend a clinical meeting at Apollo Gleneagles Hospital, Kolkata, India. All the respondents agreed to being exposed to radiation, with 78.2% using radiation in more than five cases a week. Only 65.2% always took some steps for radio-protection. Lead aprons and thyroid shields were the most common radiation protection devices used. None of the residents ever used lead gloves or protective eye glasses or dosimeters. An 82.6% felt that they did not have adequate knowledge, 85.4% of residents did not receive any formal classes regarding the risk of radiation, 21.7% either rarely or never moved out of the operating room when the radiation was being used, 42.4% did not know that the SI unit of the equivalent absorbed dose of radiation & 52.1% did not know about the amount of radiation delivered to an adult during a contrast enhanced CT scan of the abdomen. Results of the present study reveal that the urology residents of India lack knowledge about the risks of radiation exposure. Majority of them did not take necessary precautions to limit their exposure to radiation.

  2. Testing DNA barcodes in closely related species of Curcuma (Zingiberaceae) from Myanmar and China.

    Science.gov (United States)

    Chen, Juan; Zhao, Jietang; Erickson, David L; Xia, Nianhe; Kress, W John

    2015-03-01

    The genus Curcuma L. is commonly used as spices, medicines, dyes and ornamentals. Owing to its economic significance and lack of clear-cut morphological differences between species, this genus is an ideal case for developing DNA barcodes. In this study, four chloroplast DNA regions (matK, rbcL, trnH-psbA and trnL-F) and one nuclear region (ITS2) were generated for 44 Curcuma species and five species from closely related genera, represented by 96 samples. PCR amplification success rate, intra- and inter-specific genetic distance variation and the correct identification percentage were taken into account to assess candidate barcode regions. PCR and sequence success rate were high in matK (89.7%), rbcL (100%), trnH-psbA (100%), trnL-F (95.7%) and ITS2 (82.6%) regions. The results further showed that four candidate chloroplast barcoding regions (matK, rbcL, trnH-psbA and trnL-F) yield no barcode gaps, indicating that the genus Curcuma represents a challenging group for DNA barcoding. The ITS2 region presented large interspecific variation and provided the highest correct identification rates (46.7%) based on BLASTClust method among the five regions. However, the ITS2 only provided 7.9% based on NJ tree method. An increase in discriminatory power needs the development of more variable markers. © 2014 John Wiley & Sons Ltd.

  3. Potato Processing Wastewater as a Substrate for Red Pigment Production from Immobilized Gamma-Irradiated Cells of Monascus purpureus

    International Nuclear Information System (INIS)

    Hazaa, M.A.; Shash, S.M.; Emam, D.A.; Youssef, B.M.; Khalaf, M.A.

    2009-01-01

    Although pigment production by Monascus spp. in chemically defined media is well documented (in submerged cultures and free cells), very few information is available about the use of agro-industrial wastes and immobilized cells. In this study immobilized irradiated spores (in sponge cubes) of M. purpureus (24 h age and 0.5 g cubes/50 ml medium) produced high amount of red pigment reached up to 2.32 g/I, after 4 days of incubation, compared with the amount of pigment produced by the free cells (1.84 g/I). Also, potato processing wastewater (PPW) was examined as the main culture medium for red pigment production by this fungus under optimizing culture conditions for repeated batches. The results showed that with irradiated immobilized cells, the maximum amount of red pigment production (1.96 g/I) was recorded at the second batch. Moreover, high reductions of biochemical oxygen demand (BOD); 82.6 % for this waste was obtained during the second batch. The data revealed that very little amount of soluble toxic substances in the extracted sample leading to only 8% dead chicken embryos

  4. Proteomics shows Hsp70 does not bind peptide sequences indiscriminately in vivo

    International Nuclear Information System (INIS)

    Grossmann, Michael E.; Madden, Benjamin J.; Gao, Fan; Pang, Yuan-Ping; Carpenter, John E.; McCormick, Daniel; Young, Charles Y.F.

