WorldWideScience

Sample records for alloy-ehi 432

  1. 40 CFR 432.40 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability. 432.40 Section 432.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT AND POULTRY PRODUCTS POINT SOURCE CATEGORY High-Processing Packinghouse § 432.40 Applicability. This...

  2. 48 CFR 432.001 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Definitions. 432.001 Section 432.001 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.001 Definitions. The agency contract finance office is the office, other...

  3. 7 CFR 58.432 - Catalase.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Catalase. 58.432 Section 58.432 Agriculture... Material § 58.432 Catalase. The catalase preparation shall be a stable, buffered solution, neutral in pH, having a potency of not less than 100 Keil units per milliliter. The source of the catalase, its...

  4. 20 CFR 702.432 - Debarment process.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Debarment process. 702.432 Section 702.432 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR LONGSHOREMEN'S AND HARBOR... § 702.432 Debarment process. (a) Pertaining to health care providers. Upon receipt of information...

  5. 48 CFR 432.006-5 - Reporting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reporting. 432.006-5 Section 432.006-5 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.006-5 Reporting. The annual report required by FAR 32.006-5 is to be...

  6. 40 CFR 432.101 - Special definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Special definitions. 432.101 Section 432.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... animal by-product residues used in feedstuffs. (d) Tallow means a product made from beef cattle or sheep...

  7. 16 CFR 432.1 - Scope.

    Science.gov (United States)

    2010-01-01

    ... combinations, component audio amplifiers, self-powered speakers for computers, multimedia systems and sound... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Scope. 432.1 Section 432.1 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES POWER OUTPUT CLAIMS FOR AMPLIFIERS UTILIZED IN...

  8. Dicty_cDB: VHB432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB432 (Link to dictyBase) - - - Contig-U15287-1 - (Link to Original site) VHB...432F 235 - - - - - - Show VHB432 Library VH (Link to library) Clone ID VHB432 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB4-B/VHB432Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB432 (VHB432Q) /CSM/VH/VHB4-B/VHB432Q.Seq.d/ CACTGTTGGCCTACTGG...ces producing significant alignments: (bits) Value VHB432 (VHB432Q) /CSM/VH/VHB4-B/VHB432Q.Seq.d/ 440 e-123 VHB417 (VHB

  9. Dicty_cDB: SLC432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC432 (Link to dictyBase) - - - Contig-U09715-1 | Contig-U16382-1 SLC4...32P (Link to Original site) SLC432F 633 SLC432Z 188 SLC432P 821 - - Show SLC432 Library SL (Link to library) Clone ID SLC4...15-1 | Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC4...32Q.Seq.d/ Representative seq. ID SLC432P (Link to Original site) Representative DNA sequence >SLC432 (SLC4...32Q) /CSM/SL/SLC4-B/SLC432Q.Seq.d/ ATTAAATTAAATAAAAAATAAAAATGGATGGTGAAGATGTTCAAGCTTTAGTTATTGATA

  10. 42 CFR 432.10 - Standards of personnel administration.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Standards of personnel administration. 432.10 Section 432.10 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS STATE PERSONNEL ADMINISTRATION General Provisions § 432.10 Standards of personnel administration. (a)...

  11. 7 CFR 28.432 - Middling Tinged Color.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Middling Tinged Color. 28.432 Section 28.432... REGULATIONS COTTON CLASSING, TESTING, AND STANDARDS Standards Tinged Cotton § 28.432 Middling Tinged Color. Middling Tinged Color is color which is within the range represented by a set of samples in the custody of...

  12. 46 CFR 197.432 - Surface-supplied air diving.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Surface-supplied air diving. 197.432 Section 197.432... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Specific Diving Mode Procedures § 197.432 Surface... space; and (f) The surface-supplied air diver has the equipment required by § 197.346 (b) or (d). ...

  13. 46 CFR 154.432 - Expansion and contraction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Expansion and contraction. 154.432 Section 154.432... STANDARDS FOR SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Design, Construction and Equipment Membrane Tanks § 154.432 Expansion and contraction. The support system of a membrane tank must allow for...

  14. Labeled OK-432, immunomodulator of streptococcus preparation, in cancer patients

    International Nuclear Information System (INIS)

    Toki, Hironobu; Ishikawa, Morihiro; Fujii, Masashi; Yumoto, Yasuhiro; Ishimitsu, Tetsusaburo

    1982-01-01

    We investigated the pharmacokinetics of OK-432, an immunomodulator of streptococcus preparation which, is used in cancer patients for active nonspecific immunotherapy. First, OK-432 was labeled with sup(99m)Technetium in vitro. Four patients with malignancy were studied. By the method of scintigraphy using gamma camera, OK-432 administered intravenously was found to be distributed in the liver, lung and spleen, by the decreasing grade. When OK-432 was administered subcutaneously or intramuscularly in the buttocks, most of the radioactivity of sup(99m)Technetium remained locally at the injected site. These results suggested that OK-432 given intravenously was effectively phagocytized by cells of reticuloendothelial system (RES). Compared with other routes of administration, the intravenous route of OK-432 administration is thus considered more effective in order to stimulate RES, which is responsible for the first step of immune reaction. (author)

  15. 40 CFR 52.432 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... quality. 52.432 Section 52.432 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) The requirements of sections 160 through 165 of the Clean Air Act are not met... air quality. (b) Regulation for preventing significant deterioration of air quality. The provisions of...

  16. 20 CFR 410.432 - Cessation of disability.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Cessation of disability. 410.432 Section 410..., TITLE IV-BLACK LUNG BENEFITS (1969- ) Total Disability or Death Due to Pneumoconiosis § 410.432 Cessation of disability. (a) Where it has been determined that a miner is totally disabled under § 410.412...

  17. 47 CFR 74.432 - Licensing requirements and procedures.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Licensing requirements and procedures. 74.432... Broadcast Stations § 74.432 Licensing requirements and procedures. (a) A license for a remote pickup station... previously-licensed transmitters within the system license. Applications submitted for system licensing prior...

  18. OK-432 sclerotherapy for malleolar bursitis of the ankle.

    Science.gov (United States)

    Park, Kwang Hwan; Lee, Jongseok; Choi, Woo Jin; Lee, Jin Woo

    2013-10-01

    The purpose of this study was to evaluate the clinical outcomes and usefulness of OK-432 (Picibanil) sclerotherapy as a new option in the conservative treatment of patients with malleolar bursitis of the ankle. Retrospectively, we reviewed a total of 20 consecutive patients (20 feet) in whom OK-432 sclerotherapy had been performed between March 2009 and June 2010. After aspiration of fluid in the malleolar bursal sac, 0.05 mg of OK-432 was injected into the malleolar bursal sac. We evaluated the clinical outcomes and side effects at the following time points: 2 weeks, 1 month, 3 months, 6 months, and 1 year after OK-432 sclerotherapy. The responses to the treatment were assessed according to the degree of fluctuation, shrinkage of the bursal sac, and soft tissue swelling. Complete resolution was observed in 19 patients (95%) after the first or second application of OK-432 sclerotherapy, and a partial response was observed in 1 patient (5%) after a second application of OK-432 sclerotherapy. The physical component scores of SF-36 improved from 70.0 ± 6.8 to 76.5 ± 7.3 at the last follow-up (P = .0002). OK-432 sclerotherapy was a useful procedure for patients not responding to the usual conservative treatment of malleolar bursitis of the ankle. Level IV, retrospective case series.

  19. Lymphatic Malformation Architecture: Implications for Treatment With OK-432.

    Science.gov (United States)

    Malic, Claudia C; Guilfoyle, Regan; Courtemanche, Rebecca J M; Arneja, Jugpal S; Heran, Manraj K S; Courtemanche, Douglas J

    2017-10-01

    Herein, the authors aim to describe their findings of novel architectural types of lymphatic malformations (LM) and explain the relationship between these architectures and OK-432 treatment outcomes. A retrospective review was conducted of all patients diagnosed with a LM treated with OK-432 at the Vascular Anomalies Clinic at BC Children's Hospital from December 2002 to January 2012. Twenty-seven patients were included in the study. Sixty percent of lesions were present by 2 years of age with the majority located in the head and neck (59%). The average number of sclerotherapy procedures was 1.4 per patient. Treatment under fluoroscopic guidance revealed 3 new LM architectures: open-cell microcystic, closed-cell microcystic, and lymphatic channel. Response to treatment was complete or good for 14/19 macrocystic and for 1/2 mixed lesions. Open-cell microcystic LMs gave a complete or good response for 3/3, which was attributed to OK-432 freely communicating between cysts. Closed-cell microcystic LM had localized cysts that did not allow OK-432 to freely communicate and were associated with partial responses, 2/2. The lymphatic channel had a partial response. There were 2 minor complications and 1 instance of recurrence. The identification of 3 new LM architectures expands the current accepted classification to include: open-cell microcystic, closed-cell microcystic, and lymphatic channels. The majority of complete responses to OK-432 were found with macrocystic lesions. Open-cell microcystic lesions respond better to OK-432 than closed-cell microcystic lesions, and lymphatic channels may respond to OK-432. These key architecture-response relationships have direct clinical implications for treatment with OK-432 sclerotherapy.

  20. 42 CFR 432.32 - Training and use of volunteers.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS STATE PERSONNEL ADMINISTRATION Training Programs; Subprofessional and Volunteer Programs § 432.32 Training and use of volunteers. (a) State plan requirement. A State plan must... responsible for: (1) The development, organization, and administration of the volunteer program; and (2...

  1. 42 CFR 432.55 - Reporting training and administrative costs.

    Science.gov (United States)

    2010-10-01

    ... agency training activities directly related to the program: Use of space, postage, teaching supplies, and... 42 Public Health 4 2010-10-01 2010-10-01 false Reporting training and administrative costs. 432.55... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS STATE PERSONNEL ADMINISTRATION Staffing and Training...

  2. 28 CFR 43.2 - Obligations of persons receiving care and treatment.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Obligations of persons receiving care and treatment. 43.2 Section 43.2 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) RECOVERY OF COST OF HOSPITAL AND MEDICAL CARE AND TREATMENT FURNISHED BY THE UNITED STATES § 43.2 Obligations of persons...

  3. OK-432 treatment of ranula extending to the parapharyngeal space.

    Science.gov (United States)

    Ohta, Nobuo; Fukase, Shigeru; Suzuki, Yusuke; Kurakami, Kazuya; Aoyagi, Masaru; Kakehata, Seiji

    2014-02-01

    Our results confirmed that OK-432 therapy is simple, easy, safe, and effective and can be used as a substitute for surgery in the treatment of ranula extending to the parapharyngeal space. The aim of this study was to evaluate the outcome and complications of the OK-432 treatment of patients with ranula extending to the parapharyngeal space. This was a case series with planned data collection at Yamagata University and Fukase clinic. We tried this therapy in six patients with ranula extending to the parapharyngeal space, between January 2001 and February 2012. We injected OK-432 solution into the lesion with an 18 or 27 gauge needle depending on the patient's condition (location and size of ranula and complications). This treatment was performed on an outpatient basis without hospitalization. Disappearance or marked reduction of the lesion were observed in all patients who had this therapy, and local scarring and deformity of the injection sites did not occur in any patients. As side effects, local pain at the injection site and fever (37-39°C) were observed in 40% of the patients who had this therapy, but such problems resolved within a few days.

  4. The effect of OK-432 (Picibanil) injection on the histopathology of nasal turbinate.

    Science.gov (United States)

    Sengul, S; Kaygusuz, I; Akin, M M; Yalcin, Ş; Karlidag, T; Keles, E; Arslan, I

    2015-12-01

    This study aimed to assess the histopathological effect of OK-432 (Picibanil) on rabbit nasal turbinates. A total of 21 rabbits were divided into 3 treatment groups and various parts of both nasal turbinates were injected with 0.5 ml OK-432, 0.2 ml OK-432 or 0.6 ml saline (control). Bilateral nasal turbinates were later excised and studied under light microscopy to assess any histopathological changes. Animals in the 0.2 ml and 0.5 ml OK-432 groups exhibited mild ciliary loss, goblet cell loss and epithelial damage, and a marked increase in inflammatory cell infiltration, submucosal vascularisation and fibrosis. There was a significant difference in histopathological changes between the two OK-432 treated groups. In addition, each OK-432 treated group had significantly more inflammatory cell infiltration, increased submucosal vascularisation and fibrosis compared with controls. The marked fibrosis observed in OK-432-injected turbinates may be responsible for a reduction in turbinate size.

  5. OK-432 Suppresses Proliferation and Metastasis by Tumor Associated Macrophages in Bladder Cancer.

    Science.gov (United States)

    Tian, Yuan-Feng; Tang, Kun; Guan, Wei; Yang, Tao; Xu, Hua; Zhuang, Qian-Yuan; Ye, Zhang-Qun

    2015-01-01

    OK-432, a Streptococcus-derived anticancer immunotherapeutic agent, has been applied in clinic for many years and achieved great progress in various cancers. In the present study, we investigated its anticancer effect on bladder cancer through tumor associated macrophages (TAMs). MTS assay validated OK-432 could inhibit proliferation in both T24 and EJ bladder cell lines. OK-432 also induced apoptosis of bladder cancer cells in vitro. Consequently, we demonstrated that OK-432 could suppress the bladder cancer cells migration and invasion by altering the EMT-related factors. Furthermore, using SD rat model, we revealed that OK-432 inhibited tumor growth, suppressed PCNA expression and inhibited metastasis in vivo. Taken together, these findings strongly suggest that OK-432 inhibits cell proliferation and metastasis through inducing macrophages to secret cytokines in bladder cancer.

  6. OK-432 synergizes with IFN-γ to confer dendritic cells with enhanced antitumor immunity.

    Science.gov (United States)

    Pan, Ke; Lv, Lin; Zheng, Hai-xia; Zhao, Jing-jing; Pan, Qiu-zhong; Li, Jian-jun; Weng, De-sheng; Wang, Dan-dan; Jiang, Shan-shan; Chang, Alfred E; Li, Qiao; Xia, Jian-chuan

    2014-03-01

    Generation of functional dendritic cells (DCs) with boosted immunity after the withdrawal of initial activation/maturation conditions remains a significant challenge. In this study, we investigated the impact of a newly developed maturation cocktail consisting of OK-432 and interferon-gamma (IFN-γ) on the function of human monocyte-derived DCs (MoDCs). We found that OK-432 plus IFN-γ stimulation could induce significantly stronger expression of surface molecules, production of cytokines, as well as migration of DCs compared with OK-432 stimulation alone. Most importantly, DCs matured with OK-432 plus IFN-γ-induced maintained secretion of interleukin-12 (IL-12)p70 in secondary culture after stimulus withdrawal. Functionally, OK-432 plus IFN-γ-conditioned DCs induce remarkable Th1 and Tc1 responses more effectively than OK-432 alone, even more than the use of α-type-1 cytokine cocktail. As a result, DCs matured with OK-432 plus IFN-γ can prime stronger cytotoxic lymphocyte (CTL) and natural killer (NK) cell response against tumor cells in vitro. Peripheral blood mononuclear cells activated by DCs matured with OK-432 plus IFN-γ also showed greater tumor growth inhibition in vivo in null mice. Molecular mechanistic analysis showed that DC maturation using IFN-γ in concert with OK-432 involves the activation of p38 and nuclear factor-kappa B (NF-κB) pathways. This study provided a novel strategy to generate more potent immune segments in DC vaccine.

  7. 42 CFR 432.31 - Training and use of subprofessional staff.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Training and use of subprofessional staff. 432.31...; Subprofessional and Volunteer Programs § 432.31 Training and use of subprofessional staff. (a) State plan requirement. A State plan must provide for the training and effective use of subprofessional staff as...

  8. OK-432 sclerotherapy of lymphatic malformation in the head and neck: factors related to outcome.

    Science.gov (United States)

    Kim, Dong Wook

    2014-07-01

    No previous study to the best of our knowledge has examined the multiple factors related to the outcome of OK-432 sclerotherapy of lymphatic malformations. This study aimed to assess factors related to the successful outcome of OK-432 sclerotherapy for lymphatic malformations in the head and neck region. During a 6-year period, OK-432 sclerotherapy was performed in 26 patients with lymphatic malformations. Several factors related to the efficacy of OK-432 sclerotherapy were evaluated, including the type (macrocystic or microcystic), the maximum lesion diameter, amount and hemorrhagic cytology of the aspirate, degree of aspiration, injected dose of OK-432 and post-therapy inflammation-related symptom. In all cases, ultrasound (US) follow-up was performed. Of the 26 cases, 13 (50%) showed successful elimination of the lymphatic malformations in the follow-up US after the initial session, and all successful cases were of the macrocystic type. The type of lymphatic malformation and the success of OK-432 sclerotherapy were significantly related (P = 0.0149). Of the 16 cases of complete aspiration, 11 (68.8%) showed a successful outcome. Further, of the 17 cases with inflammation-related symptom, 13 (76.5%) showed a successful outcome. While the degree of aspiration and presence of inflammation-related symptom showed a significant relationship with the success of OK-432 sclerotherapy (P OK-432 sclerotherapy of lymphatic malformations, and that inflammation-related symptom was a predictor of a successful outcome.

  9. Biodegradation of Mexel 432 By Bacteria From the Seine River

    International Nuclear Information System (INIS)

    Allonier, A.S.; Khalanski, M.

    1996-01-01

    This report deals with a study of the biodegradation of a filmogenic organic product (Mexel 432) usable in the fight against corrosion, scale and fouling, presenting a certain interest in the research of processes enabling a functional and environmental efficiency for the cooling systems of thermal power stations. The study of the degradation of this product is followed by a global colorimetric method. It shows that the product is stable on the long-term in demineralized water. On the other hand, its rate of disappearance in river waters is significant (50 % in 2 or 3 days). In this phenomenon of disappearance, biodegradation seems to play a part. Some bacteria from the natural environment (river Seine) have been isolated. Two of them seem to play a significant part, since they can degrade the product in three weeks. During the degradation, the amines with long chains (more than six carbons) of the Mexel, measured by the colorimetric method, disappear. The other compounds generated by the biodegradation process are not identified. (authors)

  10. Prevention of radiation-induced bacteraemia by post-treatment with OK-432 and aztreonam

    Energy Technology Data Exchange (ETDEWEB)

    Kurishita, A.; Ono, T. (Tohoku Univ., Sendai (Japan). School of Medicine); Uchida, A. (Kyoto Univ. (Japan). Radiation Biology Center)

    1993-03-01

    The effects of combined treatment with OK-432, an immunomodulator prepared from Streptococcus haemolyticus, and aztreonam, a monobactum antibiotic, in the prevention of radiation-induced bacteraemia and mortality were examined in ICR-MCH mice irradiated with 9.5 Gy. The organisms recovered from the irradiated mice were Streptococcus faecalis and Proteus mirabilis. Treatment with aztreonam reduced the incidence of mice infected with Proteus mirabilis (p<0.01), but it showed no efficacy on Streptococcus faecalis. OK-432 could reduce the frequency of bacteraemia attributed to both organisms (p<0.05). Combined treatment with OK-432 and aztreonam further decreased the incidence of bacteraemia by both organisms; no organisms were recovered at 14 days following irradiation. The survival rate at 30 days following irradiation was 80% in mice treated with OK-432 plus aztreonam and 55% with OK-432 alone, while it was 0% in the groups treated with aztreonam or saline alone. These results indicated that combined treatment with OK-432 and a suitable antibiotic such as aztreonam is more effective than OK-432 or aztreonam alone. (Author).

  11. Prevention of radiation-induced bacteraemia by post-treatment with OK-432 and aztreonam

    International Nuclear Information System (INIS)

    Kurishita, A.; Ono, T.; Uchida, A.

    1993-01-01

    The effects of combined treatment with OK-432, an immunomodulator prepared from Streptococcus haemolyticus, and aztreonam, a monobactum antibiotic, in the prevention of radiation-induced bacteraemia and mortality were examined in ICR-MCH mice irradiated with 9.5 Gy. The organisms recovered from the irradiated mice were Streptococcus faecalis and Proteus mirabilis. Treatment with aztreonam reduced the incidence of mice infected with Proteus mirabilis (p<0.01), but it showed no efficacy on Streptococcus faecalis. OK-432 could reduce the frequency of bacteraemia attributed to both organisms (p<0.05). Combined treatment with OK-432 and aztreonam further decreased the incidence of bacteraemia by both organisms; no organisms were recovered at 14 days following irradiation. The survival rate at 30 days following irradiation was 80% in mice treated with OK-432 plus aztreonam and 55% with OK-432 alone, while it was 0% in the groups treated with aztreonam or saline alone. These results indicated that combined treatment with OK-432 and a suitable antibiotic such as aztreonam is more effective than OK-432 or aztreonam alone. (Author)

  12. 40 CFR 432.97 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Effluent limitations attainable by the application of the best control technology for conventional pollutants (BCT). 432.97 Section 432.97 Protection... POULTRY PRODUCTS POINT SOURCE CATEGORY Canned Meats Processors § 432.97 Effluent limitations attainable by...

  13. OK-432 injection therapy for cystadenocarcinoma of the parotid gland: A case report.

    Science.gov (United States)

    Makiyama, Kiyoshi; Hirai, Ryoji; Iikuni, Fusako; Ikeda, Atsuo; Tomomatsu, Hirotaka

    2016-01-01

    OK-432 is an immunomodulator that has been reported to be efficacious as an injection therapy for cervical lymphomas and ranulas. We performed OK-432 injection therapy to treat a cystadenocarcinoma of the parotid gland in a 72-year-old man. The 50 × 46-mm tumor was located in the deep lobe of the gland. The tumor had compressed the glossopharyngeal, vagus, and hypoglossal nerves, causing neurally mediated syncope, hoarseness, dysphagia, and dysarthria. A concentration of 5 KE/2 ml of OK-432 was injected. Within 2 months, the cyst had disappeared; no recurrence was apparent during 59 months of follow-up. To the best of our knowledge, no previous report has described injection of OK-432 for malignant cystic disease. We describe the injection method, injection dose, and postinjection course in the hope that this information will prove useful for future applications against malignant cystic disease.

  14. 18 CFR 367.4320 - Account 432, Allowance for borrowed funds used during construction-Credit.

    Science.gov (United States)

    2010-04-01

    ... ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Income Statement Chart of Accounts Service Company Operating Income § 367.4320 Account 432, Allowance for borrowed funds used during construction—Credit. This...

  15. Post-irradiation treatment with OK432 can prevent radiation-induced bone marrow death

    International Nuclear Information System (INIS)

    Kurishita, A.; Uehara, Y.; Tohoku Univ., Sendai; Katoh, H.; Hirose, S.; Uchida, A.; Mizutani, Y.; Okada, S.; Ono, T.

    1991-01-01

    The radioprotective effect of OK432, a Streptocuccus haemolyticus preparation, on bone marrow death was examined in mice. The LD 50 value was increased from 7.55 Gy in controls to 8.45 Gy in mice treated once with OK432 immediately after irradiation. Multiple administration of the agent further elevated the LD 50 value to 9.56 Gy. The radioprotective effect was also apparent when multiple treatments were commenced as late as 72 h after irradiation. (author)

  16. Risk Factors for Chest Pain and Fever in Patients Undergoing Pleurodesis with OK-432.

    Science.gov (United States)

    Morimoto, Yoshihito; Takei, Hidefumi; Tachibana, Keisei; Nakazato, Yoko; Tanaka, Ryota; Nagashima, Yasushi; Watanabe, Kazuhiro; Seki, Reisuke; Shinohara, Takao; Kondo, Haruhiko

    2018-02-09

    Objective In Japan, pleurodesis is often performed using OK-432. However, OK-432 may cause severe chest pain and fever. The risk factors for these complications are unclear. The aim of this study was to identify the risk factors for chest pain and fever caused by pleurodesis with OK-432. Methods The clinical data of 94 patients who underwent pleurodesis with OK-432 were retrospectively analyzed. Patients who developed chest pain (indicated by a record of rescue pain medication) and/or fever (a recorded temperature of >38°C) were identified. A logistic regression analysis was performed to determine the risk factors for these complications. Results Rescue medication for chest pain was required by 43.6% of the patients and 40.4% developed pyrexia after pleurodesis with OK-432. The univariate analysis showed that the likelihood of requiring rescue medication for chest pain was significantly increased in patients of OK-432. Furthermore, caution is advised when managing chest pain in adults of <70 years of age. Prospective studies should be performed to further investigate this issue.

  17. Combination therapy with radiation and OK-432 immunotherapy of cancer patients

    International Nuclear Information System (INIS)

    Hashimoto, Shozo; Miyamoto, Hiroshi

    1978-01-01

    We treated cancer patients with radiotherapy alone and with radiation plus immunotherapy at the Department of Radiology, Keio University Hospital. In all of the cancer patients who had radiationtherapy alone, a general depression in their immune reactivity was seen, but not seen in those who received radiationtherapy plus immunotherapy. Immunotherapy is defined as a stimulator of cancer patient's immune reaction. Usually radiationtherapy caused lymphopenia in which mainly T lymphocytes were decreased in number selectively, but there was no lymphopenia in cases treated with immunotherapy. We have performed nonspecific immunotherapy with OK-432. The result indicated that T lymphocytes were increased by OK-432 in spite of radiationtherapy. From this fact, OK-432 will be useful for suppression of metastasis and regression of tumors. (auth.)

  18. Elevation of serum procalcitonin in patients after chemical pleurodesis with intrapleural injection of OK-432.

    Science.gov (United States)

    Xu, Bing-ling; Yu, Jin-quan; Tang, Ke-jing; Liu, Da-yue; Kuang, Yu-kun

    2014-01-01

    In patients with refractory pleural effusion or pneumothorax, fever and elevated level of white blood cell count (WBC) are frequently observed after chemical pleurodesis with intrapleural injection of OK-432, which make it difficult to differentiate whether it was from the side effects of OK-432 or concurrent bacterial infection. Procalcitonin (PCT) levels were measured before and after pleurodesis so as to discuss whether PCT is useful for distinguishing between the side effects of OK-432 and concurrent bacterial infection. Twenty-six patients with refractory pleural effusion or pneumothorax who underwent chemical pleurodesis with intrapleural injection of OK-432 at the First Affiliated Hospital of Sun Yat-sen University between August 2010 and August 2012 were included in our study. Levels of PCT and WBC were measured before and after pleurodesis. Of all 26 patients, 22 patients were with refractory pleural effusion, and the other four were with pneumothorax. The median serum levels of PCT and WBC elevated from 0.155 to 1.470 ng/mL (P = 0.009) and from 5.920 to 10.475 × 10(9) /L (P = 0.000), respectively. No patient was given antibiotics and fever subsided. Intrapleural injection of OK-432 could increase the serum level of PCT and WBC with no bacterial infection. The serum PCT level may not be useful to distinguish whether fever was caused by the side effects of OK-432 or concurrent bacterial infection. © 2013 John Wiley & Sons Ltd.

  19. 5 CFR 432.105 - Proposing and taking action based on unacceptable performance.

    Science.gov (United States)

    2010-01-01

    ... prior approval for such extension from the Chief, Family Programs and Employee Relations Division.... (1) Once an employee has been afforded a reasonable opportunity to demonstrate acceptable performance pursuant to § 432.104, an agency may propose a reduction-in-grade or removal action if the employee's...

  20. Experimental intraperitoneal infusion of OK-432 in rats: Evaluation of peritoneal complications and pathology

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong Wook [Department of Radiology, Busan Paik Hospital, Inje University College of Medicine, Busan (Korea, Republic of); Kim, Hak Jin, E-mail: hakjink@pusan.ac.k [Department of Radiology, Pusan National University Hospital, Pusan National University College of Medicine, Medical Research Institute, Busan (Korea, Republic of); Lee, Jun Woo [Department of Radiology, Pusan National University Hospital, Pusan National University College of Medicine, Medical Research Institute, Busan (Korea, Republic of)

    2010-06-15

    Purpose: OK-432 is known to be a potent sclerosant of cystic lesions. The purpose of this study was to evaluate both its safety and pathologic effects after the infusion of OK-432 into the peritoneal cavity of rats. Materials and methods: Twenty male rats were used in this study. Twelve rats were infused intraperitoneally with 0.2 Klinishe Einheit of OK-432 melted in 2 mL of normal saline (group 1: the treated group); four rats each were infused intraperitoneally with 0.5 mL of 99% ethanol (group 2) and normal saline (group 3), and served as the control groups. An abdominal ultrasonographic examination was performed both before and after the infusions in all rats. Three rats in group 1 and one rat in each of groups 2 and 3 were sacrificed each week following the infusion. Gross and microscopic evaluations of the peritoneum and abdominal cavity were performed on each rat. Results: In group 1, the abdomen was clear on gross inspection and the peritoneum was unremarkable on microscopic examination. In group 2, mild-to-moderate peritoneal adhesions were revealed grossly, and inflammation and fibrosis of the peritoneum were demonstrated microscopically. In group 3, no specific abnormalities were noted on gross or microscopic examinations. Conclusion: Leakage or abnormal infusion of OK-432 solution into the peritoneal cavity during sclerotherapy of intra-abdominal or retroperitoneal cystic lesions does not result in any significant complications.

  1. Experimental intraperitoneal infusion of OK-432 in rats: Evaluation of peritoneal complications and pathology

    International Nuclear Information System (INIS)

    Kim, Dong Wook; Kim, Hak Jin; Lee, Jun Woo

    2010-01-01

    Purpose: OK-432 is known to be a potent sclerosant of cystic lesions. The purpose of this study was to evaluate both its safety and pathologic effects after the infusion of OK-432 into the peritoneal cavity of rats. Materials and methods: Twenty male rats were used in this study. Twelve rats were infused intraperitoneally with 0.2 Klinishe Einheit of OK-432 melted in 2 mL of normal saline (group 1: the treated group); four rats each were infused intraperitoneally with 0.5 mL of 99% ethanol (group 2) and normal saline (group 3), and served as the control groups. An abdominal ultrasonographic examination was performed both before and after the infusions in all rats. Three rats in group 1 and one rat in each of groups 2 and 3 were sacrificed each week following the infusion. Gross and microscopic evaluations of the peritoneum and abdominal cavity were performed on each rat. Results: In group 1, the abdomen was clear on gross inspection and the peritoneum was unremarkable on microscopic examination. In group 2, mild-to-moderate peritoneal adhesions were revealed grossly, and inflammation and fibrosis of the peritoneum were demonstrated microscopically. In group 3, no specific abnormalities were noted on gross or microscopic examinations. Conclusion: Leakage or abnormal infusion of OK-432 solution into the peritoneal cavity during sclerotherapy of intra-abdominal or retroperitoneal cystic lesions does not result in any significant complications.

  2. 27 CFR 4.32a - Voluntary disclosure of major food allergens.

    Science.gov (United States)

    2010-04-01

    ... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE Labeling Requirements for Wine § 4.32a Voluntary disclosure of major food allergens. (a) Definitions. For purposes of... the case of a tree nut, it means the name of the specific type of nut (for example, almonds, pecans...

  3. 9 CFR 93.432 - Cattle from the Republic of Ireland.

    Science.gov (United States)

    2010-01-01

    ... brucellosis qualified for export herd and that the cattle meet the requirements in § 93.432(c). (b) A brucellosis qualified for export herd is a herd in which all of the cattle have been maintained as a herd unit...., cattle over 6 months of age, except steers and spayed heifers) have been tested annually for brucellosis...

  4. Comparison of 432 Pseudomonas strains through integration of genomic, functional, metabolic and expression data

    NARCIS (Netherlands)

    Koehorst, Jasper J.; Dam, van Jesse C.J.; Heck, van Ruben G.A.; Saccenti, Edoardo; Martins dos Santos, Vitor; Suarez-Diez, Maria; Schaap, Peter J.

    2016-01-01

    Pseudomonas is a highly versatile genus containing species that can be harmful to humans and plants while others are widely used for bioengineering and bioremediation. We analysed 432 sequenced Pseudomonas strains by integrating results from a large scale functional comparison using protein

  5. 40 CFR 432.22 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.22 Section 432.22... attainable by the application of the best practicable control technology currently available (BPT). Except as... limitations: (1) In the case of process wastewater associated with the slaughtering of animals on-site or the...

  6. 40 CFR 432.12 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.12 Section 432.12... attainable by the application of the best practicable control technology currently available (BPT). Except as...) In the case of process wastewater associated with the slaughtering of animals on-site or the...

  7. 40 CFR 432.42 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.42 Section 432.42... attainable by the application of the best practicable control technology currently available (BPT). Except as...) In the case of process wastewater associated with the slaughtering of animals on-site or the...

  8. 40 CFR 432.32 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.32 Section 432.32... attainable by the application of the best practicable control technology currently available (BPT). Except as...) In the case of process wastewater associated with slaughtering of animals on-site or the processing...

  9. Alleviating action of OK-432 (Picibanil) on the myelosuppression in medulloblastoma patients induced by whole axis irradiation

    International Nuclear Information System (INIS)

    Aoki, Yoshiro

    1982-01-01

    The test subjects termed as OK-432 group which consist of 4 patients of Medulloblastoma and 2 of Pinealoma, underwent the whole axis irradiation in combination with OK-432. The control group consisting of 9 Medulloblastoma patients was subjected to the same radiation treatment without OK-432. Six of the nine patients (66.7%) irradiated showed the decrease of peripheral white blood cell counts down to 2,500, whereas, only two of six patients showed a similar decrement in OK-432 group. Three of the nine patients (33.3%) in the control group showed the decrease of white blood cell down to 2,000, but only one of the six patients in OK-432 group. The neutrophil counts decreased below the level of 1,000 in three of the nine patients (33.3%) in the control group, but none in the OK-432 group. The platelet counts decreased below the level of 100,000 in five of the nine patients (55.6%) in the control group during the irradiation period, but only one patient in the OK-432 group showed a decrease down to 100,000 counts. Three of the nine patients (33.3%) in the control group had to be stopped irradiation due to the severe leukopenia and thrombocytopenia, in contrast to the OK-432 group, which completed whole axis irradiation without interruption. These results seem to indicate that OK-432 alleviated the myelosuppression induced in patients by whole axis irradiation. This alleviating action of OK-432 is considered to be applicable to the treatment of Medulloblastoma patients. (J.P.N.)

  10. Fibrinogen variant B[beta]D432A has normal polymerization but does not bind knob 'B'

    Energy Technology Data Exchange (ETDEWEB)

    Bowley, Sheryl R.; Lord, Susan T.; (UNC)

    2009-10-23

    Fibrinogen residue B{beta}432Asp is part of hole 'b' that interacts with knob 'B,' whose sequence starts with Gly-His-Arg-Pro-amide (GHRP). Because previous studies showed B{beta}D432A has normal polymerization, we hypothesized that B{beta}432Asp is not critical for knob 'B' binding and that new knob-hole interactions would compensate for the loss of this Asp residue. To test this hypothesis, we solved the crystal structure of fragment D from B{beta}D432A. Surprisingly, the structure (rfD-B{beta}D432A+GH) showed the peptide GHRP was not bound to hole 'b.' We then re-evaluated the polymerization of this variant by examining clot turbidity, clot structure, and the rate of FXIIIa cross-linking. The turbidity and the rate of - dimer formation for B{beta}D432A were indistinguishable compared with normal fibrinogen. Scanning electron microscopy showed no significant differences between the clots of B{beta}D432A and normal, but the thrombin-derived clots had thicker fibers than clots obtained from batroxobin, suggesting that cleavage of FpB is more important than 'B:b' interactions. We conclude that hole 'b' and 'B:b' knob-hole binding per se have no influence on fibrin polymerization.

  11. Percutaneous sclerotherapy of sialoceles after parotidectomy with fibrin glue, OK-432, and bleomycin.

    Science.gov (United States)

    Chen, Wei-liang; Zhang, Li-ping; Huang, Zhi-quan; Zhou, Bin

    2013-12-01

    We evaluated the curative effect of fibrin glue combined with OK-432 (streptococcal pyrogenic exotoxin A, Picibanil™) and bleomycin on 9 patients with sialoceles after parotidectomy. The primary lesions included pleomorphic adenomas in 6 cases and Warthin's tumours in 3 cases. After a sialocele had been diagnosed each patient had repeated aspirations and pressure dressings for 3-4 weeks, but these treatments failed. The patients were then treated with percutaneous sclerotherapy with the injection of fibrin glue 8-10 ml combined with OK-432 5 mg and bleomycin 15 mg. All the sialoceles disappeared completely after a single procedure in 2-3 weeks. The patients have been followed up for more than 6 months with no evidence of recurrent sialocele or injury to the facial nerve related to sclerotherapy. This simple, safe technique can be successfully used to treat sialoceles after parotidectomy. Copyright © 2013 The British Association of Oral and Maxillofacial Surgeons. Published by Elsevier Ltd. All rights reserved.

  12. Effectiveness of OK-432 (Sapylin) to reduce seroma formation after axillary lymphadenectomy for breast cancer.

    Science.gov (United States)

    Yang, Yinlong; Gao, Erli; Liu, Xinying; Ye, Zhiqiang; Chen, Yizuo; Li, Quan; Qu, Jinmiao; Dai, Xuanxuan; Wang, Ouchen; Pan, Yifei; Zhang, Xiaohua

    2013-05-01

    The occurrence of seroma formation after axillary lymphadenectomy for breast cancer cannot be ignored. Various approaches have been used in an effort to reduce it, but these results are still controversial. We aimed to describe a new method of application of OK-432 (Sapylin, heat-treated Su strain of Streptococcus) to reduce seroma formation after axillary lymphadenectomy for breast cancer and to verify the safety and efficacy of it as a beneficial supplement for conventional surgery. A prospective, randomized analysis of consecutive quadrantectomy or mastectomy plus axillary lymphadenectomy using or not using OK-432 was designed. From July 2010 to November 2011, a total of 111 patients were enrolled in this prospective, randomized study and completed the follow-up. OK-432 applied to the axillary fossa plus placement of closed suction drainage was used in 54 patients (the experimental group); placement of closed suction drainage was used in 57 patients (the control group). There were no statistical significance between the two groups in terms of age, body mass index, treatment received, tumor size, number of removed lymph nodes, and lymph node status. Postoperative drainage magnitude and duration were significantly reduced in the experimental group (P = 0.008 and 0.003, respectively). One week after hospital discharge, fewer patients developed a palpable seroma in the experimental group: 10 in the experimental group versus 28 in the control group (P = 0.001). Fewer seromas needed aspiration (mean 1 [range 0-3] in the experimental group vs. mean 4 [range 1-5] in the control group; P OK-432 is a feasible and safe option for axillary lymphadenectomy for breast cancer. The use of it does not always prevent seroma formation, but it can reduce drainage magnitude and duration, as well as decrease the incidence of seroma after the removal of drainage. It may be increasingly conducted in day surgery clinics.

  13. Postoperative adjuvant OK-432 sclerotherapy for treatment of cervicofacial lymphatic malformations: an outcomes comparison.