    2004-01-01

    Heat shock protein 70 (Hsp70) binds peptide and has several functions that include protein folding, protein trafficking, and involvement with immune function. However, endogenous Hsp70-binding peptides had not previously been identified. Therefore, we eluted and identified several hundred endogenously bound peptides from Hsp70 using liquid chromatography ion trap mass spectrophotometry (LC-ITMS). Our work shows that the peptides are capable of binding Hsp70 as previously described. They are generally 8-26 amino acids in length and correspond to specific regions of many proteins. Through computationally assisted analysis of peptides eluted from Hsp70 we determined variable amino acid sequences, including a 5 amino acid core sequence that Hsp70 favorably binds. We also developed a computer algorithm that predicts Hsp70 binding within proteins. This work helps to define what peptides are bound by Hsp70 in vivo and suggests that Hsp70 facilitates peptide selection by aiding a funneling mechanism that is flexible but allows only a limited number of peptides to be processed

  5. The Photoluminescent Properties of New Cationic Iridium(III Complexes Using Different Anions and Their Applications in White Light-Emitting Diodes

    Directory of Open Access Journals (Sweden)

    Hui Yang

    2015-09-01

    Full Text Available Three cationic iridium(III complexes [Ir(ppy2(phen][PF6] (C1, [Ir(ppy2(phen]2SiF6 (C2 and [Ir(ppy2(phen]2TiF6 (C3 (ppy: 2-phenylpyridine, phen: 1, 10-phenanthroline using different anions were synthesized and characterized by 1H Nuclear magnetic resonance (1HNMR, mass spectra (MS, Fourier transform infrared (FTIR spectra and element analysis (EA. After the ultraviolet visible (UV-vis absorption spectra, photoluminescent (PL properties and thermal properties of the complexes were investigated, complex C1 and C3 with good optical properties and high thermal stability were used in white light-emitting diodes (WLEDs as luminescence conversion materials by incorporation with 460 nm-emitting blue GaN chips. The integrative performances of the WLEDs fabricated with complex C1 and C3 are better than those fabricated with the widely used yellow phosphor Y3Al5O12:Ce3+ (YAG. The color rendering indexes of the WLEDs with C1 and C3 are 82.0 and 82.6, the color temperatures of them are 5912 K and 3717 K, and the maximum power efficiencies of them are 10.61 Lm·W−1 and 11.41 Lm·W−1, respectively.

  6. Serodiagnosis of human neurocysticercosis using antigenic components of Taenia solium metacestodes derived from the unbound fraction from jacalin affinity chromatography

    Directory of Open Access Journals (Sweden)

    Gleyce Alves Machado

    2013-05-01

    Full Text Available The aim of the present study was to analyse Taenia solium metacestode antigens that were derived from the unbound fraction of jacalin affinity chromatography and subsequent tert-octylphenoxy poly (oxyethylene ethanol Triton X-114 (TX-114 partitioning in the diagnosis of human neurocysticercosis (NCC. Immunoassays were designed to detect T. solium-specific IgG antibodies by ELISA and immunoblot. Serum samples were collected from 132 individuals who were categorised as follows: 40 had NCC, 62 presented Taenia spp or other parasitic diseases and 30 were healthy individuals. The jacalin-unbound (J unbound fraction presented higher sensitivity and specificity rates than the jacalin-bound fraction and only this fraction was subjected to subsequent TX-114 partitioning, resulting in detergent (DJ unbound and aqueous (AJ unbound fractions. The ELISA sensitivity and specificity were 85% and 84.8% for J unbound , 92.5% and 93.5% for DJ unbound and 82.5% and 82.6% for AJ unbound . By immunoblot, the DJ unbound fraction showed 100% sensitivity and specificity and only serum samples from patients with NCC recognised the 50-70 kDa T. solium-specific components. We conclude that the DJ unbound fraction can serve as a useful tool for the differential immunodiagnosis of NCC by immunoblot.

  7. Ethanol production

    Energy Technology Data Exchange (ETDEWEB)

    Kolleurp, F; Daugulis, A J

    1985-05-01

    Extractive fermentation is a technique that can be used to reduce the effect of end-product inhibition through the use of a water-immiscible phase which removes fermentation products in situ. This has the beneficial effect of not only removing inhibitory products as they are formed (thus keeping reaction rates high) but also has the potential for reducing product recovery costs. We have chosen to examine the ethanol fermentation as a model system for end product inhibition and extractive fermentation, and have developed a computer model predicting the productivity enhancement possible with this technique. The model predicts an ethanol productivity of 82.6 g/L-h if a glucose feed of 750 g/L is fermented with a solvent having a distribution coefficient of 0.5 at a dilution rate of 5.0 h . This is more than 10 times higher than for a conventional chemostat fermentation of a 250 g/L glucose feed. In light of this, a systematic approach to extractive fermentation has been undertaken involving the screening of more than 1,000 solvents for their extractive properties. UNIFAC and UNIQUAC estimates of distribution coefficients and selectivities were compiled and ranked in a database, together with other important physical properties, such as density, surface tension and viscosity. Preliminary shake-flask and chemostat biocompatibility studies on the most promising solvents have been undertaken. The previous predictive, data base and experimental results are discussed.

  8. Science.gov (United States)

    Baenas, Diego Federico; Palmieri, Hugo J; Alomar, Juan Manuel; Álvarez Garzón, Joaquín Horacio; Berenguer, Leandro; Vilaró, Mario; Albertini, Ricardo Arturo

    2017-10-10

    Nuestros objetivos fueron determinar la etiología y analizar los perfiles de resistencia antimicrobiana de los microorganismos causantes de  infecciones urinarias no complicadas en nuestro medio. Se realizó un estudio analítico de corte transversal. Se analizó la resistencia antimicrobiana in vitro de los urocultivos. Se incluyeron 580 urocultivos de mujeres mayores de 15 años. Un 82.6% de urocultivos  correspondieron a cistitis y el 17.4%  a pielonefritis.Se obtuvieron 353 urocultivos de mujeres  < 50 años (60.9%) y 227 a ? 50 años (39.1%).Los patógenos más frecuentes fueron: Escherichia coli (85.5%) y Klebsiella pneumoniae (4.7%). Se encontró una resistencia de E coli a trimetoprima-sulfametoxazol del 28.6%, a ciprofloxacina de  7.9% y a nitrofurantoína de 0.4%. Se evidenció diferencia significativa (p=0.005) en la resistencia de E coli a ciprofloxacina en las mujeres ?50 años de edad. Nuestros datos muestran que existe una baja resistencia in vitro a nitrofurantoína.

  9. A Precision Measurement of the Neutral Pion Lifetime via the Primakoff Effect

    Energy Technology Data Exchange (ETDEWEB)

    Clinton, Eric [Univ. of Massachusetts, Amherst, MA (United States)

    2007-09-01

    The neutral pion radiative width has been measured to 8.411 eV ± 1.8% + 1.13% - 1.70% (lifetime = 7.826 ± 0.14 + 0.088 - 0.133 x 10-17 s) utilizing the Primakoff effect and roughly 4.9 to 5.5 GeV photons at the Thomas Jefferson National Accelerator Facility in Newport News, VA. The Hall B Photon Tagger, the Hall B Pair Spectrometer, a state of the art Hybrid Calorimter enabled precision incident photon energy measurement, photon flux measurement, and neutral pion identification, respectively. With these and other hardware and software tools, elastic neutral pion yields were extracted from the data. A well developed and understood simulation calculated geometric and software cut efficiency curves. The simulation also provided photo-pion production response functions to fit the experimental cross sections and extract the Primakoff cross section and thus the neutral pion radiative width and lifetime. Future work includes improving understanding of the nuclear incoherent process and any other background sources of elastic neutral pions in this data.