    Science.gov (United States)

    Kim, So Young; Lee, Sanghoon; Seo, Jeong-Meen; Lim, So Young

    2015-04-01

    Surgical treatment of extensive cervicofacial lymphatic malformations is often challenging due to a high rate of postoperative fluid re-accumulation and lesion recurrence resulting from incomplete resection. This study suggests a combined treatment of surgical resection and postoperative adjuvant OK-432 sclerotherapy via closed suction drainage. Using comparative analysis, this study aims to evaluate the efficacy of adjuvant sclerotherapy. A retrospective chart review was performed on patients who underwent surgical resection of cervicofacial lymphatic malformations between January 2009 and July 2013. Patients were divided into two groups based on whether or not adjuvant OK-432 sclerotherapy was administered via closed suction drainage after surgery. Both surgery-related and adjuvant sclerotherapy-related complications were assessed, and treatment effectiveness was measured based on the change in Cologne Disease Score (CDS) or the need for further treatment. A total of 17 patients underwent surgical resection. Nine of these patients underwent surgical resection only, while the other eight underwent surgical resection with adjuvant OK-432 sclerotherapy. The increase in total Cologne Disease Score (CDS) and change of progression parameters were significantly higher for the adjuvant sclerotherapy group compared to the surgery-only group. Additionally, there were no cases of postoperative lymphatic fluid retention among the adjuvant sclerotherapy group. The two groups exhibited similar complication rates with no statistically significant difference. Adjuvant OK-432 sclerotherapy via closed suction drainage is a safe and effective treatment modality. The combination of surgical resection and post-operative adjuvant sclerotherapy via closed suction drainage should be integrated into the treatment algorithm of extensive cervicofacial lymphatic malformation. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  14. New combined therapy of radiation and local administration of OK-432 for esophageal cancer

    International Nuclear Information System (INIS)

    Mukai, Minoru; Morita, Shinroku; Tsunemoto, Hiroshi

    1990-01-01

    We devised new combination therapy of radiation and local administration of OK-432 and performed for 26 patients with esophageal cancer between March, 1987 and December, 1988 as a pilot study. The average age was 73 years. Among 26 patients, males were 20 and females were six. Patients were irradiated at the schedule of under 2 Gy/day and the dose of TDF (time, dose and fractionation factor) 100 totally. OK-432, 10KE was endoscopically administered around cancer lesion at the beginning of the radiotherapy, and two weeks later, 5KE was given in the same manner. Complete response was obtained in 20 out of 26 cases (77%) and partial response was obtained in the remaining six cases (23%). All six patients with tumor length less than five cm showed complete response. All 16 patients who could not eat food orally before treatment, became to take food enough orally after the treatment and could discharge in good condition. One year and two years survival rate of 26 patients by Kaplan Meier method were 67.4% and 47.2%, respectively. Six patients with tumor length less than five cm, are all alive without a sign of recurrence. This combination therapy will improve not only the response rate and the survival rate, but also the quality of life of patients with esophageal cancer. (author)

  15. The use of OK-432 to prevent seroma in extended latissimus dorsi flap donor site after breast reconstruction.

    Science.gov (United States)

    Yang, Yinlong; Chen, Yizuo; Qu, Jinmiao; Zhang, Xiaohua; Pan, Yifei

    2015-01-01

    The extended latissimus dorsi (LD) flap has become a preferred method of breast reconstruction. However, donor site seroma is the most common complication of LD flap reconstruction. The purpose of this study was to investigate the effectiveness of OK-432 on postoperative drainage and seroma formation in the site of the LD myocutaneous flap donor site. A retrospective study was conducted on 49 patients who underwent immediate breast reconstruction with extended LD flaps between July 2008 and September 2013. The patients received either OK-432 (OK-432 group, n = 24) or not (control group, n = 25) in the extended LD donor site. Outcome measures were obtained from the incidence and volume of postoperative seroma, total volume of back drains, the total drainage, indwelling period of drainage, and frequency of aspiration. There were no statistically significant differences between the two groups in terms of age, body mass index, and flap size. The incidence of seroma was 41.7% in the OK-432 group and 72% in the control group (P = 0.032). There were also significant reductions in volume of postoperative seroma (P = 0.021), total drainage volume (P OK-432 is a feasible option for the reduction or prevention of seroma formation at the donor site in patients undergoing immediate breast reconstruction using a LD myocutaneous flap for breast cancer. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Combination therapy of radiation and local administration of OK-432 for esophageal cancer

    International Nuclear Information System (INIS)

    Mukai, Minoru; Kubota, Susumu; Morita, Shinroku; Akanuma, Atsuo

    1994-01-01

    Combination therapy of radiation and local administration of OK-432 was performed for patients with esophageal cancer. Sixty patients without distant metastases completed the protocol and were evaluated. The average age was 72 years. There were 50 males and 10 females. The mean tumor length was 7.0 cm. Radiation was given at a rate of 1.6-1.8 Gy/5 fractions/week using 10 MV X ray. The mean total dose was 61.1 Gy. OK-432 of 10 KE was administered endoscopically around the cancerous lesion at the biginning of radiotherapy and another 5 KE was given in the same manner two weeks later. Complete response(CR) was obtained in 43 of 60 cases (71.7%) and partial response(PR) was obtained in the remaining 17 cases. Five-year cause-specific survival was 33.7%. Five-year survival of 43 patients with CR was 46.3%, and 17 patients with PR all died within 2 years. There was a significant difference (p<0.001) between two groups. According to a tumor length, 5-year survival of patients with tumors less than 5 cm in length was 63.4% and that of patients with tumors 5-10 cm in length was 49.9%, and 4-year survival of patients with tumors more than 10 cm in length was 10.4%. There was no significant difference between the first and second groups, but a significant difference was observed between the former two groups and the third group (p<0.001). According to T classification (UICC, 1987), 5-year survival of patients with T1- 3 was 59.5%, and that of patients with T4 was 11.3%. There was a significant difference (p<0.001) between two groups. (author)

  17. 18 CFR 4.32 - Acceptance for filing or rejection; information to be made available to the public; requests for...

    Science.gov (United States)

    2010-04-01

    ... PROJECT COSTS Application for Preliminary Permit, License or Exemption: General Provisions § 4.32... major modified project: § 4.41; (iv) License for a major project—existing dam: § 4.51; (v) License for a..., and the National Historic Preservation Act of 1966, 16 U.S.C. 470hh. (4)(i) An applicant must make...

  18. 17 CFR 4.32 - Trading on a Registered Derivatives Transaction Execution Facility for Non-Institutional Customers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Trading on a Registered... Securities Exchanges COMMODITY FUTURES TRADING COMMISSION COMMODITY POOL OPERATORS AND COMMODITY TRADING ADVISORS Commodity Trading Advisors § 4.32 Trading on a Registered Derivatives Transaction Execution...

  19. 11 CFR 105.1 - Place of filing; House candidates and their authorized committees (2 U.S.C. 432(g)(1)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Place of filing; House candidates and their authorized committees (2 U.S.C. 432(g)(1)). 105.1 Section 105.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL DOCUMENT FILING (2 U.S.C. 432(g)) § 105.1 Place of filing; House candidates and their authorized...

  20. Kepler-432 b: a massive warm Jupiter in a 52-day eccentric orbit transiting a giant star

    Science.gov (United States)

    Ortiz, Mauricio; Gandolfi, Davide; Reffert, Sabine; Quirrenbach, Andreas; Deeg, Hans J.; Karjalainen, Raine; Montañés-Rodríguez, Pilar; Nespral, David; Nowak, Grzegorz; Osorio, Yeisson; Palle, Enric

    2015-01-01

    We study the Kepler object Kepler-432, an evolved star ascending the red giant branch. By deriving precise radial velocities from multi-epoch high-resolution spectra of Kepler-432 taken with the CAFE spectrograph at the 2.2 m telescope of Calar Alto Observatory and the FIES spectrograph at the Nordic Optical Telescope of Roque de Los Muchachos Observatory, we confirm the planetary nature of the object Kepler-432 b, which has a transit period of 52 days. We find a planetary mass of Mp = 5.84 ± 0.05MJup and a high eccentricity of e = 0.478 ± 0.004. With a semi-major axis of a = 0.303 ± 0.007 AU, Kepler-432 b is the first bona fide warm Jupiter detected to transit a giant star. We also find a radial velocity linear trend of γ˙ = 0.44 ± 0.04 m s-1 d-1, which suggests the presence of a third object in the system. Current models of planetary evolution in the post-main-sequence phase predict that Kepler-432 b will be most likely engulfed by its host star before the latter reaches the tip of the red giant branch. Based on observations collected at the German-Spanish Astronomical Center, Calar Alto, jointly operated by the Max-Planck-Institut für Astronomie (Heidelberg) and the Instituto de Astrofísica de Andalucía (IAA-CSIC, Granada).Based on observations obtained with the Nordic Optical Telescope, operated on the island of La Palma jointly by Denmark, Finland, Iceland, Norway, and Sweden, in the Spanish Observatorio del Roque de los Muchachos of the Instituto de Astrofísica de Canarias.Table 3 is available in electronic form at http://www.aanda.org

  1. Dynamic Toll-like receptor expression predicts outcome of sclerotherapy for lymphatic malformations with OK-432 in children.

    Science.gov (United States)

    Reismann, Marc; Ghaffarpour, Nader; Luvall, Ethel; Jirmo, Adan C; Winqvist, Ola; Radtke, Josephine; Wester, Tomas; Claesson, Gösta

    2014-03-01

    Sclerotherapy with OK-432 is recommended as a first-line treatment for lymphatic malformations. However, 40% of patients show poor response, defined by involution to OK-432 effect is highly dependent on the Toll-like receptor (TLR) 4-dependent expression of TLR7 in antigen-presenting cells. We hypothesized that the ability for TLR expression in monocytes after treatment with the TLR4-ligand lipopolysaccharide (LPS) can be used to predict successful OK-432 treatment. Blood was taken from children with low responder (LR, n = 6) and high responder (HR, n = 5) of previous OK-432 treatment. Monocytes were stimulated with LPS for 20 h. TLR expression was analyzed with fluorescence-activated cell sorting (mean fluorescence intensity). The level of significance was P ≤ 0.05. The mean age of patients in the HR group was 1.4 ± 0.9 y and in the LR group 2.8 ± 2.9 y (P = 0.31). The mean TLR4 upregulation after LPS stimulation in the HR group was significantly higher than in the LR group (factor 3.6 versus factor 1 compared with nonstimulated controls; P = 0.037). The mean TLR7 expression did not show significant differences between the groups. Dynamic TLR4 expression represents most probably a predictive parameter for the treatment of lymphatic malformations with OK-432 and should be further investigated. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Efficacy of OK-432 sclerotherapy in treatment of lymphatic malformations: long-term follow-up results.

    Science.gov (United States)

    Weitz-Tuoretmaa, Annamaria; Rautio, Riitta; Valkila, Jan; Keski-Säntti, Harri; Keski-Nisula, Leo; Laranne, Jussi

    2014-02-01

    Lymphatic malformations (LMs) are rare congenital tumors of the lymphatic system often affecting the head and neck area. Because of cosmetic and functional symptoms most patients need to be treated. Traditionally surgical treatment has been considered to be the first-line treatment for LM. However, it is challenging because of the need for complete excision. The risk of poor cosmetic result and damage to surrounding structures is high. Since Ogita presented OK-432 as a treatment for LM in 1987, it has been widely used as the primary treatment. Many papers have been published on this topic but with relatively short follow-up times. We present a material of 36 LMs treated with OK-432 during the period of 1999-2009 and with an average follow-up time of 6 years. Immediate post-treatment results were compared with the late follow-up findings. Primary and late response to therapy was evaluated with an MRI scan by measuring the change in lesion size. At the follow-up visit, all patients were clinically examined and they answered a symptom questionnaire. Later 26/36 patients were also available for a quality of life questionnaire. Primarily 67% demonstrated a complete or marked response. At the follow-up 64% showed a complete or marked response, in 11% the final response was better than the initially observed and only 2 patients had relapsed. The initial response predicted the long-term outcome accurately and the effect of OK-432 sclerotherapy seems to be long lasting. According to the MRI evaluation 80% and subjectively 94% of the patients benefitted from the treatment. Quality of life questionnaire showed high post-treatment satisfaction. We found OK-432 sclerotherapy to be a safe and effective treatment with a long lasting effect in the management of macrocystic LMs.

  3. OK-432 reduces mortality and bacterial translocation in irradiated and granulocyte-colony stimulating factor (G-CSF)-treated mice

    International Nuclear Information System (INIS)

    Nose, Masako; Uzawa, Akiko; Ogyu, Toshiaki; Suzuki, Gen

    2001-01-01

    Acute radiation induces bacterial translocation from the gut, followed by systemic infection and sepsis. In order to reduce the mortality after acute whole body irradiation, it is essential to control bacterial translocation. In this study, we established a bacterial translocation assay as a sensitive method to detect minor mucosal injury by radiation. By utilizing this assay, we evaluated the adverse effects, if any, of hematopoietic reagents on the mucosal integrity in the respiratory and gastro-intestinal tracts. Bacterial translocation to the liver and spleen occurred after whole-body irradiation if the dose exceeded 6 Gy. The administration of G-CSF unexpectedly increased the bacterial translocation in 8 Gy-irradiated mice. The pharmaceutical preparation of low-virulent Streptococcus pyogenes, OK-432, significantly reduced the endotoxin levels in peripheral blood without any reduction of bacterial translocation. A combined treatment with G-CSF and OK-432 decreased bacterial translocation and prevented death. This result indicates that the early administration of G-CSF has an adverse effect on bacterial translocation, and that a combined treatment of G-CSF and OK-432 attenuates the adverse effect of G-CSF and improves the survival rate after acute irradiation. (author)

  4. OK-432 reduces mortality and bacterial translocation in irradiated and granulocyte-colony stimulating factor (G-CSF)-treated mice

    Energy Technology Data Exchange (ETDEWEB)

    Nose, Masako; Uzawa, Akiko; Ogyu, Toshiaki [National Inst. of Radiological Sciences, Chiba (Japan); Suzuki, Gen

    2001-06-01

    Acute radiation induces bacterial translocation from the gut, followed by systemic infection and sepsis. In order to reduce the mortality after acute whole body irradiation, it is essential to control bacterial translocation. In this study, we established a bacterial translocation assay as a sensitive method to detect minor mucosal injury by radiation. By utilizing this assay, we evaluated the adverse effects, if any, of hematopoietic reagents on the mucosal integrity in the respiratory and gastro-intestinal tracts. Bacterial translocation to the liver and spleen occurred after whole-body irradiation if the dose exceeded 6 Gy. The administration of G-CSF unexpectedly increased the bacterial translocation in 8 Gy-irradiated mice. The pharmaceutical preparation of low-virulent Streptococcus pyogenes, OK-432, significantly reduced the endotoxin levels in peripheral blood without any reduction of bacterial translocation. A combined treatment with G-CSF and OK-432 decreased bacterial translocation and prevented death. This result indicates that the early administration of G-CSF has an adverse effect on bacterial translocation, and that a combined treatment of G-CSF and OK-432 attenuates the adverse effect of G-CSF and improves the survival rate after acute irradiation. (author)

  5. OK-432-stimulated chemokine secretion from human monocytes depends on MEK1/2, and involves p38 MAPK and NF-κB phosphorylation, in vitro.

    Science.gov (United States)

    Olsnes, Carla; Bredholt, Therese; Olofsson, Jan; Aarstad, Hans J

    2013-04-01

    Interaction between the immune system and cancer cells allows for the use of biological response modifiers, like OK-432, in cancer therapy. We have studied the involvement of monocytes (MOs) in the immune response to OK-432 by examining MCP-1, MIP-1α and MIP-1β secretion, in vitro. OK-432-induced IL-6/TNF-α secretion has previously been shown to depend on mitogen-activated protein kinases (MAPKs) ERK1/2 and p38, and we therefore investigated the role of these MAPKs in OK-432-induced chemokine secretion. Here we demonstrate that pharmacological MEK1/2 kinase inhibition generally impaired chemokine secretion from MOs, whereas p38 MAPK inhibition in particular reduced MIP-1α production. Furthermore, simultaneous inhibition of MEK1/2 and Syk kinase was seen to have an additive impact on reduced MCP-1, MIP-1α and MIP-1β secretion. Based on single cell flow cytometry analyses, OK-432, lipoteichoic acid (LTA) and lipopolysaccharide (LPS) were seen to induce p38 MAPK and NF-κB phosphorylation in MOs with different time kinetics. LTA and LPS have been shown to induce ERK1/2 phosphorylation, whereas the levels of phosphorylated ERK1/2 remained constant following OK-432 treatment at the time points tested. Toll-like receptors (TLRs) recognize pathogen-associated molecular patterns, and we demonstrate increased TLR2 cell surface levels on the MO population, most profoundly following stimulation with LTA and OK-432. Together these results indicate that modulation of MEK1/2 and p38 MAPK signalling could affect the response to OK-432 treatment, having the potential to improve its therapeutic potential within cancer and lymphangioma treatment. © 2012 The Authors APMIS © 2012 APMIS.

  6. Effect of soluble factors derived from oral cancer cells on the production of interferon-γ from peripheral blood mononuclear cells following stimulation with OK-432.

    Science.gov (United States)

    Ohe, Go; Sasai, Akiko; Uchida, Daisuke; Tamatani, Tetsuya; Nagai, Hirokazu; Miyamoto, Youji

    2013-08-01

    The streptococcal antitumor agent OK-432 is commonly used as an immunopotentiator for immunotherapy in various types of malignant tumors including oral cancer. It has been demonstrated that OK-432 elicits an antitumor effect by stimulating immunocompetent cells, thereby inducing multiple cytokines including interferon (IFN)-γ, interleukin (IL)-2 and IL-12. Serum concentrations of IFN-γ in patients with oral cancer were examined 24 h after administration of OK-432. Serum concentrations of IFN-γ in patients with advanced cancer were significantly lower than those in patients with early cancer. These results suggested that some soluble factors produced by cancer cells may inhibit IFN-γ production with OK-432. Thus, in the present study, an in vitro simulation model was established for the immune status of patients with oral cancer by adding conditioned medium (CM) derived from oral cancer cell lines into a culture of peripheral blood mononuclear cells (PBMCs) derived from a healthy volunteer. We investigated whether soluble factors derived from oral cancer cells affected IFN-γ production from PBMCs following stimulation with OK-432. PBMCs stimulated with OK-432 produced a large amount of IFN-γ; however, both IFN-γ production and cytotoxic activity from PBMCs induced by OK-432 were inhibited by the addition of CM in a dose-dependent manner. In order to examine these inhibitory effects against IFN-γ production, the contribution of inhibitory cytokines such as IL-4, IL-6, IL-10, transforming growth factor-β and vascular endothelial growth factor was investigated. However, neutralization of these inhibitory cytokines did not recover IFN-γ production inhibited by CM. These results indicated that unknown molecules may inhibit IFN-γ production from PBMCs following stimulation with OK-432.

  7. Radiofrequency ablation and immunostimulant OK-432: combination therapy enhances systemic antitumor immunity for treatment of VX2 lung tumors in rabbits.

    Science.gov (United States)

    Hamamoto, Shinichi; Okuma, Tomohisa; Yamamoto, Akira; Kageyama, Ken; Takeshita, Toru; Sakai, Yukimasa; Nishida, Norifumi; Matsuoka, Toshiyuki; Miki, Yukio

    2013-05-01

    To evaluate whether antitumor immunity is enhanced systemically by combining radiofrequency ablation (RFA) and local injection of an immunostimulant, OK-432. Experiments were approved by the institutional animal care committee. Experimental Japanese rabbits inoculated with VX2 tumors in the lung and the auricle were randomized into four groups of eight: control (supportive care), RFA (RFA of lung tumor), OK-432 (direct injection of OK-432 into lung tumor), and combination therapy (lung RFA and direct OK-432 injection into lung tumor). All procedures were performed 1 week after implantation of VX2 tumors (week 1). In addition, a VX2 tumor rechallenge test was performed in the RFA and combination therapy groups. Survival time was evaluated by means of the Kaplan-Meier method and by using the log-rank test for intergroup comparison. Mean auricle tumor volumes were calculated every week. Specific growth rates (SGRs) were calculated and compared by using the Mann-Whitney test. The median survival times of the control, RFA, OK-432, and combination therapy groups were 23, 36.5, 46.5, and 105 days, respectively. Survival was significantly prolonged in the combination therapy group when compared with the other three groups (P OK-432 may lead to indirectly activation of systemic antitumor immunity. © RSNA, 2013.

  8. Phosphorylation at Thr432 induces structural destabilization of the CII ring in the circadian oscillator KaiC.

    Science.gov (United States)

    Oyama, Katsuaki; Azai, Chihiro; Matsuyama, Jun; Terauchi, Kazuki

    2018-01-01

    KaiC is the central oscillator protein in the cyanobacterial circadian clock. KaiC oscillates autonomously between phosphorylated and dephosphorylated states on a 24-h cycle in vitro by mixing with KaiA and KaiB in the presence of ATP. KaiC forms a C 6 -symmetrical hexamer, which is a double ring structure of homologous N-terminal and C-terminal domains termed CI and CII, respectively. Here, through the characterization of an isolated CII domain protein, CII K aiC , we show that phosphorylation of KaiC Thr432 destabilizes the hexameric state of the CII ring to a monomeric state. The results suggest that the stable hexameric CI ring acts as a molecular bundle to hold the CII ring, which undergoes dynamic structural changes upon phosphorylation. © 2017 Federation of European Biochemical Societies.

  9. Single stage concrete pumping through 2.432 km (1.51 miles: Weather and execution challenges

    Directory of Open Access Journals (Sweden)

    Chetan Hazaree

    2015-12-01

    Full Text Available This paper describes the execution challenges faced during single stage pumping of concrete through 2.432 km. Pump and pipeline selection and installation, materials’ development, establishing of control points and controlling variations are discussed. Concrete responses to weather changes play a vital role in concreting and pumping methodology development. Measuring pump pressure during pumping can provide insightful guidance to concreting. In order to optimize concrete mixtures, distance-specific mixture designs were developed and a relation between air-free paste volume (AFPV and pumping distance is derived. Pipeline priming and washout procedures specific to long-distance pumping are elaborated in detail. The paper presents a broad understanding regarding the challenges encountered; changes in pumping distance, materials, and climate would change the approach to solutions.

  10. Clinical response, drug survival and predictors thereof in 432 patients with ankylosing spondylitis switching anti tumor necrosis factor α therapy: Results from the Danish nationwide Danbio registry

    DEFF Research Database (Denmark)

    Glintborg, Bente; Østergaard, Mikkel; Krogh, N.

    2012-01-01

    , 432 patients (30%) switched to a second and 137 (10%) to a third biological drug. Compared with non-switchers, switchers were more frequently women (33%/22%), had shorter disease duration (3 years/5 years) and higher BASDAI (62(52-76) mm/56(43-69) mm (median(interquartile-range))), Bath AS Functional...

  11. The period analysis of V418 AQL, SU BOO, RV CVn, CR CAS, GV CYG, V432 PER, and BD+42 2782

    International Nuclear Information System (INIS)

    Zasche, P.; Wolf, M.; Kučáková, H.; Uhlař, R.

    2014-01-01

    The minimum timings of eclipsing binaries V418 Aql, SU Boo, RV CVn, CR Cas, GV Cyg, V432 Per, and BD+42 2782 were collected and analyzed. Their long-term behavior was studied via period analysis, revealing a periodic term in eclipse times. We derived 576 new times of minimum. Hence, to describe the periodic variation, a third-body hypothesis was proposed and the resulting orbital periods are as follows: 70, 7.4, 53, 37, 27, 53, and 18 yr, respectively. For the system V432 Per an additional 9.5 yr variation was also found. The predicted minimum masses of these distant bodies were calculated and their detectability discussed. The light curves of SU Boo and RV CVn were analyzed using the PHOEBE program, resulting in physical parameters of the components. New variable stars in the field of V418 Aql were discovered.

  12. A Case of Sublingual Ranula That Responded Successfully to Localized Injection Treatment with OK-432 after Healing from Drug Induced Hypersensitivity Syndrome

    Directory of Open Access Journals (Sweden)

    Kunio Yoshizawa

    2016-01-01

    Full Text Available A ranula is a mucus retention cyst or pseudocyst caused by leakage of mucus from the sublingual gland and generally occurs in the oral floor. In addition, drug induced hypersensitivity syndrome (DIHS is a rare but well-recognized serious adverse effect characterized by fever, skin rashes, generalized lymphadenopathy, hepatitis, and hepatosplenomegaly and oral stomatitis. This paper presents the first case of successfully treated sublingual ranula with localized injection of OK-432 after healing from drug induced hypersensitivity syndrome, which has previously been unreported in the literature. We present the case of a 38-year-old Japanese woman with sublingual ranula that responded successfully to localized injection treatment with OK-432 after healing from drug induced hypersensitivity syndrome. She was affected with cutaneous myositis and interstitial lung disease when she was 26 years old. At the age 34 years, she received additional oral treatment of diaminodiphenyl-sulfone due to deterioration of the cutaneous myositis, which resulted in drug induced hypersensitivity syndrome (DIHS with severe oral stomatitis. Local injection of OK-432 to the ranula may be a very safe and useful treatment method even if the patient has a history of drug allergy and has connective tissue disease such as cutaneous myositis.

  13. Effects of programmed death-ligand 1 expression on OK-432 immunotherapy following transurethral resection in non-muscle invasive bladder cancer.

    Science.gov (United States)

    Liu, Zhi-Hua; Zheng, Fu-Fu; Mao, Yu-Ling; Ye, Lie-Fu; Bian, Jun; Lai, De-Hui; Ye, Yun-Lin; Dai, Yu-Ping

    2017-06-01

    The present study aimed to investigate the effect of the negative costimulatory molecule programmed death-ligand 1 (PD-L1) on immunotherapy with OK-432, following transurethral resection of bladder tumors in non-muscle invasive bladder cancer (NMIBC), and to elucidate the underlying mechanism. PD-L1 was detected by immunohistochemical staining in tumor specimens from 55 cases of NMIBC following postoperative immunotherapy with OK-432. The PD-L1 mRNA and protein expression levels were measured in the bladder cancer T24 cell line and the human uroepithelial SV-HUC-1 cell line, following treatment with interleukin (IL)-2, interferon (IFN)-α and IFN-γ, by reverse transcription-quantitative polymerase chain reaction (RT-qPCR) and western blot analysis, respectively. PD-L1 was widely expressed in the NMIBC tumors, with 56.4% (31/55) of specimens exhibiting positive staining. When compared with PD-L1-negative patients, PD-L1-positive patients exhibited significantly increased recurrence [48.4% (15/31) vs. 16.7% (4/24)] and progression [16.1% (5/31) vs. 4.2% (1/24)] rates (POK-432 intravesical immunotherapy in patients with NMIBC. The results indicated that the involved mechanism occurred via upregulation of PD-L1 by immune cytokines, which in turn suppressed the antitumor effectiveness of the immune system, thereby promoting tumor recurrence and progression.

  14. Pages 427 - 432.pmd

    African Journals Online (AJOL)

    Administrator

    Siddik Keskin who performed the statistical analysis for the study. References. 1. Andersson RE, Hugander A, Thulin AJ. Diagnostic accuracy and perforation rate in appendicitis: association with age and sex of the patient and with appendicectomy rate. Eur J. Surg. 1992;158:37-41. 2. Yang HR, Wang YC, Chung PK, Chen ...

  15. Iris Melanoma Outcomes Based on the American Joint Committee on Cancer Classification (Eighth Edition) in 432 Patients.

    Science.gov (United States)

    Shields, Carol L; Di Nicola, Maura; Bekerman, Vladislav P; Kaliki, Swathi; Alarcon, Carolina; Fulco, Enzo; Shields, Jerry A

    2018-01-13

    The American Joint Committee on Cancer (AJCC) classification was updated to the eighth edition in January 2017, providing staging for iris melanoma. This study evaluated outcomes of iris melanoma per the AJCC classification, eighth edition. Retrospective case series. Four hundred thirty-two patients with iris melanoma. Management including tumor resection, plaque radiotherapy, or enucleation. Local tumor recurrence, melanoma-related systemic metastasis, and melanoma-related death. Of 432 patients with iris melanoma, AJCC classification was category T1 (n = 324 [75%]), T2 (n = 83 [19%]), T3 (n = 2 [iris color among T categories. Overall, Kaplan-Meier analysis of outcomes (at 5 and 10 years) revealed visual acuity reduction by 3 lines or more (42% and 54%, respectively), secondary glaucoma (29% and 33%, respectively), local recurrence (8% and 17%, respectively), secondary enucleation (12% and 19%, respectively), lymph node metastasis (1% and 1%, respectively), melanoma-related systemic metastasis (5% and 10%, respectively), and melanoma-related death (3% and 4%, respectively). Compared with T1 category, the hazard ratio (HR) for local recurrence in nonenucleated eyes was 1.31 for T2, not evaluable (NE) for T3 (because of small cohort), and 6.61 for T4; the HR for metastasis was 3.41 for T2, NE for T3 (because of small cohort), and 25.6 for T4; the HR for death was 7.51 for T2, NE for T3 (because of small cohort), and 26.5 for T4; and the odds ratio for enucleation was 1.23 for T2, 3.63 for T3, and 4.72 for T4. Features predictive of melanoma-related metastasis (multivariate analysis) included secondary glaucoma (P iris melanoma. By multivariate analysis, the ratio for melanoma-related metastasis was 4 times greater in category T2 and 31 times greater in T4 compared with T1. The ratio for melanoma-related death was 8 times greater in category T2 and 20 times greater in T4 compared with T1. The cohort size for T3 was too small to provide useful information

  16. A phase II study of cisplatin, oral administration of etoposide, OK-432 and radiation therapy for inoperable stage III non-small cell lung cancer

    Energy Technology Data Exchange (ETDEWEB)

    Abe, Yoshinao [Hirosaki Univ., Aomori (Japan). School of Medicine; Takahashi, Jutaro; Fukuda, Hiroshi [and others

    1998-12-01

    This study was designed to evaluate the feasibility and efficiency of giving cisplatin, etoposide, and OK-432 concurrently with conventional radiotherapy (RTx) for patient`s with inoperable stage III, based on the TNM classification according to the International Union against Cancer staging system for lung cancer (1987) non-small cell lung cancer (NSCLC). From January 1992 to December 1994, 31 patients with cytologically or histologically confirmed stage III NSCLC were treated with RTx, to a total dose of 56-64 Gy, with concurrent daily oral administration of etoposide (25 mg) and cisplatin (20 mg) for 5 days during the third or fourth week from the start of RTx. The subcutaneous injection of 1 or 2 KE of OK-432, three times a week, for the duration of radiotherapy also started from the beginning of RTx. The number of eligible patients was 29 (26 men and 3 women). Their mean age was 66 years (range, 55-77 years). Six patients had an Eastern Cooperative Oncology Group performance status (PS) of 0; 15, 1; 8; 2. Three were stage IIIA, and 26, stage IIIB. Histologically, 2 had adenocarcinoma, 23, squamous cell carcinoma, and 4, large cell carcinoma. In 27 of the 29 patients, the RTx schedule was completed. There were no treatment-related deaths. Grade 4 toxicity (according to World Health Organisation criteria) leukopenia (700/{mu}l) was observed in 1 patient. The response rate was 79% and the median survival was 17 months. Survival rates at 1, 2 and 3 years were 62%, 31%, and 21%, respectively. The local failure rate was 51%. The combination of cisplatin, etoposide, and OK-432, given concurrently with conventional RTx is feasible and effective for inoperable stage III NSCLC. (author)

  17. Vaccination with NY-ESO-1 overlapping peptides mixed with Picibanil OK-432 and montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen.

    Science.gov (United States)

    Wada, Hisashi; Isobe, Midori; Kakimi, Kazuhiro; Mizote, Yu; Eikawa, Shingo; Sato, Eiichi; Takigawa, Nagio; Kiura, Katsuyuki; Tsuji, Kazuhide; Iwatsuki, Keiji; Yamasaki, Makoto; Miyata, Hiroshi; Matsushita, Hirokazu; Udono, Heiichiro; Seto, Yasuyuki; Yamada, Kazuhiro; Nishikawa, Hiroyoshi; Pan, Linda; Venhaus, Ralph; Oka, Mikio; Doki, Yuichiro; Nakayama, Eiichi

    2014-01-01

    We conducted a clinical trial of an NY-ESO-1 cancer vaccine using 4 synthetic overlapping long peptides (OLP; peptides #1, 79-108; #2, 100-129; #3, 121-150; and #4, 142-173) that include a highly immunogenic region of the NY-ESO-1 molecule. Nine patients were immunized with 0.25 mg each of three 30-mer and a 32-mer long NY-ESO-1 OLP mixed with 0.2 KE Picibanil OK-432 and 1.25 mL Montanide ISA-51. The primary endpoints of this study were safety and NY-ESO-1 immune responses. Five to 18 injections of the NY-ESO-1 OLP vaccine were well tolerated. Vaccine-related adverse events observed were fever and injection site reaction (grade 1 and 2). Two patients showed stable disease after vaccination. An NY-ESO-1-specific humoral immune response was observed in all patients and an antibody against peptide #3 (121-150) was detected firstly and strongly after vaccination. NY-ESO-1 CD4 and CD8 T-cell responses were elicited in these patients and their epitopes were identified. Using a multifunctional cytokine assay, the number of single or double cytokine-producing cells was increased in NY-ESO-1-specific CD4 and CD8 T cells after vaccination. Multiple cytokine-producing cells were observed in PD-1 (-) and PD-1 (+) CD4 T cells. In conclusion, our study indicated that the NY-ESO-1 OLP vaccine mixed with Picibanil OK-432 and Montanide ISA-51 was well tolerated and elicited NY-ESO-1-specific humoral and CD4 and CD8 T-cell responses in immunized patients.

  18. Failure to Diagnose Hyperparathyroidism in 10,432 Patients With Hypercalcemia: Opportunities for System-level Intervention to Increase Surgical Referrals and Cure.

    Science.gov (United States)

    Balentine, Courtney J; Xie, Rongbing; Kirklin, James K; Chen, Herbert

    2017-10-01

    To determine whether a significant number of patients with hyperparathyroidism remain undiagnosed and untreated. Failure to diagnose primary hyperparathyroidism and refer patients to surgeons leads to impaired quality of life and increased costs. We hypothesized that many patients with hyperparathyroidism would be untreated due to not considering the diagnosis, inadequate evaluation of hypercalcemia, and under-referral to surgeons. We reviewed administrative data on 682,704 patients from a tertiary referral center between 2011 and 2015, and identified hypercalcemia (>10.5 mg/dL) in 10,432 patients. We evaluated whether hypercalcemic patients underwent measurement of parathyroid hormone (PTH), had documentation of hypercalcemia/hyperparathyroidism, or were referred to surgeons. The mean age of our cohort was 54 years, with 61% females, and 56% whites. Only 3200 (31%) hypercalcemic patients had PTH levels measured, 2914 (28%) had a documented diagnosis of hypercalcemia, and 880 (8%) had a diagnosis of hyperparathyroidism in the medical record. Only 592 (22%) out of 2666 patients with classic hyperparathyroidism (abnormal calcium and PTH) were referred to surgeons. A significant proportion of patients with hyperparathyroidism do not undergo appropriate evaluation and surgical referral. System-level interventions which prompt further evaluation of hypercalcemia and raise physician awareness about hyperparathyroidism could improve outcomes and produce long-term cost savings.

  19. NY-ESO-1 Protein Cancer Vaccine With Poly-ICLC and OK-432: Rapid and Strong Induction of NY-ESO-1-specific Immune Responses by Poly-ICLC.

    Science.gov (United States)

    Takeoka, Tomohira; Nagase, Hirotsugu; Kurose, Koji; Ohue, Yoshihiro; Yamasaki, Makoto; Takiguchi, Shuji; Sato, Eiichi; Isobe, Midori; Kanazawa, Takayuki; Matsumoto, Mitsunobu; Iwahori, Kota; Kawashima, Atsunari; Morimoto-Okazawa, Akiko; Nishikawa, Hiroyoshi; Oka, Mikio; Pan, Linda; Venhaus, Ralph; Nakayama, Eiichi; Mori, Masaki; Doki, Yuichiro; Wada, Hisashi

    2017-03-23

    We conducted a clinical trial of a cancer vaccine using NY-ESO-1 protein with polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) and/or OK-432 against solid tumors. A total of 15 patients were sequentially enrolled in 4 cohorts. Patients in cohort 1 received NY-ESO-1 protein; cohort 2a received NY-ESO-1 protein+OK-432; cohort 2b received NY-ESO-1 protein+poly-ICLC; cohort 3 received NY-ESO-1 protein+OK-432+poly-ICLC with Montanide ISA-51. The endpoints of this trial were safety, NY-ESO-1 immune responses, and clinical response. Vaccine-related adverse events observed were fever and injection-site reaction (grade 1). Two patients showed stable disease after vaccination. NY-ESO-1 antibodies were observed in 4 patients at the baseline (sero-positive) and augmented in all patients after vaccination. Eleven patients showed a conversion of negative antibody responses at baseline to positive after vaccination (seroconversion). The seroconversions were observed in all 11 sero-negative patients by the fourth immunization; in particular, it was observed by the second immunization in patients with poly-ICLC, and these induced antibody responses were stronger than those in patients immunized without poly-ICLC. The number of NY-ESO-1-specific interferon (IFN)γ-producing T cells was increased in patients immunized with poly-ICLC and/or OK-432, and furthermore, the increase of IFNγ-producing CD8 T cells in patients immunized with poly-ICLC was significantly higher than that in patients without poly-ICLC. Nonspecific activations of T-cell or antigen presenting cells were not observed. Our present study showed that poly-ICLC is a promising adjuvant for cancer vaccines.

  20. Is determination between complete and incomplete traumatic spinal cord injury clinically relevant? Validation of the ASIA sacral sparing criteria in a prospective cohort of 432 patients.

    Science.gov (United States)

    van Middendorp, J J; Hosman, A J F; Pouw, M H; Van de Meent, H

    2009-11-01

    Prospective multicenter longitudinal cohort study. To validate the prognostic value of the acute phase sacral sparing measurements with regard to chronic phase-independent ambulation in patients with traumatic spinal cord injury (SCI). European Multicenter Study of Human Spinal Cord Injury (EM-SCI). In 432 patients, acute phase (0-15 days) American Spinal Injury Association (ASIA)/International Spinal Cord Society neurological standard scale (AIS) grades, ASIA sacral sparing measurements, which are S4-5 light touch (LT), S4-5 pin prick (PP), anal sensation and voluntary anal contraction; and chronic phase (6 or 12 months) indoor mobility Spinal Cord Independence Measure (SCIM) measurements were analyzed. Calculations of positive and negative predictive values (PPV/NPV) as well as univariate and multivariate logistic regressions were performed in all four sacral sparing criteria. The area under the receiver-operating characteristic curve (AUC) ratios of all regression equations was calculated. To achieve independent ambulation 1-year post injury, a normal S4-5 PP score showed the best PPV (96.5%, Pscore (91.7%, Pscores (AUC: 0.906, Pindependent ambulation than with the use of currently used distinction between complete and incomplete SCI (AUC: 0.823, Pscore measurements do not contribute significantly to the prognosis of independent ambulation. The combination of the acute phase voluntary anal contraction and the S4-5 LT and PP scores, predicts significantly better chronic phase-independent ambulation outcomes than the currently used distinction between complete and incomplete SCI. This study was granted by 'Acute Zorgregio Oost' and the 'Internationale Stiftung für Forschung in Paraplegie (IFP)'.

  1. Cryo-electron Microscopy Reconstruction and Stability Studies of the Wild Type and the R432A Variant of Adeno-associated Virus Type 2 Reveal that Capsid Structural Stability Is a Major Factor in Genome Packaging.

    Science.gov (United States)

    Drouin, Lauren M; Lins, Bridget; Janssen, Maria; Bennett, Antonette; Chipman, Paul; McKenna, Robert; Chen, Weijun; Muzyczka, Nicholas; Cardone, Giovanni; Baker, Timothy S; Agbandje-McKenna, Mavis

    2016-10-01

    The adeno-associated viruses (AAV) are promising therapeutic gene delivery vectors and better understanding of their capsid assembly and genome packaging mechanism is needed for improved vector production. Empty AAV capsids assemble in the nucleus prior to genome packaging by virally encoded Rep proteins. To elucidate the capsid determinants of this process, structural differences between wild-type (wt) AAV2 and a packaging deficient variant, AAV2-R432A, were examined using cryo-electron microscopy and three-dimensional image reconstruction both at an ∼5.0-Å resolution (medium) and also at 3.8- and 3.7-Å resolutions (high), respectively. The high resolution structures showed that removal of the arginine side chain in AAV2-R432A eliminated hydrogen bonding interactions, resulting in altered intramolecular and intermolecular interactions propagated from under the 3-fold axis toward the 5-fold channel. Consistent with these observations, differential scanning calorimetry showed an ∼10°C decrease in thermal stability for AAV2-R432A compared to wt-AAV2. In addition, the medium resolution structures revealed differences in the juxtaposition of the less ordered, N-terminal region of their capsid proteins, VP1/2/3. A structural rearrangement in AAV2-R432A repositioned the βA strand region under the icosahedral 2-fold axis rather than antiparallel to the βB strand, eliminating many intramolecular interactions. Thus, a single amino acid substitution can significantly alter the AAV capsid integrity to the extent of reducing its stability and possibly rendering it unable to tolerate the stress of genome packaging. Furthermore, the data show that the 2-, 3-, and 5-fold regions of the capsid contributed to producing the packaging defect and highlight a tight connection between the entire capsid in maintaining packaging efficiency. The mechanism of AAV genome packaging is still poorly understood, particularly with respect to the capsid determinants of the required capsid

  2. N2 elimination thermolysis reactions of 9-(4- and 5-substituted-1,2,3-triazol-1-yl)acridines to produce 1H-pyrido-[4,3,2-kl] derivatives - A theoretical study

    Science.gov (United States)

    Taherpour, Avat (Arman); Ghasemhezaveh, Fatemeh; Yari, Ako; Khodaei, Mohammad Mehdi

    2017-05-01

    9-azidoacridine reacts under 1,3-dipolar reaction with alkyne derivatives to yield 9-(4- and 5-substituted-1,2,3-triazol-1-yl)acridine derivatives. The extrusion of N2 from these compounds leads to formation of carbene and biradical intermediates. Radical moieties interact with the acridine ring to form 1H-pyrido-[4,3,2-kl] derivatives. The focus of this study was on the theoretical and computational studies of the pathways of the products. The energy levels of the reactant species, TS forms (transition states), products, the free energies of reaction (ΔrG and ΔG#), HOMO & LUMO orbital levels, the ΔEHOMO-LUMO, dipolmoments, rate constants by using Eyring's equation (k and k‧), structural data were calculated by DFT (B3LYP/6-31G∗) method. The relative energies (in kcal mol-1) of the transition states as well as the biradical (singlet (S) and triplet (T); and carbene (singlet (S) and triplet (T); intermediates of the pyrolysis reactions on the reactants were investigated as well. The stepwise of the N2 elimination reactions have also investigated. The values of the free activation energy (ΔG#) in the concerted N2 elimination pyrolysis reactions were correlated to the decomposition temperature (TDecom.) of reactants.

  3. A phase I study of vaccination with NY-ESO-1f peptide mixed with Picibanil OK-432 and Montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen.

    Science.gov (United States)

    Kakimi, Kazuhiro; Isobe, Midori; Uenaka, Akiko; Wada, Hisashi; Sato, Eiichi; Doki, Yuichiro; Nakajima, Jun; Seto, Yasuyuki; Yamatsuji, Tomoki; Naomoto, Yoshio; Shiraishi, Kenshiro; Takigawa, Nagio; Kiura, Katsuyuki; Tsuji, Kazuhide; Iwatsuki, Keiji; Oka, Mikio; Pan, Linda; Hoffman, Eric W; Old, Lloyd J; Nakayama, Eiichi

    2011-12-15

    We conducted a phase I clinical trial of a cancer vaccine using a 20-mer NY-ESO-1f peptide (NY-ESO-1 91-110) that includes multiple epitopes recognized by antibodies, and CD4 and CD8 T cells. Ten patients were immunized with 600 μg of NY-ESO-1f peptide mixed with 0.2 KE Picibanil OK-432 and 1.25 ml Montanide ISA-51. Primary end points of the study were safety and immune response. Subcutaneous injection of the NY-ESO-1f peptide vaccine was well tolerated. Vaccine-related adverse events observed were fever (Grade 1), injection-site reaction (Grade 1 or 2) and induration (Grade 2). Vaccination with the NY-ESO-1f peptide resulted in an increase or induction of NY-ESO-1 antibody responses in nine of ten patients. The sera reacted with recombinant NY-ESO-1 whole protein as well as the NY-ESO-1f peptide. An increase in CD4 and CD8 T cell responses was observed in nine of ten patients. Vaccine-induced CD4 and CD8 T cells responded to NY-ESO-1 91-108 in all patients with various HLA types with a less frequent response to neighboring peptides. The findings indicate that the 20-mer NY-ESO-1f peptide includes multiple epitopes recognized by CD4 and CD8 T cells with distinct specificity. Of ten patients, two with lung cancer and one with esophageal cancer showed stable disease. Our study shows that the NY-ESO-1f peptide vaccine was well tolerated and elicited humoral, CD4 and CD8 T cell responses in immunized patients. Copyright © 2011 UICC.

  4. Improved efficacy of therapeutic vaccination with dendritic cells pulsed with tumor cell lysate against hepatocellular carcinoma by introduction of 2 tandem repeats of microbial HSP70 peptide epitope 407-426 and OK-432.

    Science.gov (United States)

    Ge, Chiyu; Xing, Yun; Wang, Qi; Xiao, Wen; Lu, Yong; Hu, Xiangbing; Gao, Zhenqiu; Xu, Maolei; Ma, Yanjun; Cao, Rongyue; Liu, Jingjing

    2011-12-01

    Therapeutic vaccination with dendritic cells (DCs) pulsed with tumor cell lysate vaccine (H-D) represents an attractive approach for hepatocellular carcinoma (HCC) treatment. However, the efficacy of this approach is not most satisfactory for the low levels of T helper 1 (Th1)-type cytokines secretion and weak T cell responses. In this study, in order to increase the potency of H-D, two tandem repeats of microbial HSP70 peptide epitope 407-426 (2mHSP70(407-426), M2) which has been demonstrated to be effective in enhancing DC maturation were applied. The DC vaccine (HM-D) which was HCC tumor cell lysate pulsed with M2 was developed. Nevertheless, the immunotherapeutic effect was still not satisfactory enough even some promotion was obtained. Therefore, OK-432 (OK), which is a useful anti-cancer agent and effectively in stimulating DC maturation, was introduced to HM-D. Our results demonstrated that treatment with the improved DC vaccine which was tumor cell lysate pulsed with M2 and OK (HMO-D), compared with H-D and HM-D, significantly increased cell surface markers (MHC-I and II, CD40, CD80, CD86 and CD11c) expression on DCs, enhanced Th1-type cytokines (IL-12, TNF-α and IFN-γ) production but not Th2-type cytokine (IL-5) production, induced remarkable high levels of lymphocytes proliferation and CD8(+) cytotoxic T-lymphocyte (CTL). Furthermore, immunization with HMO-D effectively reduced tumor progression and enhanced the survival of mice with H22 tumors. Besides, we also found that the capability of M2 in inducing the Th1 cytokines was stronger than OK. In view of these results, HMO-D vaccination provided a novel immunotherapeutic approach for the treatment of HCC. Copyright © 2011 Elsevier B.V. All rights reserved.

  5. Obstetric and perinatal outcomes after either fresh or thawed frozen embryo transfer: an analysis of 112,432 singleton pregnancies recorded in the Human Fertilisation and Embryology Authority anonymized dataset.

    Science.gov (United States)

    Maheshwari, Abha; Raja, Edwin Amalraj; Bhattacharya, Siladitya

    2016-12-01

    To explore obstetric and perinatal outcomes in singleton pregnancies occurring as a result of fresh and thawed frozen embryo transfer using anonymized Human Fertilisation and Embryology Authority data. Retrospective cohort study. Not applicable. Singleton births after IVF/intracytoplasmic sperm injection cycles in the United Kingdom (1991-2011). A total of 112,432 cycles (95,911 fresh and 16,521 frozen) were analyzed using multivariate logistic regression to explore associations between type of embryo transferred (frozen vs. fresh) and obstetric and perinatal outcomes. Relative risks (RRs) and their 99.5% confidence intervals (CIs) were calculated using Stata 14 MP, adjusting for potential confounders. Birth weight. The adjusted RR (99.5% CI) of low birth weight [0.73 (0.66-0.80)] and very low birth weight [0.78 (0.63-0.96)] were all lower after frozen embryo transfer; however, RR of having a high birth weight baby was higher [1.64 (1.53-1.76)]. There was no difference in RR of preterm birth [0.96 (0.88-1.03)], very preterm birth [0.86 (0.70-1.05)], and congenital anomalies [0.86 (0.73-1.01)]. The findings of low birth and very low birth weight after thawed frozen embryo transfer are consistent with the literature and provide reassurance regarding the outcome of pregnancies after frozen embryo transfers. However, they highlight the possibility of high birth weight in these babies. Because these results are based on observational data, further evidence from randomized, controlled trials is needed before elective cryopreservation of all embryos is practiced in preference to the current practice of transfer of fresh embryos. Crown Copyright © 2016. Published by Elsevier Inc. All rights reserved.

  6. EAMJ September 432-448.indd

    African Journals Online (AJOL)

    2008-09-09

    Sep 9, 2008 ... The duration of surgery and the use of power tools influenced the contamination rate. ... been shown to reduce the risk of exposure to blood and body ... Maxillofacial surgery. 3. 3.7. Neurosurgery. 4. 4.9. Obstetrics/Gynaecology. 7. 8.6. Orthopaedics. 21. 25.9. Paediatric surgery. 1. 1.2. Plastic surgery. 5. 6.2.

  7. Publications | Page 432 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4311 - 4320 of 6381 ... Current, accurate data about poverty in Cambodian communes is a valuable asset. Not only can the commune ... Small and Medium Enterprises (SME) Adjustments to Information Technology (IT) in Trade Facilitation: The South Korean Experience (restricted access). This report examines how IT ...

  8. BDML Metadata: 432 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_AK BDML file for the result of computer simulation of male pronuclear migration ...in C. elegans embryo the result of computer simulation of male pronuclear migration in C. elegans embryo (me...Stokes_rad: 10) C. elegans cell simulation push00-00018 Simulation Kimura, A. and Onami, S. Shuichi Onami, R

  9. 42 CFR 432.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... that demand little or no formal education; a high school diploma; or less than 4 years of college... benefits means the employer's share of premiums for workmen's compensation, employees' retirement... specialized personnel who have professional education and training in the field of medical care or appropriate...

  10. Publications | Page 432 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4311 - 4320 of 6371 ... In India, there has been unprecedented and unregulated growth of assisted reproductive technologies (ART) clinics providing in vitro fertilization ... Connecting West and Central Africa to the global research and education infrastructure : study for the Association of African Universities (AAU) of ...

  11. Publications | Page 432 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4311 - 4320 of 6378 ... This report examines how IT was incorporated into cargo clearance procedures in Korea, and what its implications are for traders, SMEs in particular. After a short introduction in Section I, Section II examines the definition of SMEs in Korea, and SMEs'' role in Korean trade. In Section III, we.

  12. EAMJ September 432-448.indd

    African Journals Online (AJOL)

    2008-09-09

    Sep 9, 2008 ... Malnutrition alone causes false negative results and HIV-infected subjects have significantly depressed delayed type hypersensitivity responses .... Determine HIV1/2 (Abbott Labs, Germany). If indeterminate or positive, confirmatory testing was done with Capillus HIV-1/HIV-2 (Trinity Biotech,. Ireland).

  13. 16 CFR 432.2 - Required disclosures.

    Science.gov (United States)

    2010-01-01

    ... or more amplifiers dedicated to different portions of the audio frequency spectrum, such as those... Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES POWER OUTPUT CLAIMS FOR AMPLIFIERS... amplifier is not designed for an 8-ohm impedance, at the impedance for which the amplifier is primarily...

  14. 16 CFR 432.4 - Optional disclosures.

    Science.gov (United States)

    2010-01-01

    ... other instantaneous power rating, such as music power or peak power, is represented under this section... are disclosed, and well known and generally recognized by the industry at the time the representations...

  15. 75 FR 432 - Notice of Extension of Concession Contracts

    Science.gov (United States)

    2010-01-05

    ... Recreation Area. GRTE004-98 Triangle X Ranch, LLP Grand Teton National Park. JODR002-90 International Leisure... Black Canyon/Willow Beach River Adventures. Lake Mead National Recreation Area. PORE003-98 Golden Gate...

  16. 432-IJBCS-Article - Dr S O Oke - Final version

    African Journals Online (AJOL)

    User

    a new environment deliberately or otherwise can have many unanticipated ecological effects (Howard and ... activities such as road construction colonised by Tithonia diversifolia on seedling emergence in the study sites. ..... low land of Papua New Guinea. Journal of Tropical Ecology, 16: 243-251. Hutchinson J, Dalziel JM.

  17. The 4-3-2 method for Kegel exercises.

    Science.gov (United States)

    Bridgeman, Bruce; Roberts, Steven G

    2010-03-01

    Performing Kegel exercises following prostatectomy is helpful in restoring continence, but requires concentration to accomplish the required contractions consistently. Confusion and effort with executing the procedure can reduce compliance. A new method subdivides the exercises into segments that can be executed without counting. The patient performs four sets of contractions daily, each set consisting of three contractions lasting two natural breaths, separated by two natural breaths. Because each number is below the limit that can be apprehended by subitizing without counting, cognitive effort is minimized.

  18. All projects related to | Page 432 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-03-31

    Haiti continues to face serious challenges in the area of state building and democratization. Start Date: March 31, 2009. End Date: October 16, 2013. Topic: PEACE RESEARCH, CONFLICT RESOLUTION, DEMOCRATIZATION, ECONOMIC RECONSTRUCTION, Economic and social development. Region: Argentina, South ...

  19. EISA 432 Energy Audits Best Practices: Software Tools

    Energy Technology Data Exchange (ETDEWEB)

    Maryl Fisher

    2014-11-01

    Five whole building analysis software tools that can aid an energy manager with fulfilling energy audit and commissioning/retro-commissioning requirements were selected for review in this best practices study. A description of each software tool is provided as well as a discussion of the user interface and level of expertise required for each tool, a review of how to use the tool for analyzing energy conservation opportunities, the format and content of reports generated by the tool, and a discussion on the applicability of the tool for commissioning.

  20. 432 Gender Inequality and its Challenge to Women Development in ...

    African Journals Online (AJOL)

    Where male are given prominence and priority over the females (girl) in contrast, were treated as miniature women who were expected work alongside their mothers and sisters. Through these childhood experience, girls and boys learned the norms of gender; the society's definition of what is “masculine” and “feminine”.

  1. Dicty_cDB: SFB432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available from clone. 44 0.67 3 AL138753 |AL138753.8 Human DNA sequence from clone RP11-3L8 on chromosome 9 Contains the TYRP1 gene for tyrosi...nase-related protein 1 and part of a putative novel gene. 38 0.68 3 BX530067 |BX530

  2. 42 CFR 432.50 - FFP: Staffing and training costs.

    Science.gov (United States)

    2010-10-01

    ... organization or a degree in a medical field issued by a college or university certified by a professional... salary or other compensation, fringe benefits, travel, per diem, and training, at rates determined on the... education and training” means the completion of a 2-year or longer program leading to an academic degree or...

  3. Ammonothermal synthesis of alkali-alkaline earth metal and alkali-rare earth metal carbodiimides. K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}

    Energy Technology Data Exchange (ETDEWEB)

    Mallmann, Mathias; Haeusler, Jonas; Cordes, Niklas; Schnick, Wolfgang [Department of Chemistry, University of Munich (LMU) (Germany)

    2017-12-13

    Alkali-alkaline earth metal and alkali-rare earth metal carbodiimides, namely K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (x = 0 - 1) (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}, were synthesized under ammonothermal conditions in high-pressure autoclaves. The structures of the three compounds can be derived from homeotypic K{sub 5}H(CN{sub 2}){sub 3} and Na{sub 5}H(CN{sub 2}){sub 3} by partial substitution of K{sup +} or Na{sup +}by Sr{sup 2+} or Eu{sup 2+}. The reactions were carried out in two step syntheses (T{sub 1} = 673 K, T{sub 2} = 823 K) starting from sodium or potassium azide, dicyandiamide and strontium or Eu(NH{sub 2}){sub 2}, respectively. The crystal structures were solved and refined from single-crystal X-ray diffraction data [K{sub 4.16}Sr{sub 0.84}(CN{sub 2}){sub 2.84}(HCN{sub 2}){sub 0.16}: space group Im3m (no. 229), a = 7.8304(5) Aa, Z = 2, R{sub 1} = 0.024, wR{sub 2} = 0.052; K{sub 4.40}Eu{sub 0.60}(CN{sub 2}){sub 2.60}(HCN{sub 2}){sub 0.40}: space group Im anti 3m (no. 229), a = 7.8502(6) Aa, Z = 2, R{sub 1} = 0.022, wR{sub 2} = 0.049]. In contrast to the potassium carbodiimides, the sodium-strontium carbodiimide was only synthesized as microcrystalline powder. The crystal structure was determined by powder X-ray diffraction and refined by the Rietveld method [Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}: space group Im3m (no. 229), a = 7.2412(1) Aa, Z = 2, R{sub wp} = 0.050]. The presence of hydrogencyanamide units ([HNCN]{sup -}) next to carbodiimide units ([CN{sub 2}]{sup 2-}) in all compounds was confirmed by FT-IR spectroscopy. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. : tous les projets | Page 432 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: RESEARCH FELLOWSHIPS, ENVIRONMENTAL ECONOMICS, ENVIRONMENTAL MANAGEMENT, ENVIRONMENTAL PROTECTION, ENVIRONMENTAL POLICY. Région: Middle East, North of Sahara, South of Sahara, Central Asia, Far East Asia, South Asia. Programme: Alimentation, environnement et santé.

  5. 432 püksipaari Riia kongresside palee fassaadil / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2000-01-01

    Filmifestivalil "Arsenals" sai parima režissööri kujukese Mait Laas nukufilmi "Teekond Nirvaanasse" eest, teise koha preemia Valentin Kuigi mängufilm "Lurjus" ja Riho Undi nukufilm "Saamuel internetis". Peaauhinna andis loos shoti naisrežissööri Lynne Ramsay mängufilmile "Rotipüüdja" ("Ratcatcher")

  6. Treatment of Lymphatic Malformations With OK-432 (Picibanil) : Review of the Literature

    NARCIS (Netherlands)

    Poldervaart, Michelle T.; Breugem, Corstiaan C.; Speleman, Lucienne; Pasmans, Suzanne

    Introduction: Lymphatic malformations (LM) are benign structural defects that call cause serious complications because of their size and location. Traditionally surgical removal was the first treatment modality, but this Could be associated with many complications and risks. Since Ogita introduced

  7. 40 CFR 432.3 - General limitation or standard for pH.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false General limitation or standard for pH... standard for pH. Any discharge subject to BPT, BCT, or NSPS limitations or standards in this part must remain within the pH range of 6 to 9. ...

  8. Picibanil (OK-432 in the treatment of head and neck lymphangiomas in children

    Directory of Open Access Journals (Sweden)

    Elena Rebuffini

    2012-01-01

    Conclusions: Intracystic injection of Picibanil is an effective and safe treatment for macrocystic LMs in pediatric patients and may represent the treatment of choice in such cases, especially where surgical excision is associated with the risk of functional/cosmetic side effects.

  9. 42 CFR 412.432 - Method of payment under the inpatient psychiatric facility prospective payment system.

    Science.gov (United States)

    2010-10-01

    ... SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM PROSPECTIVE PAYMENT SYSTEMS FOR... inpatient psychiatric facility receives payment under this subpart for inpatient operating cost and capital... without undue risk of resulting in an overpayment to the provider. (2) Frequency of payment. For...

  10. The incidence of apparent congenital urogenital anomalies in North Indian newborns: A study of 20,432 pregnancies

    Directory of Open Access Journals (Sweden)

    A. Bhat

    2016-09-01

    Conclusions: The incidence of apparent congenital urogenital anomalies was 3.91%. Infertility treatment, parity >2 and a maternal age >30 years were independently associated with an increased risk of congenital urogenital anomalies.

  11. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2011-01-05

    ... detection system could result in overheat of the fuel tank located in the horizontal stabilizer and ignition... before each flight. Failure of the auxiliary power unit (APU) bleed leak detection system could result in... auxiliary power unit (APU) bleed leak detection system could result in overheat of the fuel tank located in...

  12. SQL Server 2008 Administration Real World Skills for MCITP Certification and Beyond (Exams 70-432 and 40-450)

    CERN Document Server

    Carpenter, Tom

    2010-01-01

    The ideal on-the-job reference guide for SQL Server 2008 database administrators. If you manage and administer SQL Server 2008 in the real world, you need this detailed guide at your desk. From planning to disaster recovery, this practical book explores tasks and scenarios that a working SQL Server DBA faces regularly and shows you step by step how to handle them. Topics include installation and configuration, creating databases and tables, optimizing the database server, planning for high availability, and more. And, if you're preparing for MCTS or MCITP certification in SQL Server 2008 admin

  13. Religious Accommodation in Employment--The Eleventh Commandment? Trans World Airlines v. Hardison, 432 U.S. 63 (1977).

    Science.gov (United States)

    Johnson, Penni

    1978-01-01

    While the court accepted the existence of the employer's duty to accommodate an employee's religious beliefs, that duty seems to be directed toward maintaining employer neutrality rather than toward conferring employee privilege. Available from Arkansas Law Review, Inc., School of Law, University of Arkansas, Fayetteville, Arkansas 72701; $10.00…

  14. Apis mellifera (Hymenoptera: Apidae) as a potential Brassica napus pollinator (cv. Hyola 432) (Brassicaceae), in Southern Brazil.

    Science.gov (United States)

    Rosa, A S; Blochtein, B; Ferreira, N R; Witter, S

    2010-11-01

    Brassica napus Linnaeus is considered a self-compatible crop; however, studies show that bee foraging elevates their seed production. Considering bee food shortages during the winter season and that the canola is a winter crop, this study aimed to evaluate the foraging behaviour of Apis mellifera Linnaeus, 1758 regarding those flowers, and to verify if it presents adequate behaviour for successfully pollinating this crop in Rio Grande do Sul State. The study was carried out in a canola field, in Southern Brazil. The anthesis stages were morphologically characterised and then related to stigma receptivity and pollen grain viability. Similarly, the behaviour of A. mellifera individuals on flowers was followed, considering the number of flowers visited per plant, the amount of time spent on the flowers, touched structures, and collected resources. Floral fidelity was inferred by analysing the pollen load of bees collected on flowers. The bees visited from 1-7 flowers/plant (x = 2.02; sd = 1.16), the time spent on the flowers varied between 1-43 seconds (x = 3.29; sd = 2.36) and, when seeking nectar and pollen, they invariably touched anthers and stigmas. The pollen load presented 100% of B. napus pollen. The bees' attendance to a small number of flowers/plants, their short permanence on flowers, their contact with anthers and stigma and the integral floral constancy allows their consideration as potential B. napus pollinators.

  15. 1994 report on Tasks 4.3.1 and 4.3.2: Survey of anticipated requirements and qualification requirements for OSS

    International Nuclear Information System (INIS)

    Silvani, V.

    1995-01-01

    This is a preliminary report summarizing some topics related to the survey on functional and qualification requirements of Operator Support Systems (OSS's) in NPP's. This document has been prepared on the basis of the information presented in the previous meetings of this CRP working group. Additional information are expected when the answers to the working group questionnaire will be available. Functionalities examined are those referring to system functions and user's needs; technology trends are also considered. For practical purposes this document is divided in the followings: Summary of major OSS requirements and related problems as derived from the existing literature; appendix 1 reporting a summary of major functions performed by the OSS's presently in operation or under development in laboratories; appendix 2 reporting the list of standards for critical software. 18 refs, tabs

  16. Is determination between complete and incomplete traumatic spinal cord injury clinically relevant? Validation of the ASIA sacral sparing criteria in a prospective cohort of 432 patients.

    NARCIS (Netherlands)

    Middendorp, J.J. van; Hosman, A.J.F.; Pouw, M.H.; Meent, H. van de

    2009-01-01

    STUDY DESIGN: Prospective multicenter longitudinal cohort study. OBJECTIVE: To validate the prognostic value of the acute phase sacral sparing measurements with regard to chronic phase-independent ambulation in patients with traumatic spinal cord injury (SCI). SETTING: European Multicenter Study of

  17. Nuclear Regulatory Commission issuances: Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1 - December 31, 1996. Volume 44, Pages 1 - 432

    International Nuclear Information System (INIS)

    1997-01-01

    The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors' Decisions--DD, and Decisions on Petitions for Rulemaking--DPRM

  18. Nuclear Regulatory Commission issuances: Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1--December 31, 1996. Volume 44, Pages 1--432

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-10-01

    The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors` Decisions--DD, and Decisions on Petitions for Rulemaking--DPRM.

  19. Contribution to the Task 4.3.1 investigate how training should be planned to ensure efficient utilization of OSS. Task 4.3.2 evaluate how the introduction of OSS influences requirements to the basic education of the operator

    International Nuclear Information System (INIS)

    Balducelli, C.

    1995-01-01

    The introduction of computerized supports to improve efficiency in the activity of an intelligent agent (the operator in NPP case) increases the agent training demand. In fact also the informatic support can be viewed as an ''artificial agent'', more or less ''active'' depending on its internal degree of autonomy: the human agent needs to be trained to ''coordinate'' his behaviour with the behaviour of the artificial agent. The basic idea of this work is that a more safe, complete and integrated OSS could be a system (an artificial agent) that gives support to the human agent not only during the plant real operations, but also during the different phases of operator education and training for normal and emergency situations management. 7 refs, 2 figs

  20. 2) 出生前診断(シンポジウム 周産期をめぐる諸問題, 第432回新潟医学会)

    OpenAIRE

    本多, 達雄; Honda, Tatsuo

    1988-01-01

    The third trimester is considered a period of gestation in which induced abortion is no longer indicated. Preterm delivery, intrauterine treatment or simple waiting are the possible consequences. The establishment of treatment teams, referral of patients and availability of, for example, intensive pediatric care and pediatric surgery may considered important consequences.

  1. ComparativeIn VitroActivities of Relebactam, Imipenem, the Combination of the Two, and Six Comparator Antimicrobial Agents against 432 Strains of Anaerobic Organisms, Including Imipenem-Resistant Strains.

    Science.gov (United States)

    Goldstein, Ellie J C; Citron, Diane M; Tyrrell, Kerin L; Leoncio, Eliza; Merriam, C Vreni

    2018-02-01

    Relebactam is an important beta-lactamase inhibitor for certain aerobic organisms, but alone it has no antianaerobic activity, with most anaerobes having MICs of ≥32 μg/ml with the exception of a very few strains. There was no enhancement or antagonism of imipenem activity with the addition of relebactam, including activity against imipenem-resistant strains. The relebactam-imipenem combination had excellent overall activity against the anaerobes tested. Copyright © 2018 American Society for Microbiology.

  2. 'Direct and Indirect Shadow Price Estimates of Nitrate Pollution Treated as an Undesirable Output and Input', Journal of Agricultural and Resource Economics Vol. 27, No. 2 (December 2002) pp: 420-432.

    OpenAIRE

    Saleem Shaik; Glenn A Helmers; Michael Langemeier

    2005-01-01

    The implication of treating environmental pollution as an undesirable output (weak disposability) as well as a normal input (strong disposability) on the direct and indirect shadow price and cost estimates of nitrogen pollution abatement is analyzed using Nebraska agriculture sector data. The shadow price of nitrogen pollution abatement treated as an undesirable output represents the reduced revenue from reducing nitrogen pollution. In contrast, the shadow price of nitrogen pollution abatemen...

  3. Beliefs, practices and attitudes of portuguese undergraduate youth (Crenças, práticas e atitudes da juventude universitária portuguesa. DOI: 10.5752/P.2175-5841.2012v10n26p432

    Directory of Open Access Journals (Sweden)

    José Pereira Coutinho

    2012-07-01

    Full Text Available Abstract This paper presents results of the author’s PhD research: Catholic beliefs and practices, attitudes toward marriage, life and sexuality. The empirical support is a survey made to a sample of 500 students from Lisbon public universities, using a non-random sampling in two phases, first a quota sampling and after a convenience one. There are some results that stand out. More than half of students of the sample call themselves Catholic and believe in the dogmatic representations about God, Jesus and Mary, though other dogmatic beliefs as hell, purgatory and resurrection are much lower. There is some spirituality among students, although the importance of God is less important. The frequencies of the Mass, prayer, Holy Communion, confession are all very low. The attitudes toward marriage, life and sexuality lie between ‘some’ and ‘very’, with abortion having the smallest rating and contraception the highest. In general, undergraduate youth is away from the norms of the Church. At the same time, these youngsters believe and belong more than they practice. Keywords: Beliefs. Practices. Attitudes. Portugal. Undergraduate students.   Resumo Este artigo apresenta resultados da tese de doutoramento do autor: crenças e práticas católicas, atitudes em relação ao casamento, à vida e à sexualidade. O suporte empírico é um inquérito aplicado a uma amostra de 500 estudantes das universidades públicas de Lisboa, usando uma amostragem não aleatória em duas fases, primeiro a amostragem por quotas e depois a amostragem por conveniência. Há alguns resultados que se destacam. Mais do que metade da amostra denomina-se católica e acredita nas representações dogmáticas de Deus, Jesus e Maria, embora outras crenças dogmáticas como inferno, purgatório e ressurreição sejam bastante mais baixas. Há alguma espiritualidade entre os estudantes, embora menos considerem que Deus seja importante. A frequência da Missa, oração, comunhão, confissão é muito baixa. As atitudes relativamente ao casamento, vida e sexualidade estão entre ‘alguma’ e ‘muita’, tendo o aborto o valor mais pequeno e a contracepção o valor maior. Na generalidade, a juventude universitária está afastada das normas da Igreja. Ao mesmo tempo, eles acreditam e pertencem mais do que praticam. Palavras-chave: Crenças. Práticas. Atitudes. Portugal. Estudantes niversitários.

  4. Teacher's Guide for Computational Models of Animal Behavior: A Computer-Based Curriculum Unit to Accompany the Elementary Science Study Guide "Behavior of Mealworms." Artificial Intelligence Memo No. 432.

    Science.gov (United States)

    Abelson, Hal; Goldenberg, Paul

    This experimental curriculum unit suggests how dramatic innovations in classroom content may be achieved through use of computers. The computational perspective is viewed as one which can enrich and transform traditional curricula, act as a focus for integrating insights from diverse disciplines, and enable learning to become more active and…

  5. 1994 report on Task 4.3.1 investigate how training should be planned to ensure efficient utilisation or OSS. Task 4.3.2 evaluate how the introduction of OSS influences requirements to the basic education of the operator

    International Nuclear Information System (INIS)

    1995-01-01

    According to the experience coming from countries where new concepts of nuclear power plants control rooms equipped with integrated system of OSSs have recently been largely tested in experimental centres equipped with powerful real-time plant simulators (e.g. NORWAY - Halden project; Japan) a training in use of the OSS is important, so that the operator can use it in the right situation and in right manner. Experiments, in which mostly experienced active control room operators from operating NPPs took part showed as well, that both the requirements for additional basic education of operators and the planning of training is influenced by a number of different factors like complexity of system structure and interface, system function, capabilities of training centres, operators background, experience and age and others. 6 refs

  6. Comparisons of CVID and IgGSD: Referring Physicians, Autoimmune Conditions, Pneumovax Reactivity, Immunoglobulin Levels, Blood Lymphocyte Subsets, and HLA-A and -B Typing in 432 Adult Index Patients

    Directory of Open Access Journals (Sweden)

    James C. Barton

    2014-01-01

    Full Text Available Common variable immunodeficiency (CVID and immunoglobulin (Ig G subclass deficiency (IgGSD are heterogeneous disorders characterized by respiratory tract infections, selective Ig isotype deficiencies, and impaired antibody responses to polysaccharide antigens. Using univariable analyses, we compared observations in 34 CVID and 398 IgGSD adult index patients (81.9% women referred to a hematology/oncology practice. Similarities included specialties of referring physicians, mean ages, proportions of women, reactivity to Pneumovax, median serum IgG3 and IgG4 levels, median blood CD56+/CD16+ lymphocyte levels, positivity for HLA-A and -B types, and frequencies of selected HLA-A, -B haplotypes. Dissimilarities included greater prevalence of autoimmune conditions, lower median IgG, IgA, and IgM, and lower median CD19+, CD3+/CD4+, and CD3+/CD8+ blood lymphocytes in CVID patients. Prevalence of Sjögren’s syndrome and hypothyroidism was significantly greater in CVID patients. Combined subnormal IgG1/IgG3 occurred in 59% and 29% of CVID and IgGSD patients, respectively. Isolated subnormal IgG3 occurred in 121 IgGSD patients (88% women. Logistic regression on CVID (versus IgGSD revealed a significant positive association with autoimmune conditions and significant negative associations with IgG1, IgG3, and IgA and CD56+/CD16+ lymphocyte levels, but the odds ratio was increased for autoimmune conditions alone (6.9 (95% CI 1.3, 35.5.

  7. Comparisons of CVID and IgGSD: referring physicians, autoimmune conditions, pneumovax reactivity, immunoglobulin levels, blood lymphocyte subsets, and HLA-A and -B typing in 432 adult index patients.

    Science.gov (United States)

    Barton, James C; Bertoli, Luigi F; Barton, J Clayborn

    2014-01-01

    Common variable immunodeficiency (CVID) and immunoglobulin (Ig) G subclass deficiency (IgGSD) are heterogeneous disorders characterized by respiratory tract infections, selective Ig isotype deficiencies, and impaired antibody responses to polysaccharide antigens. Using univariable analyses, we compared observations in 34 CVID and 398 IgGSD adult index patients (81.9% women) referred to a hematology/oncology practice. Similarities included specialties of referring physicians, mean ages, proportions of women, reactivity to Pneumovax, median serum IgG3 and IgG4 levels, median blood CD56+/CD16+ lymphocyte levels, positivity for HLA-A and -B types, and frequencies of selected HLA-A, -B haplotypes. Dissimilarities included greater prevalence of autoimmune conditions, lower median IgG, IgA, and IgM, and lower median CD19+, CD3+/CD4+, and CD3+/CD8+ blood lymphocytes in CVID patients. Prevalence of Sjögren's syndrome and hypothyroidism was significantly greater in CVID patients. Combined subnormal IgG1/IgG3 occurred in 59% and 29% of CVID and IgGSD patients, respectively. Isolated subnormal IgG3 occurred in 121 IgGSD patients (88% women). Logistic regression on CVID (versus IgGSD) revealed a significant positive association with autoimmune conditions and significant negative associations with IgG1, IgG3, and IgA and CD56+/CD16+ lymphocyte levels, but the odds ratio was increased for autoimmune conditions alone (6.9 (95% CI 1.3, 35.5)).

  8. Disease: H01471 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available HORS ... Ogita S, Tsuto T, Nakamura K, Deguchi E, Tokiwa K, Iwai N ... TITLE ... OK-432 therapy for lymphangioma in children...Rautio R, Rautiainen M, Airaksinen M ... TITLE ... OK-432 (Picibanil) therapy for lymphangiomas in children. ...

  9. Ion beam techniques used for light elements composition estimation of complex multielemental layers prepared by magnetron sputtering

    Czech Academy of Sciences Publication Activity Database

    Peřina, Vratislav; Mikšová, Romana; Vlček, J.

    (2011), s. 432-432 [ICPIG 2011 Conference /30./. 28.08.2011-02.09.2011, Belfast] Institutional research plan: CEZ:AV0Z10480505 Keywords : ERDA Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  10. ORF Alignment: NT_037436 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Drosophila melanogaster] ... Length = 72 ... Query: 373 DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTR...EKLAARTALSEARVQVWF 432 ... DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTR...EKLAARTALSEARVQVWF Sbjct: 1 ... DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWF 60 ...

  11. Local Delivery System of Immune Modulating Drug for Unresectable Adenocarcinoma: In Vitro Experimental Study and In Vivo Animal Study

    International Nuclear Information System (INIS)

    Lee, Don Haeng; Kang, Sung-Gwon; Jeong, Seok; Yoon, Chang Jin; Choi, Jung-Ah; Byun, Ju Nam; Park, Jae Hyung; Lee, Kyu Back

    2006-01-01

    The purpose of the study was to evaluate the efficacy and safety of a developed drug delivery system containing OK-432 through in vitro and animal study. An OK-432-impregnated polycarbonate/polyurethane stent membrane was used to develop a drug delivery system (DDS) enabling the locoregional release of OK-432. Polyethyleneglycol was used as a detergent and porosity generator. The stability of OK-432 in solvent, releasing kinetics of drug, and cytotoxicity of the DDS were evaluated. OK-432-impregnated DDS was implanted in mice in which a human adenocarcinoma cell line was injected and grown in their back. Flow cytometry and enzyme-linked immunosorbent assay were used for quantifying the amount of drug. OK-432 exposed to phosphate-buffered saline and OK-432 exposed to N,N-dimethylacetamide showed similar results on dot graphs and histograms. However, OK-432 exposed to tetrahydrofurane showed different dot graphs and histograms, which means that the antigenicity of the drug was changed. The release rate of OK-432 was maintained at a constant level for 6 weeks. The local delivery of OK-432 was found to have an antitumor effect on a human adenocarcinoma cell line in an animal study, but no effect on this cell line in in vitro cell culture. Histologic examination showed minimal inflammatory reaction in surrounding tissue. Our study shows that local treatment using this OK-432 release system is safe and effective in reducing adenocarcinoma in a mouse model

  12. Dark fermentative hydrogen and ethanol production from biodiesel waste glycerol using a co-culture of Escherichia coli and Enterobacter sp.

    NARCIS (Netherlands)

    Maru, B.T.; López, F.; Kengen, S.W.M.; Constantí, M.; Medina, F.

    2016-01-01

    In previous comparative studies, Enterobacter spH1 was selected as the best hydrogen and ethanol producer (Knothe, 2010). Here, glycerol fermentation was compared between three other strains: Escherichia coli CECT432, Escherichia coli CECT434 and Enterobacter cloacae MCM2/1. E. coli CECT432 was

  13. Beyond a one-man show: The prelude of Revisionist Zionism, 1922-25

    Czech Academy of Sciences Publication Activity Database

    Zouplna, Jan

    2013-01-01

    Roč. 19, č. 3 (2013), s. 410-432 ISSN 1353-7121 Institutional support: RVO:68378009 Keywords : interwar Zionism * Israeli right * Russian-Jewish intelligentsia Subject RIV: AB - History Impact factor: 0.229, year: 2013

  14. Evidence of the use of a horn yoke in the Middle La Tène period, and an analysis of animal finds from La Tène features in the Velké Zboží and Malé Zboží cadasters, central Bohemia

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2015-01-01

    Roč. 67, č. 3 (2015), s. 432-437 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : cattle horn core * pathology * yoke * hornless sheep * Late Iron Age * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. 78 FR 28023 - National Vaccine Injury Compensation Program; List of Petitions Received

    Science.gov (United States)

    2013-05-13

    ... A. Bambalis, Winston-Salem, North Carolina, Court of Federal Claims No: 09-0543V. 261. Chloe Sampley... Chloe Authement, Lake Charles, Louisiana, Court of Federal Claims No: 09- 0887V. 432. Jacquie Nygren...

  16. Narva volikogu aseesimehe mullune teenistus ei jää palju maha ministripalgast / Erik Gamzejev

    Index Scriptorium Estoniae

    Gamzejev, Erik, 1967-

    2005-01-01

    Ilmunud ka: Severnoje Poberezhje 3. mai lk 3. Narva volikogu aseesimehe Larissa Olenina mullune aastateenistus kujunes tänu korduvalt makstud toetustele 411 432 krooni suuruseks. Tabel: Muud lisatasud

  17. 75 FR 73054 - Office of Elementary and Secondary Education; Overview Information; High School Equivalency...

    Science.gov (United States)

    2010-11-29

    .... Estimated Average Size of Awards: $432,000. Maximum Award: We will reject any application that proposes a... limit. Use a font that is either 12 point or larger or no smaller than 10 pitch (characters per inch...