  10. Healthcare professional views and experiences of complementary and alternative therapies in obstetric practice in North East Scotland: a prospective questionnaire survey.

    Science.gov (United States)

    Stewart, D; Pallivalappila, A R; Shetty, A; Pande, B; McLay, J S

    2014-07-01

    The aim of this study was to investigate the use of complementary and alternative medicines (CAMs) therapy by UK healthcare professionals involved in the care of pregnant women, and to identify key predictors of use. A prospective survey. Maternity services in Grampian, North East Scotland. All healthcare professionals (135) involved in the care of pregnant women (midwives, obstetricians, anaesthetists). Questionnaire development, piloting, and distribution. Descriptive and inferential statistical analysis. A response rate of 87% was achieved. A third of respondents (32.5%) had recommended (prescribed, referred, or advised) the use of CAMs to pregnant women. The most frequently recommended CAMs modalities were: vitamins and minerals (excluding folic acid) (55%); massage (53%); homeopathy (50%); acupuncture (32%); yoga (32%); reflexology (26%); aromatherapy (24%); and herbal medicine (21%). Although univariate analysis identified that those who recommended CAMs were significantly more likely to be midwives who had been in post for more than 5 years, had received training in CAMs, were interested in CAMs, and were themselves users of CAMs, the only variable retained in bivariate logistic regression was 'personal use of CAM', with an odds ratio of 8.26 (95% CI 3.09-22.05; P pregnant women by approximately a third of healthcare professionals, with those recommending the use of CAMs being eight times more likely to be personal CAM users. © 2014 Royal College of Obstetricians and Gynaecologists.

  11. A pilot study to evaluate the clinical relevance of endometriosis-associated nerve fibers in peritoneal endometriotic lesions.

    Science.gov (United States)

    Mechsner, Sylvia; Kaiser, Andrea; Kopf, Andreas; Gericke, Christine; Ebert, Andreas; Bartley, Julia

    2009-12-01

    To investigate the clinical relevance of endometriosis-associated nerve fibers in the development of endometriosis-associated symptoms. Prospective nonrandomized study. University hospital endometriosis center. Fifty-one premenopausal patients underwent surgical laparoscopy because of chronic pelvic pain, dysmenorrhea, or for ovarian cysts. Endometriosis was diagnosed in 44 patients. The preoperative and postoperative pain scores were determined using a standardized questionnaire with a visual analogue scale from 1-10. Patients with peritoneal endometriosis were divided into two groups depending on their preoperative pain score: group A with a pain score of at least 3 or more and group B with a pain score of 2 or less. Patients without peritoneal endometriosis were classified as group C and patients without endometriosis were classified as group D. Immunohistochemical analysis of neurofilament and protein gene product 9.5 were used for nerve fiber detection. Occurrence of endometriosis-associated nerve fibers was correlated with the severity of pelvic pain and/or dysmenorrhea. Peritoneal endometriosis-associated nerve fibers were found significantly more frequently in group A than in group B (82.6% vs. 33.3%). The present study suggests that the presence of endometriosis-associated nerve fibers in the peritoneum is important for the development of endometriosis-associated pelvic pain and dysmenorrhea.

  12. Hypertension and prehypertension among adolescents in secondary schools in Enugu, South East Nigeria.

    Science.gov (United States)