  18. 76 FR 69246 - Application for New Awards; High School Equivalency Program

    Science.gov (United States)

    2011-11-08

    ... Average Size of Awards: $432,000. Maximum Award: We will reject any application that proposes a HEP award.... Use a font that is either 12 point or larger or no smaller than 10 pitch (characters per inch...

  19. Identification of Rhodococcus fascians cytokinins and their modus operandi to reshape the plant

    Czech Academy of Sciences Publication Activity Database

    Pertry, I.; Václavíková, Kateřina; Depuydt, S.; Galuszka, P.; Spíchal, Lukáš; Temmerman, W.; Stes, E.; Schmülling, T.; Kakimoto, T.; Van Montagu, M. C. E.; Strnad, Miroslav; Holsters, M.; Tarkowski, Petr; Vereecke, D.

    2009-01-01

    Roč. 106, č. 3 (2009), s. 929-934 ISSN 0027-8424 Institutional research plan: CEZ:AV0Z50380511 Keywords : phytopathogen * actinomycete * phytohormone Subject RIV: CE - Biochemistry Impact factor: 9.432, year: 2009

  20. Quantitative social research methods

    National Research Council Canada - National Science Library

    Singh, Kultar

    2007-01-01

    ... and T Distributions 382 387 394 Glossary Bibliography Index About the Author 398 411 424 432LIST OF TABLES 1.1 1.2 Cost and Benefit Distribution Over N Number of Years Review of District Action...

  1. Zeolite H-BEA catalysed multicomponent reaction: One-pot ...

    Indian Academy of Sciences (India)

    BEA catalysed multicomponent reaction: One-pot synthesis of amidoalkyl naphthols - Biologically active drug-like molecules. Sunil R Mistry Rikesh S Joshi Kalpana C Maheria. Volume 123 Issue 4 July 2011 pp 427-432 ...

  2. 78 FR 15031 - Agency Information Collection Activities: Ship's Store Declaration

    Science.gov (United States)

    2013-03-08

    ... stores, ship's stores, controlled narcotic drugs, bunker coal, or bunker oil in a format that can be..., and the articles on the ship. It is pursuant to the provisions of section 432, Tariff Act of 1930 and...

  3. Serious games for higher education: a framework for reducing design complexity

    NARCIS (Netherlands)

    Westera, Wim; Nadolski, Rob; Hummel, Hans; Wopereis, Iwan

    2008-01-01

    Westera, W., Nadolski, R., Hummel, H. G. K., & Wopereis, I. (2008). Serious games for higher education: a framework for reducing design complexity. Journal of Computer Assisted Learning, 24(5), 420-432.

  4. Ecocriticism and ´The House of Mirth´?

    OpenAIRE

    Caupert, Christina

    2012-01-01

    Ecocriticism and ´The House of Mirth´? : imaginative literature and cultural-ecological ethics. - In: Literature, ecology, ethics / Timo Müller ... (eds.). - Heidelberg : Univ.-Verl. Winter, 2012. - S. 131-145. - (Anglistische Forschungen ; 432)

  5. Marker list: QM297979 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM297979 Brassica rapa Brassicaceae cnu_m299a SSR TGTGAGAATGCAGTCCAAAACT TCTGGTCAT...GATGGTGGAAA second generation B. rapa reference linkage map ... 10.1186/1471-2164-10-432 19751531

  6. Marker list: QM297974 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM297974 Brassica rapa Brassicaceae cnu_m291a SSR CCGTACAAAGATACGCACGA ACAGAACTCGG...GGCTACCTC second generation B. rapa reference linkage map ... 10.1186/1471-2164-10-432 19751531

  7. Marker list: QM297797 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM297797 Brassica rapa Brassicaceae nia_m119a SSR GAGTGGGATTCTCATCATGG TACCGTCTTGG...CTCTTGAGT second generation B. rapa reference linkage map ... 10.1186/1471-2164-10-432 19751531

  8. Marker list: QM297976 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM297976 Brassica rapa Brassicaceae cnu_m294a SSR CAACGGTCCGTAACTGGTCT AGCTTCTCAGG...CTTGATTCG second generation B. rapa reference linkage map ... 10.1186/1471-2164-10-432 19751531

  9. 76 FR 1137 - Amendment of Limitation of Duty- and Quota-Free Imports of Apparel Articles Assembled in...

    Science.gov (United States)

    2011-01-07

    .... Title VII of the Tax Relief and Health Care Act (TRHCA) of 2006, Pub L. No. 107-432, extended the... apparel articles from Colombia and Ecuador for a six-week period, through February 12, 2011. With respect...

  10. 76 FR 66915 - Amendment of Limitation of Duty- and Quota-Free Imports of Apparel Articles Assembled in...

    Science.gov (United States)

    2011-10-28

    .... Title VII of the Tax Relief and Health Care Act (TRHCA) of 2006, Public Law 107-432, extended the... apparel articles from Colombia and Ecuador through September 30, 2011. For the period beginning on October...

  11. 76 FR 66914 - Amendment of Limitation of Duty- and Quota-Free Imports of Apparel Articles Assembled in...

    Science.gov (United States)

    2011-10-28

    .... Title VII of the Tax Relief and Health Care Act (TRHCA) of 2006, Public Law 107-432, extended the... apparel articles from Colombia and Ecuador through September 30, 2012. For the period beginning on October...

  12. Asteroid rotation excitation by subcatastrophic impacts

    Czech Academy of Sciences Publication Activity Database

    Henych, T.; Pravec, Petr

    2013-01-01

    Roč. 432, č. 2 (2013), s. 1623-1631 ISSN 0035-8711 Institutional support: RVO:67985815 Keywords : numerical methods * minor planets * general asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.226, year: 2013

  13. Physics Based Vision Systems for Robotic Manipulation

    Data.gov (United States)

    National Aeronautics and Space Administration — With the increase of robotic manipulation tasks (TA4.3), specifically dexterous manipulation tasks (TA4.3.2), more advanced computer vision algorithms will be...

  14. Stereotactic radiofrequency amygdalohippocampectomy: Two years of good neuropsychological outcomes

    Czech Academy of Sciences Publication Activity Database

    Malíková, H.; Krámská, L.; Vojtěch, Z.; Lukavský, Jiří; Liščák, R.

    2013-01-01

    Roč. 106, č. 3 (2013), s. 423-432 ISSN 0920-1211 Institutional support: RVO:68081740 Keywords : temporal lobe epilepsy * stereotactic surgery * neuropsychology outcome Subject RIV: AN - Psychology Impact factor: 2.190, year: 2013

  15. Civilian Health and Medical Program of the Uniformed Services (CHAMPUS). Change 6

    Science.gov (United States)

    1994-06-24

    Exception to general exclusion. 4-31c b. Limitations. 4-32 7. Transsexualism or hermaphroditism. 4-32 8. Cosmetic, reconstructive, or plastic surgery. 4... Transsexualism or hermaphroditism. 4-49 30. Sexual dysfunctions or inadequacies. 4-49 31. Corns, calluses, and toenails. 4-49 32. Dyslexia. 4-49 33...member) for whom the MTF provider maintains responsibility are also covered by the supplemental care program and subject to the requirements of this

  16. Analysis of the Active-Site Mechanism of Tyrosyl-DNA Phosphodiesterase I: A Member of the Phospholipase D Superfamily

    Energy Technology Data Exchange (ETDEWEB)

    Gajewski, Stefan; Comeaux, Evan Q.; Jafari, Nauzanene; Bharatham, Nagakumar; Bashford, Donald; White, Stephen W.; van Waardenburg, Robert C.A.M. (UAB); (SJCH)

    2012-03-15

    Tyrosyl-DNA phosphodiesterase I (Tdp1) is a member of the phospholipase D superfamily that hydrolyzes 3'-phospho-DNA adducts via two conserved catalytic histidines - one acting as the lead nucleophile and the second acting as a general acid/base. Substitution of the second histidine specifically to arginine contributes to the neurodegenerative disease spinocerebellar ataxia with axonal neuropathy (SCAN1). We investigated the catalytic role of this histidine in the yeast protein (His432) using a combination of X-ray crystallography, biochemistry, yeast genetics, and theoretical chemistry. The structures of wild-type Tdp1 and His432Arg both show a phosphorylated form of the nucleophilic histidine that is not observed in the structure of His432Asn. The phosphohistidine is stabilized in the His432Arg structure by the guanidinium group that also restricts the access of nucleophilic water molecule to the Tdp1-DNA intermediate. Biochemical analyses confirm that His432Arg forms an observable and unique Tdp1-DNA adduct during catalysis. Substitution of His432 by Lys does not affect catalytic activity or yeast phenotype, but substitutions with Asn, Gln, Leu, Ala, Ser, and Thr all result in severely compromised enzymes and DNA topoisomerase I-camptothecin dependent lethality. Surprisingly, His432Asn did not show a stable covalent Tdp1-DNA intermediate that suggests another catalytic defect. Theoretical calculations revealed that the defect resides in the nucleophilic histidine and that the pK{sub a} of this histidine is crucially dependent on the second histidine and on the incoming phosphate of the substrate. This represents a unique example of substrate-activated catalysis that applies to the entire phospholipase D superfamily.

  17. Combination therapy of radiation and immunomodulators in the treatment of MM46 tumor transplanted in C3H/He mice

    Energy Technology Data Exchange (ETDEWEB)

    Miyaji, C.; Ogawa, Y.; Imajo, Y.; Kimura, S. (Kobe Univ. (Japan). School of Medicine)

    1982-06-01

    Female C3H/He mice aged 12 weeks, transplanted MM46 tumor, were used in this study on the timing of administration of immunomodulators, such as PSK (a proteinbound polysaccharide prepared from Coriolus versicolor), OK-432 (Streptococcal preparation), bestatin (inhibitor of aminopeptidases of microbial origin) and levamisole (a chemical substance belonging to anthelmintics) combined with two fractionated local irradiation with the total dose of 3,000 rads. The daily dose of 250 ng/kg of PSK, 1 KE/mouse of OK-432, 300 mu g/mouse of bestatin or 3mg/kg of levamisole was respectively injected intraperitoneally for four consecutive days before or after irradiation. The anti-tumor effect was evaluated by the changes of tumor volume and survival curves. When PSK, OK-432 or levamisole was administered after irradiation, tumor growth was decreased and sixty-day survival rate and survival curve were significantly elongated compared with the control group and the group to which PSK, OK-432 or levamisole administered before irradiation (p lt 0.01). As for bestatin, no remarkable difference was observed irrespective of the timing of administration. These results suggested that some immunomodulators showed different anti-tumor activity depending on its timing of administration in the combination with radiotherapy. Concerning PSK, OK-432 and levamisole, they seemed to be beneficial in combination with prior radiotherapy in the treatment of MM46 tumor.

  18. Alleviation of acute radiation damages by post-irradiation treatments

    International Nuclear Information System (INIS)

    Kurishita, A.; Ono, T.

    1992-01-01

    Radiation induced hematopoietic and gastro-intestinal damages in mice were tried to alleviate experimentally by post-treatment. Combined treatment of OK-432 and aztreonam clearly prevented the radiation induced sepsis and elevated the survival rate in mice; the survival was 80% in the OK-432 plus aztreonam group while it was 55% in the group treated with OK-432 alone and 0% with saline. Irsogladine maleate, an anti-ulcer drug, increased the survival rate of jejunal crypt stem cells with a clear dose-related trend. The D 0 for irsogladine maleate was 2.8 Gy although it was 2.3 Gy for saline, These findings suggest that some conventional drugs are effective for radiation induced hematopoietic and gastro-intestinal damages and the possibility that they can be applied for people exposed to radiation accidentally. (author)

  19. Light-output response of the plastic scintillator for the Mars Science Laboratory (MSL) Radiation Assessment Detector (RAD)

    Science.gov (United States)

    Martin, C.; Boehm, E.; Kortmann, O.; Boettcher, S.; Wimmer-Schweingruber, R. F.; Burmeister, S.; Ehresmann, B.; Hassler, D. M.; Zeitlin, C.; Posner, A.; Neal, K.; Rafkin, S.; Weigle, E.; Reitz, G.

    2008-12-01

    The Radiation Assessment Detector (RAD) onboard NASA's Mars Science Laboratory (MSL) rover mission has been designed to detect a wide range of particle types (charged and neutral) and energies on the Mars surface. The BC432m plastic scintillator coupled to PIN photodiodes has been used as a neutron detector as well as an anticoincidence shield for the RAD instrument. We present an experimental study of the non-linear light-output response of the BC432m for protons and neutrons beams. The experimental results have been compared to the parametric formula based on the theoretical work of Birks and Chou. Furthermore, a comparison between the quenching effect found in the BC432m and in other inorganic scintillators (CsI:Tl) used in the RAD instrument has been performed.

  20. Toxicity studies for indigenous Bacillus thuringiensis isolates from Malang City, East Java on Aedes aegypti larvae.

    Science.gov (United States)

    Gama, Zulfaidah Penata; Nakagoshi, Nobukazu; Suharjono; Setyowati, Faridah

    2013-02-01

    To investigate the toxicity of indigenous Bacillus thuringiensis (B. thuringiensis)isolates from Malang City for controlling Aedes aegypti (Ae. aegypti) larvae. Soil samples were taken from Purwantoro and Sawojajar sub-districts. Bacterial isolation was performed using B. thuringiensis selective media. Phenotypic characteristics of the isolates were obtained with the simple matching method. The growth and prevalence of spores were determined by the Total Plate Count method, and toxicity tests were also performed on the third instar larval stage of Ae. aegypti. The percentage of larval mortality was analysed using probit regression. The LC50 was analysed by ANOVA, and the Tukey HSD interval was 95%. Among the 33 selected bacterial isolates, six were obtained (PWR4-31, PWR4-32, SWJ4-2b, SWJ4-4b, SWJ-4k and SWJ5-1) that had a similar phenotype to reference B. thuringiensis. Based on the dendrogram, all of the bacterial isolates were 71% similar. Three isolates that had a higher prevalence of reference B. thuringiensis were PWR4-32, SWJ4-4b and SW5-1, of which the spore prevalence was 52.44%, 23.59%, 34.46%, respectively. These three indigenous isolates from Malang City successfully killed Ae. aegypti larvae. The PWR4-32 isolates were the most effective at killing the larvae. Six indigenous B. thuringiensis isolates among the 33 bacterial isolates found in the Sawojajar and Purwantoro sub-districts were toxic to the third instar larvae of Ae. aegypti. The PWR4-32 isolates were identical to the reference B. thuringiensis and had 88% phenotype similarity. The PWR4-32 isolates had the highest spore prevalence (52.44%), and the early stationary phase occurred at 36 h. The PWR4-32 isolates were the most effective at killing Ae. aegypti larvae (LC50-72 h=2.3×10(8) cells/mL).

  1. The fatty acid and cholesterol composition of enriched egg yolk lipids obtained by modifying hens’ diets with fish oil and flaxseed

    OpenAIRE

    Yalçyn, Hasan; Basmacyoolu, Hatice; Kemal Ünal, Mustafa

    2007-01-01

    The effects of fish oil and flaxseed in the diets of laying hens on the cholesterol and fatty acid composition of egg lipids were studied. Isa-White laying hens and five experimental diets were used. The first diet was used as the control. Fish oil (1.5%), flaxseed (4.32% and 8.64) or both of them (1.5% fish oil and 4.32% flaxseed) were added to the others and hens were fed for 30 and 60 days. The cholesterol and fatty acid composition of the yolks were determined. No significant difference (p

  2. Penentuan Added Mass Hycat Akibat Gerakan Couple Heaving Pitching Pada Gelombang Reguler

    OpenAIRE

    Murtedjo, Mas

    2003-01-01

    . An experimental study has been performed at the Indonesia Hydrodynamics Laboratory to measure the added mass of a HYCAT model due to couple heave-pitch mode of motion. A series of tests were conducted by settingthe model draft at 0,278 m, in the 0,1 m wave height, three different model speed of 4.432 m/sec, 4.77 m/sec, and 5.144 m/sec, with variation in wave period ranging from 0.8 to 1.4 sec, for each model speed. Results of the experiment show that at 4.432 m/sec model speed, the added ma...

  3. Genetic and bibliographic information: AIF1 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available ion (MeSH) Digestive System Diseases (C06) > Gastrointestinal Diseases (C06.405) > Gastroenteritis (C06.405....205) > Inflammatory Bowel Diseases (C06.405.205.731) > Crohn Disease (C06.405.205.731.500) Digestive System Diseases... (C06) > Gastrointestinal Diseases (C06.405) > Intestinal Diseases (C06.4...05.469) > Inflammatory Bowel Diseases (C06.405.469.432) > Crohn Disease (C06.405.469.432.500) Cardiovascular Diseases...280.647.500) Cardiovascular Diseases (C14) > Vascular Diseases (C14.907) > Myocar

  4. Sociodemographic Characteristics Of Young Adults Screened For ...

    African Journals Online (AJOL)

    Method: HIV screening was performed on all (n = 673) young adults referred to the retrovirology unit of the Haematology Department of the University of Port Harcourt Teaching Hospital between January 2003 to December 2003 comprising of 205 males and 432 females were screened for HIV using a double ELISA ...

  5. Characteristic of monotonicity of Orlicz function spaces equipped with the Orlicz norm

    Czech Academy of Sciences Publication Activity Database

    Foralewski, P.; Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2013-01-01

    Roč. 53, č. 2 (2013), s. 421-432 ISSN 0373-8299 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : Orlicz space * Köthe space * characteristic of monotonicity Subject RIV: BA - General Mathematics

  6. Bioacciimulation of copper in the tissues of Potamonautes warreni ...

    African Journals Online (AJOL)

    The copper concentration detected in the water and sediments of the Natalspruit River, Bronkhorstspruit River and Nooitgedacht Dam exceeded certain stated ... The bioaccumulation factors (BF) calculated for the different tissues with respect to the water were highest in the gills and midgut gland (785,00 – 1257,50 and 432 ...

  7. Influence of cooling rate and cerium addition on rapidly solidified Al-TM alloys

    Czech Academy of Sciences Publication Activity Database

    Michalcová, A.; Vojtěch, D.; Schumacher, G.; Novák, P.; Klementová, Mariana; Šerák, J.; Mudrová, M.; Valdaufová, J.

    2010-01-01

    Roč. 48, č. 1 (2010), s. 1-7 ISSN 0023-432X Institutional research plan: CEZ:AV0Z40320502 Keywords : rapid solidification * Al-TM * microstructure * aluminium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2010

  8. Oxidation of aniline with strong and weak oxidants

    Czech Academy of Sciences Publication Activity Database

    Sapurina, I. Yu.; Stejskal, Jaroslav

    2012-01-01

    Roč. 82, č. 2 (2012), s. 256-275 ISSN 1070-3632 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * oxidant Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.432, year: 2012

  9. Untitled

    African Journals Online (AJOL)

    Summary. Objective. To assess the indications for and outcomes of primary caesarean section (PCS) perfomed in nulliparous and grandmultiparous women in the Abha region of Saudi Arabia. Methods. A retrospective cohort study. Materials. 393 nulliparous women (para 0) (NPG) and 432 grandmultiparous women ...

  10. Změny struktury a fázového složení intermetalické sloučeniny Ni3Al vlivem okolní atmosféry při zvýšených teplotách

    Czech Academy of Sciences Publication Activity Database

    Pizúrová, Naděžda; Schneeweiss, Oldřich

    2001-01-01

    Roč. 39, č. 2 (2001), s. 121-131 ISSN 0023-432X R&D Projects: GA ČR GA106/97/1044; GA ČR GA106/99/0183 Institutional research plan: CEZ:AV0Z2041904 Keywords : electrical resistivity * intermetallics * corrosion Subject RIV: JG - Metallurgy Impact factor: 0.343, year: 2001

  11. A comparison of the modern and classic golf swing: a clinician's ...

    African Journals Online (AJOL)

    . The clubhead hits the ball. Early follow-through. From impact to club horizontal to ground. Late follow-through. From club horizontal to end of swing. Results in the ... tus lateralis and adductor magnus.4,32 In the upper body, the combined ...

  12. A Culture of Extrinsically Motivated Students: Chemistry

    Science.gov (United States)

    Orvis, Jessica N.; Sturges, Diana; Tysinger, P. Dawn; Riggins, Keenya; Landge, Shainaz

    2018-01-01

    Recent research indicates that students are adopting a consumerist approach to education, while data shows that the best academic outcomes are associated with intrinsic motivation. The goal of the study was to explore student academic motivation in an undergraduate Principles of Chemistry I class. The study targeted 432 students enrolled in 9…

  13. 75 FR 29296 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-05-25

    ... Tanana An area north of the Tanana +431 +432 Fairbanks-North Star River and Chena River. River levee and... of Old Airport Road and Mitchell Expressway to the west. An area north of the Tanana None +446 River...)....... Approximately 460 feet None +1004 Unincorporated Areas upstream of West Charles of Fayette County. Street. City...

  14. Analysis of Medication Errors of Health Care Providers on the Basis of Data from the Czech Toxicological Information Centre over an 11-Year Period (2000-2010)

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Navrátil, Tomáš; Pelclová, D.

    2012-01-01

    Roč. 110, č. 5 (2012), s. 427-432 ISSN 1742-7835 R&D Projects: GA AV ČR IAA400400806; GA ČR GAP206/11/1638 Institutional research plan: CEZ:AV0Z40400503 Keywords : ADVERSE DRUG EVENTS * PEDIATRIC INPATIENTS * ADMINISTRATION ERRORS Subject RIV: CG - Electrochemistry Impact factor: 2.124, year: 2012

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 301 - 350 of 432 ... Vol 21, No 1 (2016), Strategies to facilitate professional development of the occupational health nurse in the occupational health setting, Abstract PDF. Nicolene de Jager, Anna G.W. Nolte, Annie Temane. Vol 22, No 1 (2017), Strengths of families to limit relapse in mentally ill family members, Abstract ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 432 ... Vol 22, No 1 (2017), Effect of personal and work stress on burnout, job satisfaction and general health of hospital nurses in South Africa, Abstract PDF ... Vol 14, No 1 (2009), Experiences of healthcare providers managing sexual assault victims in the emergency unit Part 2: Discussion of results and ...

  17. Optimal light for greenhouse culture of American ginseng seedlings

    Directory of Open Access Journals (Sweden)

    John T.A. Proctor

    2017-07-01

    Full Text Available Three greenhouse experiments with American ginseng seedlings growing under light levels from 4.8% to 68% showed a quadratic response for root dry weight, giving an optimal root dry weight of 239 mg (range 160–415 mg at an optimal light level of 35.6% (range 30.6–43.2%.

  18. A New "online" Method to Measure Increased Exhaled Isoprene in end-stage Renal Failure

    Czech Academy of Sciences Publication Activity Database

    Davies, S.; Španěl, Patrik; Smith, D.

    2001-01-01

    Roč. 16, - (2001), s. 836-839 ISSN 0931-0509 R&D Projects: GA ČR GA203/97/P130 Institutional research plan: CEZ:AV0Z4040901 Keywords : biocompatibility * haemodialysis * SIFT-MS Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.432, year: 2001

  19. Cultivation of Agaricus bisporus on wheat straw and waste tea ...

    African Journals Online (AJOL)

    Administrator

    2007-02-19

    Feb 19, 2007 ... 24 h intervals. Therefore, totally 432 measures were made for both compost formula. Thus, 27 temperature measurement points were selected in total (Figure 1). Mushroom cultivation. Composts were spawned with 30 g mycelium (Type Horst U1) per kg then filled into plastic bags as 7 kg wet weight basis.

  20. A novel approach for phytotoxicity assessment by CCD fluorescence imaging

    Czech Academy of Sciences Publication Activity Database

    Gavel, Alan; Maršálek, Blahoslav

    2004-01-01

    Roč. 19, - (2004), s. 429-432 ISSN 1520-4081 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : phytotoxicity * chlorophyll fluorescence * algal bioassay Subject RIV: EF - Botanics Impact factor: 1.373, year: 2004

  1. Growth and photoemission spectroscopic studies of ultrathin noble ...

    Indian Academy of Sciences (India)

    2015-05-24

    1989). [15] G Nicolay, R Claessen, F Reinert, V N Strocov, S Hüfner, H Gao, U Hartmann and E Buchar,. Surf. Sci. 432, 95 (1999). [16] S K Mahatha and Krishnakumar S R Menon, J. Phys.: Condens. Matter 25, 115501 (2013).

  2. 75 FR 4336 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-01-27

    ... resources in the form of fresh, nutritious, unprepared locally grown fruits, vegetables, honey and herbs... it displays a currently valid OMB control number. Food and Nutrition Service Title: 7 CFR part 245...,432. Food and Nutrition Service Title: Quality Control Review Schedule. OMb Control Number: 0584-0299...

  3. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration ... 6,432 views 4:50 Prolonged Exposure for PTSD - Duration: 2:45. Veterans Health Administration 54,464 ...

  4. Oxidation of ST55, LH15 and Arema steels at high temperatures in ambient air

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jaroslav; Million, Bořivoj; Adamaszek, K.

    2004-01-01

    Roč. 42, č. 4 (2004), s. 242-250 ISSN 0023-432X Institutional research plan: CEZ:AV0Z2041904 Keywords : high temperatures * oxidation steels * ambient air Subject RIV: JG - Metallurgy Impact factor: 1.056, year: 2004

  5. health care seeking behavior for common childhood illnesses

    African Journals Online (AJOL)

    tsion

    Care was sought from health facilities only for less than half of sick rural children 48 (43.2%) as compared to urban. 41(87.2%). Mothers' responses and actions were frequently influenced by their perception of ... CONCLUSION: There was low health care seeking practices particularly among rural mothers which might have.

  6. A Bildung-psychological investigation into student motives : McKinsey- or von Humboldt-oriented?

    NARCIS (Netherlands)

    Koops, Willem; van den Kerkhof, Michael; Ostermeier, Carlien; van de Schoot, Rens

    2016-01-01

    This study examined differential student motives among students from a social sciences bachelor’s degree, and whether this difference related to participating in educational programmes for broader intellectual formation (Bildung). Survey research was conducted among 432 Dutch students (79.5%

  7. Normalized difference vegetation index (NDVI) in the management of mountain meadows

    Czech Academy of Sciences Publication Activity Database

    Mašková, Z.; Zemek, František; Květ, Jan

    2008-01-01

    Roč. 13, - (2008), s. 417-432 ISSN 1239-6095 R&D Projects: GA ČR(CZ) GA206/99/1410 Institutional research plan: CEZ:AV0Z60870520 Keywords : normalized difference vegetation index * mountain medows * mulching Subject RIV: EH - Ecology, Behaviour Impact factor: 1.620, year: 2008 www.borenv.net

  8. Laser Plasma Plume Kinetic Spectroscopy of the Nitrogen and Carbon Species

    Czech Academy of Sciences Publication Activity Database

    Zelinger, Zdeněk; Novotný, Michal; Bulíř, Jiří; Lančok, Ján; Kubát, Pavel; Jelínek, Miroslav

    2003-01-01

    Roč. 43, - (2003), s. 426-432 ISSN 0863-1042 R&D Projects: GA AV ČR IAA1010110 Institutional research plan: CEZ:AV0Z4040901 Keywords : laser ablation * laser plasma * emission spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.863, year: 2003

  9. Formation of Layered Double Hydroxides on Alumina Surface in Aqueous Solutions Containing Divalent Metal Cations

    Czech Academy of Sciences Publication Activity Database

    Kovanda, F.; Mašátová, P.; Novotná, P.; Jirátová, Květa

    2009-01-01

    Roč. 57, č. 4 (2009), s. 425-432 ISSN 0009-8604 R&D Projects: GA ČR GA104/07/1400 Institutional research plan: CEZ:AV0Z40720504 Keywords : deposition * layered double hydroxides * supported mixed oxides Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.431, year: 2009

  10. Creep threshold of a Mg-4Al-1Ca alloy

    Czech Academy of Sciences Publication Activity Database

    Milička, Karel

    2008-01-01

    Roč. 46, č. 6 (2008), s. 323-329 ISSN 0023-432X R&D Projects: GA ČR GA106/06/1354 Institutional research plan: CEZ:AV0Z20410507 Keywords : magnesium alloys * creep * threshold behaviour * threshold stress concept * mechanisms of creep Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  11. Počáteční stadium oxidace železa a ocelí žíhaných při vysokých teplotách na vzduchu

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jaroslav; Adamaszek, K.

    2001-01-01

    Roč. 39, č. 5 (2001), s. 289-301 ISSN 0023-432X R&D Projects: GA ČR GA106/98/1367 Institutional research plan: CEZ:AV0Z2041904 Keywords : iron oxidation * high temperature Subject RIV: JG - Metallurgy Impact factor: 0.343, year: 2001

  12. Community Perspective of Alternative Methods of keeping ...

    African Journals Online (AJOL)

    UNIBEN

    Revista Panamericana de Salud Pública. 2004; 16(6): 432-42. 12. World. Health. Organization. Community participation in local health and sustainable development. Approaches and techniques. European development and health series. 2002. 13. Sumi C. Community Engagement to. Strengthen Routine Immunisation:.

  13. *Corresponding author. E-mail: m_ghaedi@mail.yu.ac.ir

    African Journals Online (AJOL)

    a

    Cerutti, S.; Moyano, S.; Gasquez, J.A., Stripeikis, J.; Olsina, R.A.; Martinez, L.D.. Spectrochim. Acta Part B 2003, 58, 2015. 28. Ghaedi, M.; Asadpour, E.; Vafaie, A. Bull. Chem. Soc. Jpn. 2006, 79, 432. 29. Daorattanachai, P.; Unob, F.; Imyim, A. Talanta 2005, 67, 59. 30. Safari, J.; Loghmani, H.; PhD Thesis, Esfahan University, ...

  14. The recognition unit of FIBCD1 organizes into a noncovalently linked tetrameric structure and uses a hydrophobic funnel (S1) for acetyl group recognition

    DEFF Research Database (Denmark)

    Thomsen, Theresa; Moeller, Jesper B; Schlosser, Anders

    2010-01-01

    combined with site-directed mutagenesis to define the binding site involved in the interaction of FIBCD1 with acetylated structures. We show that mutations of central residues (A432V and H415G) in the hydrophobic funnel (S1) abolish the binding of FIBCD1 to acetylated bovine serum albumin and chitin...

  15. Competition as an Acquisition Strategy: Impact of Competitive Research and Development on Procurement Costs

    Science.gov (United States)

    1983-11-01

    i PRounds Carried Unit Hardware Coat•s $507,790 $439,UOO $432,OO Syst;em Reliability (mean 320-440 159 n.a..miles between fiue estem MNentdinbilnty...freedom from interference (or help) from Army engineers. Further, the excellent original definition of user requirements and continuing Army self -discipline

  16. Developing Functional Parameters for a Science-Based Vehicle Cleaning Program to Reduce Transport of Non-Indigenous Invasive Plant Species

    Science.gov (United States)

    2011-06-01

    indigenous . Some species were grouped due to identification similarity and some could not be identified beyond genus due to lack of flowering under...FINAL REPORT Developing Functional Parameters for a Science-Based Vehicle Cleaning Program to Reduce Transport of Non- Indigenous Invasive...vehicles .............................. 15  4.3.2 Non- indigenous plant survey to create occupancy maps

  17. Report and policy brief from the 4th Africa Conference on Social ...

    African Journals Online (AJOL)

    male circumcision among different ethnic groups to be able to guide the debate on the latest biomedical findings ..... knowledge, but without positive sexual behavior .... during adolescence. Of these, 432 (40.5%) circumcisions took place after the men's sexual debut. Simbayi et al., found no significant differences in HIV.

  18. Vinorelbine/carboplatin vs gemcitabine/carboplatin in advanced NSCLC shows similar efficacy, but different impact of toxicity

    DEFF Research Database (Denmark)

    Helbekkmo, N; Sundstrøm, S H; Aasebø, U

    2007-01-01

    and every 8 weeks until 49 weeks. During 14 months, 432 patients were included (VC, n=218; GC, n=214). Median survival was 7.3 vs 6.4 months, 1-year survival 28 vs 30% and 2-year survival 7 vs 7% in the VC and GC arm, respectively (P=0.89). HRQOL, represented by global QOL, nausea/vomiting, dyspnoea...

  19. Microstructure, dielectric and piezoelectric properties of lead-free ...

    Indian Academy of Sciences (India)

    Nagaya T and Nakamura M 2004 Nature 432 84. Sawada T, Ando A, Sakabe Y and Damjanovic D 2003 Jpn. J. Appl. Phys. 42 6094. Shannon R D 1976 Acta Crystallogr. A32 751. Smolenskii G A and Agranovskaya A I 1958 Sov. Phys. Tech. Phys. 3 1380. Smolenski G A and Aganovskaya A I 1960 Sov. Phys. Solid State 1.

  20. Distribution, antibiotic susceptibility and tolerance of bacterial isolates in culture-positive cases of endocarditis in The Netherlands

    NARCIS (Netherlands)

    van der Meer, J. T.; van Vianen, W.; Hu, E.; van Leeuwen, W. B.; Valkenburg, H. A.; Thompson, J.; Michel, M. F.

    1991-01-01

    During a two-year period data were collected nationwide in The Netherlands on 438 episodes of bacterial endocarditis (BE) in 432 patients. Of the strains isolated in these patients 419 were available for analysis. Of these, 326 were isolated in native valve endocarditis (NVE) and 93 in prosthetic

  1. Eggshell strength of an obligate brood parasite: a test of the puncture resistance hypothesis

    Czech Academy of Sciences Publication Activity Database

    Antonov, A.; Stokke, B. G.; Moksnes, A.; Kleven, O.; Honza, Marcel; Roskaft, E.

    2006-01-01

    Roč. 60, č. 1 (2006), s. 11-18 ISSN 0340-5443 Grant - others:Research Council of Norway(NO) 151641/432 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * eggshell thickness * puncture resistance * Acrocephalus * cuckoo Subject RIV: EG - Zoology Impact factor: 2.316, year: 2006

  2. 2017-2018 Travel Expense Reports for Sylvain Dufour, Vice ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    09-30 to 2017-10-06. Destination(s):. Orlando, FL (USA). Airfare: $751.97. Other. Transportation: $228.39. Accommodation: $1,102.96. Meals and. Incidentals: $1,342.07. Other: $7.51. Total: $3,432.90. Comments: 2017-2018 Travel Expense ...

  3. Religious Capital in Relation to Teachers' Views of RE. A Comparative Study in the Greek Educational Context

    Science.gov (United States)

    Karamouzis, Polikarpos

    2015-01-01

    In this article, we attempt to conduct a comparative study of two different groups. The first group consists of Greek student teachers (1009) while the second comprises Greek in-service teachers (432) of primary education, namely current teachers with several years of experience. These teachers do not have training in theological studies, but they…

  4. A proteomic analysis of short-term exposure to fipronil in larvae of ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-30

    Nov 30, 2011 ... planthopper: Application to the study of carbamate toxicity. Insect. Biochem. Mol. 34(5): 425-432. Shelby KS, Popham HJR (2009). Analysis of ESTs generated from immune-stimulated hemocytes of larval Heliothis virescens. J. Inverteb. Pathol. 101(2): 86-95. Song KH, Jung MK, Eum JH, Hwang IC, Han SS ...

  5. 75 FR 76003 - Tricor Ten Section Hub LLC; Notice of Availability of the Environmental Assessment for the...

    Science.gov (United States)

    2010-12-07

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP09-432-000] Tricor Ten Section Hub LLC; Notice of Availability of the Environmental Assessment for the Proposed Ten Section Gas... Commission) has prepared an environmental assessment (EA) for the Ten Section Gas Storage Project, in Kern...

  6. The initial bearing capacities of subchondral bone replacements considerably contributing to chondrogenesis

    Czech Academy of Sciences Publication Activity Database

    Petrtýl, M.; Danešová, J.; Lísal, J.; Šenolt, L.; Hulejová, H.; Polanská, M.; Bastl, Zdeněk; Kruliš, Zdeněk; Černý, P.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 59-65 ISSN 1509-409X R&D Projects: GA ČR GA106/06/0761 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z40500505 Keywords : biomechanics * osteochondral defects * polymer replacement Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.432, year: 2010

  7. Prevalence of hemoprotozoan diseases in cattle population of chittagong division, Bangladesh

    DEFF Research Database (Denmark)

    Alim, Md. Abdul; Das, Shubhagata; Roy, Krisna

    2012-01-01

    A one year (2009-10) prevalence study on hemoprotozoan diseases was conducted in crossbred and indigenous cattle, Chittagong, Bangladesh. Blood samples were collected randomly from 216 crossbred and 432 indigenous cattle of four representative areas in three consecutive seasons. Samples were...

  8. Influence of long-term ageing upon the capacity of hydrogen\

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Král, Lubomír; Roupcová, Pavla

    2016-01-01

    Roč. 54, č. 6 (2016), s. 389-396 ISSN 0023-432X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : magnesium alloys * indium * hydrogen * hydrogen storage Subject RIV: BJ - Thermodynamics Impact factor: 0.366, year: 2016

  9. exploitation agricole a l'ere des herbicides dans le canton zabouo

    African Journals Online (AJOL)

    Tableau 1 : Liste de quelques herbicides utilisés dans le canton Zabouo. Nom. Commercial. Matière. Active. Type. Classe. FAO/. OMS. Formulation. Usages. ADWUMA. WURA 480 SL. Glyphosate. 480g/l. Non sélectif. III. SL. Contre les adventices des cultures de café, cacao, coton, palmier, riz, maïs, etc. BARAKA. 432 EC.

  10. Simulating grain size estimation

    Czech Academy of Sciences Publication Activity Database

    Saxl, Ivan; Sülleiová, K.; Ponížil, P.

    2001-01-01

    Roč. 39, č. 6 (2001), s. 396-409 ISSN 0023-432X R&D Projects: GA ČR GA201/99/0269 Keywords : grain size estimation% ASTM standards%Voronoi tessellations Subject RIV: BE - Theoretical Physics Impact factor: 0.343, year: 2001

  11. Gas permeation characteristics of heterogeneous ODPA-BIS P polyimide membranes at different temperatures

    Czech Academy of Sciences Publication Activity Database

    Villaluenga, J. P. G.; Seoane, B.; Hradil, Jiří; Sysel, P.

    2007-01-01

    Roč. 305, 1-2 (2007), s. 160-168 ISSN 0376-7388 Grant - others:University Complutense(ES) PR1/06-14460-B Institutional research plan: CEZ:AV0Z40500505 Keywords : heterogeneous membrane * carbon molecular sieve * polymer adsorbent Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.432, year: 2007

  12. Analytical Method Details (MS): SE2_MS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available 00.0-1500.0); 2: ITMS + c norm !corona !pi Dep MS/MS Most intense ion from (1)., Rejected mass=284.2000;300.2000;328.2000;344.2000;372.2000;388.2000;416.3000;432.3000;460.0000. ...

  13. The splicing factor U1-70K interacts with the SMN complex and is required for nuclear gem integrity

    Czech Academy of Sciences Publication Activity Database

    Stejskalová, Eva; Staněk, David

    2014-01-01

    Roč. 127, č. 18 (2014), s. 3909-3915 ISSN 0021-9533 R&D Projects: GA ČR GAP302/11/1910 Institutional support: RVO:68378050 Keywords : nuclear gems * SMN * U1-70K Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  14. Household decision-making and valuation of environmental health risks to parents and their children

    NARCIS (Netherlands)

    Adamowicz, W.; Dickie, M.; Gerking, S.; Veronesi, M.; Zinner, D.

    2014-01-01

    This paper empirically discriminates between household decision-making models for estimating parents’ willingness to pay for health risk reductions for their children and for themselves. Models are tested using data from a stated preference survey involving 432 matched pairs of married parents.

  15. Effect of preparation procedure on the formation of nanostructuredceria–zirconia mixed oxide catalysts for ethyl acetate oxidation:Homogeneous precipitation with urea vs template-assistedhydrothermal synthesis

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Ivanova, R.; Henych, Jiří; Dimitrov, M.; Kormunda, M.; Kovacheva, D.; Scotti, N.; Dal Santo, V.; Štengl, Václav

    2015-01-01

    Roč. 502, JUL (2015), s. 418-432 ISSN 0926-860X Institutional support: RVO:61388980 Keywords : Ceria–zirconia mixed oxides * Template -assisted hydrothermal method * Urea hydrolysis * Ethyl acetate oxidationa Subject RIV: CA - Inorganic Chemistry Impact factor: 4.012, year: 2015

  16. Spectral Radius and Hamiltonicity of Graphs

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Nikiforov, V.

    2010-01-01

    Roč. 432, č. 9 (2010), s. 2170-2173 ISSN 0024-3795 Institutional research plan: CEZ:AV0Z10300504 Keywords : Hamiltonian cycle * Hamiltonian path * spectral radius Subject RIV: BA - General Mathematics Impact factor: 1.005, year: 2010

  17. Notes on Hilbert and Cauchy Matrices

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav

    2010-01-01

    Roč. 432, č. 1 (2010), s. 351-356 ISSN 0024-3795 Institutional research plan: CEZ:AV0Z10300504 Keywords : Hilbert matrix * Cauchy matrix * combined matrix * AT-property Subject RIV: BA - General Mathematics Impact factor: 1.005, year: 2010

  18. RT 164: Design and Development Tools for the Systems Engineering Experience Accelerator - Part 3

    Science.gov (United States)

    2017-04-29

    Education and Teaching International , 43(2), 109-120. Spector, J. M., Christensen, D. L., Sioutine, A. V., & McCormack, D. (2001). Models and simulations... International Journal of Engineering Education , 22(5), 1070-1076. Sterman, J. D. (2010). Does formal system dynamics training improve people’s...2 Challenges in Systems Engineering Education and Workforce Development ....................................2 Experiential

  19. Experience with ultrasound of the knee joint at Mulago Hospital ...

    African Journals Online (AJOL)

    Background: The knee is prone to various pathology. Mulago Hospital records of 2001/2002 show that an average of 432 patients with knee joint disorders are seen in orthopaedic and rheumatology outpatient clinics out of a total of 5400 patients annually. For a long time the only mode of radiological investigation for these ...

  20. 5 CFR 351.602 - Prohibitions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Prohibitions. 351.602 Section 351.602 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS REDUCTION IN FORCE Release From...; (b) A specifically limited temporary or term promotion; (c) A written decision under part 432 or 752...

  1. Fatigue mechanisms in ultrafine-grained copper

    Czech Academy of Sciences Publication Activity Database

    Lukáš, Petr; Kunz, Ludvík; Svoboda, Milan

    2009-01-01

    Roč. 47, č. 1 (2009), s. 1-9 ISSN 0023-432X R&D Projects: GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : ultrafine-grained copper * effect of purity * effect of temperature Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.345, year: 2007

  2. Characterization of carbon nanofibers by SEM, TEM, ESCA and raman spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Tatarko, P.; Puchý, V.; Dusza, J.; Morgiel, J.; Bastl, Zdeněk; Mihály, J.

    2010-01-01

    Roč. 48, č. 6 (2010), s. 379-385 ISSN 0023-432X Institutional research plan: CEZ:AV0Z40400503 Keywords : carbon micro/nanofiber * cylindrical fiber * bambo-shaped fiber Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.471, year: 2010

  3. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Sunil R Mistry. Articles written in Journal of Chemical Sciences. Volume 123 Issue 4 July 2011 pp 427-432. Zeolite H-BEA catalysed multicomponent reaction: One-pot synthesis of amidoalkyl naphthols - Biologically active drug-like molecules · Sunil R Mistry Rikesh S Joshi ...

  4. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Rikesh S Joshi. Articles written in Journal of Chemical Sciences. Volume 123 Issue 4 July 2011 pp 427-432. Zeolite H-BEA catalysed multicomponent reaction: One-pot synthesis of amidoalkyl naphthols - Biologically active drug-like molecules · Sunil R Mistry Rikesh S Joshi ...

  5. The effect of cocaine sensitization on mouse immunoreactivity

    Czech Academy of Sciences Publication Activity Database

    Kubera, M.; Filip, M.; Basta-Kaim, A.; Nowak, E.; Siwanowicz, J.; Zajícová, Alena; Holáň, Vladimír; Maes, M.; Lasoń, W.

    2004-01-01

    Roč. 483, - (2004), s. 309-315 ISSN 0014-2999 R&D Projects: GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5052915 Keywords : cocaine sensitization, cytokine Subject RIV: EC - Immunology Impact factor: 2.432, year: 2004

  6. Genetic polymorphism of five genes associated with growth traits in ...

    African Journals Online (AJOL)

    While IGF-1gene revealed three fragments after digestion with Haelll with genotype AA, AB and BB and the frequencies of allele A varied from 0.432 to 0.731. Furthermore, PCR-RFLP of POUIF1 gene showed two fragments after digestion by Pst1 endonuclease with genotype TT and CC and the frequencies of allele T ...

  7. Composition and Physicochemical Properties of Starch from Christ ...

    African Journals Online (AJOL)

    Starch was extracted from seeds of Christ Thorn by hot water extraction method. The composition and physicochemical properties of the extracted starch were determined using standard methods. The results obtained from the analyses revealed that the % yield of starch was 43.2%, while moisture content, ash content, ...

  8. composition and physicochemical properties of starch from christ

    African Journals Online (AJOL)

    Thompson O. Izuagie

    Starch was extracted from seeds of Christ Thorn by hot water extraction method. The composition and physicochemical properties of the extracted starch were determined using standard methods. The results obtained from the analyses revealed that the % yield of starch was 43.2%, while moisture content, ash content, ...

  9. 5. Beethoven-Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik, 27.– 29. srpna 2012

    Czech Academy of Sciences Publication Activity Database

    Kolátorová, Petra

    2012-01-01

    Roč. 49, č. 4 (2012), s. 432-433 ISSN 0018-7003. [5. Beethoven -Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik,. Bonn, 27.08.2012-29.08.2012] Institutional support: RVO:68378076 Keywords : Beethoven * editorial work * music scores Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Recent progress in research on tungsten materials for nuclear fusion applications in Europe

    Czech Academy of Sciences Publication Activity Database

    Rieth, M.; Dudarev, S.L.; Gonzalez de Vicente, S.M.; Aktaa, J.; Ahlgren, T.; Antusch, S.; Armstrong, D.E.J.; Balden, M.; Baluc, N.; Barthe, M.-F.; Basuki, W.W.; Battabyal, M.; Becquart, C.S.; Blagoeva, N.; Boldyryeva, Hanna; Brinkmann, J.; Celino, M.; Ciupinski, L.; Correia, J.B.; De Backer, A.; Domain, C.; Gaganidze, E.; García-Rosales, C.; Gibson, J.; Gilbert, M.R.; Giusepponi, S.; Gludovatz, B.; Greuner, H.; Heinola, K.; Höschen, T.; Hoffmann, A.; Holstein, A.; Koch, F.; Krauss, W.; Li, H.; Lindig, S.; Linke, J.; Linsmeier, Ch.; López-Ruiz, P.; Maier, H.; Matějíček, Jiří; Mishra, T.P.; Muhammed, M.; Muñoz, A.; Muzyk, M.; Nordlund, K.; Nguyen-Manh, D.; Opschoor, J.; Ordás, N.; Palacios, Y.; Pintsuk, G.; Pippan, R.; Reiser, J.; Riesch, J.; Roberts, S. G.; Romaner, L.; Rosiński, M.; Sanchez, M.; Schulmeyer, W.; Traxler, H.; Ureña, G.; van der Laan, J.G.; Veleva, L.; Wahlberg, S.; Walter, M.; Weber, T.; Weitkamp, T.; Wurster, S.; Yar, M.A.; You, J.H.; Zivelonghi, A.

    2013-01-01

    Roč. 432, 1-3 (2013), s. 482-500 ISSN 0022-3115 Institutional support: RVO:61389021 Keywords : tungsten * joining * composites * graded materials * fusion materials Subject RIV: JF - Nuclear Energetics Impact factor: 2.016, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022311512004278

  11. Experimental determination and computational interpretation of biophysical properties of lipid bilayers enriched by cholesteryl hemisuccinate

    Czech Academy of Sciences Publication Activity Database

    Kulig, W.; Jurkiewicz, Piotr; Olžyńska, Agnieszka; Tynkkynen, J.; Javanainen, M.; Manna, M.; Rog, T.; Hof, Martin; Vattulainen, I.; Jungwirth, Pavel

    2015-01-01

    Roč. 1848, č. 2 (2015), s. 422-432 ISSN 0005-2736 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : Time-dependent fluorescence shift * Molecular dynamics simulations * Cholesterol -mimicking detergents Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.687, year: 2015

  12. 77 FR 60981 - Kinder Morgan Interstate Gas Transmission L.L.C.; Notice of Intent To Prepare an Environmental...

    Science.gov (United States)

    2012-10-05

    ... State) Proposed work Pony Express Pipeline (PXP). Wyoming, Nebraska, Abandon 432.4 miles Colorado... Sterling Colorado. Compressor Station. Omimex Bledsoe Tap/Receipt Yuma County, Abandon 1 valve/tap/ Meter. Colorado. receipt site. Omimex Ferguson Receipt Tap/ Phillips County, Abandon 1 valve/tap/ Meter. Colorado...

  13. 77 FR 6666 - Airworthiness Directives; CFM International, S.A. Turbofan Engines

    Science.gov (United States)

    2012-02-09

    ...; International Phone: 1-(513) 552-3272; USA Phone: (877) 432-3272; International Fax: 1-(513) 552-3329; USA Fax... that section, Congress charges the FAA with promoting safe flight of civil aircraft in air commerce by prescribing regulations for practices, methods, and procedures the Administrator finds necessary for safety in...

  14. Effects of grain size and grain boundary segregation on fracture behaviour of a polycrystalline Fe-2.65Si-0.028P alloy

    Czech Academy of Sciences Publication Activity Database

    Janovec, J.; Lejček, Pavel; Pokluda, J.; Jenko, M.

    2006-01-01

    Roč. 44, - (2006), s. 81-87 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/05/0134 Institutional research plan: CEZ:AV0Z10100520 Keywords : iron alloys * interface segregation * intergranular brittleness * Auger electron spectroscopy * scanning electron microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

  15. Dietary fat intake and subsequent weight change in adults: results from the European Prospective Investigation into Cancer and Nutrition cohorts

    DEFF Research Database (Denmark)

    Forouhi, Nita G; Sharp, Stephen J; Du, Huaidong

    2009-01-01

    weight divided by duration of follow-up). DESIGN: We analyzed data from 89,432 men and women from 6 cohorts of the EPIC (European Prospective Investigation into Cancer and Nutrition) study. Using country-specific food-frequency questionnaires, we examined the association between baseline fat intake...

  16. Micro RNA: New aspect in pathobiology of preeclampsia?

    African Journals Online (AJOL)

    Harapan Harapan

    2012-02-14

    Feb 14, 2012 ... [16] Poy MN, Eliasson L, Krutzfeldt J, Kuwajima S, Ma X,. Macdonald PE, Pfeffer S, Tuschl T, Rajewsky N, Rorsman P,. Stoffel M. A pancreatic islet-specific microRNA regulates insulin secretion. Nature 2004;432:226–30. [17] Jin P, Alisch RS, Warren ST. RNA and microRNAs in fragile X mental retardation.

  17. Physico-chemical shelf-life indicators of meat from broilers given ...

    African Journals Online (AJOL)

    The objective of the study was to determine the effect of using Moringa oleifera leaf meal (MOLM) as an additive on physico-chemical shelf life indicators of meat from broilers. A total of 432 1-day-old chicks were randomly allocated to four treatments (TRT's). Water and feed was provided ad libitum. The feeding phases were ...

  18. Transient Electromagnetic Wave Propagation in a Plasma Waveguide

    Science.gov (United States)

    2011-10-24

    T. Van Duzer , Fields and Waves in Communication Electronics, 3rd edition, John Wiley & Sons, New York, NY, pp 395-455 (1994). 15. G.F. Miner, Lines...Whinnery, & T. Van Duzer , Fields and Waves in Communication Electronics, 1st edition, John Wiley & Sons, New York, NY, pp 432-434 (1965). 18. Ibid. p

  19. Low-Loss Flexible Dielectric Waveguide for Millimeter-Wave Transmission and Its Application to Devices.

    Science.gov (United States)

    1984-08-01

    New York, 1958. 11-3. S. Ratio, J.R. Whinnery, and T. Van Duzer , FIELDS AND WAVES IN II COHMUNICATION ELECTRONICS, Wiley, New York, 1966, pp. 432...October, 1974. 111-2. S. Ramo, J.R. Whinnery, and T. Van Duzer , FIELDS AND WAVES 11. COMMUNICATION ELECTRONICS, Wiley, New York, 1966, Chapter 7. 111-3. H.G

  20. Evaluation of microalgae production coupled with wastewater treatment

    DEFF Research Database (Denmark)

    De Francisci, Davide; Su, Yixi; Iital, Arvo

    2018-01-01

    In the present study the feasibility of microalgae production coupled with wastewater treatment was assessed. Continuous cultivation of Chlorella sorokiniana with wastewater was tested in lab-scale flat panel photobioreactors. Biomass productivity was determined for four dilution rates (4.32 d-1, 3...

  1. Increasing risk of prosthetic joint infection after total hip arthroplasty

    DEFF Research Database (Denmark)

    Dale, Håvard; Fenstad, Anne M; Hallan, Geir

    2012-01-01

    The study was based on the Nordic Arthroplasty Register Association (NARA) dataset. 432,168 primary THAs from 1995 to 2009 were included (Denmark: 83,853, Finland 78,106, Norway 88,455, and Sweden 181,754). Adjusted survival analyses were performed using Cox regression models with revision due to infection...

  2. NDT characterization of decarburization of steel after long-time annealing

    Czech Academy of Sciences Publication Activity Database

    Skrbek, B.; Tomáš, Ivan; Kadlecová, Jana; Ganev, N.

    2011-01-01

    Roč. 49, č. 6 (2011), s. 401-409 ISSN 0023-432X R&D Projects: GA ČR GA101/09/1323 Institutional research plan: CEZ:AV0Z10100520 Keywords : decarburization * spring steel * non- destructive testing * Magnetic Adaptive Testing (MAT) * weighing Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.451, year: 2011

  3. Flood duration determines the reproduction success of fish in artificial oxbows in a floodplain of a potamal river

    Czech Academy of Sciences Publication Activity Database

    Janáč, Michal; Ondračková, Markéta; Jurajda, Pavel; Valová, Zdenka; Reichard, Martin

    2010-01-01

    Roč. 19, č. 4 (2010), s. 644-655 ISSN 0906-6691 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : young-of-the-year * flood pulse concept * regression * recruitment * reproductive guilds Subject RIV: EH - Ecology, Behaviour Impact factor: 1.432, year: 2010

  4. 39 Peer tutors as learning and teaching partners: a cumulative ...

    African Journals Online (AJOL)

    Peer tutors in higher education are frequently given vital teaching and learning work to do, but the training or professional .... advantages and disadvantages in terms of participating in a tutorial programme charged with enhancing students' literacy ...... Training and using peer tutors. College English, 40(4): 432-449. Bell, J.

  5. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  6. Structure and pervaporation properties of poly(phenylene-iso-phthalamide) membranes modified by Fullerene C-60

    Czech Academy of Sciences Publication Activity Database

    Penkova, A. V.; Polotskaya, G. A.; Toikka, A. M.; Trchová, Miroslava; Šlouf, Miroslav; Urbanová, Martina; Brus, Jiří; Brožová, Libuše; Pientka, Zbyněk

    2009-01-01

    Roč. 294, 6-7 (2009), s. 432-440 ISSN 1438-7492 Institutional research plan: CEZ:AV0Z40500505 Keywords : fullerene * methanol/cyclohexane mixture * modification Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.742, year: 2009

  7. 19 CFR 10.841 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... Partnership Encouragement Act of 2006 § 10.841 Applicability. Title V of Public Law 109-432, entitled the Haitian Hemispheric Opportunity through Partnership Encouragement Act of 2006 (HOPE I Act), amended the... D, Title XV of Public Law 110-234, entitled the Haitian Hemispheric Opportunity through Partnership...

  8. Download this PDF file

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... 2009. The Authors. Licensee: OpenJournals. Publishing. This work is licensed under the. Creative Commons. Attribution License. 432. Vol. 65 No. 1 Page 1 of .... about learning through icons, the overestimation of experience, and other ...... places of belonging, and believing, they can offer much to enhance.

  9. All rates are effective 15 October 2017 / En vigueur le 15 octobre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 oct. 2017 ... Everywhere / Dans tout le pays. 365. FINLAND / FINLANDE. Helsinki. 459. FINLAND / FINLANDE. Elsewhere / Ailleurs dans le pays. 371. FRANCE ... GREECE / GRÈCE. Athens / Athènes. 432. GREECE / GRÈCE. Elsewhere / Ailleurs dans le pays. 305. GRENADA / GRENADE. Everywhere / Dans tout le ...

  10. Per diem tables

    International Development Research Centre (IDRC) Digital Library (Canada)

    Andre Lavoie

    15 avr. 2016 ... Everywhere / Dans tout le pays. 352. FINLAND / FINLANDE. Helsinki. 432. FINLAND / FINLANDE. Elsewhere / Ailleurs dans le pays. 352. FRANCE ... GREECE / GRÈCE. Athens / Athènes. 438. GREECE / GRÈCE. Elsewhere / Ailleurs dans le pays. 308. GRENADA / GRENADE. Everywhere / Dans tout le ...

  11. The development of a new class of inhibitors for betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Pícha, Jan; Vaněk, Václav; Buděšínský, Miloš; Mládková, Jana; Garrow, T. A.; Jiráček, Jiří

    2013-01-01

    Roč. 65, July (2013), s. 256-275 ISSN 0223-5234 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : BHMT * inhibitor * homocysteine * phosphonate * phosphinate * amino acid derivative * bioisostere * S-alkylated homocysteine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  12. prevalence of trichomonas vaginalis among the sexual partners of ...

    African Journals Online (AJOL)

    PREVALENCE OF TRICHOMONAS VAGINALIS AMONG THE SEXUAL PARTNERS OF WOMEN WITH TRICHOMONIASIS IN IBADAN, NIGERIA. ... of the 20 men with Trichomonas vaginalis and 43.2% of the 44 men investigated were between 20 and 29 years and this parallels that of other sexually transmitted diseases.

  13. 2018-02-15T08:42:37Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    The results showed that marketing activities should be centered on female who are mostly married (83.0%) within the age group 31-40 since women are the one to purchase the meat at home, although men (56.8%) responded to the questionnaire than their female (43.2%) counterpart. It was clearly shown that respondents ...

  14. Rational design, efficient syntheses and biological evaluation of N,N '-symmetrically bis-substituted butylimidazole analogs as a new class of potent Angiotensin II receptor blockers

    Czech Academy of Sciences Publication Activity Database

    Agelis, G.; Resvani, A.; Koukoulitsa, C.; Tůmová, Tereza; Slaninová, Jiřina; Kalavrizioti, D.; Spyridaki, K.; Afantitis, A.; Melagraki, G.; Siafaka, A.; Gkini, E.; Megariotis, G.; Grdadolnik, S. G.; Papadopoulos, M. G.; Vlahakos, D.; Maragoudakis, M.; Liapakis, G.; Mavromoustakos, T.; Matsoukas, J.

    2013-01-01

    Roč. 62, Apr (2013), s. 352-370 ISSN 0223-5234 Institutional support: RVO:61388963 Keywords : AT1 receptor blockers * N,N '-Bis-alkylated butylimidazole analogs * synthesis * Wittig reaction * hydroxymethylation * structure elucidation Subject RIV: CC - Organic Chemistry Impact factor: 3.432, year: 2013

  15. Survey on Knowledge of Healthcare Providers about Childhood ...

    African Journals Online (AJOL)

    IRORO YARHERE

    Methods: Pretested self-administered and standardised questionnaires were distributed to nurses, and residents including paediatricians- in - training ... were 80 (43.2%) nurses, and 105 (56.8%) doctors, 41 (22.2%) of which were paediatricians or paediatricians-in-training. Paediatric ... and its complications lead to death.

  16. Mechanické vlastnosti hybridních laminátů s uhlíkovými vlákny

    Czech Academy of Sciences Publication Activity Database

    Chlupová, Alice; Dymáček, P.

    2002-01-01

    Roč. 40, č. 3 (2002), s. 195-208 ISSN 0023-432X Institutional research plan: CEZ:AV0Z2041904 Keywords : composites * laminates * fatigue Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

  17. Výběr středního vzdělání v rodinách podle skupinových diskuzí

    Czech Academy of Sciences Publication Activity Database

    Vojtíšková, Kateřina

    2009-01-01

    Roč. 5, 019 (2009), s. 3-38 ISSN 1801-5999 R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : focus group s * family * secondary education Subject RIV: AM - Education http://publication.fsv.cuni.cz/eng/attachments/432_019%20-%20Vojtiskova.pdf

  18. 75 FR 21043 - Notice of Determinations Terminating Investigations of Petitions Regarding Eligibility To Apply...

    Science.gov (United States)

    2010-04-22

    ... Air Crane, Central Point, Oregon. TA-W-71,728: Baxter Healthcare Corp., Mountain Home, Arkansas, covered by TA-W-71,432: Baxter Healthcare Corp., Mountain Home, Arkansas. TA-W-71,832: Electrocraft Ohio...: Cadmus Journal Services, Cadmus Communications, Columbus, Ohio. TA-W-72,479: Duro-Life Corp., Algonquin...

  19. Zítra se bude tančit všude, aneb jak jsme se protancovali ke svobodě. Dichotomie tzv. folklorního hnutí druhé poloviny 20. století

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2017-01-01

    Roč. 104, č. 4 (2017), s. 411-432 ISSN 0009-0794 R&D Projects: GA ČR(CZ) GA17-26672S Institutional support: RVO:68378076 Keywords : folklore revival movement * folklorism * folk ensembles * oral history * narratives * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  20. Extremely low-frequency electromagnetic fields disrupt magnetic alignment of ruminants

    Czech Academy of Sciences Publication Activity Database

    Burda, H.; Begall, S.; Červený, Jaroslav; Neef, J.; Němec, P.

    2009-01-01

    Roč. 106, č. 14 (2009), s. 5708-5713 ISSN 0027-8424 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : cattle * magnetoreception * roe deer * power lines Subject RIV: EH - Ecology, Behaviour Impact factor: 9.432, year: 2009

  1. Joint Services Electronics Program. Annual Report (16th). Appendix

    Science.gov (United States)

    1993-10-01

    I is equivalent to a two-partgeneralized impedance asymptotic behavior f Sas in-- al is given by surface whose faces {x > 0, y - 0 and {x < Oy 0...estimation in a multipath environment. LEEE Trawsctiom on Acormic. Speech and S$pd 0.2 Pace.s,, ASSP.36 (Apr. 198), 425-432. [101 Pillai, S. U., and Kwon , B

  2. Viscous creep in metals at intermediate temperatures

    Czech Academy of Sciences Publication Activity Database

    Kloc, Luboš; Fiala, J.

    2005-01-01

    Roč. 43, č. 2 (2005), s. 105-112 ISSN 0023-432X R&D Projects: GA AV ČR(CZ) IAA2041101 Institutional research plan: CEZ:AV0Z20410507; CEZ:AV0Z2041904 Keywords : creep * heat resistant steel Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  3. Polyphase deformation and garnet growth in politic schists of Sausar ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 116; Issue 5. Polyphase deformation and garnet growth in politic schists of Sausar Group in Ramtek area, Maharashtra, India: A study of porphyroblast–matrix relationship. A Chattopadhyay N Ghosh. Volume 116 Issue 5 October 2007 pp 423-432 ...

  4. Factors influencing creep resistance in discontinuously reinforced magnesium metal matrix composites

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Kvapilová, Marie; Svoboda, Milan

    2015-01-01

    Roč. 53, č. 4 (2015), s. 221-229 ISSN 0023-432X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : magnesium alloys * composites * creep properties testing * structure * fibres * interfaces Subject RIV: JG - Metal lurgy Impact factor: 0.365, year: 2015

  5. Cyclic plastic response and fatigue life of duplex and superduplex stainless steel

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav

    43 2005, č. 4 (2005), s. 280-289 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/02/0584 Institutional research plan: CEZ:AV0Z20410507 Keywords : duplex steel * fatigue life * cyclic plasticity Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  6. 76 FR 10587 - Product Cancellation Order for Certain Pesticide Registrations

    Science.gov (United States)

    2011-02-25

    ... 43041. 264 Bayer CropScience LP, 2 T.W. Alexander Drive, P.O. Box 12014, Research Triangle Park, NC 27709. 432 Bayer Environmental Science, 2 T.W. Alexander Drive, P.O. Box 12014, Research Triangle Park... 92660. 5741 Spartan Chemical Company, Inc., 1110 Spartan Drive, Maumee, OH 43537. 5785 Great Lakes Chem...

  7. 75 FR 69073 - Notice of Receipt of Requests To Voluntarily Cancel Certain Pesticide Registrations

    Science.gov (United States)

    2010-11-10

    ... Company, 14111 Scottslawn Road, Marysville, OH 43041. 264 Bayer CropScience LP, 2 T.W. Alexander Drive, P.O. Box 12014, Research Triangle Park, NC 27709. 432 Bayer Environmental Science, 2 T.W. Alexander..., Maumee, OH 43537. 5785 Great Lakes Chem Corps, P.O. Box 2200, West Lafayette, IN 47996- 2200. 8329 Clarke...

  8. Immunoaffinity isolation of CEACAMl on hydrazide-derivatized cellulose with immobilized monoclonal anti-CEA antibody

    Czech Academy of Sciences Publication Activity Database

    Muchová, L.; Jirsa, M.; Kuroki, M.; Dudková, L.; Beneš, Milan J.; Mareček, Z.; Šmíd, F.

    2001-01-01

    Roč. 15, č. 6 (2001), s. 418-422 ISSN 0269-3879 R&D Projects: GA AV ČR KSK4055109 Institutional research plan: CEZ:AV0Z4050913 Keywords : cellulose hydrazide-activated * carcinoembryonic antigen Subject RIV: CC - Organic Chemistry Impact factor: 1.432, year: 2001

  9. 75 FR 59181 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-09-27

    ...) Depth in feet above State City/town/county Source of flooding Location ** ground [caret] Elevation in... of Southeast. the Town of Southeast. Muscoot River At the county boundary. +512 +509 Town of Carmel.... At the county boundary. +391 +393 Stephens Brook Approximately 250 feet +432 +433 Town of Patterson...

  10. Push-Pull-Allenes: The Influences of Substituents on the Activation of Allenes by Biomimetic Zinc Complexes

    Czech Academy of Sciences Publication Activity Database

    Jahn, Burkhard O.; Eger, W. A.; Anders, E.

    65b, č. 3 (2010), s. 425-432 ISSN 0932-0776 Institutional research plan: CEZ:AV0Z40550506 Keywords : allenes * substitution effects * carbonic anhydrase Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.816, year: 2010

  11. Avrupa Birliği Hukukunda Cinsiyet Ayrımcılığına İlişkin Temel Kavramların DeğerlendirilmesiThe Review of Basic Concepts of Gender Discrimination in European Union Law

    OpenAIRE

    KONUK, BAHAR

    2013-01-01

    Pitfalls of Transformative Policy”, Review of Policy Research, Vol. 20 No.1, March 2003, s. 66; BOOT Christine-BENNET Cinnamon, “Gendermainstreaming In The European Union Towards a New Conception and Practice of Equal Opportunities?”, The European Journal of Women’s Studies, Vol. 9 No. 4, 2002, s. 432

  12. Characterization and Low-Dimensional Modeling of Urban Fluid Flow

    Science.gov (United States)

    2014-10-06

    extract coherent modes. They studied the effect of roof top shape ( pitched and flat) on turbulent flow characteristics in streets. Even with valuable...through a large array of obstacles with a scaled field experiment. Boundary- Layer Meteorology, 121:389– 432 , 2006. doi: 10.1007/s10546-006-9084-2. S.A

  13. 15 CFR 200.107 - WWV-WWVH-WWVB broadcasts.

    Science.gov (United States)

    2010-01-01

    ...) UTI corrections; (5) standard audio frequencies; (6) standard musical pitch; (7) a slow time code; (8... broadcast in alternate minutes during most of each hour. A 440-Hz tone, the musical pitch A above middle C... a few parts in 10 11 per day. (m) Special Publication 432. This publication describes in detail the...

  14. System-theoretic Interpretation of the Mode Sensing Hypothesis

    Science.gov (United States)

    2014-08-01

    Cheng, Xinyan Deng, and Tyson L. Hedrick. The mechanics and control of pitching manoeuvres in a freely flying hawkmoth (Manduca sexta). J. Exp. Biol...Control. Academic Press, San Diego, 1995. [59] R. H. Bartels and G. W. Stewart. Algorithm 432 : Solution of the matrix equation AX C XB D C . Communications

  15. Structural Health Monitoring System Trade Space Analysis Tool with Consideration for Crack Growth, Sensor Degradation and a Variable Detection Threshold

    Science.gov (United States)

    2014-09-18

    affect the rotation and translation of the POD curve was pressed by Pado et al. (2013). In an SHM system using piezoelectric sensors (PZT) using pitch ...Smart Materials and Structures, 10, 432 . Buderath, M. (2004). Review the process of integrating SHM systems into condition based maintenance as

  16. Complete sequence of the mitochondrial genome of ...

    Indian Academy of Sciences (India)

    Supplementary data: Complete sequence of the mitochondrial genome of Odontamblyopus rubicundus (Perciformes: Gobiidae): genome characterization and phylogenetic analysis. Tianxing Liu, Xiaoxiao Jin, Rixin Wang and Tianjun Xu. J. Genet. 92, 423–432. Figure 1. Gene map of O. rubicundus mitochondrial genome.

  17. Dependence of the length of the hydrogen bond on the covalent and cationic radii of hydrogen, and additivity of bonding distances

    Czech Academy of Sciences Publication Activity Database

    Heyrovská, Raji

    2006-01-01

    Roč. 432, č. 1-3 (2006), s. 348-351 ISSN 0009-2614 R&D Projects: GA MŠk(CZ) LC06035 Institutional research plan: CEZ:AV0Z50040507 Keywords : length of the hydrogen bond * ionic radius * Golden ratio Subject RIV: BO - Biophysics Impact factor: 2.462, year: 2006

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 432 ... Vol 10, No 3 (2005), The impact of organisational culture on the adaptation of newly employed nurses to the work environment, Abstract ... Vol 22, No 1 (2017), The perceptions of professional nurses on student mentorship in clinical areas: A study in Polokwane municipality hospitals, Limpopo ...

  19. Psykologisk svangreprofylakse. Et tvaerfagligt netvaerk i sygehusregi

    DEFF Research Database (Denmark)

    Knop, J; Østerberg-Larsen, B

    2001-01-01

    AND DISCUSSION: Anxiety and crisis reactions owing to previous PBC, family problems, and concerns about the fetus were the predominant reasons for referral. A total of 87% met the ICD-10 criteria for adjustment disorder (F 43.2), whereas psychotic disorders were infrequent. In 52%, 1-4 sessions were sufficient...

  20. Cyber-Harassment: A Study of a New Method for an Old Behavior

    Science.gov (United States)

    Beran, Tanya; Li, Qing

    2005-01-01

    A total of 432 students from grades 7-9 in Canadian schools reported their experiences of cyber-harassment, which is a form of harassment that occurs through the use of electronic communications such as e-mail and cell phones. More than two-thirds of students (69%) have heard of incidents of cyber-harassment, about one quarter (21%) have been…

  1. Creep resistance of single crystal superalloys CMSX-4 and CM186LC

    Czech Academy of Sciences Publication Activity Database

    Lukáš, Petr; Čadek, Josef; Kunz, Ludvík; Svoboda, Milan; Klusák, Jan

    2005-01-01

    Roč. 43, č. 1 (2005), s. 5-19 ISSN 0023-432X R&D Projects: GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : creep of single crystal superalloys Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.973, year: 2005

  2. Influence of sub-cooling on the energy performance of two ...

    African Journals Online (AJOL)

    In this study, the effects of sub-cooling on the various refrigeration cycle performance parameters using the alternative refrigerants (R432A and R433A) as working fluids were evaluated theoretically and compared with those obtained using the baseline refrigerant (R22). The results obtained showed that the thermodynamic ...

  3. Parenting Styles and Health-Related Behavior in Childhood and Early Adolescence: Results of a Longitudinal Study

    Science.gov (United States)

    Lohaus, Arnold; Vierhaus, Marc; Ball, Juliane

    2009-01-01

    This study addresses the development of health-related behavior during childhood and adolescence and the protective influence of an authoritative parenting style. The study is based on two samples followed from Grades 2 through 5 and from Grades 4 through 7. The first sample consisted of 432 second graders with a mean age of 7.9 years at the…

  4. Creep behavior of metals processed by equal-channel angular pressing

    Czech Academy of Sciences Publication Activity Database

    Kawasaki, M.; Sklenička, Václav; Langdon, T. G.

    2011-01-01

    Roč. 49, č. 1 (2011), s. 75-83 ISSN 0023-432X Institutional research plan: CEZ:AV0Z20410507 Keywords : Creep * severe plastic deformation * equal-channel angular pressing * ultrafine-grained material Subject RIV: JG - Metallurgy Impact factor: 0.451, year: 2011

  5. Acceleration of multiply charged ions by a high-contrast femtosecond laser pulse of relativistic intensity from the front surface of a solid target

    Czech Academy of Sciences Publication Activity Database

    Shulyapov, S. A.; Mordvintsev, I. M.; Ivanov, K. A.; Volkov, P. V.; Zarubin, P. I.; Ambrožová, Iva; Turek, Karel; Savelyev, A. B.

    2016-01-01

    Roč. 46, č. 5 (2016), s. 432-436 ISSN 1063-7818 Institutional support: RVO:61389005 Keywords : relativistic intensity * contrast * laser plasma * ion acceleration * multiply charged ions * collision ionisation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.119, year: 2016

  6. Lossless and lossy compression of images from the OMC experiment of integral project

    Czech Academy of Sciences Publication Activity Database

    Bernas, M.; Páta, P.; Hudec, René

    1999-01-01

    Roč. 39, - (1999), s. 429-432 ISSN 0888-6512 Institutional research plan: CEZ:AV0Z1003909 Keywords : image processing * image compression * astronomical images Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.392, year: 1998

  7. 75 FR 21625 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2010-04-26

    ...-of-Way Grant, Rocky Mountain Power, Juab, Salt Lake, Tooele and Utah Counties, UT, Wait Period Ends...: Pamela M. Kordenbrock 615-781-5770. EIS No. 20100135, Final EIS, BLM, NV, Round Mountain Expansion..., Contact: Mike McNeill 308-432-0336. EIS No. 20100137, Draft EIS, USFS, ID, Robo Elk Project, Proposes...

  8. Blockade of Nociceptin Signaling Reduces Biochemical, Structural and Cognitive Deficits after Traumatic Brain Injury

    Science.gov (United States)

    2010-07-01

    magnetic compass directions but refer to S being the experimenter’s position, N being at the opposite point, E being to the experi menter’s right and...dissociate ‘spatial mapping’ and ‘working memory’ theories of hippocampal function. in Neurobiology of the Hippocampus (ed. Seifert, W.) 405 432 (Academic

  9. Sugarcane aphid spatial distribution in grain sorghum fields

    Science.gov (United States)

    Sorghum is an important summer grain crop in the United States. In 2014, the U.S. produced 432 million bushels of sorghum valued at $1.67 billion on more than 6 million acres. The sugarcane aphid, Melanaphis sacchari (Zehntner), was discovered in damaging numbers in grain sorghum, Sorghum bicolor ...

  10. Microstructure evolution of an Al-Pd-Co alloy

    Czech Academy of Sciences Publication Activity Database

    Kahalová, Ĺ.; Kusý, M.; Buršík, Jiří; Svoboda, Milan; Illeková, E.; Švec, P.; Dolinšek, J.; Janovec, J.

    2008-01-01

    Roč. 46, č. 4 (2008), s. 221-227 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/07/1259 Institutional research plan: CEZ:AV0Z20410507 Keywords : complex metallic alloys * Al-Pd-Co system * differential thermal analysis Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  11. Phase analysis of Fe-B-V system

    Czech Academy of Sciences Publication Activity Database

    Homolová, V.; Výrostková, A.; Čiripová, L.; Kroupa, Aleš

    2013-01-01

    Roč. 51, č. 2 (2013), s. 135-139 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/10/1908 Institutional support: RVO:68081723 Keywords : CALPHAD method * Fe-B-V system * phase diagram Subject RIV: BJ - Thermodynamics Impact factor: 0.546, year: 2013

  12. Temporal stability of diagnostic criteria for antisocial personality disorder in male alcohol dependent patients

    NARCIS (Netherlands)

    Verheul, R.; van den Brink, W.; Koeter, M. W.

    1998-01-01

    We evaluated the temporal stability of diagnostic criteria for antisocial personality disorder in 432 male alcohol dependent patients. Indicators for temporal stability were criterion continuation (i.e., the proportion of current or recent diagnoses among those with a lifetime diagnosis) and

  13. 75 FR 25254 - Notice of Public Information Collection Being Reviewed by the Federal Communications Commission...

    Science.gov (United States)

    2010-05-07

    ... and any other instrument of station authorization for an AM, FM or TV station be posted in a conspicuous place at the place the licensee considers to be the principal control point of the transmitter. 47... available at the transmitter site. 47 CFR 74.432(j) (remote pickup broadcast station) and 74.832(j) (low...

  14. 78 FR 26363 - Information Collections Being Reviewed by the Federal Communications Commission Under Delegated...

    Science.gov (United States)

    2013-05-06

    ... AM, FM or TV station be posted in a conspicuous place at the place the licensee considers to be the principal control point of the transmitter. 47 CFR 74.165 requires that the instrument of authorization for an experimental broadcast station be available at the transmitter site. 47 CFR 74.432(j) (remote...

  15. 76 FR 2403 - Agency Information Collection Activities: Ship's Store Declaration

    Science.gov (United States)

    2011-01-13

    ... the vessel, such as sea stores, ship's stores, controlled narcotic drugs, bunker coal, or bunker oil... section 432, Tariff Act of 1930 and provided for by 19 CFR 4.7, 4.7a, 4.81, 4.85, and 4.87. This form is...

  16. 76 FR 13655 - Agency Information Collection Activities: Ship's Store Declaration

    Science.gov (United States)

    2011-03-14

    ..., bunker coal, or bunker oil in a format that can be readily audited and checked by CBP. The form was... provisions of section 432, Tariff Act of 1930 and provided for by 19 CFR 4.7, 4.7a, 4.81, 4.85, & 4.87. This...

  17. Microstructure evaluation of MoSi2 based composite materials by SANS investigations

    Czech Academy of Sciences Publication Activity Database

    Ballóková, B.; Šaroun, Jan; Besterci, M.; Hvizdoš, P.