    Ujunwa, Fortune A; Ikefuna, Anthony N; Nwokocha, Ada R C; Chinawa, Josephat M

    2013-11-02

    Hypertension is a prevalent cardiovascular disease risk factor among blacks and adolescent hypertension can progress into adulthood. To determine the prevalence of hypertension and prehypertension among secondary school adolescents in Enugu South East Nigeria. A study of 2694 adolescents aged 10-18 years in Enugu metropolis was carried out. Socio-demographic profile anthropometric and blood pressure readings were obtained. Derived measurements such as Prehypertension, hypertension and BMI were obtained. The results showed that the mean systolic blood pressure and diastolic blood pressure for males were 106.66+ 11.80 mmHg and 70.25 + 7.34 mmHg respectively. The mean SBP and DBP for females were 109.83+ 11.66 mmHg and 72.23 + 8.26 mmHg respectively (p Blood pressure was found to increase with age. Prevalence of hypertension and prehypertension was 5.4% and 17.3% respectively with a higher rate in females (6.9%) than males (3.8%). Prevalence of prehypertension among males and females were 14.3% and 20.1% respectively. The prevalence of obesity was 1.9%. Modifiable risk factors exist among adolescents. Early lifestyle modification and a strengthened school health are recommended.

  13. Oxidized fish oil in rat pregnancy causes high newborn mortality and increases maternal insulin resistance.

    Science.gov (United States)

    Albert, Benjamin B; Vickers, Mark H; Gray, Clint; Reynolds, Clare M; Segovia, Stephanie A; Derraik, José G B; Lewandowski, Paul A; Garg, Manohar L; Cameron-Smith, David; Hofman, Paul L; Cutfield, Wayne S

    2016-09-01

    Fish oil is commonly taken by pregnant women, and supplements sold at retail are often oxidized. Using a rat model, we aimed to assess the effects of supplementation with oxidized fish oil during pregnancy in mothers and offspring, focusing on newborn viability and maternal insulin sensitivity. Female rats were allocated to a control or high-fat diet and then mated. These rats were subsequently randomized to receive a daily gavage treatment of 1 ml of unoxidized fish oil, a highly oxidized fish oil, or control (water) throughout pregnancy. At birth, the gavage treatment was stopped, but the same maternal diets were fed ad libitum throughout lactation. Supplementation with oxidized fish oil during pregnancy had a marked adverse effect on newborn survival at day 2, leading to much greater odds of mortality than in the control (odds ratio 8.26) and unoxidized fish oil (odds ratio 13.70) groups. In addition, maternal intake of oxidized fish oil during pregnancy led to increased insulin resistance at the time of weaning (3 wks after exposure) compared with control dams (HOMA-IR 2.64 vs. 1.42; P = 0.044). These data show that the consumption of oxidized fish oil is harmful in rat pregnancy, with deleterious effects in both mothers and offspring. Copyright © 2016 the American Physiological Society.

  14. Impact of the vibrations on the environment caused by passages of trains at variable speed

    Directory of Open Access Journals (Sweden)

    Kożuch Barbara

    2016-01-01

    Full Text Available The paper deals with negative environmental impact caused by the passages of different kinds of trains at variable speed. The study is based on the measurement results which took place in Poland in 2013 on the railway line no. 4. The effect of the traction unit – Pendolino (EMU 250 on the vibration climate was analysed. The impact of passages of new trains was compared to currently operated rolling stock. The speed of trains was varying between 40 and 250 km/h. Vibration measurements were conducted by stuff of an accredited Laboratory of Structural Mechanics at Cracow University of Technology (Accreditation No. AB 826. The influence of the indicated vibrations due to passages of the trains on the building in the neighbourhood of the line was investigated. The vibration assessment was done for horizontal components of vibrations according to Polish standard code. Assessment of environmental impact was presented by indicator of perceptibility of vibration through construction (WODB, which refers to the Scales of Dynamic Influences (SDI scales. The limits specified by standards in any of the passages have not been exceeded. The change of speed or rolling stock resulted in a change in the characteristic of the vibration spectrum.