    2009-01-01

    Roč. 47, č. 6 (2009), s. 375-380 ISSN 0023-432X Institutional research plan: CEZ:AV0Z10480505 Keywords : molybdenum disilicide * SANS * microstructure parameters Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.345, year: 2007

  18. Pontusel on ikka parimad nahad / Kaarel Tarand

    Index Scriptorium Estoniae

    Tarand, Kaarel, 1966-

    2008-01-01

    Kultuuriministeeriumi 2009. a. eelarvest. Kultuuriministeeriumi andmetel kahaneb rahaline toetus riigieelarvest kunsti valdkonnale 8,05 miljonilt kroonilt 4,32 miljoni kroonini (46%). Eesti Kunstnike Liidu president Jaan Elken sellest, kas ministeerium on erialaliidult küsinud arvamust kulude vähendamise võimalikkuse osas ja informeerinud tekkinud olukorrast, 2009. a. rahalistest võimalustest

  19. Přejatá slova ve filmovém a divadelním lexiku v češtině a v ruštině

    Czech Academy of Sciences Publication Activity Database

    Součková, Ludmila

    2012-01-01

    Roč. 81, č. 4 (2012), s. 423-432 ISSN 0037-6736 R&D Projects: GA AV ČR IAA900920703 Institutional support: RVO:68378017 Keywords : loan words * Russian and Czech * film and theatre * vocabulary Subject RIV: AI - Linguistics

  20. Modelling of recrystallization and grain boundary migration by cellular automata

    Czech Academy of Sciences Publication Activity Database

    Kroc, J.; Paidar, Václav

    426-432, - (2003), s. 3873-3878 ISSN 0255-5476 R&D Projects: GA ČR GA202/02/0916 Institutional research plan: CEZ:AV0Z1010914 Keywords : cellular automata * dynamic recrystallization * grain boundary migration * modeling * simulation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.602, year: 2003

  1. Influence of annealing on the microstructure of commercial Mg alloy AZ31 after mechanical forming

    Czech Academy of Sciences Publication Activity Database

    Jäger, A.; Lukáč, P.; Gärtnerová, Viera; Haloda, J.; Dopita, M.

    2006-01-01

    Roč. 432, 1-2 (2006), 20-25 ISSN 0921-5093 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnesium * texture * static recrystallization * grain boundaries * twinning * electron backscatter diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.490, year: 2006

  2. Gender Divide and Acceptance of Collaborative Web 2.0 Applications for Learning in Higher Education

    Science.gov (United States)

    Huang, Wen-Hao David; Hood, Denice Ward; Yoo, Sun Joo

    2013-01-01

    Situated in the gender digital divide framework, this survey study investigated the role of computer anxiety in influencing female college students' perceptions toward Web 2.0 applications for learning. Based on 432 college students' "Web 2.0 for learning" perception ratings collected by relevant categories of "Unified Theory of Acceptance and Use…

  3. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. M Senthilkumar. Articles written in Journal of Earth System Science. Volume 122 Issue 2 April 2013 pp 419-432. Geochemical processes controlling the groundwater quality in lower Palar river basin, southern India · M Senthilkumar L Elango · More Details Abstract Fulltext ...

  4. Rural Homelessness in Northwest Ohio: Reasons, Patterns, Statistics, and Trends.

    Science.gov (United States)

    Podlin, Georgette A.

    Rural homelessness in America is difficult to define, to count, and to see. This article reports the findings of a 1993 county-wide study of rural homelessness. During a one year survey, 118 homeless households were interviewed. Of those surveyed, 25.8 percent were male adults, 30.9 percent were female adults, and 43.2 percent were children.…

  5. A case with Lichen planus in the lines of Blaschko

    Directory of Open Access Journals (Sweden)

    Metehan Gençoğlu

    2011-12-01

    Full Text Available Lichen planus is an inflammatory disorder that may involveskin and mucous membranes. Linear lichen planusis a rare disorder occurring in approximately 0.2% of patientswith lichen planus. We report a case of linear lichenplanus on the upper extremity which lesions followed thelines of Blaschko. J Clin Exp Invest 2011; 2 (4: 430-432

  6. Closed-cell polymeric foam for hydrogen separation and storage

    Czech Academy of Sciences Publication Activity Database

    Pientka, Zbyněk; Pokorný, P.; Bélafi-Bakó, K.

    2007-01-01

    Roč. 304, 1-2 (2007), s. 82-87 ISSN 0376-7388 R&D Projects: GA ČR GA203/06/1207 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymeric foam * gas separation * hydrogen storage Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.432, year: 2007

  7. Facile synthesis of nitrophenyl 2-acetamido-2-deoxy-alpha-D-mannopyranosides from ManNAc-oxazoline

    Czech Academy of Sciences Publication Activity Database

    Křenek, Karel; Šimon, Petr; Weignerová, Lenka; Fliedrová, Barbora; Kuzma, Marek; Křen, Vladimír

    2012-01-01

    Roč. 8, MAR 2012 (2012), s. 428-432 ISSN 1860-5397 R&D Projects: GA ČR GAP207/10/0321; GA MŠk(CZ) 7E11011 Keywords : alpha-ManNAc * glycosylation * glycosidase Subject RIV: CC - Organic Chemistry Impact factor: 2.801, year: 2012

  8. The influence of PWHT regime on microstructure and creep rupture behaviour of dissimilar T92/TP316H ferritic/austenitic welded joints with Ni-based filler metal

    Czech Academy of Sciences Publication Activity Database

    Falat, L.; Výrostková, A.; Svoboda, Milan; Milkovič, O.

    2011-01-01

    Roč. 49, č. 6 (2011), s. 417-426 ISSN 0023-432X Institutional research plan: CEZ:AV0Z20410507 Keywords : dissimilar weldment T92/TP316H * post-weld heat treatment (PWHT) * microstructure Subject RIV: JG - Metallurgy Impact factor: 0.451, year: 2011

  9. Prevalence and diversity of Arcobacter spp. isolated from the internal organs of spontaneous porcine abortions in Denmark

    DEFF Research Database (Denmark)

    On, Stephen L.W.; Jensen, Tim Kåre; Bille-Hansen, Vivi

    2002-01-01

    pathogens (Brucella, Leptospira, PPV PRRSV), but Arcobacter spp, were recovered from 23/55 abortions. Co-infections with Streptococcus suis, Escherichia coli, and haemolytic streptococci were observed in 7/23 Arcobacter-positive fetuses, and in 4/32 Arcobacter-negative fetuses, Histopathological analyses...

  10. Prepubertal unilateral gynecomastia and the presence of 47,XXY mosaicism in breast epithelial cells

    DEFF Research Database (Denmark)

    Andersen, Peter Stemann; Petersen, Bodil Laub; Juul, Anders

    2013-01-01

    , and sclerotherapy with Picibanil (OK-432) was attempted without any detectable effect on size. The mass was later excised. The pathological examination revealed mammary gland tissue suggestive of idiopathic gynecomastia. FISH revealed 47, XXY mosaicism in the abnormal breast epithelial cells, but not in peripheral...

  11. Management of Florida Scrub for Threatened and Endangered Species

    Science.gov (United States)

    1998-12-01

    predation, parasitism, and herbivory patterns (reviewed in general by Trame and Tazik 1995). Fragmentation can also result in localized extinctions of flora...Axelrod, D. I., 1958. " Evolution of the Madro-Tertiary geoflora," Botanical Review, 24: 432-509. Berry, D. M. and Menges, E. S. 1995. "Post-fire

  12. Marker-assisted selection on E. coli F4ab/ac resistance and the effect on neonatal survival in piglets

    DEFF Research Database (Denmark)

    Jørgensen, Claus Bøttcher; Anderson, Susan I.; Cirera, Susanna

    to the genomic sequence of pig mucin 4 we also report on more than 15 SNPs discovered in the porcine MUC4 sequence. Collaboration with the Danish Slaughterhouses on genotyping of the intron 7 SNP of Mucin 4 in 6.373 breeding boars (3.432 Landrace and 2.941 Large White) and analysis of their offspring has...

  13. Clinton, Trump In A Tie.

    Science.gov (United States)

    2016-09-01

    Forty-seven percent of the 432 respondents to our online survey said they plan to vote for Clinton, and the exact same percentage said they intend to vote for Trump. Most respondents thought Trump would do a better job making the system more efficient. A clear majority said that Clinton would do better job limiting cost shifting to consumers.

  14. Normobaric Hypoxia Induces Mild Damage to Epithelium of Terminal Bronchioles in Rabbits (Ultrastructural Study)

    Czech Academy of Sciences Publication Activity Database

    Uhlík, J.; Konrádová, V.; Vajner, L.; Adášková, Jana

    2005-01-01

    Roč. 50, č. 10 (2005), s. 432-438 ISSN 0375-8427 Source of funding: V - iné verejné zdroje Keywords : airways * Clara cells * ciliated cells * electron microscopy Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.621, year: 2005

  15. Afløbsinstallationer

    DEFF Research Database (Denmark)

    Ovesen, K.; Faldager, I.; Nielsen, V.

    Denne SBI-anvisning gennemgår hele afløbsområdet og giver beskrivelser, dimensioneringsvejledninger og eksempler med udgangspunkt i Norm for afløbsinstallationer, DS 432, 2.udgave 1994. I anvisningen behandles spildevands-, regnvands- og drænvandsinstallationer både i forbindelse med separat- og...

  16. GB virus C epidemiology in Denmark

    DEFF Research Database (Denmark)

    Christensen, Peer B; Fisker, Niels; Mygind, Lone H

    2003-01-01

    children, 9 and 15 years of age (n = 901), blood donors (n = 5,203), hospital employees (n = 1,432), and prisoners and injecting drug users (n = 447). In-house RT-PCR for GBV-CRNA was used together with a commercial ELISA for anti-E2 (Boehringer, Germany). In addition, questionnaires for risk factors...

  17. Cognitive And Neural Sciences Division 1992 Programs

    Science.gov (United States)

    1992-08-01

    Neuronal Micronets as Nodal Elements PRINCIPAL INVESTIGATOR: Thomas H. Brown Yale University Department of Psychology (203) 432-7008 R&T PROJECT CODE...of neural nets, and to develop a micronet architecture which captures the computations in neurons. Approach: Simulations will be conducted of the

  18. Synchronous population fluctuations of forest and field voles: implications for population management

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Suchomel, J.; Purchart, L.; Heroldová, Marta; Čepelka, L.; Homolka, Miloslav

    2011-01-01

    Roč. 432, - (2011), s. 97-98 ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. Berlin, 26.09.2011-30.09.2011] R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bank vole * common vole * correlation of population fluctuations Subject RIV: EH - Ecology, Behaviour

  19. Preparation and photocatalytic property of a novel dumbbell-shaped ZnO microcrystal photocatalyst

    DEFF Research Database (Denmark)

    Sun, Jian-Hui; Dong, Shu-Ying; Wang, Yong-Kui

    2009-01-01

    achieved 68.0%, 99.0% and 98.5%, the TOC removal efficiencies achieved 43.2%, 59.4% and 70.6%, respectively. Compared to commercial ZnO, 16-22% higher TOC removal efficiency was obtained by the dumbbell-shaped ZnO. The results indicated that the prepared dumbbell-shaped ZnO microcrystal photocatalyst...

  20. New treatment of early fetal chylothorax

    DEFF Research Database (Denmark)

    Nygaard, Ulrikka; Sundberg, Karin; Nielsen, Henriette Svarre

    2007-01-01

    OBJECTIVE: To evaluate OK-432, a preparation of Streptococcus pyogenes, in the treatment of early fetal chylothorax. METHODS: A prospective study of all fetuses (n=7) with persistent early chylothorax (gestational ages 16-21 weeks) referred to the tertiary center of fetal medicine in Denmark...

  1. Narayanamurti, Dr Venkatesh

    Indian Academy of Sciences (India)

    Specialization: Solid State, Nanoscience, Electronic Materials, Science Policy Address: Benjamin Peirce Professor of Technology & Public Policy, Harvard University, 107D, Pierce Hall, 29, Oxford Street, Cambridge, MA 02138, USA Contact: Office: (+1-617) 384 8211. Residence: (+1-508) 432 2075. Fax: (+1-617) 496 5264

  2. The potential of controlling gastrointestinal parasitic infections in ...

    African Journals Online (AJOL)

    Max R.

    Although alternatives such as grazing management, selective breeding for resistant hosts, worm vaccines and the use of biological agents have been ..... and bacteriological parameters in goats. Deutsche Tierarztliche Wochenschrift 104, 432–435. Urquhart, G.M., Armour, J., Duncan, J.L., Dunn, A.M. & Jennings, F.W., 1987.

  3. Secondhand Smoke

    Science.gov (United States)

    ... 5 (43.2%) nonsmokers who lived below the poverty level were exposed to secondhand smoke. Occupation 10 Differences in secondhand smoke exposure related to people’s jobs decreased over the past 20 years, but large differences still exist. Some groups continue to have high levels of ...

  4. Synthesis of Novel N-9-Substituted Purine Derivatives from Polymer Supported alpha-Amino Acids

    Czech Academy of Sciences Publication Activity Database

    Vanda, D.; Jorda, Radek; Lemrová, B.; Volná, T.; Kryštof, Vladimír; McMaster, C.; Soural, M.

    2015-01-01

    Roč. 17, č. 7 (2015), s. 426-432 ISSN 2156-8952 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk(CZ) LO1304 Institutional support: RVO:61389030 Keywords : alpha-amino acids * solid-phase synthesis * purine derivatives Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.317, year: 2015

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    Pedersen K S, Bendix J and Clerac R 2014 Chem. Commun. 50 4396. 14. Saitoh E, Miyajima H, Yamaoka T and Tatara G 2004. Nature 432 203. 15. Leuenberger M N and Loss D 2001 Nature 410 789. 16. Yamanouchi M, Chiba D, Matsukura F and Ohno H. 2004 Nature 428 539. 17. Bogani L and Wernsdorfer W 2008 Nat.

  6. Translational Regulation of PTEN/MMAC1 Expression in Prostate Cancer

    Science.gov (United States)

    2003-05-01

    the structures predicted are extremely stable with a typical free energy as high as -432 kcal/mole, which is well beyond the energy shown to inhibit...finally amplified by the 7374 HAN AND ZHANG MOL. CELL. BIOL. A BSg ~ = .1000 SV40 Chimeric R. Luciferase F. Luciferase SV4O SV4 I PRF Promoter Gene Gene

  7. Assessment of the thermodynamic properties and phase diagram of the Bi–Pd system

    Czech Academy of Sciences Publication Activity Database

    Vřešťál, J.; Pinkas, J.; Watson, A.; Scott, A.; Houserová, Jana; Kroupa, Aleš

    2006-01-01

    Roč. 30, č. 1 (2006), s. 14-17 ISSN 0364-5916 R&D Projects: GA MŠk(CZ) OC 531.002 Institutional research plan: CEZ:AV0Z2041904 Keywords : phase diagram * thermodynamic modelling Subject RIV: BJ - Thermodynamics Impact factor: 1.432, year: 2006

  8. Assessment of the thermodynamic properties and phase diagram of the Bi-Pd system

    Czech Academy of Sciences Publication Activity Database

    Vřešťál, Jan; Pinkas, J.; Watson, A.; Scott, A.; Houserová, Jana; Kroupa, Aleš

    2006-01-01

    Roč. 30, č. 1 (2006), s. 14-17 ISSN 0364-5916 R&D Projects: GA MŠk OC 531.001; GA MŠk OC 531.002 Institutional research plan: CEZ:AV0Z20410507 Keywords : phase diagram * ab initio calculations * calorimetry Subject RIV: BJ - Thermodynamics Impact factor: 1.432, year: 2006

  9. AcEST: DK949197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 432 e-121 sp|O24339|CATA_SOLAP Catalase OS=Soldanella al...t: 181 ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH 225 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina

  10. Glucose-6-phosphate dehydrogenase, ribonucleases and esterases upon tobacco mosaic virus infection and benzothiodiazole treatment in tobacco

    Czech Academy of Sciences Publication Activity Database

    Šindelářová, Milada; Šindelář, Luděk; Burketová, Lenka

    2002-01-01

    Roč. 45, č. 3 (2002), s. 423-432 ISSN 0006-3134 R&D Projects: GA ČR GA522/99/1264 Institutional research plan: CEZ:AV0Z5038910 Keywords : chlorophyll * Nicotiana tabacum * PAGE Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.583, year: 2002

  11. Appraising Gender Role Portrayals in TV Commercials.

    Science.gov (United States)

    Kolbe, Richard H.; Langefeld, Carl D.

    1993-01-01

    Examines gender role orientations of characters in prime time television advertisements through the Bem Sex-Role Inventory (BSRI) completed by 426 college students (43.2% females). Results confirm the appropriateness of the scale for self- and person-perception ratings. Uses of the BSRI in gender role research are discussed. (SLD)

  12. 77 FR 35031 - 4 OTC, Inc.; Decision and Order

    Science.gov (United States)

    2012-06-12

    ... Health Canada in some form or fashion to ensure them that they're not going to do that and understand the... dietary supplement. [Tr. 148; see also 69 FR 6788 (2004)]. b. Product Trends 9. John Kronebusch is a... also required to keep a record of all ephedrine sales. [Tr. 36, 51-2, 432]. b. Self-Certification 16...

  13. Warm-up strategy and high-intensity endurance performance in trained cyclists

    DEFF Research Database (Denmark)

    Christensen, Peter Møller; Bangsbo, Jens

    2015-01-01

    PURPOSE: To evaluate the influence of warm-up exercise intensity and subsequent recovery on intense endurance performance, selected blood variables and the VO2 response. METHODS: Twelve highly trained male cyclists (VO2-max: 72.4±8.0·mL/min/kg, incremental-test peak power output (iPPO): 432±31 W...

  14. Mikromechanistické aspekty vlivu délky trhliny na lomovou houževnatost a tranzitní chování ocelí

    Czech Academy of Sciences Publication Activity Database

    Chlup, Zdeněk; Dlouhý, Ivo

    2002-01-01

    Roč. 40, č. 4 (2002), s. 254-267 ISSN 0023-432X R&D Projects: GA AV ČR IAA2041003; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : fracture toughness * transition behaviour * constraint Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.493, year: 2002

  15. Longitudinální studium lidského vývoje: historie, výsledky a perspektivy pražské a brněnské studie celoživotního vývoje člověka

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Kebza, V.

    2011-01-01

    Roč. 55, č. 5 (2011), s. 422-432 ISSN 0009-062X R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : life -span development * longitudinal study * optimal development * personality * well-being * human strenghts Subject RIV: AN - Psychology Impact factor: 0.087, year: 2011

  16. Current Practices In Infant Nutrition In Benin City, Nigeria ...

    African Journals Online (AJOL)

    Of the 780 mothers 432 (55.6%) had children who were less than 6 months while 348(44.6%) had older infants. About 98.0% of the mothers were practicing one form of breast-feeding or the other. The exclusive breastfeeding rate (EBR), predominant breastfeeding rate (PBR) and bottle-feed rates (BOTFR) were respectively ...

  17. East African Medical Journal - Vol 78, No 8 (2001)

    African Journals Online (AJOL)

    Epidemiology of poliomyelitis in northwestern Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T. Tessema, A. Hailu, 430-432. http://dx.doi.org/10.4314/eamj.v78i8.8996 ...

  18. The Relevance Of Research And Development (R&D) Programmes ...

    African Journals Online (AJOL)

    The purpose of this study was to assess the relevance of Research and Development (R&D) programmes of Nigerian universities in national development. Data was collected form 432 senior academic staff of five selected universities in Nigeria. Indicators of relevance such as quality, results, dissemination, utilization and ...

  19. 75 FR 5584 - Fipronil; Product Cancellation Order and Amendment to Terminate Uses

    Science.gov (United States)

    2010-02-03

    [email protected] . SUPPLEMENTARY INFORMATION: I. General Information A. Does this Action Apply to Me? This... registrants of the products in Tables 1 and 2 of this unit, in sequence by EPA company number. Table 3.--Registrants of Cancelled and/or Amended Fipronil Products EPA Company Number Company Name and Address 432...

  20. 892-IJBCS-Article-Dr Bobo Kadiri Serge

    African Journals Online (AJOL)

    DR GATSING

    cocoa/coffee plantations (CF) and annual cultures made of open ..... (Bobo et al., 2006b). Different results were also found in a Malaysian dipterocarp forest at. Pasoh Forest Reserve (Negeri Sembilan,. Page 9. K. S. BOBO et al. / Int. J. Biol. Chem. Sci. 5(2): 419-432, 2011. 427. Peninsular Malaysia) where arthropods were.

  1. Aerosol Beam Focused-Laser Induced Plasma Spectrometer (ABF-LIPS) Continuous Emissions Multi-Metals Analyzer

    Science.gov (United States)

    2012-06-01

    19 3.2.1.3 Kirksite Furnace ...................................................................... 20 3.2.2 Test Facility Selection – TEAD ... TEAD ........................................................................................................ 45 4.1.2.1 October 2004 Test...52 4.3.2 TEAD 2005 Performance Assessment...................................................... 54 4.4 TECHNOLOGY

  2. Prevalence of falciparum malaria amongst pregnant women in Aba ...

    African Journals Online (AJOL)

    Malaria during pregnancy poses a substantial risk to mother and foetus especially an infection with Plasmodium falciparum. This study was undertaken to assess the prevalence of falciparum malaria among pregnant women in Aba South Local Government Area, Abia State, south-east Nigeria. Blood samples from 432 ...

  3. Endosomal sorting of VAMP3 is regulated by PI4K2A

    Czech Academy of Sciences Publication Activity Database

    Jovic, M.; Kean, M. J.; Dubánková, Anna; Bouřa, Evžen; Gingras, A. C.; Brill, J. A.; Balla, T.

    2014-01-01

    Roč. 127, č. 17 (2014), s. 3745-3756 ISSN 0021-9533 Institutional support: RVO:61388963 Keywords : PI4K2A * VAMP3 * PtdIns4P * vesicle fusion * sorting * SNARE Subject RIV: CE - Biochemistry Impact factor: 5.432, year: 2014

  4. Blood Pressure and Impedance Cardiography duríng Tilt Table Test

    Czech Academy of Sciences Publication Activity Database

    Jurák, Pavel; Halámek, Josef; Vondra, Vlastimil; Plachý, M.; Fráňa, P.; Leinveber, Pavel

    2009-01-01

    Roč. 36, - (2009), s. 429-432 ISSN 0276-6574 R&D Projects: GA AV ČR IAA200650801 Institutional research plan: CEZ:AV0Z20650511 Keywords : blood pressure * heart rate * thoracic impedance cardiography Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering http://cinc.mit.edu/archives/2009/pdf/0429.pdf

  5. Acid-base-driven matrix-assisted mass spectrometry for targeted metabolomics

    Czech Academy of Sciences Publication Activity Database

    Shroff, R.; Rulíšek, Lubomír; Doubský, J.; Svatoš, Aleš

    2009-01-01

    Roč. 106, č. 25 (2009), s. 10092-10096 ISSN 0027-8424 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : clinical diagnostic * matrix design * positive /negative ions * MALDI Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 9.432, year: 2009

  6. Dicty_cDB: Contig-U15236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DN... 38 0.40 CP001614_432( CP001614 |pid:none) Teredinibacter turnerae T7901, c...P001488_1192( CP001488 |pid:none) Brucella melitensis ATCC 23457 ... 33 7.5 CP001614_3492( CP001614 |pid:none) Teredinibacter turner

  7. 2017-2018 Expense report for Sylvain Dufour | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-09-30

    Total travel expenses: CA$13,130.42. Participate in the Gartner Symposium and ITxpo 2017. September 30, 2017 to October 6, 2017. CA$3,432.90. Participate in the Chief Economist Roundtable organized by the Business Development Bank of Canada. September 21, 2017 to September 22, 2017. CA$654.38. Review of ...

  8. Chicagoland Single-Family Housing Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Spanier, J. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States); Scheu, R. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States); Brand, L. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States); Yang, J. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States)

    2012-06-01

    In this report, the PARR team identifies housing characteristics and energy use for fifteen housing types in the Chicagoland (Cook County, Illinois) region and specifies measure packages that provide an optimum level of energy savings based on a BEopt analysis. The analysis is based on assessor data and actual energy consumption data on 432,605 houses representing approximately 30% of the population.

  9. Chicagoland Single-Family Housing Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Spanier, J.; Scheu, R.; Brand, L.; Yang, J.

    2012-06-01

    In this report, the PARR team identifies housing characteristics and energy use for fifteen housing types (groups) in the Chicagoland (Cook County, Illinois) region and specifies measure packages that provide an optimum level of energy savings based on a BEopt analysis. The analysis is based on assessor data and actual energy consumption data on 432,605 houses representing approximately 30% of the population.

  10. Calculation of ternary interdiffusion coefficients using a single diffusion couple

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Rothová, Věra

    2016-01-01

    Roč. 54, č. 5 (2016), s. 305-314 ISSN 0023-432X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : diffusion * interdiffusion * ternary alloys * ternary diffusion coefficients Subject RIV: BJ - Thermodynamic s Impact factor: 0.366, year: 2016

  11. Phytochemical screening and antimicrobial efficacy of extracts from ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-17

    Dec 17, 2008 ... phytochemical screening and antimicrobial activity against gram-positive and gram-negative bacteria using the disc-diffusion method. ... Biomolecules of plant origin appear as alternatives for the control of even resistant species of bacteria .... nervous system of rat and guinea pig. J. Neurocytol. 15: 432-443.

  12. Foreign Language Anxiety Levels in Second Life Oral Interaction

    Science.gov (United States)

    Melchor-Couto, Sabela

    2017-01-01

    Virtual worlds have been described as low anxiety environments (Dickey, 2005), where students may feel "shielded" behind their avatars (Rosell-Aguilar, 2005: 432). The aim of this article is to analyse the evolution of the Foreign Language Anxiety (FLA) levels experienced by a group of participants who used the virtual world "Second…

  13. Dislocation Structures in Nickel Based Superalloy Inconel 792-5A Fatigued at Room Temperature and 700 °C

    Czech Academy of Sciences Publication Activity Database

    Petrenec, Martin; Obrtlík, Karel; Polák, Jaroslav; Man, Jiří

    2008-01-01

    Roč. 567-568, - (2008), s. 429-432 ISSN 0255-5476. [MSMF /5./. Brno, 27.06.2007-29.06.2007] R&D Projects: GA ČR(CZ) GP106/05/P521 Institutional research plan: CEZ:AV0Z20410507 Keywords : Low cycle fatigue * superalloy * dislocation structure Subject RIV: JL - Materials Fatigue, Friction Mechanics

  14. Flow mechanisms in creep of a short-fibre AZ91 alloy-based composite

    Czech Academy of Sciences Publication Activity Database

    Pahutová, Marie; Sklenička, Václav; Kuchařová, Květa; Svoboda, Milan; Langdon, T. G.

    43 2005, č. 1 (2005), s. 34-44 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/03/0901 Institutional research plan: CEZ:AV0Z20410507 Keywords : AZ91 magnesium alloy * metal matrix composite * short fibre reinforcement Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  15. Anomalous high temperature creep behaviour of an Al-8.5Fe-1.3V-1.7Si (8009Al type) alloy reinforced with alumina short fibres

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2004-01-01

    Roč. 42, č. 1 (2004), s. 9-20 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : High temperature creep- load transfer Subject RIV: JI - Composite Materials Impact factor: 1.056, year: 2004

  16. Load transfer effect in the true threshold creep behaviour

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2003-01-01

    Roč. 41, č. 2 (2003), s. 127-132 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Dispersion strengthening * load transfer Subject RIV: JI - Composite Materials Impact factor: 0.563, year: 2003

  17. Creep of three-phase alloy Fe-30%Al-5.2%Zr

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Ferdinand; Kratochvíl, P.; Kejzlar, P.

    2015-01-01

    Roč. 53, č. 3 (2015), s. 127-132 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/12/1452 Institutional support: RVO:68081723 Keywords : iron aluminides * creep * precipitation Subject RIV: JG - Metallurgy Impact factor: 0.365, year: 2015

  18. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  19. Creep properties of aluminium processed by ECAP

    Czech Academy of Sciences Publication Activity Database

    Král, Petr; Dvořák, Jiří; Jäger, Aleš; Kvapilová, Marie; Horita, Z.; Sklenička, Václav

    2016-01-01

    Roč. 54, č. 6 (2016), s. 441-451 ISSN 0023-432X R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 ; RVO:68378271 Keywords : equal channel angular pressing (ECAP) * aluminium * ultrafine-grained microstructure * creep Subject RIV: JG - Metallurgy; JG - Metallurgy (FZU-D) Impact factor: 0.366, year: 2016

  20. Novel Interpretation of High Temperature Creep in an ODS Cu-ZrO2 Alloy

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2002-01-01

    Roč. 40, č. 3 (2002), s. 133-145 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : ODS Cu Alloy s * Creep Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

  1. Autonomous Observations of the Upper Ocean Stratification and Velocity Field about the Seasonality Retreating Marginal Ice Zone

    Science.gov (United States)

    2016-12-30

    rkrishfield@wboi.edu Mary-Louise Timmermans 111 Kline Geology Laboratory, Yale University PO Box 208 109, New Haven CT 06520-8 109 phone: (203) 432-3167...upper Arctic Ocean. Objectives As a contribution to the Marginal lee Zone DRl , thi s research element was designed to observe the seasonal

  2. Trajectories and nuclear arrangement of PML bodies are influenced by A-type lamin deficiency

    Czech Academy of Sciences Publication Activity Database

    Stixová, Lenka; Matula, Pavel; Kozubek, Stanislav; Gombitová, A.; Cmarko, D.; Raška, I.; Bártová, Eva

    2012-01-01

    Roč. 104, č. 7 (2012), s. 418-432 ISSN 0248-4900 R&D Projects: GA MŠk(CZ) LD11020; GA ČR GBP302/12/G157 Institutional research plan: CEZ:AV0Z50040702 Keywords : FRAP * LMNA gen * PML Subject RIV: BO - Biophysics Impact factor: 3.488, year: 2012

  3. Long-term population dynamics of the field vole from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Bejček, V.; Flousek, J.; Šťastný, K.; Zima, Jan; Sedláček, F.

    2011-01-01

    Roč. 432, - (2011), s. 89 ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. 26.09.2011-30.09.2011, Berlin] Institutional research plan: CEZ:AV0Z60930519 Keywords : climate effects * Microtus agrestis * population cycles * time series analysis Subject RIV: EH - Ecology, Behaviour

  4. The role of product information on consumer sensory evaluation, expectations, experiences and emotions of cricket-flour-containing buns

    DEFF Research Database (Denmark)

    Pambo, Kennedy O.; Okello, Julius J.; Mbeche, Robert M.

    2018-01-01

    attributes of a common bakery product (buns) that was blended with cricket-flour i.e., cricket-flour-containing (CFC) buns. We also tested whether provision of information can modulate the sensory evaluations, personal involvement and emotions. The study is based on a field experiment involving 432...

  5. African Journals Online (AJOL)

    African Journals Online (AJOL)

    AJOL is a Non-Profit Organisation based in South Africa. More about AJOL and the challenges we work to address. AJOL hosts 521 Journals, including 221 Open Access Journals; The site has 12 744 Issues containing 149 215 Abstracts. There are 143 432 Full Text Articles for download, of which 82 212 are Open Access ...

  6. Residual stresses determination by neutron diffraction in a 100Cr6 chromium steel bearing ring

    Czech Academy of Sciences Publication Activity Database

    Rogante, M.; Martinat, G.; Mikula, Pavol; Vrána, Miroslav

    2013-01-01

    Roč. 51, č. 5 (2013), s. 275-281 ISSN 0023-432X R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : 100Cr6 steel * rings * martensitic hardening * tempering * residual stress es * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.546, year: 2013

  7. Disease: H00917 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00917 Congenital dyserythropoietic anemias (CDAs) Congenital dyserythropoietic anemia...ion, gene) ... AUTHORS ... Iolascon A, Russo R, Delaunay J ... TITLE ... Congenital dyserythropoietic anemias. ... J...AUTHORS ... Kamiya T, Manabe A ... TITLE ... Congenital dyserythropoietic anemia. ... JOURNAL ... Int J Hematol 92:432-8 (2010) DOI:10.1007/s12185-010-0667-9 ...

  8. Comparing the harmful effects of nontuberculous mycobacteria and Gram negative bacteria on lung function in patients with cystic fibrosis

    DEFF Research Database (Denmark)

    Qvist, Tavs; Taylor-Robinson, David; Waldmann, Elisabeth

    2015-01-01

    BACKGROUND: To better understand the relative effects of infection with nontuberculous mycobacteria and Gram negative bacteria on lung function decline in cystic fibrosis, we assessed the impact of each infection in a Danish setting. METHODS: Longitudinal registry study of 432 patients with cystic...

  9. Runoff Responses to Forest Thinning at Plot and Catchment Scales in a Headwater Catchment Draining Japanese Cypress Forest

    Science.gov (United States)

    We examined the effect of forest thinning on runoff generation at plot and catchment scales in headwater basins draining a Japanese cypress (Chamaecyparis obtusa) forest. We removed 58.3% of the stems (corresponding to 43.2% of the basal area) in the treated headwater basin (catc...

  10. Initiation of fatigue cracks in ultrafine-grained copper

    Czech Academy of Sciences Publication Activity Database

    Lukáš, Petr; Kunz, Ludvík; Navrátilová, Lucie

    2012-01-01

    Roč. 50, č. 6 (2012), s. 407-419 ISSN 0023-432X Institutional support: RVO:68081723 Keywords : ultrafine-grained microstructure * fatigue * slip bands * microcrack initiation * grain coarsening Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.687, year: 2012

  11. Constant structure creep experiments on aluminium

    Czech Academy of Sciences Publication Activity Database

    Milička, Karel

    2011-01-01

    Roč. 49, č. 5 (2011), s. 307-318 ISSN 0023-432X R&D Projects: GA AV ČR IAA2041203 Institutional research plan: CEZ:AV0Z20410507 Keywords : mechanical properties * high temperature deformation * creep * aluminium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.451, year: 2011

  12. Relations among Student Attention Behaviors, Teacher Practices, and Beginning Word Reading Skill

    Science.gov (United States)

    Saez, Leilani; Folsom, Jessica Sidler; Al Otaiba, Stephanie; Schatschneider, Christopher

    2012-01-01

    The role of student attention for predicting kindergarten word reading was investigated among 432 students. Using "Strengths and Weaknesses of ADHD Symptoms and Normal Behavior Rating Scale" behavior rating scores, the authors conducted an exploratory factor analysis, which yielded three distinct factors that reflected selective…

  13. Current status of Co-Re-based alloys being developed to supplement Ni-based superalloys for ultra-high temperature applications in gas turbines

    Czech Academy of Sciences Publication Activity Database

    Mukherji, D.; Strunz, Pavel; Gilles, R.; Karge, L.; Rösler, J.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 287-294 ISSN 0023-432X EU Projects: European Commission(XE) 283883 - NMI3-II Institutional support: RVO:61389005 Keywords : Co-base alloy * scanning electron microscopy (SEM) * neutron scattering Subject RIV: JG - Metallurgy Impact factor: 0.365, year: 2015

  14. The significance of methionine, histidine and tryptophan in plant responses and adaptation to cadmium stress

    Czech Academy of Sciences Publication Activity Database

    Zemanová, V.; Pavlík, Milan; Pavlíková, D.; Tlustoš, P.

    2014-01-01

    Roč. 60, č. 9 (2014), s. 426-432 ISSN 1214-1178 Institutional support: RVO:61389030 Keywords : abiotic stress * amino acids * heavy metals Subject RIV: CE - Biochemistry Impact factor: 1.226, year: 2014 http://www.agriculturejournals.cz/publishedArticles/PSE/2014-60-9-426

  15. Nod2 is required for the regulation of commensal microbiota in the intestine

    Czech Academy of Sciences Publication Activity Database

    Petnicki-Ocwieja, T.; Hrnčíř, Tomáš; Liu, Y.-J.; Biswas, A.; Hudcovic, Tomáš; Tlaskalová, Helena; Kobayashi, K.

    2009-01-01

    Roč. 106, č. 37 (2009), s. 15813-15818 ISSN 0027-8424 R&D Projects: GA ČR GA303/06/0974 Institutional research plan: CEZ:AV0Z50200510 Keywords : commensal bacteria * crohn's disease * mouse Subject RIV: EC - Immunology Impact factor: 9.432, year: 2009

  16. The effect of carbon on the structure of Fe-40Al-xC (at.%)

    Czech Academy of Sciences Publication Activity Database

    Vodičková, V.; Kratochvíl, P.; Dobeš, Ferdinand

    2007-01-01

    Roč. 45, č. 3 (2007), s. 153-158 ISSN 0023-432X Institutional research plan: CEZ:AV0Z20410507 Keywords : iron aluminide (Fe-Al type) * phase composition Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  17. Improved thermostability and enzyme activity of a recombinant phyA mutant phytase from Aspergillus niger N25 by directed evolution and site-directed mutagenesis.

    Science.gov (United States)

    Tang, Zizhong; Jin, Weiqiong; Sun, Rong; Liao, Yan; Zhen, Tianrun; Chen, Hui; Wu, Qi; Gou, Lin; Li, Chenlei

    2018-01-01

    We previously constructed three recombinant phyA mutant strains (PP-NP m -8, PP-NP ep -6A and I44E/T252R-PhyA), showing improved catalytic efficiency or thermostability of Aspergillus niger N25 phytase, by error-prone PCR or site-directed mutagenesis. In this study, directed evolution and site-directed mutagenesis were further applied to improve the modified phytase properties. After one-round error-prone PCR for phytase gene of PP-NP ep -6A, a single transformant, T195L/Q368E/F376Y, was obtained with the significant improvements in catalytic efficiency and thermostability. The phytase gene of T195L/Q368E/F376Y, combined with the previous mutant phytase genes of PP-NP ep -6A, PP-NP m -8 and I44E/T252R-PhyA, was then sequentially modified by DNA shuffling. Three genetically engineered strains with desirable properties were then obtained, namedQ172R, Q172R/K432R andQ368E/K432R. Among them, Q172R/K432R showed the highest thermostability with the longest half-life and the greatest remaining phytase activity after heat treatment, while Q368E/K432R showed the highest catalytic activity. Five substitutions (Q172R, T195L, Q368E, F376Y, K432R) identified from random mutagenesis were added sequentially to the phytase gene of PP-NP ep -6A to investigate how the mutant sites influence the properties of phytase. Characterization and structural analysis demonstrated that these mutations could produce cumulative or synergistic improvements in thermostability or catalytic efficiency of phytase. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. α4He elastic scattering at high energies

    International Nuclear Information System (INIS)

    Usmani, A.A.; Usmani, Q.N.

    1988-03-01

    Differential cross sections for α 4 He elastic scattering have been calculated at incident α particle momenta of 4.32, 5.07 and 7.0 GeV/c within the framework of the Glauber multiple scattering theory. The full Glauber amplitude is calculated using the Monte Carlo method for evaluating multidimensional integrals. We find that, in general, the more realistic double Gaussian model for the density brings theory closer to experiment as compared to the generally used single Gaussian model. Our results with the double Gaussian model are in fairly good agreement with the experimented data at 4.32 and 5.07 GeV/c. (author). 11 refs, 4 figs, 1 tab

  19. Risk of leukemia in first degree relatives of patients with nonsyndromic cleft lip and palate

    Directory of Open Access Journals (Sweden)

    Eduardo GONÇALVES

    2014-01-01

    Full Text Available The aim of this study was to determine the frequency of leukemia in parents of patients with nonsyndromic cleft lip and/or cleft palate (NSCL/P. This case-control study evaluated first-degree family members of 358 patients with NSCL/P and 1,432 subjects without craniofacial alterations or syndromes. Statistical analysis was carried out using Fisher’s test. From the 358 subjects with NSCL/P, 3 first-degree parents had history of leukemia, while 2 out of 1,432 subjects from the unaffected group had a family history of leukemia. The frequency of positive family history of leukemia was not significantly increased in first-degree relatives of patients with NSCL/P.

  20. Fundamental Characterization of Spanwise Loading and Trailed Wake Vortices

    Science.gov (United States)

    2016-07-01

    exterior to the tunnel flow that rides on a set of two vertically separated rails (seen in Fig. 1). The blade pitch bearing is located on the wing side of...58.5 25.236 6.620 56.966 55.5 44.145 Data 60.5 25.151 6.624 57.042 55.498 43.998 Data 60.5 25.206 6.607 57.042 55.497 43.999 Data D- 432 VG horizontal...63 45.555 6.584 57.005 52.756 46.016 Data 64 45.482 6.570 57.003 52.755 46.016 Data 64 45.555 6.584 57.005 52.756 46.016 Data Table 432 : Vertical

  1. Simultaneous circulation of all four dengue serotypes in Manaus, State of Amazonas, Brazil in 2011

    Directory of Open Access Journals (Sweden)

    Michele de Souza Bastos

    2012-06-01

    Full Text Available INTRODUCTION: Manaus, the capital city of the state of Amazon with nearly 2 million inhabitants, is located in the middle of the Amazon rain forest and has suffered dengue outbreaks since 1998. METHODS: In this study, blood samples were investigated using reverse transcriptase-polymerase chain reaction (RT-PCR, aimed at identifying dengue virus serotypes. RESULTS: Acute phase sera from 432 patients were tested for the presence of dengue virus. Out of the 432 patients, 137 (31.3% were found to be positive. All the four dengue virus serotypes were observed. CONCLUSIONS: The simultaneous circulation of the four dengue serotypes is described for the first time in Manaus and in Brazil.

  2. Powder metallurgy processing of high strength turbine disk alloys

    Science.gov (United States)

    Evans, D. J.

    1976-01-01

    Using vacuum-atomized AF2-1DA and Mar-M432 powders, full-scale gas turbine engine disks were fabricated by hot isostatically pressing (HIP) billets which were then isothermally forged using the Pratt & Whitney Aircraft GATORIZING forging process. While a sound forging was produced in the AF2-1DA, a container leak had occurred in the Mar-M432 billet during HIP. This resulted in billet cracking during forging. In-process control procedures were developed to identify such leaks. The AF2-1DA forging was heat treated and metallographic and mechanical property evaluation was performed. Mechanical properties exceeded those of Astroloy, one of the highest temperature capability turbine disk alloys presently used.

  3. Web monitoring of industrial signals using embedded systems

    Directory of Open Access Journals (Sweden)

    Cesar Augusto Romero-Molano

    2016-01-01

    Full Text Available The paper presents the design of software and hardware for a system of web monitoring of industrial signals. This prototype provides a web interface which can observe in real time the status of four industrial-type signal on-off. MSP432 microcontroller is used for sampling and transmitting monitored signals to a Raspberry PI which receives by a UART link the MSP432 monitored data and presents them immediately in the front-end web application. The prototype design was verified with a pneumatic application that consists of four single-acting cylinders and it was observed an efficient synchronization between the occurrence of the triggering event or change in status of any of the monitored cylinder and web publishing.

  4. Quantification of Gains and Risks of Static Thermal Rating Based on Typical Meteorological Year

    Czech Academy of Sciences Publication Activity Database

    Heckenbergerová, Jana; Musílek, P.; Filimonenkov, K.

    2013-01-01

    Roč. 44, č. 1 (2013), s. 227-235 ISSN 0142-0615 R&D Projects: GA MŠk LD12009 Grant - others:GA AV ČR(CZ) M100300904 Institutional support: RVO:67985807 Keywords : Overhead power transmission lines * Conductor ampacity * Probabilistic static thermal rating * Typical meteorological year * Risk tolerance * Energy throughput Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 3.432, year: 2012

  5. Prototyping the Use of Dispersion Models to Predict Ground Concentrations During Burning of Deployed Military Waste

    Science.gov (United States)

    2012-03-22

    plastics, all kinds of pipes and tiles) 0.00% Food waste/ Diapers 15.81% Polystyrene (PS) (Class 6 plastics, Styrofoam, disposable coffee cups...disposable coffee cups ,plastic food boxes, plastic cutlery, packing foam and peanuts) 0.46% Food waste/ Diapers 4.32% Polycarbonate (Class 7 plastics...To get a text output select utilities then convert to ASCII, the file will be names “cdump” and will be in working folder under HYSPLIT directory

  6. Download this PDF file

    African Journals Online (AJOL)

    wks) 3 l .00 31.00 42 44. Delay in peak production (wks) (Optimal:30wks approx) 1 1 12 14. Total egg (x. 000) 43.68 42.15 21.36 17 06. Egg value (x N,0000) 262.08 252.9 128.16 102.36. Stock population 430 432 216 175. Egg value/bird ($1) ...

  7. Mirror symmetry breaking in cubic phases and isotropic liquids driven by hydrogen bonding.

    Science.gov (United States)

    Alaasar, Mohamed; Poppe, Silvio; Dong, Qingshu; Liu, Feng; Tschierske, Carsten

    2016-11-24

    Achiral supramolecular hydrogen bonded complexes between rod-like 4-(4-alkoxyphenylazo)pyridines and a taper shaped 4-substituted benzoic acid form achiral (Ia3[combining macron]d) and chiral "Im3[combining macron]m-type" bicontinuous cubic (I432) phases and a chiral isotropic liquid mesophase (Iso 1 [ * ] ). The chiral phases, resulting from spontaneous mirror symmetry breaking, represent conglomerates of macroscopic chiral domains eventually leading to uniform chirality.

  8. Marine Corps Operational Medicine: Determining Medical Supply Needs of the Forward Resuscitative Surgery System and the Shock Trauma Platoon

    Science.gov (United States)

    2005-10-17

    NMCSD drsallee@nmcsd.navy.med.mil (619)532-8276 LCDR David Schoo SYSCOM David.Schoo@usmc.mil (703)432-3221 HMC Timothy Snyder NMLC tesnyder...0.06 $32.00 6515012471001 Clip Hemostatic Raney Design Scalp Clips Plastic Disposable 200s 0.4 PG 0.85 0.052 $84.89 0.34 0.0208 $33.96

  9. An organometallic route to long helicenes

    Czech Academy of Sciences Publication Activity Database

    Sehnal, Petr; Stará, Irena G.; Šaman, David; Tichý, Miloš; Míšek, Jiří; Cvačka, Josef; Rulíšek, Lubomír; Chocholoušová, Jana; Vacek, Jaroslav; Goryl, G.; Szymonski, M.; Císařová, I.; Starý, Ivo

    2009-01-01

    Roč. 106, č. 32 (2009), s. 13169-13174 ISSN 0027-8424 R&D Projects: GA ČR GA203/06/1792; GA MŠk LC512 Grant - others:FP6(XE) 015847 Institutional research plan: CEZ:AV0Z40550506 Keywords : nonracemic compounds * STM imaging * helicene Subject RIV: CC - Organic Chemistry Impact factor: 9.432, year: 2009

  10. Caractérisation d'une bactériocine produite par une bactérie lactique Leuconostoc pseudomesenteroides isolée du boza

    OpenAIRE

    Makhloufi, Kahina Maya

    2011-01-01

    Lactic acid bacteria inhibit food spoilage bacteria by producing large amounts of lactic acid and growth-inhibiting peptides termed bacteriocins. Bacteriocins are ribosomally synthesized and are usually active against related species including pathogens, in particular Listeria and Enterococcus. We here isolated a bacteriocin produced by a strain called KM432Bz isolated from boza, a fermented drink usually consummed in Balkans, that we identified as a Leuconostoc pseudomesenteroides. Mass spec...

  11. Body mass index (BMI) in patients attending the anaesthesia clinic ...

    African Journals Online (AJOL)

    The Body Mass Index (BMI) ranged between 16.3 kg/m2 and 44.4 kg/m2. The mean BMI was 26.16 kg/m2 with a standard deviation of 4.65. Overall, 43.2 patients had a normal BMI, 35.4% of patients were overweight, 20.3% of patients were obese and 1.2% were underweight. Amongst males, 62.2% had a normal BMI, ...

  12. Mechanism of post-seismic floods after the Wenchuan earthquake in ...

    Indian Academy of Sciences (India)

    Ding Hairong

    2017-10-06

    Oct 6, 2017 ... Wang J, Jin Z D and Hilton G R et al. 2015 Controls on fluvial evacuation of sediment from earthquake-triggered landslides; Geology 43(2) 115–118. Wu Y F, Yu B and Ma Y et al. 2011 Debris flow of. Shuangyangzi gully, Dujiangyan City in Wenchuan earth- quake area; Sci. Soil Water Conserv. 9(3) 13–17 ...

  13. Nutrition-related cancer prevention knowledge of undergraduate ...

    African Journals Online (AJOL)

    Results: Less than half (49%) had good nutrition-related knowledge of cancer prevention. ... cereals and grains (χ2 = 13.724; p= 0.000), legumes/nuts (χ2 = 17.268; p = 0.000), meat (χ2= 22.972; p = 0.000), fish χ2 = 23.017; p = 0.000), pastry snacks (χ2 = 36.159; p = 0.000) and sugary drinks (χ2= 6.432; p = 0.011).

  14. Influence of surrounding atmosphere on crystallization of as-quenched Fe-Ni-Zr ribbon

    Czech Academy of Sciences Publication Activity Database

    Roupcová, Pavla; Schneeweiss, Oldřich; Bezdička, Petr; Petrovič, P.

    2006-01-01

    Roč. 44, č. 3 (2006), s. 127-132 ISSN 0023-432X R&D Projects: GA MŠk 1M0512 Institutional research plan: CEZ:AV0Z20410507; CEZ:AV0Z40320502 Keywords : as-quenched material * kinetics of crystallization * Mossbauer spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

  15. Rapports 2017-2018 sur les frais de voyage pour Sylvain Dufour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    But: Participer au Symposium Gartner et ExpoIT 2017. Date(s). 2017-09-30 au 2017-10-06. Destination(s). Orlando, Floride (É.-U.) Billet d'avion. 751.97 $. Frais de transport au sol ou autrement. 228.39 $. Frais de logement. 1 102.96 $. Repas et frais divers. 1 342.07 $. Autre frais. 7.51 $. Total. 3 432.90 $. Commentaires.

  16. Intravenous Lipid Emulsion Therapy Does Not Improve Hypotension Compared to Sodium Bicarbonate for Tricyclic Antidepressant Toxicity: A Randomized, Controlled Pilot Study in a Swine Model

    Science.gov (United States)

    2014-11-01

    this possibility. In addition, there may be a difference in the way humans and swine metabolize the lipid drop- lets, although this has not been...acidotic state than in the sodium bicarbonate group. Acidosis increases the fraction of ionized ami- triptyline, which may theoretically slow diffusion...therapy. Pediatrics 2012;130:e432–8. 15. Al-Duaij N, George M, O’Donnell K, Burns EM. Lipid emulsion in massive imipramine overdose. Clin Toxicol

  17. State-space Generalized Predicitve Control for redundant parallel robots

    Czech Academy of Sciences Publication Activity Database

    Belda, Květoslav; Böhm, Josef; Valášek, M.

    2003-01-01

    Roč. 31, č. 3 (2003), s. 413-432 ISSN 1539-7734 R&D Projects: GA ČR GA101/03/0620 Grant - others:CTU(CZ) 0204512 Institutional research plan: CEZ:AV0Z1075907 Keywords : parallel robot construction * generalized predictive control * drive redundancy Subject RIV: BC - Control Systems Theory http://library.utia.cas.cz/separaty/historie/belda-0411126.pdf

  18. Inhibition of Matriptase Activity Results in Decreased Intestinal Epithelial Monolayer Integrity In Vitro.

    Directory of Open Access Journals (Sweden)

    E Pászti-Gere

    Full Text Available Barrier dysfunction in inflammatory bowel diseases implies enhanced paracellular flux and lowered transepithelial electrical resistance (TER causing effective invasion of enteropathogens or altered intestinal absorption of toxins and drug compounds. To elucidate the role of matriptase-driven cell surface proteolysis in the maintenance of intestinal barrier function, the 3-amidinophenylalanine-derived matriptase inhibitor, MI-432 was used on porcine IPEC-J2 cell monolayer. Studies with two fluorescent probes revealed that short (2 h treatment with MI-432 caused an altered distribution of oxidative species between intracellular and extracellular spaces in IPEC-J2 cells. This perturbation was partially compensated when administration of inhibitor continued for up to 48 h. Significant decrease in TER between apical and basolateral compartments of MI-432-treated IPEC-J2 cell monolayers proved that matriptase is one of the key effectors in the maintenance of barrier integrity. Changes in staining pattern of matriptase and in localization of the junctional protein occludin were observed suggesting that inhibition of matriptase by MI-432 can also exert an effect on paracellular gate opening via modulation of tight junctional protein assembly. This study confirms that non-tumorigenic IPEC-J2 cells can be used as an appropriate small intestinal model for the in vitro characterization of matriptase-related effects on intestinal epithelium. These findings demonstrate indirectly that matriptase plays a pivotal role in the development of barrier integrity; thus matriptase dysfunction can facilitate the occurence of leaky gut syndrome observed in intestinal inflammatory diseases.

  19. Fire Suppression by Halon 2402. Volume 2

    Science.gov (United States)

    1987-10-01

    5. HUMO 2402 EVAPORATION DATA, AIR VBWOCITY =3W( FT/MTV. iiD ________________ Tim., mus, Air temp., lalon temp., Temperature, minutes gri F F F 0...time. 4.3.2 Sampling for inspection of filled containers. A random sample offilled cont iners snali De selected from each lot in accordance with MIL-STD...flamev ionization detector (FID). (b) Column: 25-meter long, 0.2 nmn diameter, 5-percent pheny! 9 percent methyl silicone WCOT capillary column, or

  20. Polyhydroxylated Sapphyrins: Multisite Non-metallic Catalysts for Activated Phosphodiester Hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Král, V.; Lang, Kamil; Králová, Jarmila; Dvořák, Michal; Martásek, P.; Chin, A.O.; Andrievsky, A.; Lynch, V.; Sessler, J. L.

    2006-01-01

    Roč. 128, č. 2 (2006), s. 432-437 ISSN 0002-7863 R&D Projects: GA ČR GA301/04/1315; GA ČR(CZ) GA303/05/0336 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z50520514 Keywords : phosphoryl-transfer-reactions * metal-ions * alkaline-phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 7.696, year: 2006

  1. Spatial decisions and cognitive strategies of monkeys and humans based on abstract spatial stimuli in rotation test

    Czech Academy of Sciences Publication Activity Database

    Nekovářová, Tereza; Nedvídek, Jan; Klement, Daniel; Bureš, Jan

    2009-01-01

    Roč. 136, č. 36 (2009), s. 15478-15482 ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517; GA ČR(CZ) GA309/09/0286; GA AV ČR KJB500110704 Institutional research plan: CEZ:AV0Z50110509 Keywords : spatial cognition * geometry of space * mental rotations Subject RIV: FH - Neurology Impact factor: 9.432, year: 2009

  2. Determinants of exchange rate volatility: the case of the new EU members

    Czech Academy of Sciences Publication Activity Database

    Stančík, Juraj

    2007-01-01

    Roč. 57, 9-10 (2007), s. 414-432 ISSN 0015-1920 R&D Projects: GA ČR GA402/06/1293; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : exchange-rate volatility * TARCH model * EMU integration Subject RIV: AH - Economics Impact factor: 0.382, year: 2007 http://journal.fsv.cuni.cz/storage/1085_fau_9_10_2007_00000002.pdf

  3. Ilhas: o começo e o fim do mundo

    Directory of Open Access Journals (Sweden)

    Marilia Teresinha de Sousa Machado

    2015-12-01

    Full Text Available Steven Roger Fischer. Ilhas: de Atlântida a Zanzibar. São Paulo: Editora Unesp, 2014. 432p. [Tradução de Claudia Freire]. ISBN 978-85-393-0550-6. Preço: R$ 65,00. Inclui bibliografia, imagens e índice remissivo. Traduzido do original: Islands: From Atlantis to Zanzibar (London: Reaktion Books, 2012.

  4. Modelling Agent-Environment Interaction in Multi-Agent Simulations with Affordances

    Science.gov (United States)

    2010-04-01

    RI, USA, 2004. AIAA. 14. Carole Bernon, Massimo Cossentino, and Juan Pavi. An overview of current trends in European AOSE research. Informatica , 29(5...Abdelkader Gouaich and Fabien Michel. Towards a unified view of the environment(s) within multi-agent systems. Informatica , 29(4):423–432, November 2005. 59...coordination in mas. Informatica , 29(4):433–443, November 2005. 128. Michael A. Riley and Marie-Vee Santana. Mutuality relations, observations, and

  5. Effects of Sodium Chloride on Some Physiological Traits and ...

    African Journals Online (AJOL)

    The desired salinity levels were developed by mixing the required amount of NaCl in soil before filling the pots (0, 2.16, 4.32, 8.64 g/kg soil). In most southern provinces of Iran, Soil Salinity is a growing problem particularly in irrigated agricultural areas and has been found to reduce safflower yield. The results indicated that ...

  6. Microstructure stability and creep behaviour of advanced high chromium ferritic steels

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Kudrman, J.; Svoboda, Milan; Kloc, Luboš

    43 2005, č. 1 (2005), s. 20-33 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/02/0608; GA AV ČR(CZ) IAA2041101; GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : 9-12%Cr steels * microstructure stability * creep behaviour * nonsteady creep loading Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  7. Tennessee Army National Guard (TNARNG) Range Expansion at Arnold Air Force Base, Tennessee. Environmental Assessment

    Science.gov (United States)

    2012-11-01

    E Barrens Confirmed: Primary CACTF Buffer, CCRC Pink Lady Slipper Cypripedium acaule - S-CE Oak forests and woodlands Confirmed: MK-19 Range...36 195 Manganese 181 181 Zinc 432 133 119 111 795 Source: TRI-DDS (https://dod-tridds.org/tri-web/) mm = millimeters Note: The following...expose buried archaeological or building materials such as chipped stone, tools, pottery, bone , historic crockery, glass or metal items, or should

  8. Bora and Aurora-A continue to activate Plk1 in mitosis

    Czech Academy of Sciences Publication Activity Database

    Bruinsma, W.; Macůrek, Libor; Freire, R.; Lindqvist, A.; Medema, R.H.

    2014-01-01

    Roč. 127, č. 4 (2014), s. 801-811 ISSN 0021-9533 R&D Projects: GA ČR GA13-18392S Grant - others:Ministerio de Economía y Competitividad(ES) SAF2010-22357; CONSOLIDER-Ingenio(NL) CDS2007-0015 Keywords : Aurora-A * Bora * Mitosis * Plk1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  9. Synthesis and biological evaluation of guanidino analogues of roscovitine

    Czech Academy of Sciences Publication Activity Database

    Dolečková, Iva; Česnek, Michal; Dračínský, Martin; Brynda, Jiří; Voller, J.; Janeba, Zlatko; Kryštof, Vladimír

    2013-01-01

    Roč. 62, April 2013 (2013), s. 443-452 ISSN 0223-5234 R&D Projects: GA MŠk 1M0508; GA ČR GAP305/12/0783 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Keywords : 6-Guanidinopurine * Olomoucine * Roscovitine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  10. Lomová houževnatost lité nízkolegované CrNiMo oceli s bainitickou strukturou

    Czech Academy of Sciences Publication Activity Database

    Holzmann, Miloslav; Kozák, Vladislav

    2004-01-01

    Roč. 42, č. 6 (2004), s. 384-398 ISSN 0023-432X R&D Projects: GA ČR GA106/02/0745; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : cast bainitic steel * fracture toughness * cleavage fracture stress Subject RIV: JG - Metallurgy Impact factor: 1.056, year: 2004

  11. Networks for the weak topology of Banach and Fréchet spaces

    Czech Academy of Sciences Publication Activity Database

    Gabriyelyan, S.; Kąkol, Jerzy; Kubiś, Wieslaw; Marciszewski, W.

    2015-01-01

    Roč. 432, č. 2 (2015), s. 1183-1199 ISSN 0022-247X R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : Fréchet space * space of continuous functions * locally convex space Subject RIV: BA - General Mathematics Impact factor: 1.014, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022247X15006836

  12. Investigation of Strouhal numbers of iced cable models of cable-supported bridges with respect to angle of wind attack

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Tatara, M.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Marušić, A.

    2015-01-01

    Roč. 112, 2-B (2015), s. 417-432 ISSN 1897-628X R&D Projects: GA MŠk(CZ) LO1219; GA MPO(CZ) FR-TI3/654 Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JN - Civil Engineering http://suw.biblos.pk.edu.pl/resources/i5/i6/i6/i8/i4/r56684/GorskiP_InvestigationsStrouhal.pdf

  13. Synergy between pathogen release and resource availability in plant invasion

    Czech Academy of Sciences Publication Activity Database

    Blumenthal, D.; Mitchell, C. E.; Pyšek, Petr; Jarošík, Vojtěch

    2009-01-01

    Roč. 106, č. 19 (2009), s. 7899-7904 ISSN 0027-8424 R&D Projects: GA MŠk LC06073 Grant - others:Evropská komise(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * enemy release * resource availability Subject RIV: EG - Zoology Impact factor: 9.432, year: 2009

  14. 77 FR 45539 - Great Lakes Pilotage Rates-2013 Annual Review and Adjustment

    Science.gov (United States)

    2012-08-01

    ... enclose a stamped, self-addressed postcard or envelope. We will consider all comments and material... if necessary. 46 U.S.C. 9303(f). The Secretary's duties and authority under the Act have been... Payroll taxes 0 0 0 Other 1,432 1,130 2,562 Total other pilotage costs 238,027 187,857 425,884 Pilot Boat...

  15. The Frölicher–Nijenhuis bracket and the geometry of G_2-and Spin(7)-manifoldser

    Czech Academy of Sciences Publication Activity Database

    Kawai, K.; Le, Hong-Van; Schwachhöfer, L.

    2018-01-01

    Roč. 197, č. 2 (2018), s. 411-432 ISSN 0373-3114 Institutional support: RVO:67985840 Keywords : Frölicher-Nijenhuis backet * G2 manifold * Fernández classification Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.864, year: 2016 https://link.springer.com/ article /10.1007%2Fs10231-017-0685-9

  16. Structure changes in two chosen metallic materials exposed to molten LiF-NaF eutectic mixture – model of corrosion behaviour

    Czech Academy of Sciences Publication Activity Database

    Král, Lubomír; Čermák, Jiří; Matal, O.; Šimo, T.; Nesvadba, L.; Jílek, M.

    2009-01-01

    Roč. 47, č. 2 (2009), s. 63-73 ISSN 0023-432X R&D Projects: GA MPO 2A-1TP1/067 Institutional research plan: CEZ:AV0Z20410507 Keywords : steels and nickel alloys * corrosion * diffusion Subject RIV: JF - Nuclear Energetics Impact factor: 1.345, year: 2007 http://www.kovmat.sav.sk/abstract.php?rr=47&cc=2&ss=63

  17. Code Pulse: Software Assurance (SWA) Visual Analytics for Dynamic Analysis of Code

    Science.gov (United States)

    2014-09-01

    4.3.2. We’ve long been adopters of agile methodologies in our software development practices and fol- lowed a Scrum -like process for Code Pulse...Design Prototype Although we’re strong proponents of leveraging agile and iterative methodologies for software development, identifying the use...application including BodgeIt, WAVESEP, WebGoat, and Jen- kins. 4.4.2 Demonstrations and Evaluations Our agile development approach and close interaction

  18. A Methodology for Technology Characterization and Evaluation for Naval Ships

    Science.gov (United States)

    1985-06-01

    Comparison (Integrated vs Individual) Indice HSLA DKHS PDSS SUM INTEGR Displacement ELTJ -50.8 -432.8 -483.6 -489.1 Total Volume EFT ] -535 -31333...31868 -32195 Fuel Weight ELTJ -2.5 -155.5 -158.0 -163.6 V0 [KT] +0.05 -0.79 -0.74 -0.51 Seakeeping Rank -0.06 -1.01 -1.07 -0.81 Avg Acq Cost [$MJ +0.1

  19. Energy use in the U.S. steel industry: An historical perspective and future opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Stubbles, John [Steel Industry Consultant, Mason, OH (United States)

    2000-09-01

    Renowned industry expert Dr. John Stubbles has projected the energy savings that the U.S. steel industry could reasonably expect to achieve in the report, Energy Use in the U.S. Steel Industry: Historical Perspective and Future Opportunities (PDF 432 KB). The report examines the potential impacts of state-of-the-art technologies and operating practices, as well as structural changes in the industry itself.

  20. Nitrous Oxide Explosive Hazards

    Science.gov (United States)

    2008-05-01

    JC, Departement d’anesthesie- reanimation, CHU Angers, 49033 cedex 01, Angers, France , Ann Fr Anesth Reanim, pp 366-8, April 22, 2003. 8. “Some...Krisjansons, Doren E. Bollinger , and Rudolph Edse, ARL 62-431. September 1962. 21. “Detonability of Nitrous Oxide at Elevated Initial Pressures and...Temperatures”, James A Laughrey, Loren E. Bollinger , Rudolph Edse, ARL 62-432, September 1962. 22. “Investigation of Decomposition Characteristics

  1. Effect of grain refinement by ECAP on creep of pure Cu

    Czech Academy of Sciences Publication Activity Database

    Blum, W.; Dvořák, Jiří; Král, Petr; Eisenlohr, P.; Sklenička, Václav

    2014-01-01

    Roč. 590, JAN (2014), s. 423-432 ISSN 0921-5093 R&D Projects: GA ČR(CZ) GAP108/11/2260; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Cu * ECAP * Static recrystallization * Creep * Ductility * High-angle boundaries Subject RIV: JJ - Other Materials Impact factor: 2.567, year: 2014

  2. Spectral analysis of coniferous foliage and possible links to soil chemistry: Are spectral chlorophyll indices related to forest floor dissolved organic C and N?

    Czech Academy of Sciences Publication Activity Database

    Albrechtová, Jana; Seidl, Z.; Aitkenhead-Peterson, J. A.; Lhotáková, Z.; Rock, B. N.; Alexander, J.E.; Malenovský, Zbyněk; McDowell, W. H.

    2008-01-01

    Roč. 404, 2-3 (2008), s. 424-432 ISSN 0048-9697 R&D Projects: GA MŠk(CZ) ME 658 Grant - others:NSF(US) DEB108385 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60870520 Keywords : chlorophyll indexes * reflectance * DON and DOC Subject RIV: EF - Botanics Impact factor: 2.579, year: 2008

  3. Integrated Multivariate Health Monitoring System for Helicopters Main Rotor Drives: Development and Validation with In-Service Data

    Science.gov (United States)

    2014-10-02

    Speed, Roll Angle, Pitch Angle, True Airspeed, Radio Altitude, Vertical Speed, Normal Acceleration, Density Altitude, Tail Rotor Torque, Main Rotor...Torque, Roll Rate, Pitch Rate, Yaw Rate, Longi- tudinal Acceleration. It has been hypothesised that the accelerometric measure- ments are in some extent...integrated control process in the following way: 10 ANNUAL CONFERENCE OF THE PROGNOSTICS AND HEALTH MANAGEMENT SOCIETY 2014 432 ANNUAL CONFERENCE OF

  4. Planetary Gearbox Fault Diagnosis Using a Single Piezoelectric Strain Sensor

    Science.gov (United States)

    2014-12-23

    was used in this paper. For this type PGB, the number of teeth is linear to the radius of each gears pitch circle. This indicates that the gear ratio...10 2 216 24 10.67 6 20 4 432 48 21.33 12 30 6 648 72 32 18 40 8 864 96 42.67 24 50 10 1080 120 53.33 30 * All the values are in unit of Hz. 3.2

  5. The 16th IFAC Workshop on Control Applications of Optimization

    Science.gov (United States)

    2015-10-09

    of Guidance, Control and Dynamics, 25, 425 - 432 . Shinar, J. (1981). Solution techniques for realistic pursuit- evasion games. In C. Leondes (ed...considered here consists of two orthogonal gimbals allowing two rotations in pitch and yaw, see Fig. 1. These two rotations are supposed to isolate the...to be decoupled. Thus, only the rotati :m in pitch is studied in the sequel. The block diagram in Fig. 2 shm..-s the model d the system used for

  6. An Integrated System for Wildlife Sensing

    Science.gov (United States)

    2014-08-14

    meters / second Compass 92 Orientation relative to magnetic north, plus pitch and roll angles degrees Figure 8. Coordinate reference frame for...following format: 13 Time stamp, azimuth, pitch , roll, Azimuth is the angle between the magnetic north direction and the y axis of the Android device...Document Number 432 -BHM0-15-10, Revision 110, March 2013. Available on-line (accessed April 2014): http://support.flir.com/DocDownload/Assets/87

  7. Evaluation of Novel Polyunsaturated Fatty Acid Derived Lipid Mediators of Inflammation to Ameliorate the Deleterious Effects of Blast Overpressure on Eye and Brain Visual Processing Centers in Rats

    Science.gov (United States)

    2014-10-01

    animal was lost to histopathology, due to its unexpected death shortly after being ERG tested for the final time. A total of 108 eye and 432 brain...Moderate 5 = Severe 6 = Catastrophic ( pitch black) Judged by intensity of silver stain coloration * * * * Efficacy Order Right: RVD1 > PDX...PDX SHAM + RVD1 Brain optic tracts Brain optic tract injury scoring scale: 1 = None 2 = Slight 3 = Mild 4 = Moderate 5 = Severe 6 = Catastrophic ( pitch

  8. Hypertension in Mexican adults: results from the National Health and Nutrition Survey 2006 Hipertensión en adultos mexicanos: resultados de la Encuesta Nacional de Nutrición y Salud 2006

    OpenAIRE

    Simón Barquera; Ismael Campos-Nonato; Lucía Hernández-Barrera; Salvador Villalpando; César Rodríguez-Gilabert; Ramón Durazo-Arvizú; Carlos A Aguilar-Salinas

    2010-01-01

    OBJECTIVE: To describe the prevalence of hypertension among Mexican adults, and to compare to that observed among Mexican-Americans living in the US. MATERIAL AND METHOD: The primary data source came from adults (>20 years) sampled (n=33366) in the Mexican National Health and Nutrition Survey 2006 (ENSANUT 2006). Hypertension was defined when systolic blood pressure was >140 and/or diastolic was >90 or patients previously diagnosed. RESULTS: A total of 43.2% of participants were classified as...

  9. Brane-world cosmology and inflation

    Indian Academy of Sciences (India)

    A Lukas and D Skinner, J. High Energy Phys. 0109, 020 (2001). M C Bento, O Bertolami and A A Sen, Phys. Rev. D67, 063511 (2003). [8] J Garriga and M Sasaki, Phys. Rev. D62, 043523 (2000). [9] K Koyama and J Soda, Phys. Lett. B483, 432 (2000). [10] S Kanno, M Sasaki and J Soda, Prog. Theor. Phys. 109, 357 (2003).

  10. Genetics Home Reference: generalized pustular psoriasis

    Science.gov (United States)

    ... 2015 Apr;135(4):1067-70.e9. doi: 10.1016/j.jaci.2014.09.043. Epub 2014 Nov ... 2012 May 4;90(5):796-808. doi: 10.1016/j.ajhg.2012.03.013. Epub 2012 Apr ... 2011 Sep 9;89(3):432-7. doi: 10.1016/j.ajhg.2011.07.022. Epub 2011 Aug ...

  11. Sphaeromyxa artedielli sp. n. (Myxozoa: Sphaeromyxidae), a parasite of sculpins (Cottidae) in northern Norway

    Czech Academy of Sciences Publication Activity Database

    Karlsbakk, E.; Bårdsgjære Einen, A.C.; Bartošová, Pavla

    2013-01-01

    Roč. 60, č. 5 (2013), s. 425-432 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GPP506/11/P724 Institutional support: RVO:60077344 Keywords : Myxosporeans * marine fish * new species * Artediellus atlanticus * Triglops murrayi * SSU rRNA gene sequences * pseudogene * northern Atlantic Ocean * Sphaeromyxa balbianii Subject RIV: EE - Microbiology, Virology Impact factor: 1.211, year: 2013

  12. Reproductive biology of the Sompat grunt, Pomadasys jubelini ...

    African Journals Online (AJOL)

    SARAH

    2013-12-30

    Dec 30, 2013 ... Ocean.Fish.Bull.107: 420-432. Sylla, S., B.C. Atsé and N.J. Kouassi, 2009. Stratégie de reproduction du Carangidae Trachinotus teraia Cuvier, 1832 dans la lagune Ebrié (Côte d'Ivoire).Sc.Nat., 6 (1) : 83 - 94. Vazzoler, A.E.A.M, 1996. Biologia da reproducão de. Peixes Teleósteos. Teoria e prática. Maringá,.

  13. Plasma spraying of Fe-Cr-Al alloy powder

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Leitner, J.; Kolman, Blahoslav Jan; Písačka, Jan; Schneeweiss, Oldřich

    2008-01-01

    Roč. 46, č. 1 (2008), s. 17-25 ISSN 0023-432X R&D Projects: GA AV ČR IAA1041404 Institutional research plan: CEZ:AV0Z20430508; CEZ:AV0Z20410507 Keywords : Fe-Cr-Al alloy powder * plasma spraying * oxidation * vaporization * composition changes Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.345, year: 2007

  14. Isothermal oxidation of metallic coatings deposited by a water-stabilized plasma gun

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Nop, P.; Kopřiva, P.; Kolman, Blahoslav Jan; Dubský, Jiří

    2006-01-01

    Roč. 44, č. 1 (2006), s. 41-48 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/03/0710 Institutional research plan: CEZ:AV0Z20430508 Keywords : plasma spraying * metallic coatings * oxidation tests * oxidation kinetics * oxide structure * element distribution Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.138, year: 2006

  15. Evaluation of two approaches to genotyping major histocompatibility complex class I in a passerine—CE-SSCP and 454 pyrosequencing

    Czech Academy of Sciences Publication Activity Database

    Promerová, Marta; Babik, W.; Bryja, Josef; Albrecht, Tomáš; Stuglik, M.; Radwan, J.

    2012-01-01

    Roč. 12, č. 2 (2012), s. 285-292 ISSN 1755-098X R&D Projects: GA AV ČR IAA600930608; GA ČR GA206/06/0851; GA ČR GAP505/10/1871 Institutional research plan: CEZ:AV0Z60930519 Keywords : avian * Carpodacus erythrinus * major histocompatibility complex * next-generation sequencing * scarlet rosefinch Subject RIV: EG - Zoology Impact factor: 7.432, year: 2012

  16. A mathematical model for the third-body concept

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; Petrov, A.

    2018-01-01

    Roč. 23, č. 3 (2018), s. 420-432 ISSN 1081-2865 R&D Projects: GA ČR(CZ) GA15-12227S Institutional support: RVO:67985840 Keywords : third-body * hysteresis operators * variational inequality Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 2.953, year: 2016 http://journals.sagepub.com/doi/abs/10.1177/1081286517732827

  17. Elevated Levels of Serum Tumor Markers CEA and CA15-3 Are Prognostic Parameters for Different Molecular Subtypes of Breast Cancer

    OpenAIRE

    Shao, Yingbo; Sun, Xianfu; He, Yaning; Liu, Chaojun; Liu, Hui

    2015-01-01

    Background & Aims The utility of measuring carcinoembryonic antigen(CEA) and cancer antigen 15-3 (CA15-3) levels in patients with breast cancer remains controversial. The present study aims to investigate the prognostic value of preoperative serum CEA and CA15-3 levels in breast cancer patients. Methods Serum preoperative CEA and CA 15-3 concentration levels were measured in a total of 432 breast cancer patients. The association of tumor markers levels with clinicopathological parameters and ...

  18. Model for Atmospheric Propagation of Spatially Combined Laser Beams

    Science.gov (United States)

    2016-09-01

    pp. 432–445, Aug. 2002. [10] D. R. Williams. (2016, May.). Earth fact sheet. NASA Goddard Space Flight Center . [Online]. Available: http...propagation model by generating WaveTrain results for all my test cases. I would also like to thank my wife, Amy, for supporting me throughout this journey ...The LaWS project started in 2010 [4] and was awarded to Kratos Defense and Security solutions by the Naval Surface Warfare Center . LaWS was designed

  19. High-spin states in the sup 9 sup 7 Tc nucleus

    CERN Document Server

    Bucurescu, D; Cata-Danil, I; Ivascu, M; Marginean, N; Rusu, C; Stroe, L; Ur, C A; Gadea, A

    2003-01-01

    High-spin states in the sup 9 sup 7 Tc nucleus have been studied by in-beam gamma-ray spectroscopy with the reaction sup 8 sup 2 Se( sup 1 sup 9 F,4n gamma) at 68 MeV incident energy. Excited states have been observed up to about 8 MeV excitation and spin 43/2 Planck constant. The observed level scheme is compared with results of shell model calculations. (orig.)

  20. Permanent Genetic Resources added to Molecular Ecology Resources Database 1 April 2012 – 31 May 2012

    Czech Academy of Sciences Publication Activity Database

    Mendel, Jan; Papoušek, Ivo; Marešová, Eva; Vetešník, Lukáš; Halačka, Karel; Nowak, M.; Čížková, Dagmar

    2012-01-01

    Roč. 12, č. 5 (2012), s. 972-974 ISSN 1755-098X R&D Projects: GA ČR GP206/09/P608 Institutional support: RVO:68081766 Keywords : Romanogobio * gudgeon * microsatellites * hybrid Subject RIV: EB - Genetics ; Molecular Biol ogy Impact factor: 7.432, year: 2012 http://tomato. biol .trinity.edu/manuscripts/12-5/mer-12-0021.pdf

  1. Novel porphyrin conjugates with a potent photodynamic antitumor effect: differential efficacy of mono- and bis-beta-cyclodextrin derivatives in vitro and in vivo

    Czech Academy of Sciences Publication Activity Database

    Králová, Jarmila; Synytsya, A.; Poučková, P.; Koc, Michal; Dvořák, Michal; Král, V.

    2006-01-01

    Roč. 82, č. 2 (2006), s. 432-438 ISSN 0031-8655 R&D Projects: GA ČR(CZ) GA301/01/0976; GA ČR(CZ) GA301/04/1315 Institutional research plan: CEZ:AV0Z50520514 Keywords : photodynamic therapy * porphyrin * tumor Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.061, year: 2006

  2. Analysis of water-soluble fraction of metals in atmospheric aerosols using aerosol counterflow two-jets unit and chemiluminescent detection

    Czech Academy of Sciences Publication Activity Database

    Vojtěšek, Martin; Mikuška, Pavel; Večeřa, Zbyněk; Křůmal, Kamil

    2012-01-01

    Roč. 92, č. 4 (2012), s. 432-449 ISSN 0306-7319 R&D Projects: GA MŽP SP/1A3/148/08; GA MŽP SP/1B7/189/07; GA MŽP SP/1A3/55/08 Institutional research plan: CEZ:AV0Z40310501 Keywords : atmospheric aerosols * metals * continuous aerosol collector Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.240, year: 2012

  3. Simultaneous oxidation and decarburization of cast iron powder during plasma spraying

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Schneeweiss, Oldřich; Chráska, Tomáš; Dubský, Jiří; Písačka, Jan

    2009-01-01

    Roč. 47, č. 1 (2009), s. 19-24 ISSN 0023-432X R&D Projects: GA AV ČR IAA1041404 Institutional research plan: CEZ:AV0Z20430508; CEZ:AV0Z20410507 Keywords : cast iron powder * plasma spraying * oxidation * decarburization Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.345, year: 2007 http://kovmat.sav.sk/abstract.php?rr=47&cc=1&ss=19

  4. A 3D Hydrodynamic Model for Heterogeneous Biofilms with Antimicrobial Persistence

    Science.gov (United States)

    2014-01-01

    treatment, all bacteria reproduce provided that the nutrient supply is sufficient. Since the susceptible cells are more metabolically active, their...there is little access to nutrient, since it is in a dormant state [28], saying metabolic inactive. The biomass flux is mainly at the top sur- face of... bacteria is less metabolical active [28], staying at the bottom of the biomass, where there is less nutrient. 4.3.2 Slow penetration effects due to

  5. Influence of yttrium content on the Ce.sub.Lu1./sub. and Ce.sub.Lu2./sub. luminescence characteristics in (Lu.sub.1-x./sub.Y.sub.x./sub.).sub.2./sub.SiO.sub.5./sub.: Ce single crystal

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Ren, G.; Horodysky, P.; Pazzi, G.P.; Kučerková, Romana

    2011-01-01

    Roč. 34, č. 2 (2011), s. 428-432 ISSN 0925-3467 R&D Projects: GA MŠk(CZ) ME10084; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * excited state ionization * temperature dependence * L(Y)SO: Ce Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.023, year: 2011

  6. Vliv podmínek šíření trhliny na dimenzi fraktálu lomové plochy

    Czech Academy of Sciences Publication Activity Database

    Němec, Ondřej; Dlouhý, Ivo; Strnadel, B.