  15. Modeling compositional dynamics based on GC and purine contents of protein-coding sequences

    KAUST Repository

    Zhang, Zhang

    2010-11-08

    Background: Understanding the compositional dynamics of genomes and their coding sequences is of great significance in gaining clues into molecular evolution and a large number of publically-available genome sequences have allowed us to quantitatively predict deviations of empirical data from their theoretical counterparts. However, the quantification of theoretical compositional variations for a wide diversity of genomes remains a major challenge.Results: To model the compositional dynamics of protein-coding sequences, we propose two simple models that take into account both mutation and selection effects, which act differently at the three codon positions, and use both GC and purine contents as compositional parameters. The two models concern the theoretical composition of nucleotides, codons, and amino acids, with no prerequisite of homologous sequences or their alignments. We evaluated the two models by quantifying theoretical compositions of a large collection of protein-coding sequences (including 46 of Archaea, 686 of Bacteria, and 826 of Eukarya), yielding consistent theoretical compositions across all the collected sequences.Conclusions: We show that the compositions of nucleotides, codons, and amino acids are largely determined by both GC and purine contents and suggest that deviations of the observed from the expected compositions may reflect compositional signatures that arise from a complex interplay between mutation and selection via DNA replication and repair mechanisms.Reviewers: This article was reviewed by Zhaolei Zhang (nominated by Mark Gerstein), Guruprasad Ananda (nominated by Kateryna Makova), and Daniel Haft. 2010 Zhang and Yu; licensee BioMed Central Ltd.

  16. Assessment of the effectiveness of topical propranolol 4% gel for infantile hemangiomas.

    Science.gov (United States)

    Mashiah, Jacob; Kutz, Ana; Rabia, Smail Hadj; Ilan, Efrat Bar; Goldberg, Ilan; Sprecher, Eli; Harel, Avikam

    2017-02-01

    Infantile hemangiomas (IHs) are the most common vascular tumors in children. Because of their benign character and natural involution, the vast majority of IHs do not require any treatment. In the past few years, topical beta blockers have been reported to be an effective treatment of superficial IHs. We sought to evaluate the clinical effectiveness and safety profile of topical propranolol 4% gel for the treatment of IHs. A retrospective study of all cases of IHs treated with topical propranolol 4% gel between 2013 and 2015 was performed. All patients were evaluated in a pediatric dermatology unit of a tertiary medical center. Epidemiologic, clinical, and treatment data, including effectiveness score and safety, were reviewed. The study included 63 patients with a total of 75 IHs. Of the total number of IHs, 43 (57.3%) showed a good response to treatment, 19 (25.3%) a partial response, and 13 (17.33%) poor or no response, thus 62 (82.6%) had good or partial response to treatment. Age at treatment initiation, treatment time, thickness of the superficial component, and size of the lesions were shown to predict response to therapy. Out of the entire examined group, only two patients reported minor local side effects manifested by irritation, redness, and scaling of the treated area. No systemic adverse effects were reported. This is an uncontrolled retrospective study. Propranolol 4% gel is a safe and efficient topical therapy for IH. © 2017 The International Society of Dermatology.

  17. Novel clinical staging for patients with end-stage gastrointestinal carcinoma.

    Science.gov (United States)

    Yasuda, Naokuni; Nakashima, Osamu; Ohnaka, Toru; Kamisaka, Koji; Tsunoda, Akira; Kusano, Mitsuo

    2006-01-01

    We created a new clinical staging system for end-stage gastrointestinal (GI) carcinoma to clarify the therapeutic goals for these patients. Data were obtained from a retrospective review of medical charts. Based on daily clinical observation of 144 patients with end-stage GI carcinoma, we classified the terminal stages as A, B, C, and D. The mean durations of terminal stages A, B, C, and D were 19, 16.6, 6.6, and 1.8 days, respectively, in patients with end-stage gastric cancer and 28.5, 9.1, 5.4, and 1.9 days, respectively, in patients with colorectal cancer. Moreover, 88.0% of patients with gastric carcinoma and 82.6% of patients with colorectal carcinoma passed through terminal stages A, B, C, and D sequentially. The patients in terminal stage B experienced temporary relief of symptoms, but those in terminal stage C did not (P terminal stages can easily be judged by clinical observation and may be an effective new tool with which to manage patients with end-stage GI carcinoma and their families.

  18. Self-medication in academics of a public university in the south of Minas Gerais.

    Directory of Open Access Journals (Sweden)

    Cristina Martiniano MONTANARI

    2015-02-01

    Full Text Available Introduction: Self-medication is a common practice anywhere in the world and the study of drug use is recognized as an important indicator in identifying the major pathologies in specific populations, estimating the prevalence and enabling better understanding on how populations use therapeutic resources. Objective: The objective of the study was to verify the prevalence of self-medication among students of a public university in southern Minas Gerais and verify if the healthcare academics behave differently from the ones of humanities area. To this end, we performed a descriptive cross-sectional study with a sample of 200 students, with 100 in the area of ​​Health Science (group 1 and 100 of the area of Humanities (group 2. Results: The prevalence of self-medication was 96.9 % among students in group 1 and 82.6 % in group 2 (p = 0.002. The most commonly used classes of drugs were analgesics/antipyretics. The main responsible for the indication of the drug in group 1 was the pharmacist; and in group 2 relatives and friends (p = 0.002 Conclusion: The self-medication proved to be a frequent practice among academics, demonstrating the need to devise strategies to sensitize the academic community regarding this practice.

  19. A feasibility study on SiC optoinjected CCD with buried channels

    International Nuclear Information System (INIS)

    Ye Na; Chen Zhiming; Xie Longfei

    2013-01-01

    An SiC optoinjected charge-coupled device with buried channels (BCCD) is designed for the detection of ultraviolet light (UV), and its feasibility is studied by means of Silvaco numerical simulation software. Charge storage and transfer characteristics of the BCCD can be conformed by simulation results. The buried channel design is a key point to realize the high sensitivity of the device. The channel mobility of electrons in the 6H-SiC BCCD can be changed from 47 to 200 cm 2 /(V.s) when the channel is replaced from surface to the subsurface of 0.2 μm. With the optimized device parameters, the density of stored electrons can reach up to 1.062 × 10 11 cm −2 and the number of stored electrons is up to 1.826 × 10 8 for UV light with wavelengths from 200 to 380 nm and an intensity of 0.1 W/cm 2 under a driving voltage of 15 V at room temperature. (semiconductor devices)

  20. The improvement of the mechanical properties of PMMA denture base by Al2O3 particles with nitrile rubber

    Science.gov (United States)

    Alhareb, Ahmed Omran; Akil, Hazizan Md; Ahmad, Zainal Arifin

    2017-07-01

    Poly methyl methacrylate (PMMA) is mostly used for fabrication of denture base by heat-curing technique. Therefore, the purpose of this study is to investigate the effect of Al2O3 filler as toughening particles together with nitrile butadiene rubber (NBR) particles as impact modifier were used to reinforce PMMA denture base materials on the impact strength (IS) and fracture toughness (KIC). PMMA powder was mixed with liquid methyl methacrylate (MMA) and ethylene glycol dimethacrylate (EGDMA) as crosslinking agent. The powder components are PMMA, benzoyl peroxide, NBR (5, 7.5 and 10 wt%), and Al2O3 filler (5 wt%) treated by silane. The liquid components are 90% of methyl methacrylate and 10 % ethylene glycol dimethacryate. FTIR analyses confirmed that the Al2O3 filler was successfully treated with silane as coupling agent. The morphology of fracture surfaces was characterized using field emission scanning electron microscopy (FESEM). The results shown that IS and KIC improved significantly when using treated the Al2O3 filler. IS has increased to 56% (8.26 KJ/m2) and 73% (2.77 MPa.m1/2) for KIC when treated Al2O3 filler compared to unreinforced PMMA matrix. Statistical analyses of data results were significantly improved (PNBR with treated Al2O3 filler compared to other the compositions.