    2003-01-01

    Roč. 41, č. 3 (2003), s. 177-192 ISSN 0023-432X R&D Projects: GA ČR GA106/01/0342; GA AV ČR IAA2041003 Institutional research plan: CEZ:AV0Z2041904 Keywords : tempered microalloyed steel * fractography * fracture toughness Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.563, year: 2003 http://www.kovmat.sav.sk/km3-03.htm

  7. Proceedings for the Annual Army Environmental Research and Development Symposium (14th) Held in Williamsburg, Virginia on 14-16 November 1989

    Science.gov (United States)

    1990-04-01

    Hallas, 1986. " Glyphosate -Degrading Microorganisms from Industrial Activated Sludge" Applied and Environmental Microbiology, vol 51 No 2 Feb 1986 p. 432...Terry M. and Laurence E. Hallas, 1986. " Glyphosate -Degrading Microorganisms from Industrial Activated Sludge" Applied and Environmental Microbiology...81 71 C (160 F) Neat No Grow Group Non-Meth Ambient Neat No 161 Intex Chemical 8798 82 C (180 F) Neat No McGean-Rohco 82 C (180 F) Neat No Cee Bee A

  8. Significance of epidermal growth factor receptor signaling for acquisition of meiotic and developmental competence in mammalian oocytes

    Czech Academy of Sciences Publication Activity Database

    Procházka, Radek; Blaha, Milan; Němcová, Lucie

    2017-01-01

    Roč. 97, č. 4 (2017), s. 537-549 ISSN 0006-3363 R&D Projects: GA MZe(CZ) QJ1510138; GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : amphiregulin * cumulus cells * epidermal growth factor receptor Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Reproductive biology (medical aspects to be 3) Impact factor: 3.432, year: 2016

  9. Fluctuations of pol I and fibrillarin contents of the nucleoli

    Czech Academy of Sciences Publication Activity Database

    Hornaceka, M.; Kováčik, L.; Mazel, T.; Cmarko, D.; Bártová, Eva; Raška, I.; Smirnov, E.

    2017-01-01

    Roč. 8, č. 4 (2017), s. 421-432 ISSN 1949-1034 R&D Projects: GA ČR GBP302/12/G157 Institutional support: RVO:68081707 Keywords : ribosomal-rna genes * transcription sites * human-lymphocytes Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 2.387, year: 2016

  10. Impact of poor muscle strength on clinical and service outcomes of older people during both acute illness and after recovery

    OpenAIRE

    Gariballa, Salah; Alessa, Awad

    2017-01-01

    Background Although Low muscle strength is an important predictor of functional decline in older people, however information on its impact on clinical and service outcomes in acute care settings is still lacking. The aim of this study is to measure the impact of low muscle strength on clinical and service outcomes in older adults during both acute illness and recovery. Methods Randomly selected 432 hospitalised older patients had their clinical characteristics and nutritional status assessed ...

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    We note that one may start from any of the above 12 cards and complete the Flush by taking two more on its right, such as. QJI0, 765, etc. In the case we start with 4 or 3, we may complete the Flush with 432 or 32A, respectively. But one cannot start from 2 and proceed because the combination 2AK is not allowed. Hence 2 ...

  12. High Temperature Creep of an Al-8,5Fe-1,3V-1,7Si Alloy

    Czech Academy of Sciences Publication Activity Database

    Kuchařová, Květa; Zhu, S. J.; Čadek, Josef

    2002-01-01

    Roč. 40, č. 2 (2002), s. 69-84 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Al-8,5Fe 1,3V 1,7Si alloy * creep behavior , true threshold stress Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

  13. Effects of rind removal on physicochemical quality characteristics of fresh-cut watermelon [Citrus lanatus (Thunb) Matsum & Nakai] during cold storage

    NARCIS (Netherlands)

    Petrou, P.; Soteriou, G.; Schouten, R.E.; Kyriacou, C.

    2013-01-01

    The impact of removing the rind from fresh-cut watermelon slices was assessed on the quality of the product during storage at 4 °C for 9 days. Flesh lycopene declined from 55.4 to 47.9 mg kg-1 f.w. and colour lightness (L*) increased from 43.2 to 45.8 after 2 days of storage. Initial heart and

  14. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2017-11-01

    Nov 1, 2017 ... 44.9. Marital Status. Married. 201. 56.8. Unmarried. 153. 43.2. Educational status. Unable to read and write. 119. 33.6. Primary and secondary education. 143. 40.4. Tertiary Education. 92. 26. Occupation. Student. 105. 29.7. Farmer. 59. 16.7. Housewife. 90. 25.4. Government and private employee. 76. 21.5.

  15. Human Behavior Representation in Constructive Simulation (La representation du comportement humain dans la simulation constructive)

    Science.gov (United States)

    2009-09-01

    Attention 4-4 4.3 Models of Perception 4-5 4.3.1 Stimulus Properties 4-5 4.3.2 Physiological Properties 4-6 4.3.3 Psychological Properties 4-7...HPM Human Performance Model/Modeling HQ HeadQuarters HTA Hierarchical Tasks Analysis HUM HUMan Resources and Performance (TTCP) IA Intelligent...Program PAC Personality-based Architecture for Cognition PAM Preparatory Attentional Memory PFC Problem Focused Coping PM Perceptual-Motor

  16. Extremely slow carbon diffusion in carbon-supersaturated surface of ferrite

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Král, Lubomír

    2014-01-01

    Roč. 52, č. 3 (2014), s. 125-133 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/11/0148; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : carbon diffusion * carbon supersaturation * diffusion barrier * ferrite * P91 Subject RIV: BJ - Thermodynamics Impact factor: 0.406, year: 2014

  17. U.S. Policy and Latin America in the 1990’s

    Science.gov (United States)

    1992-01-01

    Herrera, Genaro. Pinochet ; The Politics of Power. Boston: Unwin, 1988. (F 3100 .A73413 1988) Atkins, G. Pope. Latin America in the International...Varas, Augusto . Democracy under Siege: New Military Power in Latin America. Contributions in Military Studies 84. New York: Greenwood, 1989. (F...1414.2 .D432 1989) Varas, Augusto . Hemisoheric Security and U.S. Policy in Latin America. Boulder: Westview, 1989. (UA 21 .H39 1989) Varas, Augusto

  18. Sequencing wheat chromosome arm 7BS delimits the 7BS/4AL translocation and reveals homoeologous gene conservation

    Czech Academy of Sciences Publication Activity Database

    Berkman, P.J.; Skarshewski, A.; Manoli, S.; Lorenc, M. T.; Stiller, J.; Smits, L.; Lai, K.; Cambell, E.; Kubaláková, Marie; Šimková, Hana; Batley, J.; Doležel, Jaroslav; Hernandez, P.; Edwards, D.

    2012-01-01

    Roč. 124, č. 3 (2012), s. 423-432 ISSN 0040-5752 R&D Projects: GA MŠk(CZ) LC06004 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : POLYPLOID WHEAT * BIN MAP * BRACHYPODIUM-DISTACHYON Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.658, year: 2012

  19. Civilian First Responder Decontamination Equipment Characteristics Survey Results

    Science.gov (United States)

    2010-01-01

    lingering effects to themselves Harmful to eyes Harsh decon solutions Having to wait their turn for decon to occur, no " instant gratification " or...The survey questions as posted on the internet are provided in Appendix B. 15 4.3.2 Administer Survey. The RKB, a national information resource...was active 20 August to 9 October 2007. Appendix B shows the survey as it was posted on RKB. The internet was used as the sole method of eliciting

  20. Únavové poškození v aluminium lithiových slitinách, Část II. Iniciace a šíření krátkých trhlin

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav; Man, Jiří; Obrtlík, Karel

    2001-01-01

    Roč. 39, č. 3 (2001), s. 179-189 ISSN 0023-432X R&D Projects: GA ČR GA106/95/1529; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium-lithium alloy * fatigue crack initiation * short crack growth Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.343, year: 2001

  1. Fighter Aircraft OBIGGS (On-Board Inert Gas Generator System) Study. Volume 2

    Science.gov (United States)

    1987-06-01

    I. Fungus Grouts Fungi ATCC No. USDA No. Aspergillus niger 9642 386 Aspergillus flavus 9643 380 Aspergillus versicolor 11730 432 Penicillium...and molecular sieve air separation modules were evaluated. An advanced technology permeable membrane air separation module was the best choice for ATF...34o Production quantity "o Prototype quantity "o Weight "o Volume "o Next higher assembly integration factors "o Electronic "o Structural "o Operating

  2. The Use of Adenosine Agonists to Treat Nerve Agent-Induced Seizure and Neuropathology

    Science.gov (United States)

    2016-09-01

    NUMBER 6. AUTHOR(S) Thomas, TP and Shih, T-M. 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S...AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER US Army Medical Research Institute of Chemical Defense ATTN: MCMR-CDR-P 2900...effects of adenosine by caffeine or 8-(p-sulfophenyl)theophylline. The Journal of Pharmacology and Experimental Therapeutics. 240: 428-432. 44

  3. Neutron energy distribution function reconstructed from time-of-flight signals in deuterium gas-puff Z-pinch

    Czech Academy of Sciences Publication Activity Database

    Klír, D.; Kravárik, J.; Kubeš, J.; Rezac, K.; Ananev, S.S.; Bakshaev, Y. L.; Blinov, P. I.; Chernenko, A. S.; Kazakov, E.D.; Korolev, V. D.; Ustroev, G. I.; Juha, Libor; Krása, Josef; Velyhan, Andriy

    2009-01-01

    Roč. 37, č. 3 (2009), s. 425-432 ISSN 0093-3813 R&D Projects: GA MŠk(CZ) LC528; GA MŠk LA08024 Grant - others:IAEA(XE) RC 14817 Institutional research plan: CEZ:AV0Z10100523 Keywords : deuterium * fusion reaction * gas puff * Monte Carlo reconstruction * neutron energy spectra * neutron s * Z-pinch Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.043, year: 2009

  4. Knockdown of proteins involved in iron metabolism limits tick reproduction and development

    Czech Academy of Sciences Publication Activity Database

    Hajdušek, O.; Sojka, Daniel; Kopáček, Petr; Burešová, Veronika; Franta, Zdeněk; Šauman, Ivo; Winzerling, J.; Grubhoffer, L.

    2009-01-01

    Roč. 106, č. 4 (2009), s. 1033-1038 ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC06009; GA MŠk LC07032; GA AV ČR IAA600220603 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50070508 Keywords : tick ferritin * iron metabolism * RNA interference Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.432, year: 2009

  5. Aphid parasitoids (Hymenoptera, Braconidae, Aphidiinae) and their associations related to biological control in Brazil

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Sampaio, M. V.; Bueno, V. H. P.

    2007-01-01

    Roč. 51, č. 1 (2007), s. 107-118 ISSN 0085-5626 R&D Projects: GA AV ČR IBS5007102 Grant - others:FAO programmers(BR) TCP/BRA/8908 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphid * host range * insect-plant interactions Subject RIV: EH - Ecology, Behaviour Impact factor: 0.432, year: 2007

  6. Sergeia podlipaevi gen. nov., sp. nov. (Trypanosomatidae, Kinetoplastida), a parasite of biting midges (Ceratopogonidae, Diptera)

    Czech Academy of Sciences Publication Activity Database

    Svobodová, M.; Zídková, L.; Čepička, I.; Oborník, Miroslav; Lukeš, Julius; Votýpka, Jan

    2007-01-01

    Roč. 57, č. 2 (2007), s. 423-432 ISSN 1466-5026 R&D Projects: GA MŠk(CZ) LC06009; GA MŠk 2B06129 Institutional research plan: CEZ:AV0Z60220518 Keywords : Culicoides * Trypanosoma * trypanosomatids * transmission * biting midges * 18S SSU * GAPDH Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.384, year: 2007

  7. Search for doubly-charged Higgs boson production at HERA

    Czech Academy of Sciences Publication Activity Database

    Aktas, A.; Andreev, V.; Anthonis, A.; Cvach, Jaroslav; Reimer, Petr; Zálešák, Jaroslav

    2006-01-01

    Roč. 638, - (2006), s. 432-440 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LC527; GA MŠk(CZ) 1P05LA259 Institutional research plan: CEZ:AV0Z10100502 Keywords : HI experiment * ep scattering * Higgs boson Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 5.043, year: 2006

  8. Effect of Tb and Al substitution within the rare earth and cobalt sublattices on magnetothermal properties of Dy.sub.0.5./sub.Ho.sub.0.5./sub.Co.sub.2./sub.

    Czech Academy of Sciences Publication Activity Database

    Chzhan, V.B.; Tereshina, Evgeniya; Mikhailova, A.B.; Politova, G.A.; Tereshina, I. S.; Kozlov, V.I.; Ćwik, J.; Nenkov, K.; Alekseeva, O.A.; Filimonov, A.V.

    2017-01-01

    Roč. 432, June (2017), s. 461-465 ISSN 0304-8853 R&D Projects: GA ČR GA16-03593S Institutional support: RVO:68378271 Keywords : rare-earth intermetallics * laves phase * heat capacity * magnetocaloric effect Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  9. Editorial

    OpenAIRE

    Sabry, Tarik

    2004-01-01

    Interest in the phenomenon of migration from developing countries to Western industrialised societies is not a new one. In fact, scholarly contributions to the compendium of research and analysis dealing with the subject of migration, its mechanics, causes and consequences have now been accumulating for more than a century. The result is a compendium with a ‘largely fragmented set of theories that have developed largely in isolation from one another’ (Massey, 1996: 432). Examples include: neo...

  10. Abrasive wear of WC-NiMoCrFeCo thermally sprayed coatings in dependence on different types of abrasive sands

    Czech Academy of Sciences Publication Activity Database

    Kašparová, M.; Zahálka, F.; Houdková, Š.; Ctibor, Pavel

    2010-01-01

    Roč. 48, č. 1 (2010), s. 75-85 ISSN 0023-432X R&D Projects: GA AV ČR 1QS200430560 Institutional research plan: CEZ:AV0Z20430508 Keywords : WC-Hastelloy * abrasive wear * Al2O3 sand * SiO2 sand * braun size * abrasive efficiency Subject RIV: JG - Metallurgy Impact factor: 0.471, year: 2010 http://kovmat.sav.sk/abstract.php?rr=48&cc=1&ss=73

  11. 49 CFR 172.400 - General labeling requirements.

    Science.gov (United States)

    2010-10-01

    ... B) POISON 172.430 6.2 INFECTIOUS SUBSTANCE 1 172.432 7 (see § 172.403) RADIOACTIVE WHITE-I 172.436 7... 172.411 1.6 EXPLOSIVES 1.6 172.411 2.1 FLAMMABLE GAS 172.417 2.2 NONFLAMMABLE GAS 172.415 2.3 POISON...)) POISON INHALATION HAZARD 172.429 6.1(other than material poisonous by inhalation) POISON 172.430 6.1...

  12. The effect of novel [3-fluoro-(2-phosphonoethoxy)propyl]purines on the inhibition of Plasmodium falciparum, Plasmodium vivax and human hypoxanthine-guanine-(xanthine) phosphoribosyltransferases

    Czech Academy of Sciences Publication Activity Database

    Baszczyňski, Ondřej; Hocková, Dana; Janeba, Zlatko; Holý, Antonín; Jansa, Petr; Dračínský, Martin; Keough, D. T.; Guddat, L. W.

    2013-01-01

    Roč. 67, Sep (2013), s. 81-89 ISSN 0223-5234 R&D Projects: GA MV VG20102015046; GA ČR GAP207/11/0108 Grant - others:National Health and Madical Research Council(AU) 1030353; National Health and Medical Research Council(AU) 569703 Institutional support: RVO:61388963 Keywords : Malaria * nucleoside phosphonates * fluorine * purines * FPMP Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.432, year: 2013

  13. Synthesis and in vitro biological evaluation of 2,6,9-trisubstituted purines targeting multiple cyclin-dependent kinases

    Czech Academy of Sciences Publication Activity Database

    Zatloukal, M.; Jorda, Radek; Gucký, T.; Řezníčková, Eva; Voller, Jiří; Pospíšil, T.; Malínková, V.; Adamcová, H.; Kryštof, Vladimír; Strnad, Miroslav

    2013-01-01

    Roč. 61, SI (2013), s. 61-72 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : Cyclin-dependent kinase * Inhibitor * Roscovitine Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.432, year: 2013

  14. Adaptation to chronic continuous hypoxia potentiates Akt/HK2 anti-apoptotic pathway during brief myocardial ischemia/reperfusion insult

    Czech Academy of Sciences Publication Activity Database

    Kolář, D.; Grešíková, M.; Wasková-Arnoštová, P.; Elsnicová, B.; Kohutová, J.; Horníková, D.; Vebr, P.; Neckář, Jan; Blahová, T.; Kašparová, D.; Novotný, J.; Kolář, František; Nováková, O.; Žurmanová, J.M.

    2017-01-01

    Roč. 432, 1-2 (2017), s. 99-108 ISSN 0300-8177 R&D Projects: GA ČR(CZ) GA13-10267S Institutional support: RVO:67985823 Keywords : heart * hypoxia * ischemia/reperfusion * hexokinase * protein kinase B/Akt * mitochondria Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery OBOR OECD: Biochemistry and molecular biology Impact factor: 2.669, year: 2016

  15. Functional diversity of staphylinid beetles (Coleoptera: Staphylinidae) in maize fields: testing the possible effect of genetically modified, insect resistant maize

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Zdeňka; Skoková Habuštová, Oxana; Boháč, J.; Sehnal, František

    2016-01-01

    Roč. 106, č. 4 (2016), s. 432-445 ISSN 0007-4853 R&D Projects: GA MZe QH91093 Grant - others:GA JU(CZ) 038/2014/P; project MOBILITY(CZ) 7AMB14SK096 Program:7A Institutional support: RVO:60077344 Keywords : GM crops * Bt maize * Cry3Bb1 Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.758, year: 2016

  16. Residual stress determination by neutron diffraction in a car gear-shaft made of 20NiCrMo2 alloyed case hardening steel

    Czech Academy of Sciences Publication Activity Database

    Rogante, M.; Mazzanti, M.; Mikula, Pavol; Vrána, Miroslav

    2012-01-01

    Roč. 50, č. 4 (2012), s. 213-220 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP204/12/1360 Institutional support: RVO:61389005 Keywords : 20NiCrMo2 steel * gear-shaft * caser hardening * residual stress * neutron diffraction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.687, year: 2012

  17. Environmental performance policy indicators for the public sector: The case of the defence sector

    OpenAIRE

    Ramos, Tomás B.; Alves, Inês; Subtil, Rui; Melo, João Joanaz de

    2007-01-01

    Journal of Environmental Management, nº 82 p. 410–432 The development of environmental performance policy indicators for public services, and in particular for the defence sector, is an emerging issue. Despite a number of recent initiatives there has been little work done in this area, since the other sectors usually focused on are agriculture, transport, industry, tourism and energy. This type of tool can be an important component for environmental performance evaluation at polic...

  18. Effect of Brief Exposure to Paraquat on Some Blood Parameters of ...

    African Journals Online (AJOL)

    Clarias gariepinus (mean weight, 100.34 ± 8.13g SD; mean total length, 19.02 ± 4.32 cm SD) were exposed (four fish/tank) to 0, 1.25, 2.50 and 5.00 mgl-1 paraquat solution in triplicate in rectangular glass aquaria (60.9 x 30.4 x 30.4 cm3) under a static condition for 72 hours to determine the effect of exposure on the ...

  19. AcEST: DK951326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6206|ENOX2_HUMAN Ecto-NOX disulfide-thiol exchanger 2 OS=Ho... 31 7.0 sp|Q13474|DRP2_HUMAN Dystrophin... + +G +P +Q+L + +Q L VQEEY++++A LEK Sbjct: 432 VELLKQEQGKVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELEK 484 >sp|Q13474|DRP2_HUMAN Dystro...phin-related protein 2 OS=Homo sapiens GN=DRP2 PE=2 SV=2 Length = 957 Score = 30.8

  20. Social Anxiety and Internet Addiction among Rural Left-behind Children: The Mediating Effect of Loneliness

    OpenAIRE

    REN, Yujia; YANG, Jiao; LIU, Liqiong

    2017-01-01

    Background: At present, the mental health of rural left-behind children is a major social problem in China. Internet addiction, social anxiety, and loneliness are common psychological and behavioral problems among rural left-behind children, but the relationships among these issues have not been clearly identified. Methods: A total of 432 junior year 1 to senior year 3 students were randomly selected from 2 rural middle schools in Hunan Province of China as the research subjects. The Internet...

  1. Компонентный состав эфирного масла полыни австрийской, произрастающей в Ставропольском крае

    OpenAIRE

    Коновалов, Д.; Коновалов, Ю.

    2006-01-01

    The componental structure of essential oil of Artemisia austriaca Jacq. growing in Stavropol region was investigated by GC-MS method. 31 compounds are identified. The basic components are: a-thujone (55,26%), eucalyptol (12,01%), b-thujone (7,21%), terpineol-4 (4,32%), (+)-camphor (4,11%), (S)-cis-verbenol (2,68%), borneol (1,94%), o-cymene (1,72%), (-)-cis-sabinol (1,25%).

  2. X-HALE: The Development of a Research Platform for the Validation of Nonlinear Aeroelastic Codes

    Science.gov (United States)

    2011-03-01

    instead using disposable acrylic forms to sand the airfoils into shape. These acrylic forms are cut using a waterjet and provide a more precise airfoil...41 4.3.1 Wing Box Strain Gauge Installation and Foam Cutting ....................... 41 4.3.2 Wing Box...HALE’s Composite Wing without Joiner Blocks [5] 4.3.1 Wing Box Strain Gauge Installation and Foam Cutting Figure 25 shows the expanded wing structure of

  3. Mechanisms of nuclear lamina growth in interphase

    Czech Academy of Sciences Publication Activity Database

    Zhironkina, O.A.; Kurchashova, S.Y.; Pozharskaia, V.A.; Cherepanynets, V.D.; Strelkova, O.S.; Hozák, Pavel; Kireev, I.I.

    2016-01-01

    Roč. 145, č. 4 (2016), s. 419-432 ISSN 0948-6143 R&D Projects: GA ČR GA16-03403S Grant - others:Russian Fund for Basic Research(RU) 13-04-00885; Russian Fund for Basic Research(RU) 15-54-78077 Institutional support: RVO:68378050 Keywords : Nuclear lamina * Microdomains * Interphase * Nucleus * DNA replication * Cell cycle Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.553, year: 2016

  4. Chemical composition, molecular weight distribution, secondary structure and effect of NaCl on functional properties of walnut (Juglans regia L) protein isolates and concentrates

    OpenAIRE

    Mao, Xiao-Ying; Hua, Yu-Fei

    2012-01-01

    Chemical composition, molecular weight distribution, secondary structure and effect of sodium chloride concentration on functional properties of walnut protein isolates, concentrates and defatted walnut flour were study. Compared with walnut protein concentrates (75.6%) and defatted walnut flour (52.5%), walnut protein isolates contain a relatively high amount of protein (90.5%). The yield of walnut protein isolates and concentrates was 43.2% and 76.6%, respectively. In molecular weight distr...

  5. The Frölicher–Nijenhuis bracket and the geometry of G_2-and Spin(7)-manifoldser

    Czech Academy of Sciences Publication Activity Database

    Kawai, K.; Le, Hong-Van; Schwachhöfer, L.

    2018-01-01

    Roč. 197, č. 2 (2018), s. 411-432 ISSN 0373-3114 Institutional support: RVO:67985840 Keywords : Frölicher-Nijenhuis backet * G2 manifold * Fernández classification Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.864, year: 2016 https://link.springer.com/article/10.1007%2Fs10231-017-0685-9

  6. Soutien organisationnel de la phase 2 de l'ITT : Grupo de Análisis ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au cours de cette période, le GRADE devrait devenir un centre d'études et de recherches de première classe et être plus présent à l'échelle locale, régionale et internationale. Projet nᵒ. 107865. État du projet. Actif. Durée. 54 mois. Agent(e) responsable du CRDI. Antonio Romero. Financement total. CAD$ 2,303,432. Pays.

  7. Applicability of empirical formulas and fractography for assessment of creep life and creep fracture modes of tempered martensitic 9%Cr steel

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Král, Petr; Kvapilová, Marie; Dvořák, Jiří

    2017-01-01

    Roč. 55, č. 2 (2017), s. 69-80 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA16-09518S; GA MŠk LM2015069 Institutional support: RVO:68081723 Keywords : P92 steel * mechanical characterisation * creep * plasticity * fracture * electron microscopy Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 0.366, year: 2016

  8. High-temperature low-cycle fatigue behaviour of HIP treated and untreated superalloy MAR-M247

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel; Čelko, L.

    2016-01-01

    Roč. 54, č. 6 (2016), s. 471-481 ISSN 0023-432X R&D Projects: GA TA ČR(CZ) TA04011525; GA ČR(CZ) GA15-20991S Institutional support: RVO:68081723 Keywords : hot isostatic pressing * high-temperature low cycle fatigue * fatigue life curves * Ni-based superalloy * dislocation structures * planar bands Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.366, year: 2016

  9. Design of Alpha Voltaic Power Source Using Americium 241 (241Am) and Diamond with a Power Density of 10 mW/cm3

    Science.gov (United States)

    2017-10-19

    detectors) is one of the most widely available and affordable sources of alpha radiation. 241Am has a half-life of 432 years, enabling long- lived ...mobility. The next step will be to fabricate a diamond vertical or quasi-vertical diode and irradiate it. This experiment will give important insights for...distribution is unlimited. NOTICES Disclaimers The findings in this report are not to be construed as an official Department of the Army

  10. Kloakering i landbruget og ved mindre beboelser i landzone

    DEFF Research Database (Denmark)

    Petersen, H.W.

    Publikationen er beregnet til at bruges sammen med DIF's "Norm for afløbsinstallationer", DS 432, og "Norm for mindre afløbsanlæg med nedsivning", DS 440. Den giver vejledning i planlægning og udførelse af afløbsanlæg med rørledninger i jord for ajle og spildevand ført til opbevaringstank eller v...

  11. Evaluation de la satisfaction des patients d'un service d'urgences ...

    African Journals Online (AJOL)

    Objectif: évaluer la satisfaction des patients dans le service des urgences. Méthodes : étude descriptive transversale à passage unique par questionnaire, de janvier à avril 2010. Résultats : 338 patients d'âge moyen 44,9 ans ont été inclus. La majorité (51%) était analphabète;43,2% agriculteurs ou du secteur informel.

  12. Anatomy of a Hostage Rescue: What Makes Hostage Rescue Operations Successful?

    Science.gov (United States)

    2004-09-01

    Huth, Paul K. (1988). Extended Deterrence and the Prevention of War. New Haven, Connecticut: Yale University Press. Jarín, Edgardo Mercado (2001...La Revolución Geoestratégica. Lima, Peru: Centro de Altos Estudios Militares (CAEN) 99-12-432. Katz, Samuel M. (1992). The Elite. New York...Upper Saddle River, N.J.: Prentice Hall. Murakami, Yusuke (1999). El Espejo del Otro. Lima, Peru: Instituto de Estudios Peruanos, IEP. 183

  13. Structures of a novel phosphoric triamide and its organotin(IV) complex

    Czech Academy of Sciences Publication Activity Database

    Shariatinia, Z.; Mirhosseini Mousavi, H.S.; Bereciartua, P.J.; Dušek, Michal

    2013-01-01

    Roč. 745, NOV (2013), s. 432-438 ISSN 0022-328X Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:68378271 Keywords : organotin(IV) complex * phosphoric triamide * X-ray crystallography * hydrogen bond * nanoparticles * NMR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.302, year: 2013

  14. Inside-out signaling promotes dynamic changes in the carcinoembryonic antigen-related cellular adhesion molecule 1 (CEACAM1) oligomeric state to control its cell adhesion properties.

    Science.gov (United States)

    Patel, Prerna C; Lee, Hannah S W; Ming, Aaron Y K; Rath, Arianna; Deber, Charles M; Yip, Christopher M; Rocheleau, Jonathan V; Gray-Owen, Scott D

    2013-10-11

    Cell-cell contacts are fundamental to multicellular organisms and are subject to exquisite levels of control. The carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) can engage in both cis-homophilic (parallel) oligomerization and trans-homophilic (anti-parallel) binding. In this study, we establish that the CEACAM1 transmembrane domain has a propensity to form cis-dimers via the transmembrane-embedded (432)GXXXG(436) motif and that this basal state is overcome when activated calmodulin binds to the CEACAM1 cytoplasmic domain. Although mutation of the (432)GXXXG(436) motif reduced CEACAM1 oligomerization, it did not affect surface localization of the receptor or influence CEACAM1-dependent cellular invasion by the pathogenic Neisseria. The mutation did, however, have a striking effect on CEACAM1-dependent cellular aggregation, increasing both the kinetics of cell-cell association and the size of cellular aggregates formed. CEACAM1 association with tyrosine kinase c-Src and tyrosine phosphatases SHP-1 and SHP-2 was not affected by the (432)GXXXG(436) mutation, consistent with their association with the monomeric form of wild type CEACAM1. Collectively, our results establish that a dynamic oligomer-to-monomer shift in surface-expressed CEACAM1 facilitates trans-homophilic binding and downstream effector signaling.

  15. Association of CYP1B1 Polymorphisms with Breast Cancer: A Case-Control Study in the Han Population in Ningxia Hui Autonomous Region, P. R. China

    Science.gov (United States)

    Jiao, Haiyan; Liu, Chunlian; Guo, Weidong; Peng, Liang; Chen, Yintao; Martin, Francis L.

    2010-01-01

    Studies investigating possible associations between cytochrome P4501B1 (CYP1B1) polymorphisms and breast cancer risk have been inconsistent. We set out to ascertain whether there might be an association between polymorphisms in exon 2 (codon 119, G→T) and exon 3 (codon 432, G→C) of CYP1B1 and breast cancer in a Chinese Han population in the rural region of Ningxia. Using an allele-specific polymerase chain reaction method and direct DNA sequencing, the presence or absence of the two CYP1B1 polymorphisms was investigated. Genotype and allele frequencies were analyzed in breast cancer cases (n = 152) and healthy age-matched controls (n = 156). The odds ratio (OR) of 119G→T or 432G→C in breast cancer cases and controls was 3.3 (95% CI: 1.28 to 8.28) and 2.8 (95% CI: 1.04 to 7.51), respectively. In addition, the OR for people with both polymorphisms (119T and 432C) was 4.69 (95% CI: 1.97 to 11.19). Our results suggest that certain polymorphisms in the CYP1B1 gene might increase risk for breast cancer among Han Chinese, perhaps because they influence the efficiency of CYP1B1 bio-transformation of oestrogens or pro-carcinogens into DNA-reactive electrophiles that may act as cancer-initiating agents. PMID:20212917

  16. Degradation of tocopherols in rice bran oil submitted to heating at different temperatures.

    Science.gov (United States)

    Bruscatto, M H; Zambiazi, R C; Sganzerla, M; Pestana, V R; Otero, D; Lima, R; Paiva, F

    2009-10-01

    The objective of this study has been to evaluate the stability of alpha-, (gamma+beta)-, and delta-tocopherols in rice bran oil chemically refined submitted to heating in a heater without air circulation and shielded from light, at temperatures of 100 degrees C and 180 degrees C. The collection of samples took place after 48, 96, 144, 192, 240, 336, and 432 h of heating and were stored in amber-colored flasks and frozen (-18 degrees C). The analyses of tocopherols took place in accordance with the method by Chen and Bergman (2005), with slight modifications, utilizing a system of high efficiency system of liquid chromatography. It was observed that the alpha-tocopherol is present at higher concentration in rice bran oil (328.4 mg/kg), followed by (gamma+beta)-tocopherol (99.1 mg/kg), and delta-tocopherol (7.7 mg/kg). The alpha-tocopherol in rice bran oil submitted to 100 degrees C showed a reduction of 28.65% at the end of 432 h of heating whereas when submitted to 180 degrees C temperature; its reduction was of 100% at the end of 240 h of heating. The contents of (gamma+beta)- and delta-tocopherol in rice bran oil at the end of 432 h of heating at 100 degrees C was of 79.9 and 6.4 mg/100 g, respectively.

  17. The Vibrio cholerae Mrp system: cation/proton antiport properties and enhancement of bile salt resistance in a heterologous host.

    Science.gov (United States)

    Dzioba-Winogrodzki, Judith; Winogrodzki, Olga; Krulwich, Terry A; Boin, Markus A; Häse, Claudia C; Dibrov, Pavel

    2009-01-01

    The mrp operon from Vibrio cholerae encoding a putative multisubunit Na(+)/H(+) antiporter was cloned and functionally expressed in the antiporter-deficient strain of Escherichia coli EP432. Cells of EP432 expressing Vc-Mrp exhibited resistance to Na(+) and Li(+) as well as to natural bile salts such as sodium cholate and taurocholate. When assayed in everted membrane vesicles of the E. coli EP432 host, Vc-Mrp had sufficiently high antiport activity to facilitate the first extensive analysis of Mrp system from a Gram-negative bacterium encoded by a group 2 mrp operon. Vc-Mrp was found to exchange protons for Li(+), Na(+), and K(+) ions in pH-dependent manner with maximal activity at pH 9.0-9.5. Exchange was electrogenic (more than one H(+) translocated per cation moved in opposite direction). The apparent K(m) at pH 9.0 was 1.08, 1.30, and 68.5 mM for Li(+), Na(+), and K(+), respectively. Kinetic analyses suggested that Vc-Mrp operates in a binding exchange mode with all cations and protons competing for binding to the antiporter. The robust ion antiport activity of Vc-Mrp in sub-bacterial vesicles and its effect on bile resistance of the heterologous host make Vc-Mrp an attractive experimental model for the further studies of biochemistry and physiology of Mrp systems. Copyright 2008 S. Karger AG, Basel.

  18. Physical, Chemicals and Flavors of Some Varieties of Arabica Coffee

    Directory of Open Access Journals (Sweden)

    Yusianto .

    2014-08-01

    Full Text Available Export of Arabica coffee was 28,100 tons/year or 8.28% total export of Indonesian coffee, most of them are specialty coffee. Beside their origin, variety and determine the of physical, chemical and flavors characters. The promising clones or varieties i.e. BP 416A, BP 418A, BP 430A, BP 431A, BP 432A, BP 507A, BP 508A, BP 509A, BP 511A, BP 513A, BP 516A, BP 517A and BP 518A still not be determined their quality This research was conducted to analyze their physicals, chemicals and flavors during 2 periods of harvesting (2004 and 2005, using AS 1, S 795 and USDA 762 as the control. Mature coffee berry was harvested, sorted manually, and depulped, cleaned manually and then fermented in plastic sacks during 36 hours. The fermented parchment was washed, and then sun dried, dehulled to get green coffee. Observations wre conducted on green coffee yield, husk content, color of green coffee, distribution of size, bulk density of green and roasted coffee, roasting characters, color of roasted beans, and pH, acidity and flavors. The results showed (a The lowest content of husk was BP 432A and the highest was USDA 762. The control varieties of AS 1, S 795 and USDA 762, showed husk content >15%, while those potential varieties were < 15% except BP 416A. (b Beans size >6,5 mm and more than 80% were BP 416A, BP 430A, BP 432A, BP 509A, P 88 and S 795. Green coffee of BP 430A, BP 432A and BP 509A were uniform, but S 795 was not uniform. AS 1 and BP 416A and P 88 was one group; S 795 was one group with BP 542A; BP 509 was a group with BP 432A; but BP4 30A and USDA 762 were the other groups. (c Green coffee of USDA 762 was the palest color, but BP 542A was the darkest color. AS 1 and S 795 were a group with all potential varieties, except BP 542A. (d Roasted coffee of USDA 762 was the palest color and AS 1 was the darkest. In this case, AS 1 was a group with BP 430A, BP 509A and P 88, while S 795 was a group with BP 416A and BP 432A, but USDA 762 and BP 542A were

  19. Chemical genetics reveals a specific requirement for Cdk2 activity in the DNA damage response and identifies Nbs1 as a Cdk2 substrate in human cells.

    Directory of Open Access Journals (Sweden)

    Lara Wohlbold

    2012-08-01

    Full Text Available The cyclin-dependent kinases (CDKs that promote cell-cycle progression are targets for negative regulation by signals from damaged or unreplicated DNA, but also play active roles in response to DNA lesions. The requirement for activity in the face of DNA damage implies that there are mechanisms to insulate certain CDKs from checkpoint inhibition. It remains difficult, however, to assign precise functions to specific CDKs in protecting genomic integrity. In mammals, Cdk2 is active throughout S and G2 phases, but Cdk2 protein is dispensable for survival, owing to compensation by other CDKs. That plasticity obscured a requirement for Cdk2 activity in proliferation of human cells, which we uncovered by replacement of wild-type Cdk2 with a mutant version sensitized to inhibition by bulky adenine analogs. Here we show that transient, selective inhibition of analog-sensitive (AS Cdk2 after exposure to ionizing radiation (IR enhances cell-killing. In extracts supplemented with an ATP analog used preferentially by AS kinases, Cdk2(as phosphorylated the Nijmegen Breakage Syndrome gene product Nbs1-a component of the conserved Mre11-Rad50-Nbs1 complex required for normal DNA damage repair and checkpoint signaling-dependent on a consensus CDK recognition site at Ser432. In vivo, selective inhibition of Cdk2 delayed and diminished Nbs1-Ser432 phosphorylation during S phase, and mutation of Ser432 to Ala or Asp increased IR-sensitivity. Therefore, by chemical genetics, we uncovered both a non-redundant requirement for Cdk2 activity in response to DNA damage and a specific target of Cdk2 within the DNA repair machinery.

  20. A Novel Supra-Brow Combined with Infra-Brow Lift Approach for Asian Women.

    Science.gov (United States)

    Shu, Maoguo; He, Lin; Su, Yingjun; Shi, Junli; Zhang, Xi; Liu, Xiangyu; Yu, Xueyuan

    2016-06-01

    Direct brow lift surgery remains popular among Asian women despite its disadvantages. The traditional direct brow lift by a supra-brow incision is not suitable for Asian women because of their unique facial features, such as higher eyebrows, wider upper eyelids, and more orbital fat. Therefore, we designed a novel brow lift technique via a supra-brow combined with an infra-brow approach for Asian women. An area of skin above and below the eyebrow was measured, demarcated, and surgically removed. The redundant orbicularis oculi muscle (OOM) was excised while keeping the frontalis muscle intact. The OOM in the inferior flap was elevated and sutured to the frontalis muscle. In cases of puffy eyelids, orbital fat was partially removed through an infra-brow incision. Finally, a series of modifications were performed to reduce post-operative scarring. A total of 496 patients underwent this surgery from July 2009 to December 2013 and 432 patients were followed up for at least 6 months after surgery. Post-operative scars, in most patients (428/432), were inconspicuous. There were no facial nerve injuries documented and eight patients reported transient forehead numbness. The height of the palpebral fissure was increased but there was no marked increase observed of the distance between the upper eyelid edge and the eyebrow. In follow-up visits, 409 out of 432 patients (94.7 %) were satisfied with their surgical results. This new brow lift technique via a supra-brow combined with an infra-brow approach provided a simple and safe surgical repair of lateral brow ptosis, upper eyelids hooding, and crows' feet in Asian women. The surgical outcomes were predictable and the scars were inconspicuous. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .