WorldWideScience

Sample records for alloy-ehi 432

  1. 48 CFR 432.001 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Definitions. 432.001 Section 432.001 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.001 Definitions. The agency contract finance office is the office, other...

  2. 5 CFR 551.432 - Sleep time.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Sleep time. 551.432 Section 551.432... FAIR LABOR STANDARDS ACT Hours of Work Special Situations § 551.432 Sleep time. (a) Except as provided in paragraph (b) of this section, bona fide sleep time that fulfills the following conditions shall...

  3. 20 CFR 702.432 - Debarment process.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Debarment process. 702.432 Section 702.432 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR LONGSHOREMEN'S AND HARBOR... § 702.432 Debarment process. (a) Pertaining to health care providers. Upon receipt of information...

  4. 46 CFR 153.432 - Cooling systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Cooling systems. 153.432 Section 153.432 Shipping COAST... Control Systems § 153.432 Cooling systems. (a) Each cargo cooling system must have an equivalent standby... cooling system. (b) Each tankship that has a cargo tank with a required cooling system must have a manual...

  5. 42 CFR 426.432 - Discovery.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Discovery. 426.432 Section 426.432 Public Health... § 426.432 Discovery. (a) General rule. If the ALJ orders discovery, the ALJ must establish a reasonable timeframe for discovery. (b) Protective order—(1) Request for a protective order. Any party receiving a...

  6. 7 CFR 58.432 - Catalase.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Catalase. 58.432 Section 58.432 Agriculture... Material § 58.432 Catalase. The catalase preparation shall be a stable, buffered solution, neutral in pH, having a potency of not less than 100 Keil units per milliliter. The source of the catalase, its...

  7. 48 CFR 432.412 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contract clause. 432.412 Section 432.412 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Advance Payments for Non-Commercial Items 432.412 Contract clause. The decision...

  8. Fabrication of cold-rolled bands of the alloy-ehi 702 in rolls

    International Nuclear Information System (INIS)

    Zhuchin, V.N.; Gindin, A.Sh.; Shaburov, V.E.; Vladimirov, S.M.; Sokolov, V.A.; Shavkun, V.V.; Perepelitsa, I.V.; Markov, V.V.; Naymov, E.P.; Evstaf'ev, P.P.

    1977-01-01

    The questions are discussed, connected with the manufacture of cold-rolled strip of alloy EI702 in reels from strip blanks. It has been established that in the manufacture of hot-rolled stock from EI702 slabs it is necessary to use powerful rolling equipment because of high resistance to deformation. The reel method for manufacturing EI702 alloy improves the rolled stock and increases percentage of serviceable stock, as well as the output

  9. 40 CFR 432.41 - Special definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Special definitions. 432.41 Section 432.41 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... definitions. For the purpose of this subpart: High-processing packinghouse means a packinghouse which...

  10. 40 CFR 432.31 - Special definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Special definitions. 432.31 Section 432.31 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... definitions. For the purpose of this subpart: Low-processing packinghouse means a packinghouse that processes...

  11. 40 CFR 432.111 - Special definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Special definitions. 432.111 Section 432.111 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... definitions. For the purpose of this subpart: Poultry first processing means slaughtering of poultry and...

  12. Dicty_cDB: SLC432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC432 (Link to dictyBase) - - - Contig-U09715-1 | Contig-U16382-1 SLC4...32P (Link to Original site) SLC432F 633 SLC432Z 188 SLC432P 821 - - Show SLC432 Library SL (Link to library) Clone ID SLC4...15-1 | Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC4...32Q.Seq.d/ Representative seq. ID SLC432P (Link to Original site) Representative DNA sequence >SLC432 (SLC4...32Q) /CSM/SL/SLC4-B/SLC432Q.Seq.d/ ATTAAATTAAATAAAAAATAAAAATGGATGGTGAAGATGTTCAAGCTTTAGTTATTGATA

  13. 48 CFR 432.006-4 - Procedures.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS CONTRACT FINANCING 432.006-4 Procedures. (a) Immediately upon submittal of the referral described... decision making process. (c) The OIG will determine the need for and the extent of an investigation. (d...

  14. Treatment of Lymphangiomas with OK-432 (Picibanil)

    International Nuclear Information System (INIS)

    Rautio, Riitta; Keski-Nisula, Leo; Laranne, Jussi; Laasonen, Erkki

    2003-01-01

    Purpose: To determine the efficacy of OK-432 sclerotherapy in the treatment of lymphangiomas. Methods: The treatment was begun for 14 patients with lymphangioma. The age range of the patients at the time of the first injection was from 10 months to 42 years. Eleven of the lesions involved the head and neck region, two the thorax and one was localized in the extremity. Prior to treatment all patients were investigated with either magnetic resonance imaging, computed tomography, ultrasound or a combination of these modalities. The injections were performed with ultrasound and/or fluoroscopic guidance. Eight patients received OK-432 as first-line treatment; five were treated after surgery and one after medical therapy. On average, 2.2 intracystic injections were performed per patient. Nine of the lesions were macrocystic and five were mixed lesions. Results: Eleven patients showed complete or marked response to the OK-432 sclerotherapy, two patients had moderate shrinkage of their lesions and only one patient showed no response to therapy. Macrocystic lesions showed the best response to therapy. Those patients who received OK-432 as first-line treatment showed complete or marked response. Conclusion: It was found that treatment of lymphangiomas with OK-432 was safe and effective

  15. Treatment of lymphangiomas with OK-432 (Picibanil).

    Science.gov (United States)

    Rautio, Riitta; Keski-Nisula, Leo; Laranne, Jussi; Laasonen, Erkki

    2003-01-01

    To determine the efficacy of OK-432 sclerotherapy in the treatment of lymphangiomas. The treatment was begun for 14 patients with lymphangioma. The age range of the patients at the time of the first injection was from 10 months to 42 years. Eleven of the lesions involved the head and neck region, two the thorax and one was localized in the extremity. Prior to treatment all patients were investigated with either magnetic resonance imaging, computed tomography, ultrasound or a combination of these modalities. The injections were performed with ultrasound and/or fluoroscopic guidance. Eight patients received OK-432 as first-line treatment; five were treated after surgery and one after medical therapy. On average, 2.2 intracystic injections were performed per patient. Nine of the lesions were macrocystic and five were mixed lesions. Eleven patients showed complete or marked response to the OK-432 sclerotherapy, two patients had moderate shrinkage of their lesions and only one patient showed no response to therapy. Macrocystic lesions showed the best response to therapy. Those patients who received OK-432 as first-line treatment showed complete or marked response. It was found that treatment of lymphangiomas with OK-432 was safe and effective.

  16. 40 CFR 432.1 - General Applicability.

    Science.gov (United States)

    2010-07-01

    ... waters of the U.S. from facilities engaged in the slaughtering, dressing and packing of meat and poultry products for human consumption and/or animal food and feeds. Meat and poultry products for human... STANDARDS MEAT AND POULTRY PRODUCTS POINT SOURCE CATEGORY § 432.1 General Applicability. As defined more...

  17. 40 CFR 432.101 - Special definitions.

    Science.gov (United States)

    2010-07-01

    ... slaughterhouse, packinghouse or poultry dressing or processing operation, uses raw material at rates greater than... STANDARDS MEAT AND POULTRY PRODUCTS POINT SOURCE CATEGORY Renderers § 432.101 Special definitions. For the... animal and poultry trimmings, bones, meat scraps, dead animals, feathers and related usable by-products...

  18. 7 CFR 28.432 - Middling Tinged Color.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Middling Tinged Color. 28.432 Section 28.432... REGULATIONS COTTON CLASSING, TESTING, AND STANDARDS Standards Tinged Cotton § 28.432 Middling Tinged Color. Middling Tinged Color is color which is within the range represented by a set of samples in the custody of...

  19. 48 CFR 432.003 - Simplified acquisition procedures financing.

    Science.gov (United States)

    2010-10-01

    ... procedures financing. 432.003 Section 432.003 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.003 Simplified acquisition procedures financing. (a) The chief of the contracting office may approve contract financing on a contract to be...

  20. 48 CFR 432.113 - Customary contract financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...

  1. 48 CFR 432.102 - Description of contract financing methods.

    Science.gov (United States)

    2010-10-01

    ... financing methods. 432.102 Section 432.102 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are...

  2. 48 CFR 432.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.202-4 Section 432.202-4 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 432.202-4 Security for Government financing. Prior to determining that an offeror's financial condition is adequate...

  3. [Treatment of lymphangioma with OK-432 infiltration].

    Science.gov (United States)

    Rodríguez, J; Cáceres, F; Vargas, P

    2012-10-01

    The management of lymphangioma using sclerotherapy has proven to be an effective therapeutic. Our aim was to evaluate the therapeutic efficacy of OK-432 (Picibanil) in patients with lymphagioma. The study was performed from November 2010 to July 2011. Fifteen patients of both genders were diagnosed with lymphangioma, 12 days to 12 years old. All patients were infiltrated with OK-432. The studied variables were: previous surgery, localization, type of lymphangioma, number of effective injections, reduction of mass valued as excellent (100% reduction), good (reduction > 50%) and bad (reduction < 50%), presence of recurrence and complications. 40% of pacients had prior surgery and 53.3% were located in the cervical-face region. The type of macrocystic lymphangioma was present in 40% of the series, mixed type in 46.6% and microcystic type in 13.4%. The number of effective infiltrations were 3. In 6 cases (40%) the result was excellent in 5 cases (33.4%) the result was good and in 4 cases (26.6%). We had 1 recurrence (6.6%) and we haven't had complications. Injection of OK-432 in macrocystic lymphangioma and mixed had a safe therapeutic modality with satisfactory results. So it is a valid alternative to conventional surgery.

  4. Labeled OK-432, immunomodulator of streptococcus preparation, in cancer patients

    International Nuclear Information System (INIS)

    Toki, Hironobu; Ishikawa, Morihiro; Fujii, Masashi; Yumoto, Yasuhiro; Ishimitsu, Tetsusaburo

    1982-01-01

    We investigated the pharmacokinetics of OK-432, an immunomodulator of streptococcus preparation which, is used in cancer patients for active nonspecific immunotherapy. First, OK-432 was labeled with sup(99m)Technetium in vitro. Four patients with malignancy were studied. By the method of scintigraphy using gamma camera, OK-432 administered intravenously was found to be distributed in the liver, lung and spleen, by the decreasing grade. When OK-432 was administered subcutaneously or intramuscularly in the buttocks, most of the radioactivity of sup(99m)Technetium remained locally at the injected site. These results suggested that OK-432 given intravenously was effectively phagocytized by cells of reticuloendothelial system (RES). Compared with other routes of administration, the intravenous route of OK-432 administration is thus considered more effective in order to stimulate RES, which is responsible for the first step of immune reaction. (author)

  5. 40 CFR 52.432 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... quality. 52.432 Section 52.432 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) The requirements of sections 160 through 165 of the Clean Air Act are not met... air quality. (b) Regulation for preventing significant deterioration of air quality. The provisions of...

  6. 40 CFR 86.432-78 - Deterioration factor.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Deterioration factor. 86.432-78... 1978 and Later New Motorcycles, General Provisions § 86.432-78 Deterioration factor. (a) Deterioration factors shall be developed for each test vehicle from the emission test results. A separate factor shall...

  7. OK-432 sclerotherapy for malleolar bursitis of the ankle.

    Science.gov (United States)

    Park, Kwang Hwan; Lee, Jongseok; Choi, Woo Jin; Lee, Jin Woo

    2013-10-01

    The purpose of this study was to evaluate the clinical outcomes and usefulness of OK-432 (Picibanil) sclerotherapy as a new option in the conservative treatment of patients with malleolar bursitis of the ankle. Retrospectively, we reviewed a total of 20 consecutive patients (20 feet) in whom OK-432 sclerotherapy had been performed between March 2009 and June 2010. After aspiration of fluid in the malleolar bursal sac, 0.05 mg of OK-432 was injected into the malleolar bursal sac. We evaluated the clinical outcomes and side effects at the following time points: 2 weeks, 1 month, 3 months, 6 months, and 1 year after OK-432 sclerotherapy. The responses to the treatment were assessed according to the degree of fluctuation, shrinkage of the bursal sac, and soft tissue swelling. Complete resolution was observed in 19 patients (95%) after the first or second application of OK-432 sclerotherapy, and a partial response was observed in 1 patient (5%) after a second application of OK-432 sclerotherapy. The physical component scores of SF-36 improved from 70.0 ± 6.8 to 76.5 ± 7.3 at the last follow-up (P = .0002). OK-432 sclerotherapy was a useful procedure for patients not responding to the usual conservative treatment of malleolar bursitis of the ankle. Level IV, retrospective case series.

  8. Uso de OK-432 em crianças com linfangioma OK-432 therapy for lymphangioma in children

    Directory of Open Access Journals (Sweden)

    Everaldo Ruiz Jr.

    2004-04-01

    Full Text Available OBJETIVO: Relatar a experiência no uso do OK-432 para tratamento de linfangiomas em crianças. MÉTODOS: Estudo retrospectivo de 19 crianças com linfangioma tratadas com OK-432 no Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto - USP, durante o período de 1999 a 2003. RESULTADOS: Todos os pacientes apresentaram alguma resposta ao OK-432, 12 pacientes apresentaram regressão total, sete apresentaram regressão parcial variando de 50% a 80%. Os pacientes apresentaram febre após a aplicação da droga com duração de 2 a 10 dias. Não se observaram cicatrizes após a aplicação do OK-432. CONCLUSÕES: A droga OK-432 é segura, eficaz e pode ser utilizada como primeira escolha no tratamento de pacientes com linfangiomas devido à excelente resposta, podendo tornar desnecessária a realização de cirurgia. Em pacientes com resposta parcial, podem ser realizadas novas aplicações de OK-432 ou cirurgia menos mutilante, devido à redução das dimensões da lesão.OBJECTIVE: To report the experience with OK-432 therapy for lymphangioma in children. METHODS: Retrospective study of 19 children with lymphangioma treated with OK-432 in Ribeirão Preto, state of São Paulo, Brazil, between 1999 and 2003. RESULTS: All patients presented response to OK-432, 12 had total shrinkage and seven had partial shrinkage varying from 50% to 80%. Patients had fever after injections of OK-432 for 2 to 10 days, no damage to the overlying skin was observed. CONCLUSION: OK-432 is safe, effective and can be used as primary choice of treatment of patients with lymphangiomas because of the excellent response. In these cases surgery should not be necessary. In patients with partial regression new injections of OK-432 must be used to shrink the lesion. Thereby safely surgery could be made.

  9. 40 CFR 432.105 - New source performance standards (NSPS).

    Science.gov (United States)

    2010-07-01

    ... GUIDELINES AND STANDARDS MEAT AND POULTRY PRODUCTS POINT SOURCE CATEGORY Renderers § 432.105 New source... renderer that does not cure cattle hide as part of the plant operations. If a renderer does cure hide, the...

  10. Adult cystic hygroma: successful use of OK-432 (Picibanil).

    Science.gov (United States)

    Woolley, S L; Smith, D R K; Quine, S

    2008-11-01

    We report an adult case of cystic lymphangioma treated with OK-432 (Picibanil). A case report and review of the literature concerning the use of OK-432 to treat cystic lymphangioma is presented. A 31-year-old woman developed a cystic lymphangioma four weeks post-partum. This was treated initially by aspiration, for diagnostic purposes. Investigation suggested that surgery would be challenging. A review of the literature demonstrated success with OK-432 in the treatment of this condition, although primarily in the paediatric population. This patient was successfully treated thus, and at the time of writing remained symptom free. A suggested management plan is outlined. Treatment with OK-432 is useful in the management of cystic lymphangiomas in adults and should be considered as first line treatment.

  11. Linfangioma cervical: manejo terapéutico con OK-432 (Picibanil Cervical lymphangioma: therapeutic management with OK-432 (Picibanil

    Directory of Open Access Journals (Sweden)

    E. Valle Rodríguez

    2007-12-01

    Full Text Available Introducción: El linfangioma es una malformación del sistema linfático. El abordaje clásico ha sido la cirugía. El OK-432 (Picibanil tiene acción esclerosante y se está utilizando cómo primer escalón terapéutico. El objetivo es aportar un nuevo caso de linfangioma tratado con OK-432 y hacer una revisión de la literatura. Material y método: Aportamos un varón de 16 años con un linfangioma cervical macroquístico de 10 x 6 cm tratado con una dosis de OK-432. Resultados: A las 16 semanas del tratamiento, el tamaño del linfangioma era de 6 x 2 cm, siendo clínicamente inapreciable. Discusión: El tratamiento con OK-432 tiene una alta tasa de curación, con una baja tasa de recidiva y una fibrosis circunscrita a la lesión. En relación con la cirugía, se evitan cicatrices y posibles lesiones de estructuras vitales.Introduction: Lymphangioma is a malformation of the lymphatic system. The classic approach is surgery. OK-432 (Picibanil has sclerosing action and is being used as the first therapeutic step. The objective was to report a new case of lymphangioma treated with OK-432 and to review the literature. Material and method: We report the case of a 16-year-old man with a 10x6-cm macrocystic cervical lymphangioma treated with a dose of OK-432. Results: At 16 weeks of treatment, the size of the lymphangioma was 6x2 cm and it was clinically unappreciable. Discussion: OK-432 treatment has a high cure rate, low recurrence rate, and fibrosis circumscribed to the lesion. Compared to surgery, scars and possible harm to vital structures are avoided.

  12. Radiotherapy of medulloblastoma combined with OK-432 (Picibanil)

    International Nuclear Information System (INIS)

    Aoki, Yoshiro

    1986-01-01

    The OK-432 group consists of 8 Medulloblastoma patients, 5 Pinealoma patients and 1 Pons glioma patient, while the historical control group consists of 12 Medulloblastoma patients who have been treated only with radiation at NIRS. The frequency of the week when the value of white blood cell counts decreased below 2,500 was 13 weeks per 98 weeks of total observation period (13.3 %) in the OK-432 group. However, it was 37 weeks per 103 weeks (35.9 %) in the control group. The frequency of the week when the value of the platelet counts decreased below 10 x 10 4 was 5 weeks per 98 weeks (5.1 %) in the OK-432 group, while it was 21 weeks per 103 weeks (20.4 %) in the control group. The OK-432 group received 54.4 ± 3.3 Gy/ 34 ± 2 fractions/ 51 ± 4 days to the cerebellar tumor, except a one-year-old girl who received only a half of the radiation dose as the other patients who were older than 5 years, while the control group received 47.2 ± 7.3 Gy/ 34 ± 7 fractions/ 49 ± 10 days. In terms of TDF, the OK-432 group received 83.5 ± 8.7 and the control group received 63.5 ± 10.2, whereby the difference between the OK-432 group and the control group is statistically significant at 2 % level. To the spinal cord, the OK-432 group received 27.1 ± 3.1 Gy/ 27 ± 5 fractions/ 41 ± 9 days, while the control group received 25.4 ± 7.5 Gy/ 27 ± 13 fractions/ 43 ± 25 days. The survival rate of 8 Medulloblastoma patients treated with radiation combined with OK-432 is as follows : the relative survival rate is 75.1 % in one year, 62.5 % in 3 years and 62.5 % in 5 years, in contrast to the rate of 73.3 % in one year, 20.0 % in 3 years and 20.0 % in 5 years in the control group. (J.P.N.)

  13. [Unsuccessful treatment with OK-432 picibanil for orbital lymphangioma].

    Science.gov (United States)

    Lanuza García, A; Bañón Navarro, R; Llorca Cardeñosa, A; Delgado Navarro, C

    2012-01-01

    Lymphangioma is a malformation of the lymphatic system. The classic approach is surgery. We report a case of orbital lymphangioma in a girl who was given OK-432 to avoid surgery and its complications. OK-432 is a lyophilized mixture of group A Streptococcus pyogenes which produces a fibrosis limited to the lesion with a high cure rate. The main advantages are the easy intra-lesional application. with no scars and or damage of closed areas. Its main disadvantage is a significant local inflammatory reaction. Copyright © 2011 Sociedad Española de Oftalmología. Published by Elsevier Espana. All rights reserved.

  14. 40 CFR 432.5 - Incorporation by reference.

    Science.gov (United States)

    2010-07-01

    ... AND STANDARDS MEAT AND POULTRY PRODUCTS POINT SOURCE CATEGORY § 432.5 Incorporation by reference. (a... Federal Register. The material is available for purchase at the address in paragraph (b) of this section..., Washington, DC. (b) The following material is available for purchase from the National Technical Information...

  15. OK-432 sclerotherapy for benign cystic head and neck lesions

    International Nuclear Information System (INIS)

    Kim, Chang Hyun; Rho, Myung Ho; Lee, Sang Wook

    2003-01-01

    To evaluate the efficacy of OK-432 solution for slerotheraphy of cystic lesions of the head and neck. Nineteen cystic lesions comprising ten plunging ranulas, three simple ranulas, three cystic lymphangiomas, one first branchial cleft cyst and two unknown supraclavicular cysts considered to be lymphangiomas were treated by sucking out as much liquid content as possible and then injecting the same volume of OK-432 solution under ultrasound guidance. Patients were followed up clinically and radiologically. Follow-up sonography or CT- performed after a mean interval of nine months showed total or near-total shrinkage of four plunging ranulas. However, six such lesions recurred in spite of more than one (mean, two) sclerotherapy sessions. In cases involving two simple ranulas at the floor of the mouth, failure resulted from extracystic leakage of OK-432 solution via the puncture site. Two unilocular cystic lymphangiomas completely regressed during the follow-up period (mean, seven months), but the multiocular type showed a 65% volume reduction after 12 months. A first branchial cleft cyst was markedly reduced in size, with only a small cystic portion remaining after eight months, follow-up. Two supraclavicular cysts with straw-color fluid did not respond to sclerotherapy. OK-432 sclerotherapy of macrocystic lymphangiomas is an effective and promising alternative to surgery. For other cysts, however, including plunging ranula, efficacy, varied, and 64% of such lesions recurred

  16. OK-432 sclerotherapy for benign cystic head and neck lesions

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Chang Hyun; Rho, Myung Ho; Lee, Sang Wook [Masan Samsung Hospital, Masan (Korea, Republic of)

    2003-12-01

    To evaluate the efficacy of OK-432 solution for slerotheraphy of cystic lesions of the head and neck. Nineteen cystic lesions comprising ten plunging ranulas, three simple ranulas, three cystic lymphangiomas, one first branchial cleft cyst and two unknown supraclavicular cysts considered to be lymphangiomas were treated by sucking out as much liquid content as possible and then injecting the same volume of OK-432 solution under ultrasound guidance. Patients were followed up clinically and radiologically. Follow-up sonography or CT- performed after a mean interval of nine months showed total or near-total shrinkage of four plunging ranulas. However, six such lesions recurred in spite of more than one (mean, two) sclerotherapy sessions. In cases involving two simple ranulas at the floor of the mouth, failure resulted from extracystic leakage of OK-432 solution via the puncture site. Two unilocular cystic lymphangiomas completely regressed during the follow-up period (mean, seven months), but the multiocular type showed a 65% volume reduction after 12 months. A first branchial cleft cyst was markedly reduced in size, with only a small cystic portion remaining after eight months, follow-up. Two supraclavicular cysts with straw-color fluid did not respond to sclerotherapy. OK-432 sclerotherapy of macrocystic lymphangiomas is an effective and promising alternative to surgery. For other cysts, however, including plunging ranula, efficacy, varied, and 64% of such lesions recurred.

  17. 48 CFR 432.007 - Contract financing payments.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contract financing... CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.007 Contract financing payments. The HCA may prescribe, on a case-by-case basis, a shorter period for financing payments. [61 FR 53646, Oct. 15, 1996. Redesignated...

  18. 48 CFR 432.114 - Unusual contract financing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Unusual contract financing... CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.114 Unusual contract financing. The HCA is authorized to approve unusual contract financing. The signed determination and finding...

  19. OK-432 (Picibanil) therapy for lymphangiomas in children.

    Science.gov (United States)

    Laranne, J; Keski-Nisula, L; Rautio, Riitta; Rautiainen, Markus; Airaksinen, Mari

    2002-05-01

    Lymphangiomas are benign, soft tumors that most often affect the head and neck area, usually causing marked cosmetic and functional problems. Treatment options include surgery and a large number of different sclerotherapy agents. Surgical treatment is challenging because of the need for complete excision. The risk of damage to surrounding structures or poor cosmetic results is high. Various sclerotherapy agents have been shown to have minimal effects on lymphangiomas. Their use has been associated with severe systemic, local and cosmetic side effects. OK-432 (Picibanil) is a new and promising form of sclerotherapy. An intracystic injection of OK-432 produces a local inflammatory reaction, which leads to resolution of the lesion. We have treated 11 pediatric lymphangioma patients with OK-432 with excellent results: complete regression in six, marked regression in four and no response in one case. Local swelling should be anticipated, especially when treating lesions near the upper airway. We found OK-432 injections to be safe and effective as a first line of treatment for lymphangiomas.

  20. OK-432 sclerotherapy of cervical chylous lymphocele after neck dissection.

    Science.gov (United States)

    Roh, Jong-Lyel; Park, Chan Il

    2008-06-01

    Postoperative cervical chylous lymphoceles are extremely rare circumscribed collections of lymph which are usually treated by drainage or surgical exploration, but rarely by sclerotherapy. We investigated the efficacy of OK-432 (Picibanil, Chungai Pharmaceutical Co., Tokyo, Japan) sclerotherapy in the treatment of cervical lymphocele after neck dissection. Four patients with postoperative lymphocele who could not be cured by repeated percutaneous needle aspiration and pressure dressing were treated with intralesional injection of 0.1-0.2 mg OK-432 after aspiration of fluid. The aspirated fluid was assessed biochemically and cytologically, and regular palpation and ultrasonography/computed tomography were used to evaluate outcomes and recurrences. Two patients with chyle leak during neck dissection had lymphoceles in the left supraclavicular region 3 weeks later. The other two patients had lymphoceles on the right neck 9 and 12 months, respectively, after neck dissection. All aspirated fluids were chylous in origin without tumor cells. OK-432 sclerotherapy scored all four lesions with no major complications except for fever and local pain for several days. No lymphocele recurrences or metastatic cancers were observed in any patient for >1 year after sclerotherapy. Intralesional injection of OK-432 may be a safe and effective alternative to surgical exploration in the treatment of cervical lymphocele after neck dissection.

  1. Efficacy and safety of OK-432 immunotherapy of lymphatic malformations.

    Science.gov (United States)

    Smith, Mark C; Zimmerman, M Bridget; Burke, Diane K; Bauman, Nancy M; Sato, Yutaka; Smith, Richard J H

    2009-01-01

    To determine the efficacy and safety of the immunostimulant OK-432 (Picibanil) as a treatment option in the management of children with cervicofacial lymphatic malformations. A prospective, randomized, multi-institutional phase II clinical trial at 27 U.S. academic medical centers. 182 patients with lymphatic malformations (LM) were enrolled between January 1998 and November 2004. Of the 151 patients with complete case report forms, 117 patients were randomized into immediate or delayed treatment groups; 34 patients were nonrandomized and assigned to the open-label group. Treatment consisted of a four-dose intralesional injection series of OK-432 at eight-week intervals. Patients randomized into the delayed treatment group served as observational controls for spontaneous regression. Response to therapy was measured radiographically by quantitating change in lesion size and graded as complete (90%-100%), substantial (60%-89%), intermediate (20%-59%), or none (<20%). Of 117 patients randomized with intent-to-treat, 68% demonstrated a complete or substantial response to OK-432 immunotherapy. Response data for macrocystic LM were higher, with a complete or substantial response in 94% of patients; 63% of patients with mixed macrocystic-microcystic LM responded to treatment; no patients with microcystic LM responded to treatment. Spontaneous resolution occurred in less than 2% of patients. Median follow-up of 2.9 years demonstrated a 9% recurrence rate. Major adverse effects related to therapy occurred in 11 patients. As compared to historical surgical data on LM, OK-432 immunotherapy is more effective (P < .001) and has a lower morbidity (P < .001). OK-432 immunotherapy is an effective, safe, and simple treatment option for the management of macrocystic cervicofacial LM. ClinicalTrials.gov Identifier: NCT00010452.

  2. 27 CFR 4.32a - Voluntary disclosure of major food allergens.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Voluntary disclosure of major food allergens. 4.32a Section 4.32a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Requirements for Wine § 4.32a Voluntary disclosure of major food allergens. (a) Definitions. For purposes of...

  3. 28 CFR 43.2 - Obligations of persons receiving care and treatment.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Obligations of persons receiving care and treatment. 43.2 Section 43.2 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) RECOVERY OF COST OF HOSPITAL AND MEDICAL CARE AND TREATMENT FURNISHED BY THE UNITED STATES § 43.2 Obligations of persons...

  4. Status of the USNRC/PNL Halden test IFA-432

    International Nuclear Information System (INIS)

    Bradley, E.R.; Cunningham, M.E.; Lanning, D.D.; Williford, R.E.

    1980-01-01

    The NRC/PNL fuel assembly IFA-432 began irradiation in December 1975 and as of January 1980 had reached an assembly average burnup of 2120 GJ/kgU (24.5 GWd/MTM). The rods in this assembly are heavily instrumented and this has allowed a fairly thorough analysis of fuel behavior. The emphasis of the analysis has been to evaluate the observed changes in thermal/mechanical behavior. These changes are related to estimates of fuel density changes, fission gas release, and fuel cracking and relocation. The following conclusions have been reached concerning the irradiation of IFA-432. Based on analysis of steady-state and transient thermal data, the fuel in all rods is extensively cracked and relocated. Significant reductions in the effective fuel thermal conductivity have been deduced from the analysis of the transient thermal data

  5. Development of a high-power 432 MHz DTL

    International Nuclear Information System (INIS)

    Naito, F.; Kato, T.; Takasaki, E.; Yamazaki, Y.; Kawasumi, T.; Suzuki, K.; Iino, Y.

    1992-01-01

    A high-power model of a 432 MHz Drift-Tube Linac is under construction. It will accelerate H - ions from 3 to 5.4 MeV, and is a prototype of the DTL for the Japanese Hadron Project. Several new techniques have been developed for constructing the DTL: fabricating and assembling methods of permanent quadrupole magnet and a drift tube, alignment of the drift tube, and a method of connecting the tanks. (Author) 6 refs., 5 figs

  6. The effect of OK-432 (Picibanil) injection on the histopathology of nasal turbinate.

    Science.gov (United States)

    Sengul, S; Kaygusuz, I; Akin, M M; Yalcin, Ş; Karlidag, T; Keles, E; Arslan, I

    2015-12-01

    This study aimed to assess the histopathological effect of OK-432 (Picibanil) on rabbit nasal turbinates. A total of 21 rabbits were divided into 3 treatment groups and various parts of both nasal turbinates were injected with 0.5 ml OK-432, 0.2 ml OK-432 or 0.6 ml saline (control). Bilateral nasal turbinates were later excised and studied under light microscopy to assess any histopathological changes. Animals in the 0.2 ml and 0.5 ml OK-432 groups exhibited mild ciliary loss, goblet cell loss and epithelial damage, and a marked increase in inflammatory cell infiltration, submucosal vascularisation and fibrosis. There was a significant difference in histopathological changes between the two OK-432 treated groups. In addition, each OK-432 treated group had significantly more inflammatory cell infiltration, increased submucosal vascularisation and fibrosis compared with controls. The marked fibrosis observed in OK-432-injected turbinates may be responsible for a reduction in turbinate size.

  7. Biological effect of OK-432 (picibanil) and possible application to dendritic cell therapy.

    Science.gov (United States)

    Ryoma, Yoshiki; Moriya, Yoichiro; Okamoto, Masato; Kanaya, Isao; Saito, Motoo; Sato, Mitsunobu

    2004-01-01

    OK-432 (Picibanil), a streptococcal preparation with potent biological response modifying activities, was approved in Japan as an anticancer agent in 1975. In the ensuing 30 years, since then, a significant amount of data, including clinical as well as experimental studies, has been accumulated. OK-432 has been reported to induce various cytokines, activate immunological cells and thus augment anticancer immunity. Recently, the interrelation between innate immunity and adaptive immunity has become clear and it was reported that OK-432 acts, at least in part, via Toll-like receptor (TLR) 4-MD2 signaling pathway. In addition, dendritic cells (DCs) are considered to play a pivotal role in immunological response and it is reported that OK-432 induced maturation of DCs both in vitro and in vivo. These results suggest that OK-432 is a useful adjuvant in DC-based anticancer immunotherapy. Clinical studies of DC therapy with OK-432 are under way.

  8. Sclerotherapy of cervical cysts with Picibanil (OK-432).

    Science.gov (United States)

    Knipping, Stephan; Goetze, Gerrit; Neumann, Kerstin; Bloching, Marc

    2007-04-01

    The effectiveness of intralesional sclerotherapy of lymphangiomas and ranulas with OK-432 (Picibanil) has been proved in several clinical studies. The aim of our study was to review the effectiveness of sclerotherapy of benign cervical cysts with Picibanil as an alternative method to surgical excision. Between March 2002 and March 2006, a prospective observational study was carried out to assess the effects of Picibanil on cervical cysts. Between 2002 and 2006 we treated 14 patients having cervical cysts through intralesional application of Picibanil with a dose of 0.01 mg/ml. So far we used Picibanil with 13 patients achieving a high success rate. In eight cases we observed, both clinically and ultrasonographically, a nearly complete regression, and a complete regression of the cysts in three cases. In two cases the cysts atrophied. In these cases only residual findings could be observed. In one case we extirpated the remaining cyst. If there is no clear reaction of the cyst to the treatment, an excision is indicated 6 weeks after the injections to gain meaningful histological examination. No significant complication after sclerotherapy with Picibanil was observed. According to our results the application of OK-432 (Picibanil) is a safe and effective primary method for sclerotherapy of benign cervical cysts which can replace surgical extirpation in special cases. However, the risk of malign diseases has to be excluded before the commencement of the Picibanil treatment.

  9. Effects of OK-432 (picibanil) on the estrogen receptors of MCF-7 cells and potentiation of antiproliferative effects of tamoxifen in combination with OK-432.

    Science.gov (United States)

    Aoyagi, H; Iino, Y; Takeo, T; Horii, Y; Morishita, Y; Horiuchi, R

    1997-01-01

    OK-432 (picibanil), a streptococcal preparation, has a strong biological response modifier (BRM) function and is expected to produce clinical improvement and prolongation of survival in treated cancer patients in Japan. We were interested in whether OK-432 augments estrogen receptor (ER) levels in breast cancer. To investigate the effect of the BRMs on cellular growth and the characteristics of ER and progesterone receptors (PgR) in the human breast cancer cell line MCF-7, we used OK-432, Krestin (PSK), a protein-bound polysaccharide extracted from Coriolus versicolor, and lentinan, a fungal branched (1...3)-beta-D-glycan. OK432 and PSK dose dependently inhibited DNA synthesis of MCF-7 cells, and the 50% inhibitory concentrations of OK-432 and PSK were 1.2 KE (klinische Einheit, clinical unit)/ml and 200 micrograms/ml, respectively. Lentinan showed no direct anticancer effect in vitro. We found that OK-432 induced a 2-fold increase in ER levels in MCF-7 cells at 0.005 KE/ml, but not in PgR. Lentinan and low-dose PSK did not change ER or PgR levels, but high-dose PSK decreased ER and PgR. We also studied the combined effect of OK-432 and antiestrogens, tamoxifen (TAM) and DP-TAT-59. The combined treatment with OK-432 and TAM showed an additive inhibitory effect on MCF-7 cells. These results suggest that OK-432 may augment the therapeutic effect of TAM in breast cancer.

  10. Whole abdominal irradiation for ovarian cancer in combined treatment with OK-432 picibanil

    International Nuclear Information System (INIS)

    Morita, Shinroku; Arai, Tatsuo; Tsunemoto, Hiroshi

    1986-01-01

    One hundred seventeen patients with postoperative ovarian cancer who were treated with whole abdominal irradiation by the open-field technique were analyzed as to the effectiveness of combined therapy with or without OK-432. OK-432, 0.2 to 2.0 (KE) (kev) daily, has been used to prevent bone marrow suppression since 1978 at NIRS. Cumulative five-year survival rates were 63.6 % in the OK-432 group (37 patients) and 54.5 % in the NON-OK-432 group (34 patients). The complete rates of previously arranged treatment schedules were 81 % and 66 % in the two groups, respectively, as we originally intended. (author)

  11. The prognostic advantage of preoperative intratumoral injection of OK-432 for gastric cancer patients

    Science.gov (United States)

    Gochi, A; Orita, K; Fuchimoto, S; Tanaka, N; Ogawa, N

    2001-01-01

    To investigate, by a multi-institutional randomized trial, the prognostic significance of the augmentation of tumour-infiltrating lymphocytes (TILs) by preoperative intratumoral injection of OK-432 (OK-432 it), a bacterial biological response modifier, in patients with gastric cancer. The 10-year survival and disease-free survival were examined and analysis of the factors showing survival benefit was performed. 370 patients who had undergone curative resection of gastric cancer were enrolled in this study and followed up for 10 years postoperatively. Patients were randomized into either an OK-432 it group or a control group. Ten Klinishe Einheit (KE) of OK-432 was endoscopically injected at 1 to 2 weeks before the operation in the OK-432 it group. Both groups received the same adjuvant chemoimmunotherapy consisting of a bolus injection of mitomycin C (0.4 mg kg−1i.v.) and administration of tegafur and OK-432 from postoperative day 14 up to 1 year later. Tegafur (600 mg day−1) was given orally and OK-432 (5 KE/2 weeks) was injected intradermally for a maintenance therapy. The TILs grades in resected tumour specimens and presence of metastasis and metastatic pattern in dissected lymph nodes were examined. Multivariate analysis was performed to determine the efficacy of OK-432 it on prognostic factors. All patients were followed up for 10 years. The overall 5- and 10-year survival rates and disease-free survival rates of the OK-432 it group were not significantly higher than those of the control group. However, OK-432 it significantly increased the 5- and 10-year survival rates of patients with stage IIIA + IIIB, moderate lymph node metastasis (pN2), and positive TILs. OK-432 it was most effective at prolonging the survival of patients who had both positive TILs and lymph node metastasis. The OK-432 it group with positive TILs showed a significant decrease in metastatic lymph node frequency and in the number of lymph node micro- metastatic foci when compared to

  12. Irradiation history and final postirradiation data for IFA-432

    International Nuclear Information System (INIS)

    Lanning, D.D.

    1986-11-01

    The irradiation history and final postirradiation examination (PIE) results are presented for the Halden fuel assembly IFA-432. In particular, the three instrumented rods (Rods 2, 3, and 5) that continued to the highest burnup (46 MWd/kgM) are emphasized. The long survival rate of the fuel instrumentation allowed a continuous record to be kept of linear heat generation rate and fuel temperatures throughout the operating history of the asembly. Fission gas release was estimated based on a combination of gas retention and ceramographic data. The PIE data show that the postirradiation condition of the rods is qualitatively consistent with the power/temperature histories experienced. Fission gas release estimates are: Rod 2 (380 μm as-fabricated gap), 20-40%; Rod 5 (230 μm as-fabricated gap), 20-40%; and Rod 3 (76 μm as-fabricated gap), 0-20%

  13. Enhancement of antitumor activity of OK-432 (picibanil) by Triton X-114 phase partitioning.

    Science.gov (United States)

    Hashimoto, Masahito; Takashige, Katsuhiro; Furuyashiki, Maiko; Yoshidome, Keitaro; Sano, Ryoko; Kawamura, Yutaka; Ijichi, Shinji; Morioka, Hirofumi; Koide, Hiroyuki; Oku, Naoto; Moriya, Yoichiro; Kusumoto, Shoich; Suda, Yasuo

    2008-01-01

    OK-432 (Picibanil), a Streptococcal immunotherapeutic agent, has been used for immunotherapy of various cancers as a biological response modifier (BRM). However, OK-432 contains multiple components consisting of immunotherapeutic ones and contaminants which may weaken the effects or exert side-effects. In this study, we investigated extraction of contaminants from OK-432 using Triton X-114 (TX-114)-water phase partitioning and examined an antitumor effect of the resulting preparation. OK-432 was subjected to TX-114 partitioning to give residual precipitate designated as OK-TX-ppt. OK-TX-ppt exerted no TLR2-mediated activity, but induced interleukin (IL)-6 in human PBMC. OK-TX-ppt also induced tumor necrosis factor (TNF)-alpha, IL-10, IL-12, and interferon (IFN)-gamma in PBMC. Moreover, IFN-gamma-inducing activity of OK-TX-ppt was significantly higher and IL-10 production was lower than that of OK-432. In tumor-bearing mice model, administration of OK-TX-ppt i.p. extended the survival time of Meth-A-bearing mice compared to OK-432. OK-TX-ppt also increased the levels of IL-12 and IFN-gamma in mouse spleen cells in vitro. These results indicated that TX-114 partitioning removed some contaminants, which attenuates the antitumor effect, from OK-432 and increase the immunotherapeutic effects of OK-432.

  14. 42 CFR 412.432 - Method of payment under the inpatient psychiatric facility prospective payment system.

    Science.gov (United States)

    2010-10-01

    ... facility prospective payment system. 412.432 Section 412.432 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM PROSPECTIVE PAYMENT SYSTEMS FOR INPATIENT HOSPITAL SERVICES Prospective Payment System for Inpatient Hospital Services of Inpatient...

  15. 42 CFR 432.31 - Training and use of subprofessional staff.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Training and use of subprofessional staff. 432.31...; Subprofessional and Volunteer Programs § 432.31 Training and use of subprofessional staff. (a) State plan requirement. A State plan must provide for the training and effective use of subprofessional staff as...

  16. 27 CFR 4.32b - Petitions for exemption from major food allergen labeling.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Petitions for exemption from major food allergen labeling. 4.32b Section 4.32b Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE...

  17. Protective action of OK-432 (Picibanil) on the radiation-induced myelosuppression

    International Nuclear Information System (INIS)

    Aoki, Yoshiro

    1986-01-01

    This report aims to examine the alleviating action of OK-432 against the radiation-induced myelosuppression in the whole body irradiated mice. The mice treated with OK-432 were given OK-432 with the dose of 5.0 KE by intraperitoneal injection 24 hours before irradiation, while the control group was given 1.0 ml of saline according to the same procedure as the OK-432 group. The fifty percent lethal dose on the 30th day after the whole body irradiation is 700R in the OK-432 group, while it is 580R in the control group. The dose reduction factor (DRF) is 1.21 in this series. The white blood cell counts decreased after irradiation with 300R in both groups. The recovery of WBC counts in the OK-432 group began at the 6th or 7th day after irradiation, while the decreased level continued until the 20th day in the control group. The WBC counts and the spleen weights were examined on the 10th day after irradiation. The WBC counts of the OK-432 group were higher than those of the control group, the difference of which was statistically significant at the 5 % level at 300R. The spleens of the OK-432 group were heavier and larger than those of the control group, the difference of which was statistically significant at the 0.1 % level for the dose range from 300 to 500R. The HE-stained spleen of the OK-432 group on the 10th day after irradiation showed the increase of hematopoietic cells in the enlarged sinus in comparison with that of the control group. The timing of OK-432 administration and the percentage of the survival of the OK-432 group on 30th day, irradiated with 600R to the whole body, were examined. The 5.0 KE of OK-432 was injected from 4 days before and upto 4 days after irradiation to each group. When OK-432 was inected from 2 days before and upto 12 hours after irradiation, the OK-432 group showed the good survival rate in comparison with the control group. (J.P.N.)

  18. Inhibitory effects of OK-432 (Picibanil) on cellular proliferation and adhesive capacity of breast carcinoma cells.

    Science.gov (United States)

    Horii, Yoshio; Iino, Yuichi; Maemura, Michio; Horiguchi, Jun; Morishita, Yasuo

    2005-02-01

    We investigated the potent inhibitory effects of OK-432 (Picibanil) on both cellular adhesion and cell proliferation of estrogen-dependent (MCF-7) or estrogen-independent (MDA-MB-231) breast carcinoma cells. Cellular proliferation of both MCF-7 and MDA-MB-231 cells was markedly inhibited in a dose-dependent manner, when the carcinoma cells were exposed to OK-432. Cell attachment assay demonstrated that incubation with OK-432 for 24 h reduced integrin-mediated cellular adhesion of both cell types. However, fluorescence activated cell sorter (FACS) analysis revealed that incubation with OK-432 for 24 h did not decrease the cell surface expressions of any integrins. These results suggest that the binding avidity of integrins is reduced by OK-432 without alteration of the integrin expression. We conclude that OK-432 inhibits integrin-mediated cellular adhesion as well as cell proliferation of breast carcinoma cells regardless of estrogen-dependence, and that these actions of OK-432 contribute to prevention or inhibition of breast carcinoma invasion and metastasis.

  19. Successful pleurodesis with OK-432 (picibanil in preterm infants with persistent pleural effusion

    Directory of Open Access Journals (Sweden)

    Jeong Eun Kim

    2012-05-01

    Full Text Available OK-432 (picibanil is an inactivated preparation of &lt;em&gt;Streptococcus pyogenes&lt;/em&gt; that causes pleurodesis by inducing a strong inflammatory response. Intrapleural instillation of OK-432 has recently been used to successfully treat neonatal and fetal chylothorax. Here we report a trial of intrapleural instillation of OK-432 in two preterm infants who were born with hydrops fetalis and massive bilateral pleural effusion. Both cases showed persistent pleural effusion, refractory to conservative treatment, up to postnatal days 26 and 46, respectively. An average of 80 to 140 mL of pleural fluid was drained daily. In case 1, the infant was treated with OK-432 during the fetal period at gestation 28 weeks and 4 days of gestation, but showed recurrence of pleural effusion and progressed into hydrops. Within two to three days after OK-432 injection, the amount of pleural fluid drainage was dramatically decreased and there was no reaccumulation. We did not observe any side effects related to OK-432 injection. We suggest that OK-432 should be considered as a therapeutic option in infants who have persistent pleural effusion for more than four weeks, with the expectation of the early removal of the chest tube and a good outcome.

  20. Prevention of radiation-induced bacteraemia by post-treatment with OK-432 and aztreonam

    Energy Technology Data Exchange (ETDEWEB)

    Kurishita, A.; Ono, T. (Tohoku Univ., Sendai (Japan). School of Medicine); Uchida, A. (Kyoto Univ. (Japan). Radiation Biology Center)

    1993-03-01

    The effects of combined treatment with OK-432, an immunomodulator prepared from Streptococcus haemolyticus, and aztreonam, a monobactum antibiotic, in the prevention of radiation-induced bacteraemia and mortality were examined in ICR-MCH mice irradiated with 9.5 Gy. The organisms recovered from the irradiated mice were Streptococcus faecalis and Proteus mirabilis. Treatment with aztreonam reduced the incidence of mice infected with Proteus mirabilis (p<0.01), but it showed no efficacy on Streptococcus faecalis. OK-432 could reduce the frequency of bacteraemia attributed to both organisms (p<0.05). Combined treatment with OK-432 and aztreonam further decreased the incidence of bacteraemia by both organisms; no organisms were recovered at 14 days following irradiation. The survival rate at 30 days following irradiation was 80% in mice treated with OK-432 plus aztreonam and 55% with OK-432 alone, while it was 0% in the groups treated with aztreonam or saline alone. These results indicated that combined treatment with OK-432 and a suitable antibiotic such as aztreonam is more effective than OK-432 or aztreonam alone. (Author).

  1. Prevention of radiation-induced bacteraemia by post-treatment with OK-432 and aztreonam

    International Nuclear Information System (INIS)

    Kurishita, A.; Ono, T.; Uchida, A.

    1993-01-01

    The effects of combined treatment with OK-432, an immunomodulator prepared from Streptococcus haemolyticus, and aztreonam, a monobactum antibiotic, in the prevention of radiation-induced bacteraemia and mortality were examined in ICR-MCH mice irradiated with 9.5 Gy. The organisms recovered from the irradiated mice were Streptococcus faecalis and Proteus mirabilis. Treatment with aztreonam reduced the incidence of mice infected with Proteus mirabilis (p<0.01), but it showed no efficacy on Streptococcus faecalis. OK-432 could reduce the frequency of bacteraemia attributed to both organisms (p<0.05). Combined treatment with OK-432 and aztreonam further decreased the incidence of bacteraemia by both organisms; no organisms were recovered at 14 days following irradiation. The survival rate at 30 days following irradiation was 80% in mice treated with OK-432 plus aztreonam and 55% with OK-432 alone, while it was 0% in the groups treated with aztreonam or saline alone. These results indicated that combined treatment with OK-432 and a suitable antibiotic such as aztreonam is more effective than OK-432 or aztreonam alone. (Author)

  2. 40 CFR 432.73 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... application of the best available technology economically achievable (BAT). 432.73 Section 432.73 Protection... POULTRY PRODUCTS POINT SOURCE CATEGORY Sausage and Luncheon Meats Processors § 432.73 Effluent limitations attainable by the application of the best available technology economically achievable (BAT). Except as...

  3. 40 CFR 432.77 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... application of the best control technology for conventional pollutants (BCT). 432.77 Section 432.77 Protection... POULTRY PRODUCTS POINT SOURCE CATEGORY Sausage and Luncheon Meats Processors § 432.77 Effluent limitations attainable by the application of the best control technology for conventional pollutants (BCT). Except as...

  4. 40 CFR 432.72 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.72 Section 432.72... AND POULTRY PRODUCTS POINT SOURCE CATEGORY Sausage and Luncheon Meats Processors § 432.72 Effluent limitations attainable by the application of the best practicable control technology currently available (BPT...

  5. Biodegradation of Mexel 432 By Bacteria From the Seine River

    International Nuclear Information System (INIS)

    Allonier, A.S.; Khalanski, M.

    1996-01-01

    This report deals with a study of the biodegradation of a filmogenic organic product (Mexel 432) usable in the fight against corrosion, scale and fouling, presenting a certain interest in the research of processes enabling a functional and environmental efficiency for the cooling systems of thermal power stations. The study of the degradation of this product is followed by a global colorimetric method. It shows that the product is stable on the long-term in demineralized water. On the other hand, its rate of disappearance in river waters is significant (50 % in 2 or 3 days). In this phenomenon of disappearance, biodegradation seems to play a part. Some bacteria from the natural environment (river Seine) have been isolated. Two of them seem to play a significant part, since they can degrade the product in three weeks. During the degradation, the amines with long chains (more than six carbons) of the Mexel, measured by the colorimetric method, disappear. The other compounds generated by the biodegradation process are not identified. (authors)

  6. OK-432 as a sclerosing agent to treat wound-healing impairment.

    Science.gov (United States)

    Fasching, G; Sinzig, M

    2007-12-01

    We report on the application of OK-432 (picibanil) in a patient with prolonged wound healing impairment. A 13-year-old girl had suffered a polytrauma with a displaced fracture of the sacrum which required neurosurgical decompression of the sacral plexus. Postoperatively, a seroma with recurrent fistulation was seen. Excision of the wound, prolonged suction drainage and the instillation of hypertonic glucose solution did not have any effect over a period of four months postoperatively. Relying on our personal experience of the treatment of lymphangiomas using OK-432 we instilled OK-432 into the wound. Leakage stopped immediately, there was a regression of fluid accumulation and four weeks later the ultrasound examination was normal. The patient is still asymptomatic four years after treatment. OK-432 can be used effectively for the treatment of chronic wound healing impairment.

  7. 18 CFR 367.4320 - Account 432, Allowance for borrowed funds used during construction-Credit.

    Science.gov (United States)

    2010-04-01

    ... ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Income Statement Chart of Accounts Service Company Operating Income § 367.4320 Account 432, Allowance for borrowed funds used during construction—Credit. This...

  8. Post-irradiation treatment with OK432 can prevent radiation-induced bone marrow death

    International Nuclear Information System (INIS)

    Kurishita, A.; Uehara, Y.; Tohoku Univ., Sendai; Katoh, H.; Hirose, S.; Uchida, A.; Mizutani, Y.; Okada, S.; Ono, T.

    1991-01-01

    The radioprotective effect of OK432, a Streptocuccus haemolyticus preparation, on bone marrow death was examined in mice. The LD 50 value was increased from 7.55 Gy in controls to 8.45 Gy in mice treated once with OK432 immediately after irradiation. Multiple administration of the agent further elevated the LD 50 value to 9.56 Gy. The radioprotective effect was also apparent when multiple treatments were commenced as late as 72 h after irradiation. (author)

  9. Acute behavioral effects of intrapleural OK-432 (Picibanil) administration in preterm fetal sheep.

    Science.gov (United States)

    Cowie, Rosalind V; Stone, Peter R; Parry, Emma; Jensen, Ellen C; Gunn, Alistair J; Bennet, Laura

    2009-01-01

    To develop a model to study the fetal effects of intrapleural infusion of OK-432 (Picibanil), a pleurodesis agent derived from killed Gram-positive streptococci. OK-432 (0.1 mg, n = 5), or normal saline (n = 5) were infused over 20 min into the pleural space of chronically instrumented preterm fetal sheep at 0.7 gestation. Fetal physiological parameters, including breathing and nuchal activity were monitored in utero from 6 h before infusion until 12 h afterward, and fetuses were killed after 7 days recovery. OK-432 was associated with transient suppression of fetal EEG activity, breathing and body movements from 3-6 h after infusion. Hypotension and hypoxia did not occur. At postmortem, local pleural adhesions were seen around the site of OK-432 infusion but not in saline treated fetuses. Intrapleural administration of OK-432 is associated with marked but transient fetal behavioral effects. This model will enable preclinical investigation of the neural and cardiovascular safety of OK-432 at a clinical relevant stage of development. Copyright 2009 S. Karger AG, Basel.

  10. Treatment of lymphatic malformations of head and neck with OK-432 sclerotherapy induce systemic inflammatory response.

    Science.gov (United States)

    Närkiö-Mäkelä, Mervi; Mäkelä, Teppo; Saarinen, Pia; Salminen, Päivi; Julkunen, Ilkka; Pitkäranta, Anne

    2011-01-01

    Systemic immune responses after OK-432 (Picibanil) sclerotherapy in patients with head and neck lymphatic malformations (LM) were examined to achieve a better understanding of the mechanism of OK-432 sclerotherapy and to evaluate the long-term treatment outcome. Serum samples from 17 consecutive patients with head and neck LMs were collected during a total of 26 OK-432 treatment episodes. Serum C-reactive protein (CRP), interleukins (IL) 1β, 6, 8, 10, tumor necrosis factor (TNF)-α, interferon (IFN)-γ, RANTES, immune protein (IP)-10 and macrophage chemoattractant protein (MCP)-1 as well as blood leukocyte counts were determined. Clinical outcome of the treatment was evaluated at the last visit and from patient files. Elevated serum levels of IP-10 (means at baseline 702 ng/L, after 1 day 1180 ng/L, after 4 weeks 691 ng/L) were seen on day one after OK-432 sclerotherapy (p < 0.05). C-reactive protein and leukocyte counts 1 day after treatment differed statistically significantly (p < 0.05) from the baseline. No significant differences with other cytokines investigated were observed. Patients with macrocystic LM responded better than patients with microcystic LM (p = 0.01). The elevated levels of IP-10, C-reactive protein and leukocyte levels indicate that OK-432 sclerotherapy induces systemic immune responses in patients with LM. The mechanisms of OK-432 sclerotherapy are still not precisely understood, but the IP-10 elevation may reflect local antiangiogenetic properties of immunoactivation induced by OK-432.

  11. Primary treatment of pediatric plunging ranula with nonsurgical sclerotherapy using OK-432 (Picibanil).

    Science.gov (United States)

    Roh, Jong-Lyel; Kim, Hyo Sun

    2008-09-01

    Although surgery is the first choice of therapy for plunging ranula, it is associated with technical difficulties, morbidity and recurrence. Plunging ranula may be also primarily treated with nonsurgical sclerotherapy, but there is little experience in pediatric patients. We, therefore, assessed the efficacy of OK-432 sclerotherapy for pediatric plunging ranula. Nine children with plunging ranula were prospectively treated with intracystic injections of OK-432. At the outpatient clinic, the ranula was punctured in the neck and aspirated mucus was replaced with 0.1-0.2mg OK-432 solution. The size of the ranula was compared before and after sclerotherapy. Total or nearly total shrinkage was observed in 6 of 9 patients; marked reduction (>50% of original size) in 2; and partial reduction (<50% of original size) in 1. At a mean follow-up of 26 months after last sclerotherapy, recurrence was observed in only 1 patient; this patient showed complete response after reinjection of OK-432 solution. No significant complications were observed, with only fever and mild local pain observed in 4 patients for 2-4 days after treatment. OK-432 sclerotherapy is safe and effective in the treatment of pediatric plunging ranula. Sclerotherapy may become a primary treatment modality prior to surgery.

  12. The therapeutic effect of OK-432 (picibanil) sclerotherapy for benign neck cysts.

    Science.gov (United States)

    Kim, Myung Gu; Kim, Sun Gon; Lee, Jun Ho; Eun, Young Gyu; Yeo, Seung Geun

    2008-12-01

    In general, benign neck cysts are treated by surgical excision. This can present technical difficulties and frequent recurrences, because of insufficient surgery. Sclerosing agents such as OK-432 have been tested for the nonsurgical treatment of these cysts. We have assessed the efficacy of OK-432 sclerotherapy for benign neck cysts. The study group consisted of 75 patients (42 men, 33 women) diagnosed with and treated for benign neck cysts between March 2001 and December 2007 by intralesional injection of OK-432. The liquid content of each cyst was aspirated as much as possible, and the same volume of OK-432 solution was injected. Patients were assessed by ultrasonography or computerized tomography, and therapeutic outcomes and adverse effects were evaluated by patient age, sex, cyst type, and number of injections. Of the 75 treated patients, 31 (41.3%) showed total shrinkage, seven (9.3%) showed near-total shrinkage (>90% of cyst volume), five (6.6%) showed marked shrinkage (>70% of cyst volume), and 17 (22.7%) showed partial shrinkage (<70% of cyst volume). No response was seen in 15 patients (20%). Despite repeated sclerotherapy, eight patients (10.7%) showed recurrences. Minor adverse effects of therapy included fever, localized pain, and odynophagia but these complications spontaneously disappeared within several days. OK-432 sclerotherapy is a safe and effective primary alternative to surgery in patients with benign neck cysts.

  13. Combination therapy with radiation and OK-432 immunotherapy of cancer patients

    International Nuclear Information System (INIS)

    Hashimoto, Shozo; Miyamoto, Hiroshi

    1978-01-01

    We treated cancer patients with radiotherapy alone and with radiation plus immunotherapy at the Department of Radiology, Keio University Hospital. In all of the cancer patients who had radiationtherapy alone, a general depression in their immune reactivity was seen, but not seen in those who received radiationtherapy plus immunotherapy. Immunotherapy is defined as a stimulator of cancer patient's immune reaction. Usually radiationtherapy caused lymphopenia in which mainly T lymphocytes were decreased in number selectively, but there was no lymphopenia in cases treated with immunotherapy. We have performed nonspecific immunotherapy with OK-432. The result indicated that T lymphocytes were increased by OK-432 in spite of radiationtherapy. From this fact, OK-432 will be useful for suppression of metastasis and regression of tumors. (auth.)

  14. 17 CFR 4.32 - Trading on a Registered Derivatives Transaction Execution Facility for Non-Institutional Customers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Trading on a Registered Derivatives Transaction Execution Facility for Non-Institutional Customers. 4.32 Section 4.32 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION COMMODITY POOL OPERATORS AND COMMODITY TRADING...

  15. 40 CFR 432.22 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.22 Section 432.22... attainable by the application of the best practicable control technology currently available (BPT). Except as... limitations: (1) In the case of process wastewater associated with the slaughtering of animals on-site or the...

  16. 40 CFR 432.12 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.12 Section 432.12... attainable by the application of the best practicable control technology currently available (BPT). Except as...) In the case of process wastewater associated with the slaughtering of animals on-site or the...

  17. 40 CFR 432.42 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.42 Section 432.42... attainable by the application of the best practicable control technology currently available (BPT). Except as...) In the case of process wastewater associated with the slaughtering of animals on-site or the...

  18. 40 CFR 432.32 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... application of the best practicable control technology currently available (BPT). 432.32 Section 432.32... attainable by the application of the best practicable control technology currently available (BPT). Except as...) In the case of process wastewater associated with slaughtering of animals on-site or the processing...

  19. [Effect of intravenous treatment with OK-432 on the bone marrow in patients with lung cancer].

    Science.gov (United States)

    Fujii, M; Ishikawa, M; Toki, H

    1984-03-01

    We studied effects of OK-432 on the bone marrow and peripheral blood cells of lung cancer patients. The nuclear cell count of bone marrow increased in 5 to 7 patients upon intravenous treatment with OK-432 compared with 3 of 6 patients who were intramuscularly treated with OK-432. Serial neutrophil counts of bone marrow increased in all 7 patients treated intravenously compared with 3 of 6 patients treated intramuscularly. The mean nuclear cell count or the serial neutrophil count of bone marrow in intravenously treated patients was significantly higher than the pretreatment values (p less than 0.001). In the peripheral blood picture, the difference in white blood cells or neutrophils before and after intravenous treatment was also statistically significant (p less than 0.01). There was no change in the erythrocytic series count of bone marrow and the hemoglobin count. Our results support the superiority of intravenous OK-432 treatment over intramuscular treatment in the growth-accelerating effect on bone marrow cells, especially regarding the neutrophil series.

  20. Experimental intraperitoneal infusion of OK-432 in rats: Evaluation of peritoneal complications and pathology

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong Wook [Department of Radiology, Busan Paik Hospital, Inje University College of Medicine, Busan (Korea, Republic of); Kim, Hak Jin, E-mail: hakjink@pusan.ac.k [Department of Radiology, Pusan National University Hospital, Pusan National University College of Medicine, Medical Research Institute, Busan (Korea, Republic of); Lee, Jun Woo [Department of Radiology, Pusan National University Hospital, Pusan National University College of Medicine, Medical Research Institute, Busan (Korea, Republic of)

    2010-06-15

    Purpose: OK-432 is known to be a potent sclerosant of cystic lesions. The purpose of this study was to evaluate both its safety and pathologic effects after the infusion of OK-432 into the peritoneal cavity of rats. Materials and methods: Twenty male rats were used in this study. Twelve rats were infused intraperitoneally with 0.2 Klinishe Einheit of OK-432 melted in 2 mL of normal saline (group 1: the treated group); four rats each were infused intraperitoneally with 0.5 mL of 99% ethanol (group 2) and normal saline (group 3), and served as the control groups. An abdominal ultrasonographic examination was performed both before and after the infusions in all rats. Three rats in group 1 and one rat in each of groups 2 and 3 were sacrificed each week following the infusion. Gross and microscopic evaluations of the peritoneum and abdominal cavity were performed on each rat. Results: In group 1, the abdomen was clear on gross inspection and the peritoneum was unremarkable on microscopic examination. In group 2, mild-to-moderate peritoneal adhesions were revealed grossly, and inflammation and fibrosis of the peritoneum were demonstrated microscopically. In group 3, no specific abnormalities were noted on gross or microscopic examinations. Conclusion: Leakage or abnormal infusion of OK-432 solution into the peritoneal cavity during sclerotherapy of intra-abdominal or retroperitoneal cystic lesions does not result in any significant complications.

  1. Experimental intraperitoneal infusion of OK-432 in rats: Evaluation of peritoneal complications and pathology

    International Nuclear Information System (INIS)

    Kim, Dong Wook; Kim, Hak Jin; Lee, Jun Woo

    2010-01-01

    Purpose: OK-432 is known to be a potent sclerosant of cystic lesions. The purpose of this study was to evaluate both its safety and pathologic effects after the infusion of OK-432 into the peritoneal cavity of rats. Materials and methods: Twenty male rats were used in this study. Twelve rats were infused intraperitoneally with 0.2 Klinishe Einheit of OK-432 melted in 2 mL of normal saline (group 1: the treated group); four rats each were infused intraperitoneally with 0.5 mL of 99% ethanol (group 2) and normal saline (group 3), and served as the control groups. An abdominal ultrasonographic examination was performed both before and after the infusions in all rats. Three rats in group 1 and one rat in each of groups 2 and 3 were sacrificed each week following the infusion. Gross and microscopic evaluations of the peritoneum and abdominal cavity were performed on each rat. Results: In group 1, the abdomen was clear on gross inspection and the peritoneum was unremarkable on microscopic examination. In group 2, mild-to-moderate peritoneal adhesions were revealed grossly, and inflammation and fibrosis of the peritoneum were demonstrated microscopically. In group 3, no specific abnormalities were noted on gross or microscopic examinations. Conclusion: Leakage or abnormal infusion of OK-432 solution into the peritoneal cavity during sclerotherapy of intra-abdominal or retroperitoneal cystic lesions does not result in any significant complications.

  2. 42 CFR 488.432 - Civil money penalties: When a penalty is collected.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Civil money penalties: When a penalty is collected... PROCEDURES Enforcement of Compliance for Long-Term Care Facilities with Deficiencies § 488.432 Civil money... hearing on the determination of the noncompliance that is the basis for imposition of the civil money...

  3. 11 CFR 101.1 - Candidate designations (2 U.S.C. 432(e)(1)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate designations (2 U.S.C. 432(e)(1)). 101.1 Section 101.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CANDIDATE STATUS AND... and address, party affiliation, and office sought, the District and State in which Federal office is...

  4. 11 CFR 102.11 - Petty cash fund (2 U.S.C. 432(h)(2)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Petty cash fund (2 U.S.C. 432(h)(2)). 102.11 Section 102.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REGISTRATION, ORGANIZATION, AND... and Congressional district) sought by such candidate. ...

  5. Comparison of 432 Pseudomonas strains through integration of genomic, functional, metabolic and expression data

    NARCIS (Netherlands)

    Koehorst, Jasper J.; Dam, van Jesse C.J.; Heck, van Ruben G.A.; Saccenti, Edoardo; Martins dos Santos, Vitor; Suarez-Diez, Maria; Schaap, Peter J.

    2016-01-01

    Pseudomonas is a highly versatile genus containing species that can be harmful to humans and plants while others are widely used for bioengineering and bioremediation. We analysed 432 sequenced Pseudomonas strains by integrating results from a large scale functional comparison using protein

  6. Alleviating action of OK-432 (Picibanil) on the myelosuppression in medulloblastoma patients induced by whole axis irradiation

    International Nuclear Information System (INIS)

    Aoki, Yoshiro

    1982-01-01

    The test subjects termed as OK-432 group which consist of 4 patients of Medulloblastoma and 2 of Pinealoma, underwent the whole axis irradiation in combination with OK-432. The control group consisting of 9 Medulloblastoma patients was subjected to the same radiation treatment without OK-432. Six of the nine patients (66.7%) irradiated showed the decrease of peripheral white blood cell counts down to 2,500, whereas, only two of six patients showed a similar decrement in OK-432 group. Three of the nine patients (33.3%) in the control group showed the decrease of white blood cell down to 2,000, but only one of the six patients in OK-432 group. The neutrophil counts decreased below the level of 1,000 in three of the nine patients (33.3%) in the control group, but none in the OK-432 group. The platelet counts decreased below the level of 100,000 in five of the nine patients (55.6%) in the control group during the irradiation period, but only one patient in the OK-432 group showed a decrease down to 100,000 counts. Three of the nine patients (33.3%) in the control group had to be stopped irradiation due to the severe leukopenia and thrombocytopenia, in contrast to the OK-432 group, which completed whole axis irradiation without interruption. These results seem to indicate that OK-432 alleviated the myelosuppression induced in patients by whole axis irradiation. This alleviating action of OK-432 is considered to be applicable to the treatment of Medulloblastoma patients. (J.P.N.)

  7. Alleviating action of OK-432 (Picibanil) on the myelosuppression in Medulloblastoma patients induced by whole axis irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Aoki, Yoshiro (National Inst. of Radiological Sciences, Chiba (Japan))

    1982-11-01

    The test subjects termed as OK-432 group which consist of 4 patients of Medulloblastoma and 2 of Pinealoma, underwent the whole axis irradiation in combination with OK-432. The control group consisting of 9 Medulloblastoma patients was subjected to the same radiation treatment without OK-432. Six of the nine patients (66.7%) irradiated showed the decrease of peripheral white blood cell counts down to 2,500, whereas, only two of six patients showed a similar decrement in OK-432 group. Three of the nine patients (33.3%) in the control group showed the decrease of white blood cell down to 2,000, but only one of the six patients in OK-432 group. The neutrophil counts decreased below the level of 1,000 in three of the nine patients (33.3%) in the control group, but none in the OK-432 group. The platelet counts decreased below the level of 100,000 in five of the nine patients (55.6%) in the control group during the irradiation period, but only one patient in the OK-432 group showed a decrease down to 100,000 counts. Three of the nine patients (33.3%) in the control group had to be stopped irradiation due to the severe leukopenia and thrombocytopenia, in contrast to the OK-432 group, which completed whole axis irradiation without interruption. These results seem to indicate that OK-432 alleviated the myelosuppression induced in patients by whole axis irradiation. This alleviating action of OK-432 is considered to be applicable to the treatment of Medulloblastoma patients.

  8. Treatment of lymphatic malformations with OK-432 (Picibanil): review of the literature.

    Science.gov (United States)

    Poldervaart, Michelle T; Breugem, Corstiaan C; Speleman, Lucienne; Pasmans, Suzanne

    2009-07-01

    Lymphatic malformations (LM) are benign structural defects that can cause serious complications because of their size and location. Traditionally, surgical removal was the first treatment modality, but this could be associated with many complications and risks. Since Ogita introduced OK-432 (picibanil) in 1987 as a treatment method, this sclerosant has become popular. This paper is a review of the trials published so far on this topic. A literature search of English trials with 5 or more patients in it with LM who had never been treated before was done. The paper had to use the microcystic-macrocystic classification and have a mean follow-up of more than a year to be included in this review. Results were classified as "excellent" when the lesions show a regression of more than 90%, "good" when regression is more than 50%, and "poor" when shrinkage is less than 50% (this also includes no response at all). Twenty-seven percent of microcystic LMs show an excellent result; 33%, a good result; and 40%, a poor result. Of the macrocystic LMs, 88% have excellent results. Recurrence rates vary from 5% to 8%. The adverse effects are mostly mild. Most trials have a short follow-up; therefore, there are uncertainties when it comes to cure and regression. Mostly, the adverse effects of OK-432 are trivial and disappear after a week, but the need for a temporary tracheostomy has been described. Screening for allergic reactions to penicilline is needed, with the risk of anaphylactic shock in mind. It is difficult to compare the different techniques used by the authors, and none of the trials included in this study are randomized controlled trials; most are retrospective and were so-called level 4 studies. This review demonstrates that OK-432 is an effective way to treat LM. Because of a possible risk of airway obstruction, treatment should always take place in specialized treatment facilities. Macrocystic lesions show a better response to OK-432 treatment than microcystic lesions

  9. Evaluation of OK-432 Injection Therapy as Possible Primary Treatment of Intraoral Ranula.

    Science.gov (United States)

    Kono, Michihide; Satomi, Takafumi; Abukawa, Harutsugi; Hasegawa, On; Watanabe, Masato; Chikazu, Daichi

    2017-02-01

    A ranula is a pseudocyst caused by mucous extravasation from the sublingual gland. Recently, a sclerosing agent, OK-432 (picibanil), has been reported to be highly effective for treating lymphangioma and cervical cystic lesions. The present study assessed the effectiveness of OK-432 injection therapy for intraoral ranula to clarify whether it can be used as the primary treatment. The present study was a retrospective clinical study of patients with intraoral ranula who received OK-432 injection therapy from 2005 to 2015. The ranula size was measured on computed tomography or magnetic resonance imaging studies. We dissolved 1 Klinische Einheit (KE) unit of OK-432 powder in normal saline equal to the aspiration volume. The primary endpoint was the treatment results. The secondary endpoints were the relation between the treatment results and the lesion length and aspiration volume. A total of 23 patients received OK-432 injection therapy for an intraoral ranula. The mean lesion size was 19.96 mm. The mean aspiration volume was 2.14 mL. The number of injections was 1 to 4 (mean 1.70). The treatment results were complete regression (CR) in 18 (78.2%), partial regression (PR) in 3 (13.0%), and no response (NR) in 2 (8%) patients after the last injection. The overall efficacy rate was 91.2% (21 of 23). No serious complications were observed. The lesion length and aspiration volume of the CR group was 17.38 mm and 1.40 mL, respectively. The lesion length and aspiration volume of the PR/NR group was 29.20 mm and 4.80 mL, respectively. The PR/NR group lesions were significantly larger than the CR group lesions. OK-432 injection therapy for intraoral ranula is safe and effective compared with other surgical therapies. This therapy could potentially become a primary treatment of intraoral ranula. Copyright © 2016 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.

  10. Experimental performance of R432A to replace R22 in residential air-conditioners and heat pumps

    International Nuclear Information System (INIS)

    Park, Ki-Jung; Shim, Yun-Bo; Jung, Dongsoo

    2009-01-01

    In this study, thermodynamic performance of R432A and HCFC22 is measured in a heat pump bench tester under both air-conditioning and heat pumping conditions. R432A has no ozone depletion potential and very low greenhouse warming potential of less than 5. R432A also offers a similar vapor pressure to HCFC22 for 'drop-in' replacement. Test results showed that the coefficient of performance and capacity of R432A are 8.5-8.7% and 1.9-6.4% higher than those of HCFC22 for both conditions. The compressor discharge temperature of R432A is 14.1-17.3 deg. C lower than that of HCFC22 while the amount of charge for R432A is 50% lower than that of HCFC22 due to its low density. Overall, R432A is a good long term 'drop-in' environmentally friendly alternative to replace HCFC22 in residential air-conditioners and heat pumps due to its excellent thermodynamic and environmental properties

  11. Percutaneous sclerotherapy of sialoceles after parotidectomy with fibrin glue, OK-432, and bleomycin.

    Science.gov (United States)

    Chen, Wei-liang; Zhang, Li-ping; Huang, Zhi-quan; Zhou, Bin

    2013-12-01

    We evaluated the curative effect of fibrin glue combined with OK-432 (streptococcal pyrogenic exotoxin A, Picibanil™) and bleomycin on 9 patients with sialoceles after parotidectomy. The primary lesions included pleomorphic adenomas in 6 cases and Warthin's tumours in 3 cases. After a sialocele had been diagnosed each patient had repeated aspirations and pressure dressings for 3-4 weeks, but these treatments failed. The patients were then treated with percutaneous sclerotherapy with the injection of fibrin glue 8-10 ml combined with OK-432 5 mg and bleomycin 15 mg. All the sialoceles disappeared completely after a single procedure in 2-3 weeks. The patients have been followed up for more than 6 months with no evidence of recurrent sialocele or injury to the facial nerve related to sclerotherapy. This simple, safe technique can be successfully used to treat sialoceles after parotidectomy. Copyright © 2013 The British Association of Oral and Maxillofacial Surgeons. Published by Elsevier Ltd. All rights reserved.

  12. Picibanil (OK-432) in the treatment of head and neck lymphangiomas in children

    OpenAIRE

    Rebuffini, Elena; Zuccarino, Luca; Grecchi, Emma; Carinci, Francesco; Merulla, Vittorio Emanuele

    2012-01-01

    Background: Picibanil (OK-432) is a lyophilized mixture of group A Streptococcus pyogenes with antineoplastic activity. Because of its capacity to produce a selective fibrosis of lymphangiomas (LMs), it has been approved by Japanese administration in 1995 for the treatment of LMs. Materials and Methods: We treated 15 children (age range: 6-60 months) affected by head and neck macrocystic LMs with intracystic injections (single dose of 0.2 mL) of Picibanil (1-3 injections). Results: Co...

  13. Treatment of lymphangiomas with OK-432 (Picibanil) sclerotherapy: a prospective multi-institutional trial.

    Science.gov (United States)

    Giguère, Chantal M; Bauman, Nancy M; Sato, Yutaka; Burke, Diane K; Greinwald, John H; Pransky, Seth; Kelley, Peggy; Georgeson, Keith; Smith, Richard J H

    2002-10-01

    To describe and to determine the robustness of our study evaluating the efficacy of OK-432 (Picibanil) as a therapeutic modality for lymphangiomas. Prospective, randomized trial and parallel-case series at 13 US tertiary care referral centers. Thirty patients diagnosed as having lymphangioma. Ages in 25 ranged from 6 months to 18 years. Twenty-nine had lesions located in the head-and-neck area. Every patient received a 4-dose injection series of OK-432 scheduled 6 to 8 weeks apart unless a contraindication existed or a complete response was observed before completion of all injections. A control group was observed for 6 months. Successful outcome of therapy was defined as a complete or a substantial (>60%) reduction in lymphangioma size as determined by calculated lesion volumes on computed tomographic or magnetic resonance imaging scans. Overall, 19 (86%) of the 22 patients with predominantly macrocystic lymphangiomas had a successful outcome. OK-432 should be efficacious in the treatment of lymphangiomas. Our study design is well structured to clearly define the role of this treatment agent.

  14. Vaccination with OK-432 followed by TC-1 tumor lysate leads to significant antitumor effects.

    Science.gov (United States)

    Chen, I-Ju; Yen, Chih-Feng; Lin, Kun-Ju; Lee, Chyi-Long; Soong, Yung-Kuei; Lai, Chyong-Huey; Lin, Cheng-Tao

    2011-07-01

    Human papillomavirus (HPV) infects large numbers of women worldwide and is present in more than 99% of all cervical cancer. TC-1 cell is a cell line with high expression of E7 antigen of HPV type 16 and its cell lysate has been demonstrated as an ideal inducer of E7-specific, antitumor immunity. OK-432 (Picibanil), a penicillin-killed Streptococcus pyogenes, has been reported with potent immunomodulation properties in cancer treatment by stimulating the maturation of dendritic cells (DCs) and secretion of Th-1 type cytokines. The current study demonstrated that a protocol to immunize the C57BL/6 mice with OK-432 followed by treatment with TC-1 lysate can generate markedly increased immune responses of E7-specific CD4(+) T cells and a moderate increase of natural killer (NK) cell, as well as a satisfactorily protective and therapeutic antitumor effect by triggering the DCs to prime T cells. Depletion of lymphocyte subset in vivo suggested that the antitumor effects could be dominantly executed by CD8+ T cells and followed by NK cells, and both of these reactions were induced by the generation of robust E7-specific CD4(+) T helper cell response. These findings warrant OK-432 combination with tumor-lysate as an effective and safe vaccine in future clinical application of cervical cancer.

  15. Effect of Picibanil (OK 432) on the Scavenging Effect of Free Radicals Produced during Liver Regeneration in the Rat

    OpenAIRE

    Okamoto, Ko; Hamazaki, Keisuke; Iwagaki, Hiromi; Orita, Kunzo; Mori, Akitane

    1995-01-01

    We administered a biological response modifier Picibanil (OK-432), attenuated Streptococcus pyogenes, via the dorsal vein of the penis after 70% hepatectomy in rats, and clarified the scavenging effect of Picibanil on free radicals generated in the regenerating liver. A group of 5 rats was intravenously administered with 25 KE/kg of OK-432 after hepatectomy, while the control group was given saline after hepatectomy. Serum levels of aspartate aminotransferase and alanine aminotransferase and ...

  16. Final irradiation and postirradiation data from the NRC/PNL instrumented assembly IFA-432

    International Nuclear Information System (INIS)

    Lanning, D.D.; Bradley, E.R.

    1986-02-01

    The instrumented six-rod test assembly IFA-432, sponsored by USNRC, operated in the Halden Reactor from December 1975 to May 1984, with surviving fuel thermocouples, neutron detectors and pressure transducers. Peak burnups of 46 MWd/kgM were achieved. Interim destructive examination data were obtained at peak burnups of 24 and 34 MWd/kgM. This paper presents a synopsis of the irradiation histories and postirradiation examination data for the high burnup rods. The postirradiation condition of the rods correlates well with their individual design parameters and operating conditions

  17. Therapie einer postoperativ entstandenen zystischen Raumforderung mit Picibanil (OK-432): Ein Fallbericht

    OpenAIRE

    Schlüter, A; Weller, P; Mattheis, S; Lang, S

    2014-01-01

    Einleitung: Picibanil (=OK432) ist ein Lysat bestehend aus Penicillin G und mit H2O2 attenuiertem Streptococcus pyogenes. In den letzten Jahrzehnten wurde Picibanil zur Therapie von Pleuraergüssen, Lymphangiomen, Chylusfisteln, medianen Halszysten und Ranulae eingesetzt. Es verursacht eine Immunreaktion mit aseptischer Entzündung. Dies führt zu einer Zerstörung des Endothels und konsekutiv zu einer Verklebung und Schrumpfung des Zystensacks.Falldarstellung: Wir berichten über einen 40-jähri...

  18. Treatment of Primary Fetal Hydrothorax with OK-432 (Picibanil): Outcome in 14 Fetuses and a Review of the Literature.

    Science.gov (United States)

    O'Brien, Brooke; Kesby, Greg; Ogle, Robert; Rieger, Ingrid; Hyett, Jon A

    2015-01-01

    Primary fetal hydrothorax (PFHT) is an uncommon condition with an estimated prevalence of 1 in 10,000/15,000 pregnancies. Therapeutic interventions include thoracocentesis, thoraco-amniotic shunting (TAS), and pleurodesis using OK-432. A review of the literature was performed to identify all cases of PFHT treated with TAS and OK-432. All cases of PFHT referred to the Fetal Maternal Unit at Royal Prince Alfred Hospital between 2002 and 2012 were retrospectively reviewed. In the cohort of fetuses treated with OK-432, the main perinatal outcomes evaluated were termination of pregnancy, live birth, neonatal death, and fetal death in utero. Secondary outcomes included gestational age (GA) at diagnosis, GA at treatment, GA at resolution, birth weight, and GA at birth. The development of the children was screened using the Ages and Stages Questionnaires, Version 3 (ASQ-3, 2009). Primary hydrothorax was diagnosed in 31 fetuses, of which 14 had treatment with OK-432. One pregnancy terminated after treatment with OK-432. Survival was 85% (11/13): 100% in fetuses treated with OK-432 without hydrops, and 78% in those treated with hydrops. This compares well to the cases of TAS in the literature with an average survival of 63%: 85% in fetuses without hydrops and 55% with hydrops. The mean GA at birth was 36(+4) weeks and mean birth weight 3,007 g. Eight of the 9 children screened with ASQ-3 scored well within the normal range. OK-432 appears to be a valid treatment option in fetuses with PFHT, particularly in those diagnosed at early GAs. © 2014 S. Karger AG, Basel.

  19. New combined therapy of radiation and local administration of OK-432 for esophageal cancer

    International Nuclear Information System (INIS)

    Mukai, Minoru; Morita, Shinroku; Tsunemoto, Hiroshi

    1990-01-01

    We devised new combination therapy of radiation and local administration of OK-432 and performed for 26 patients with esophageal cancer between March, 1987 and December, 1988 as a pilot study. The average age was 73 years. Among 26 patients, males were 20 and females were six. Patients were irradiated at the schedule of under 2 Gy/day and the dose of TDF (time, dose and fractionation factor) 100 totally. OK-432, 10KE was endoscopically administered around cancer lesion at the beginning of the radiotherapy, and two weeks later, 5KE was given in the same manner. Complete response was obtained in 20 out of 26 cases (77%) and partial response was obtained in the remaining six cases (23%). All six patients with tumor length less than five cm showed complete response. All 16 patients who could not eat food orally before treatment, became to take food enough orally after the treatment and could discharge in good condition. One year and two years survival rate of 26 patients by Kaplan Meier method were 67.4% and 47.2%, respectively. Six patients with tumor length less than five cm, are all alive without a sign of recurrence. This combination therapy will improve not only the response rate and the survival rate, but also the quality of life of patients with esophageal cancer. (author)

  20. Modification of radiation therapy by RP-170, hypoxic cell sensitizer and OK-432, biological response modifier (BRM)

    International Nuclear Information System (INIS)

    Murayama, Chieko; Mori, Tomoyuki; Tamauchi, Hidekazu

    1995-01-01

    Studies have shown that the combination therapy with RP-170, irradiation and OK-432 could produce significantly higher antitumor effect. The multiple local administration of OK-432 showed superior sensitizing effect in tumor growth delay, tumor control and survival rate. DMF from TCD 50 assay was 2.09 which might be equivalent to that from irradiation with over several hundred mg/kg of RP-170. Additionally combined with 50 mg/kg RP-170, nearly available dose in clinical use, the combined treatment with RP-170, irradiation and OK-432 produced DMF of 1.4, which could be gotten by over 100 mg/kg of RP-170. The success of this combination therapy on murine tumors might also suggest a possibility for a great benefit in clinical radiotherapy. More detailed investigations, histological and immunological research, are under progress. 14 refs., 2 tabs., 3 figs

  1. IFPE/IFA-432, Fission Gas Release, Mechanical Interaction BWR Fuel Rods, Halden

    International Nuclear Information System (INIS)

    Turnbull, J.A.

    1996-01-01

    Description: It contains data from experiments that have been performed at the IFE/OECD Halden Reactor Project, available for use in fuel performance studies. It covers experiments on thermal performance, fission product release, clad properties and pellet clad mechanical interaction. It includes also experimental data relevant to high burn-up behaviour. IFA-432: Measurements of fuel temperature response, fission gas release and mechanical interaction on BWR-type fuel rods up to high burn-ups. The assembly featured several variations in rod design parameters, including fuel type, fuel/cladding gap size, fill gas composition (He and Xe) and fuel stability. It contained 6 BWR-type fuel rods with fuel centre thermocouples at two horizontal planes, rods were also equipped with pressure transducers and cladding extensometers. Only data from 6 rods are compiled here

  2. OK432 (picibanil) efficacy in an adult with cystic cervical lymphangioma. A case report.

    Science.gov (United States)

    Alonso, Juan; Barbier, Luis; Alvarez, Julio; Romo, Laura; Martín, Jesús C; Arteagoitia, Iciar; Santamaría, Joseba

    2005-01-01

    Cervical cystic lymphangioma (CCL) is a rare and benign tumour involving congenital and cystic abnormalities derived from lymphatic vessels. The most accepted treatment continues to be surgical excision. However, when this infiltrates vital neurovascular neck structures, complete excision is difficult and if only partial, the recurrence rate is very high. The most frequently used alternative treatment is to inject sclerosants into the lesion. The use of these techniques has reported good results in children; however, there are few references thereof with regard to adults. We are reporting on a cervical cystic lymphangioma in a male aged 22, treated with an intra-lesion injection of 20 cc with 0.01 mg/cc dilution of OK-432 (picibanil) in physiological serum. Sole complications were fever and local reaction where the solution was injected. One month after treatment the lymphangioma had totally remitted and sixteen months later continues in remittance.

  3. Treatment of lymphangiomas in children: an update of Picibanil (OK-432) sclerotherapy.

    Science.gov (United States)

    Greinwald, J H; Burke, D K; Sato, Y; Poust, R I; Kimura, K; Bauman, N M; Smith, R J

    1999-10-01

    Picibanil (OK-432) is a sclerosing agent derived from a low-virulence strain of Streptococcus pyogenes that induces regression of macrocystic lymphangiomas. This report describes a prospective, nonrandomized trial to evaluate the efficacy of Picibanil in the treatment of 13 affected children ranging in age from 1 to 94 months. On average, 4.1 fluoroscopically guided intracystic injections were performed per child, with an average total dose of 0.56 mg of Picibanil. As judged by physical examination and radiographic studies, 5 children (42%) showed a complete or substantial response, and 2 children (16%) showed an intermediate response. No response was seen in 5 children (42%), 2 of whom had massive craniofacial lymphangioma. Factors that contribute to failure with Picibanil sclerotherapy are the presence of a significant microcystic component to the lesion, massive craniofacial involvement, and previous surgical resection. Macrocystic lymphangiomas of the infratemporal fossa or cervical area have the best response to therapy.

  4. 11 CFR 105.1 - Place of filing; House candidates and their authorized committees (2 U.S.C. 432(g)(1)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Place of filing; House candidates and their authorized committees (2 U.S.C. 432(g)(1)). 105.1 Section 105.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL DOCUMENT FILING (2 U.S.C. 432(g)) § 105.1 Place of filing; House candidates and their authorized...

  5. Percutaneous sclerotherapy of massive macrocystic lymphatic malformations of the face and neck using fibrin glue with OK-432 and bleomycin.

    Science.gov (United States)

    Chen, W-l; Huang, Z-q; Chai, Q; Zhang, D-m; Wang, Y-y; Wang, H-j; Wang, L; Fan, S

    2011-06-01

    Picibanil (OK-432) and bleomycin have been used as alternative sclerosing agents for lymphatic malformations. This study evaluated the clinical curative effect of sclerotherapy using fibrin glue combined with OK-432 and bleomycin for the treatment of macrocystic lymphatic malformations of the face and neck. Fifteen paediatric patients (6 males; 9 females, aged 13 months to 14 years) who had received percutaneous sclerotherapy for massive macrocystic lymphatic malformations of the face and neck were retrospectively reviewed. Affected regions included the neck, parotid region and parapharynx, mouth floor, face and cheek, and orbital regions. All patients showed preoperative symptoms of space-occupying lesions between 4 cm × 5 cm and 12 cm × 16 cm in size. Fibrin glue with OK-432 and bleomycin was injected under general anaesthesia. All patients received preoperative and follow-up CT scans. Outcomes were assessed by three surgeons. All patients exhibited mid-facial swelling for 3-4 weeks after surgery, but no major complications. Follow-up periods ranged from 8 to 16 months. Eight lesions were completely involuted, five were mostly involuted, and two were partially involuted. Percutaneous sclerotherapy using fibrin glue with OK-432 and bleomycin provided a simple, safe, and reliable alternative treatment for massive macrocystic lymphatic malformations of the face and neck. Copyright © 2011 International Association of Oral and Maxillofacial Surgeons. Published by Elsevier Ltd. All rights reserved.

  6. OK-432 (Picibanil) sclerotherapy for recurrent dislocation of the temporomandibular joint in elderly edentulous patients: Case reports.

    Science.gov (United States)

    Matsushita, Kazuhiro; Abe, Takae; Fujiwara, Toshikatsu

    2007-09-01

    Dislocation of the temporomandibular joint (TMJ) is a thorny problem not only for a patient but also a doctor. Especially for the elderly edentulous patients, it is very hard to treat the condition although there are many surgical and non-surgical procedures. We successfully treated it in two elderly edentulous patients by injection of OK-432 as a sclerosing agent.

  7. Data report for the NRC/PNL Halden Assembly IFA-432

    International Nuclear Information System (INIS)

    Hann, C.R.; Bradley, E.R.; Cunningham, M.E.; Lanning, D.D.; Marshall, R.K.; Williford, R.E.

    1978-08-01

    The report presents the in-reactor data collected from the NRC/PNL Halden Assembly IFA-432 as a part of the program entitled ''Experimental Vertification of Steady State Fuel Codes,'' sponsored by the Fuel Behavior Research Branch of the USNRC. The purpose of this program is to reduce the uncertainties of calculating the thermal stored energy in an operating nuclear fuel rod. The report presents fuel centerline thermocouple readings, cladding elongation monitor readings, rod internal pressure readings, and neutron detector readings. The neutron detector readings were corrected to represent rod local powers at the thermocouple locations. These data are presented in the form of plots of the variables versus time during the portion of the irradiation period from December 1975 to January 1978. Also included are descriptions of the test rationale, assembly and rod designs, test facility, instrument array and calibration, and data processing methods. Topical reports discussing specific aspects and results of the data analysis are referenced. As of May 1978, the assembly burnup had reached its design goal of 20,000 MWd/MTM. However, it has been decided to leave the assembly in core to collect high burnup fission gas release data. The xenon-filled Rod 4 was replaced with the non-instrumented Rod 8 (Rod 1 design) after the first cycle. Six of the twelve original thermocouples, four of the six cladding elongation monitors, all SPND'S and all pressure transducers remain operable at this writing

  8. Sclerotherapy with picibanil (OK-432) for congenital lymphatic malformation in the head and neck.

    Science.gov (United States)

    Sung, M W; Lee, D W; Kim, D Y; Lee, S J; Hwang, C H; Park, S W; Kim, K H

    2001-08-01

    Congenital lymphatic malformations of the head and neck (LMHN) present special challenges to the otolaryngologist-head and neck surgeon. Recently, a number of sclerotherapy trials have shown promising results. In this study, we present our experiences with picibanil (OK-432) sclerotherapy for this lesion. Retrospectively review. We retrospectively reviewed 21 patients who have undergone sclerotherapy with picibanil for LMHN. Satisfactory response with complete or nearly complete shrinkage of the lesions was observed in 15 cases after repeated sclerotherapy (average, two times). We did not observe any significant morbidity or complications in the patients treated with picibanil. Reduction in size of the mass was achieved in weeks to months. Some of the patients who had not had any other previous treatment showed remarkable reductions in size even after the first therapy. When we used picibanil sclerotherapy as a primary treatment for the LMHN, most of our patients showed satisfactory results regardless of the size or location of the lesions. Given with our experience and the reports that failure of picibanil sclerotherapy does not hinder subsequent surgical salvage procedures, we recommend trying picibanil sclerotherapy as a primary treatment for the LMHN and performing surgical excision as a secondary modality if the response to the sclerotherapy is not satisfactory.

  9. Randomized controlled study on the effect of adjuvant immunotherapy with OK-432 on malignant gliomas

    International Nuclear Information System (INIS)

    Shibata, Shobu; Mori, Kazuo; Moriyama, Tadayoshi; Tanaka, Keisei; Moroki, Jiro.

    1985-01-01

    During periods from January, 1981 to December, 1983, 51 patients (31 malignant astrocytomas, 17 glioblastomas, and others 3) were treated with radiochemotherapy using Nimustine hydrochloride, ACNU (group B) and radiochemoimmunotherapy with Picibanil, OK-432 (group A) by randomized controlled study. Group A consisted of 24 patients and group B of 27 patients. The differences in the background of the two groups were not statistically significant. Survival curves of both groups were shown by the Kaplan-Meier method. The postoperative survival rate at 1 year and 2 years were 70 % and 30 %, respectively, equal in both groups, and the differences between groups A and B were not statistically significant by the Cox-Mantel test. The side effects by group B therapy were most prominent in the bone marrow, and severe leukopenia occurred. However, group A therapy suppressed leukopenia after 2 months. Immunological parameters, such as purified protein derivative skin reaction test did not change, but streptococcal Su-polysaccharide skin reaction test became positive after group A therapy. (author)

  10. Picibanil (OK-432) in the treatment of head and neck lymphangiomas in children.

    Science.gov (United States)

    Rebuffini, Elena; Zuccarino, Luca; Grecchi, Emma; Carinci, Francesco; Merulla, Vittorio Emanuele

    2012-12-01

    Picibanil (OK-432) is a lyophilized mixture of group A Streptococcus pyogenes with antineoplastic activity. Because of its capacity to produce a selective fibrosis of lymphangiomas (LMs), it has been approved by Japanese administration in 1995 for the treatment of LMs. We treated 15 children (age range: 6-60 months) affected by head and neck macrocystic LMs with intracystic injections (single dose of 0.2 mL) of Picibanil (1-3 injections). Complete disappearance of the lesion was noticed in eight (53.33%) cases, a marked (>50%) reduction of LMs was found five (33.33%) cases, while a moderate (Picibanil side effects included fever, local inflammation, and transitory increase of blood platelets' concentration; a single case of anemia was resolved with concentrated red blood cells transfusion. Intracystic injection of Picibanil is an effective and safe treatment for macrocystic LMs in pediatric patients and may represent the treatment of choice in such cases, especially where surgical excision is associated with the risk of functional/cosmetic side effects.

  11. Treatment of lymphangiomas of the head and neck in children by intralesional injection of OK-432 (Picibanil).

    Science.gov (United States)

    Brewis, C; Pracy, J P; Albert, D M

    2000-04-01

    The treatments previously used for lymphangiomas of the head and neck in children-surgery and intralesional injection of sclerosants-are associated with significant morbidity. A new treatment-intralesional injection of OK-432-was used for lymphangiomas of the head and neck in 11 children. The results were total shrinkage in two, marked shrinkage in two, slight shrinkage in five and no response in two. The results were not affected by previous surgery nor by whether aspiration prior to injection was possible. There were no recurrences in those children in whom shrinkage occurred and no child had subsequent surgery following injection. The results of this series support those of previous series showing that OK-432 injection is an effective and safe treatment for lymphangiomas of the head and neck in children.

  12. OK-432 reduces mortality and bacterial translocation in irradiated and granulocyte-colony stimulating factor (G-CSF)-treated mice

    Energy Technology Data Exchange (ETDEWEB)

    Nose, Masako; Uzawa, Akiko; Ogyu, Toshiaki [National Inst. of Radiological Sciences, Chiba (Japan); Suzuki, Gen

    2001-06-01

    Acute radiation induces bacterial translocation from the gut, followed by systemic infection and sepsis. In order to reduce the mortality after acute whole body irradiation, it is essential to control bacterial translocation. In this study, we established a bacterial translocation assay as a sensitive method to detect minor mucosal injury by radiation. By utilizing this assay, we evaluated the adverse effects, if any, of hematopoietic reagents on the mucosal integrity in the respiratory and gastro-intestinal tracts. Bacterial translocation to the liver and spleen occurred after whole-body irradiation if the dose exceeded 6 Gy. The administration of G-CSF unexpectedly increased the bacterial translocation in 8 Gy-irradiated mice. The pharmaceutical preparation of low-virulent Streptococcus pyogenes, OK-432, significantly reduced the endotoxin levels in peripheral blood without any reduction of bacterial translocation. A combined treatment with G-CSF and OK-432 decreased bacterial translocation and prevented death. This result indicates that the early administration of G-CSF has an adverse effect on bacterial translocation, and that a combined treatment of G-CSF and OK-432 attenuates the adverse effect of G-CSF and improves the survival rate after acute irradiation. (author)

  13. Effect of concomitant use of immunomodulator (OK-432 and/or PSK) on advanced lung cancer (squamous cell carcinoma and adenocarcinoma) treated with radiation with combined chemotherapy

    International Nuclear Information System (INIS)

    Ogawa, Yasuhiro; Kimura, Shuji; Imajo, Yoshinari

    1982-01-01

    Between 1975 and 1979, 209 cases of primary lung cancer admitted to the department of radiology were treated with radiation with combined chemotherapy. OK-432 and/or PSK as an immunomodulator was administered to 130 of these cases, and survival curves were evaluated between the patients with OK-432 and/or PSK and those without immunomodulator. In 61 cases (squamous cell carcinoma and adenocarcinoma) in stage III (UICC, 1978), fifty percent survival period was found to be 12.5 months for 16 cases with OK-432, 13.5 months for 9 cases with OK-432 and PSK, 9.0 months for 18 cases with PSK, and 8.0 months for 18 cases without immunotherapy, respectively. (author)

  14. Effect of concomitant use of immunomodulator (OK-432 and/or PSK) on primary lung cancer (stages III, IV) treated with radiation combined with chemotherapy

    International Nuclear Information System (INIS)

    Kimura, S.; Ogawa, Y.; Imajo, Y.

    1982-01-01

    OK-432 (a lyophilized preparation of a low virulent strain, Su, of Streptococcus hemolytics (Group A) treated with penicillin G) and/or PSK (a protein-bound polysaccharide prepared from Coriolus versicolor) as an immunomodulator was administered to 209 patients of advanced lung cancer treated with radiation with combined chemotherapy. Their effects on immunological parameters and patients' survival periods were examined. Suppression of both PHA (phytohemagglutinin) skin test activities and lymphocyte blastoid transformation with PHA were reduced in the immunomodulator administered group compared with the non-administered group. Survival curves were evaluated between the patients with OK-432 and/or PSK and those without immunomodulator. It was suggested that OK-432 and/or PSK combined with radiation with combined chemotherapy was effective for the elongation of the survival period. These results indicated that the long-term administration of OK-432 and/or PSK was recommended for patients with advanced lung cancer. (author)

  15. Effect of soluble factors derived from oral cancer cells on the production of interferon-γ from peripheral blood mononuclear cells following stimulation with OK-432.

    Science.gov (United States)

    Ohe, Go; Sasai, Akiko; Uchida, Daisuke; Tamatani, Tetsuya; Nagai, Hirokazu; Miyamoto, Youji

    2013-08-01

    The streptococcal antitumor agent OK-432 is commonly used as an immunopotentiator for immunotherapy in various types of malignant tumors including oral cancer. It has been demonstrated that OK-432 elicits an antitumor effect by stimulating immunocompetent cells, thereby inducing multiple cytokines including interferon (IFN)-γ, interleukin (IL)-2 and IL-12. Serum concentrations of IFN-γ in patients with oral cancer were examined 24 h after administration of OK-432. Serum concentrations of IFN-γ in patients with advanced cancer were significantly lower than those in patients with early cancer. These results suggested that some soluble factors produced by cancer cells may inhibit IFN-γ production with OK-432. Thus, in the present study, an in vitro simulation model was established for the immune status of patients with oral cancer by adding conditioned medium (CM) derived from oral cancer cell lines into a culture of peripheral blood mononuclear cells (PBMCs) derived from a healthy volunteer. We investigated whether soluble factors derived from oral cancer cells affected IFN-γ production from PBMCs following stimulation with OK-432. PBMCs stimulated with OK-432 produced a large amount of IFN-γ; however, both IFN-γ production and cytotoxic activity from PBMCs induced by OK-432 were inhibited by the addition of CM in a dose-dependent manner. In order to examine these inhibitory effects against IFN-γ production, the contribution of inhibitory cytokines such as IL-4, IL-6, IL-10, transforming growth factor-β and vascular endothelial growth factor was investigated. However, neutralization of these inhibitory cytokines did not recover IFN-γ production inhibited by CM. These results indicated that unknown molecules may inhibit IFN-γ production from PBMCs following stimulation with OK-432.

  16. Evaluation of the in-pile pressure data from instrumented fuel assemblies IFA-431 and IFA-432

    International Nuclear Information System (INIS)

    Bradley, E.R.; Cunningham, M.E.; Lanning, D.D.; Williford, R.E.

    1979-10-01

    This report includes results of the examination of the in-pile pressure data from instrumented test assemblies IFA-431 and 432. The pressure data have been used to estimate the fission gas release fraction as a function of fuel burnup. Included are comparisons of the estimated release functions and those predicted by three fission gas release models using the experimental temperature histories of the fuel rods. These comparisons show that fuel temperature is the primary factor in determining fission gas release and that burnup-enhanced fission gas release is not important in UO 2 fuels irradiated to 1700 GJ/kgU

  17. O uso de Picibanil (OK-432 no tratamento do linfangioma de cabeça e pescoço

    Directory of Open Access Journals (Sweden)

    Mello-Filho Francisco V.

    2002-01-01

    Full Text Available Introdução e Objetivo: O Linfangioma Cérvico-Facial (LCF é geralmente um tumor volumoso, envolvendo estruturas importantes da face e do pescoço. A terapia habitualmente recomendada é a retirada cirúrgica, porém, esta é geralmente seguida de seqüelas importantes, causando deformidade da região. Com o objetivo de avaliarmos uma terapêutica alternativa, analisamos a eficiência do Picibanil (OK 432 no tratamento de LCF em crianças. Forma de Estudo: Clínico retrospectivo. Material e Método: Estudo retrospectivo de seis crianças com diagnóstico de LCF tratadas com OK-432 no HCFMRP-USP no período de 1997 a 2001. Foram analisadas as seguintes características dos LCF: dimensões, tipos de cistos e volume aspirado. Avaliamos, também, o número de aplicações de OK 432 com os respectivos intervalos de tempo utilizados, sua evolução, intercorrências e o resultado final do tratamento. Resultados: Os LCFs apresentavam de oito a 15cm em seu maior diâmetro, na ocasião da primeira consulta, sendo o tipo de cisto mais freqüentemente encontrado o tipo macro cisto. O volume de liquido aspirado variou de dois a 60 ml e o número de aplicações de uma a cinco vezes em intervalos variáveis de um mês a um ano. Em todos os pacientes ocorreu regressão da massa tumoral, sendo que em três houve o desaparecimento total do LCF. A única intercorrência observada foi febre em media de 38.2º C em todos pacientes. Conclusão: O OK 432 é uma droga segura, eficaz e que pode ser utilizada como medida de primeira escolha no tratamento do LCF.

  18. Efficacy of in vitro sensitized cells generated by in vivo priming with OK-432 for adoptive immunotherapy of the poorly immunogenic B16-Bl6 melanoma.

    Science.gov (United States)

    Mukai, S; Kato, H; Kimura, S; Asai, K; Kawahito, Y; Inoue, M; Yamamura, Y; Sano, H; Sugino, S; Shu, S; Kondo, M

    1996-02-01

    We investigated the efficacy of the streptococcal preparation OK-432 as an adjuvant for in vivo priming in induction of sensitized cells for adoptive immunotherapy of the poorly immunogenic B16-BL6 (BL6) melanoma. C57BL/6 (B6) mice were immunized subcutaneously (s.c.) with 3 x 10(6) viable BL6 tumor cells admixed with various doses of OK-432 ranging from 1 to 100 micrograms in the foot-pad. Draining popliteal lymph nodes (LNs) were harvested 7 days after immunization and LN cells were further sensitized with irradiated tumor cells in the presence of 60-300 IU/ml of IL-2 for 11 days. These in vitro sensitized (IVS) cells (2 x 10(6)) were transferred intravenously (i.v.) to B6 mice bearing 4-day pulmonary metastases established by i.v. injection of 2-4 x 10(5) viable BL6 cells. The mice were also received intraperitoneally (i.p.) 4 x 10(4) IU/day of IL-2 for 4 days after adoptive transfer. Transfer of IVS cells from mice immunized by s.c. injection of tumor cells admixed with 10 micrograms of OK-432 significantly reduced the numbers of BL6 pulmonary metastases compared with that of control IVS' cells without the administration of OK-432 (P = 0.003). These effective IVS cells also significantly prolonged the survival of treated animals (P = 0.003). Functional IVS cells required in vitro stimulation with tumor cells. However, addition of OK-432 in the vaccine resulted in no enhancement of in vitro cytotoxicity and no characteristic change of phenotype of IVS cells. These results suggest that in vivo priming of OK-432 facilitates the sensitization of tumor-reactive T-cells. The procedure of in vivo priming with OK-432 may be beneficial in the adoptive immunotherapy of melanoma.

  19. The bacterial preparation OK432 induces IL-12p70 secretion in human dendritic cells in a TLR3 dependent manner.

    Science.gov (United States)

    Hovden, Arnt-Ove; Karlsen, Marie; Jonsson, Roland; Appel, Silke

    2012-01-01

    Dendritic cells (DC) used in therapeutic cancer immunotherapy have to be able to stimulate T cells resulting in an immune response that can efficiently target the cancer cells. One of the critical hurdles has been the lack of IL-12p70 production when maturating the DC, which is rectified by using the bacterial preparation OK432 (trade name Picibanil) to mature the cells. In order to identify the mechanism behind OK432 stimulation of DC, we investigated the contribution of different TLR to examine their involvement in IL-12p70 production. By combining different inhibitors of TLR signaling, we demonstrate here that TLR3 is responsible for the IL-12p70 production of DC induced by OK432. Moreover, our data suggest that the ligand triggering IL-12p70 secretion upon TLR3 stimulation is sensitive to proteinase and partly also RNAse treatment. The fact that a bacterial compound like OK432 can activate the TLR3 pathway in human DC is a novel finding. OK432 demonstrates a critical ability to induce IL-12p70 production, which is of great relevance in DC based cancer immunotherapy.

  20. The bacterial preparation OK432 induces IL-12p70 secretion in human dendritic cells in a TLR3 dependent manner.

    Directory of Open Access Journals (Sweden)

    Arnt-Ove Hovden

    Full Text Available Dendritic cells (DC used in therapeutic cancer immunotherapy have to be able to stimulate T cells resulting in an immune response that can efficiently target the cancer cells. One of the critical hurdles has been the lack of IL-12p70 production when maturating the DC, which is rectified by using the bacterial preparation OK432 (trade name Picibanil to mature the cells. In order to identify the mechanism behind OK432 stimulation of DC, we investigated the contribution of different TLR to examine their involvement in IL-12p70 production. By combining different inhibitors of TLR signaling, we demonstrate here that TLR3 is responsible for the IL-12p70 production of DC induced by OK432. Moreover, our data suggest that the ligand triggering IL-12p70 secretion upon TLR3 stimulation is sensitive to proteinase and partly also RNAse treatment. The fact that a bacterial compound like OK432 can activate the TLR3 pathway in human DC is a novel finding. OK432 demonstrates a critical ability to induce IL-12p70 production, which is of great relevance in DC based cancer immunotherapy.

  1. 75 FR 15419 - Notice of Intent To Grant Exclusive License of U.S. Patent Application No. 12/432,842 Filed April...

    Science.gov (United States)

    2010-03-29

    ... Exclusive License of U.S. Patent Application No. 12/432,842 Filed April 30, 2009 Entitled: ``A Soil Stabilization Soil Comprising Same, and a Method of Stabilizing Soil'' AGENCY: Department of the Army, U.S. Army... climates with sandy, gravelly soils where emulsions and hydraulic cements will not effectively cure. If...

  2. Clinical response, drug survival and predictors thereof in 432 patients with ankylosing spondylitis switching anti tumor necrosis factor α therapy: Results from the Danish nationwide Danbio registry

    DEFF Research Database (Denmark)

    Glintborg, Bente; Østergaard, Mikkel; Krogh, N.

    2012-01-01

    , 432 patients (30%) switched to a second and 137 (10%) to a third biological drug. Compared with non-switchers, switchers were more frequently women (33%/22%), had shorter disease duration (3 years/5 years) and higher BASDAI (62(52-76) mm/56(43-69) mm (median(interquartile-range))), Bath AS Functional...

  3. Analysis of fuel relocation for the NRC/PNL Halden assemblies IFA-431, IFA-432, and IFA-513. Interim report

    International Nuclear Information System (INIS)

    Williford, R.E.; Mohr, C.L.; Lanning, D.D.; Cunningham, M.E.; Rausch, W.N.

    1980-06-01

    The effects of the thermally-induced cracking and subsequent relocation of UO2 fuel pellets on the thermal and mechanical behavior of light-water reactor fuel rods during irradiation are quantified in this report. Data from the Nuclear Regulatory Commission/Pacific Northwest Laboratory Halden experiments on instrumented fuel assemblies (IFA) IFA-431, IFA-432, and IFA-513 are analyzed. Beginning-of-life in-reactor measurements of fuel center temperatures, linear heat ratings, and cladding axial elongations are used in a new model to solve for the effective thermal conductivity and elastic moduli of the cracked fuel column. The primary assumptions of the new model are that (1) the cracked fuel is in a hydrostatic state of stress in the (r,theta) plane, and that (2) there is no axial slipping between fuel and cladding. Three basic parameters are used to describe the cracked fuel: (1) the crack pattern, (2) the crack roughness, and (3) the fuel surface (gap) roughness. Recommendations are made on refining the model

  4. The period analysis of V418 AQL, SU BOO, RV CVn, CR CAS, GV CYG, V432 PER, and BD+42 2782

    International Nuclear Information System (INIS)

    Zasche, P.; Wolf, M.; Kučáková, H.; Uhlař, R.

    2014-01-01

    The minimum timings of eclipsing binaries V418 Aql, SU Boo, RV CVn, CR Cas, GV Cyg, V432 Per, and BD+42 2782 were collected and analyzed. Their long-term behavior was studied via period analysis, revealing a periodic term in eclipse times. We derived 576 new times of minimum. Hence, to describe the periodic variation, a third-body hypothesis was proposed and the resulting orbital periods are as follows: 70, 7.4, 53, 37, 27, 53, and 18 yr, respectively. For the system V432 Per an additional 9.5 yr variation was also found. The predicted minimum masses of these distant bodies were calculated and their detectability discussed. The light curves of SU Boo and RV CVn were analyzed using the PHOEBE program, resulting in physical parameters of the components. New variable stars in the field of V418 Aql were discovered.

  5. 抽动障碍患儿432例血铅水平对脑电图活动的影响%Influence of Blood Lead Level on Electrical Activity of Brain in 432 Children with Tic Disorder

    Institute of Scientific and Technical Information of China (English)

    田广燕; 梁向荣; 高在芬; 刘勇

    2011-01-01

    目的 探讨抽动障碍患儿血铅水平变化对脑电活动的影响及其发病机制的研究,对比不同血铅水平患儿脑电图变化的特点.方法 对本院2005年1月- 2011年4月临床确诊的432例抽动障碍患儿进行血铅水平及脑电图检测.采用原子吸收光谱分析法测定其血铅水平,并进行t检验.将432例抽动障碍患儿分为3组,Ⅰ组:血铅水平<50μg·L-1;Ⅱ组:血铅水平50 ~ 100μg·L-1;Ⅲ组:血铅水平> 100 μg·L-1.结果 1.Ⅰ组患儿脑电图异常发生率为7.14%(2/28例),Ⅱ组患儿脑电图异常发生率为14.23%(40/281例),Ⅲ组患儿脑电图异常发生率为46.34%(57/123例).Ⅰ组与Ⅱ组脑电图异常发生率比较差异无统计学意义(P>0.05),Ⅰ组与Ⅲ组脑电图异常发生率比较差异有统计学意义(P<0.01),Ⅱ组与Ⅲ组脑电图异常发生率比较差异有统计学意义(P<0.01).2.除年龄≤4岁患儿外,脑电图异常患儿较脑电图正常患儿血铅水平明显升高(P<0.01,0.05).结论 血铅水平升高会加重抽动障碍患儿的脑功能损伤.及早进行驱铅治疗可能对抽动障碍患儿脑功能损伤的恢复有重要意义.%Objective To study the influence and pathogenesis of blood lead level on electrical activity of brain in children with tic disorder, and to research the characteristics of electroencephalogram (EEG) in children with different concentrations of blood lead. Methods The level of blood lead and EEG were assessed in 432 children with tic disorder from Jan. 2005 to Apr. 2011. The level of blood lead were examined by atomic absorption spectrophotometry method. Statistical analysis were performed by t - test. According to the blood lead level, the children were divided into 3 groups, group Ⅰ :blood lead 100 μg · L-1. Results 1. The EEG abnormal statistics results showed abnormal rate in group Ⅰ ,group Ⅱ and group Ⅲ were 7. 14% (2/28 cases) , 14.23% (40/ 281 cases) and 46. 34% (57/123 cases

  6. A Case of Sublingual Ranula That Responded Successfully to Localized Injection Treatment with OK-432 after Healing from Drug Induced Hypersensitivity Syndrome

    Directory of Open Access Journals (Sweden)

    Kunio Yoshizawa

    2016-01-01

    Full Text Available A ranula is a mucus retention cyst or pseudocyst caused by leakage of mucus from the sublingual gland and generally occurs in the oral floor. In addition, drug induced hypersensitivity syndrome (DIHS is a rare but well-recognized serious adverse effect characterized by fever, skin rashes, generalized lymphadenopathy, hepatitis, and hepatosplenomegaly and oral stomatitis. This paper presents the first case of successfully treated sublingual ranula with localized injection of OK-432 after healing from drug induced hypersensitivity syndrome, which has previously been unreported in the literature. We present the case of a 38-year-old Japanese woman with sublingual ranula that responded successfully to localized injection treatment with OK-432 after healing from drug induced hypersensitivity syndrome. She was affected with cutaneous myositis and interstitial lung disease when she was 26 years old. At the age 34 years, she received additional oral treatment of diaminodiphenyl-sulfone due to deterioration of the cutaneous myositis, which resulted in drug induced hypersensitivity syndrome (DIHS with severe oral stomatitis. Local injection of OK-432 to the ranula may be a very safe and useful treatment method even if the patient has a history of drug allergy and has connective tissue disease such as cutaneous myositis.

  7. 432-μm laser's beam-waist measurement for the polarimeter / interferometer on the EAST Tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Z. X.; Liu, H. Q.; Jie, Y. X. [Chinese Academy of Sciences, Anhui (China); and others

    2014-10-15

    A far-infrared (FIR) polarimeter / interferometer (PI) system is under development for measurements of the current-density and the electron-density profiles in the EAST tokamak. The system will utilize three identical 432-μm CHCOOH lasers pumped by a CO{sub 2} laser. Measurements of the laser beam's waist size and position are basic works. This paper will introduce three methods with a beam profiler and several focusing optical elements. The beam profiler can be used to show the spatial energy distribution of the laser beam. The active area of the profiler is 12.4 x 12.4 mm{sup 2}. Some focusing optical elements are needed to focus the beam in order for the beam profiler to receive the entire laser beam. Two principles and three methods are used in the measurement. The first and the third methods are based on the same principle, and the second method adopts an other principle. Due to the fast and convenient measurement, although the first method is a special form of the third and it can only give the size of beam waist, it is essential to the development of the experiment and it can provide guidance for the choices of the sizes of the optical elements in the next step. A concave mirror, a high-density polyethylene (HDPE) lens and a polymethylpentene (TPX) lens are each used in the measurement process. The results of these methods are close enough for the design of PI system's optical path.

  8. Pages 427 - 432.pmd

    African Journals Online (AJOL)

    Administrator

    the MPV decrease into consideration along with the White Blood Cell Count elevation would be beneficial in patients with ... children is still problematic. ... complete blood count was studied using horiba ABX. Pentra DX 120 automatic blood count device in two ... was analyzed, there was a linear relationship between.

  9. A phase II study of cisplatin, oral administration of etoposide, OK-432 and radiation therapy for inoperable stage III non-small cell lung cancer

    International Nuclear Information System (INIS)

    Abe, Yoshinao; Takahashi, Jutaro; Fukuda, Hiroshi

    1998-01-01

    This study was designed to evaluate the feasibility and efficiency of giving cisplatin, etoposide, and OK-432 concurrently with conventional radiotherapy (RTx) for patient's with inoperable stage III, based on the TNM classification according to the International Union against Cancer staging system for lung cancer (1987) non-small cell lung cancer (NSCLC). From January 1992 to December 1994, 31 patients with cytologically or histologically confirmed stage III NSCLC were treated with RTx, to a total dose of 56-64 Gy, with concurrent daily oral administration of etoposide (25 mg) and cisplatin (20 mg) for 5 days during the third or fourth week from the start of RTx. The subcutaneous injection of 1 or 2 KE of OK-432, three times a week, for the duration of radiotherapy also started from the beginning of RTx. The number of eligible patients was 29 (26 men and 3 women). Their mean age was 66 years (range, 55-77 years). Six patients had an Eastern Cooperative Oncology Group performance status (PS) of 0; 15, 1; 8; 2. Three were stage IIIA, and 26, stage IIIB. Histologically, 2 had adenocarcinoma, 23, squamous cell carcinoma, and 4, large cell carcinoma. In 27 of the 29 patients, the RTx schedule was completed. There were no treatment-related deaths. Grade 4 toxicity (according to World Health Organisation criteria) leukopenia (700/μl) was observed in 1 patient. The response rate was 79% and the median survival was 17 months. Survival rates at 1, 2 and 3 years were 62%, 31%, and 21%, respectively. The local failure rate was 51%. The combination of cisplatin, etoposide, and OK-432, given concurrently with conventional RTx is feasible and effective for inoperable stage III NSCLC. (author)

  10. Efficacy of dendritic cells matured early with OK-432 (Picibanil), prostaglandin E2, and interferon-alpha as a vaccine for a hormone refractory prostate cancer cell line.

    Science.gov (United States)

    Yoo, Changhee; Do, Hyun-Ah; Jeong, In Gab; Park, Hongzoo; Hwang, Jung-Jin; Hong, Jun Hyuk; Cho, Jin Seon; Choo, Myong-Soo; Ahn, Hanjong; Kim, Choung-Soo

    2010-09-01

    Dendritic cells (DCs) are potent antigen-presenting cells. OK432 (Picibanil) was introduced as a potent stimulator of DC maturation in combination with prostaglandin-E(2) and interferon-alpha. We compared the efficacy of a DC-prostate cancer vaccine using early-mature DCs stimulated with OK432, PGE2 and INF-alpha (OPA) with that of vaccines using other methods. On days 3 or 7 of DC culture, TNF-alpha (T), TNF-alpha and LPS (TL) or OPA were employed as maturation stimulators. DU145 cells subjected to heat stress were hybridized with mature DCs using polyethyleneglycol. T cells were sensitized by the hybrids, and their proliferative and cytokine secretion activities and cytotoxicity were measured. The yields of early-mature DCs were higher, compared to yields at the conventional maturation time (P<0.05). In the early maturation setting, the mean fusion ratios, calculated from the fraction of dual-positive cells, were 13.3%, 18.6%, and 39.9%, respectively (P=0.051) in the T only, TL, and OPA-treated groups. The function of cytotoxic T cells, which were sensitized with the hybrids containing DCs matured early with OPA, was superior to that using other methods. The antitumor effects of DC-DU145 hybrids generated with DCs subjected to early maturation with the OPA may be superior to that of the hybrids using conventional maturation methods.

  11. Unexpected Behavior of Enaminones: Interesting New Routes to 1,6-Naphthyridines, 2-Oxopyrrolidines and Pyrano[4,3,2-de][1,6]naphthyridines

    Directory of Open Access Journals (Sweden)

    Herbert Meier

    2012-12-01

    Full Text Available Reaction of enaminones 1a–d with 2-aminoprop-1-ene-1,1,3-tricarbonitrile (2 in the presence of AcOH/NH4OAc afforded 7-amino-5-oxo-5,6-dihydro-1,6-naphthyridine-8-carbonitrile derivatives 9a–d. On the other hand, 2-aminopyrano[4,3,2-de] [1,6]naphthyridine-3-carbonitriles 20a–c,e were the only obtained products from the reactions of 1a–d with 2 in the presence of AcOH/NaOAc, while 1d afforded [3,5-bis-(4-chloro-benzoyl-phenyl]-(4-chloro-phenyl-methanone 21 under the same condition. The reaction of 2 with diethyl acetylenedicarboxylate in the presence of AcOH/NH4OAc afforded (4-cyano-5-dicyanomethylene-2-oxo-2,5-dihydro-1H-pyrrol-3-yl-acetic acid ethyl ester 15B.

  12. Vaccination with NY-ESO-1 overlapping peptides mixed with Picibanil OK-432 and montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen.

    Science.gov (United States)

    Wada, Hisashi; Isobe, Midori; Kakimi, Kazuhiro; Mizote, Yu; Eikawa, Shingo; Sato, Eiichi; Takigawa, Nagio; Kiura, Katsuyuki; Tsuji, Kazuhide; Iwatsuki, Keiji; Yamasaki, Makoto; Miyata, Hiroshi; Matsushita, Hirokazu; Udono, Heiichiro; Seto, Yasuyuki; Yamada, Kazuhiro; Nishikawa, Hiroyoshi; Pan, Linda; Venhaus, Ralph; Oka, Mikio; Doki, Yuichiro; Nakayama, Eiichi

    2014-01-01

    We conducted a clinical trial of an NY-ESO-1 cancer vaccine using 4 synthetic overlapping long peptides (OLP; peptides #1, 79-108; #2, 100-129; #3, 121-150; and #4, 142-173) that include a highly immunogenic region of the NY-ESO-1 molecule. Nine patients were immunized with 0.25 mg each of three 30-mer and a 32-mer long NY-ESO-1 OLP mixed with 0.2 KE Picibanil OK-432 and 1.25 mL Montanide ISA-51. The primary endpoints of this study were safety and NY-ESO-1 immune responses. Five to 18 injections of the NY-ESO-1 OLP vaccine were well tolerated. Vaccine-related adverse events observed were fever and injection site reaction (grade 1 and 2). Two patients showed stable disease after vaccination. An NY-ESO-1-specific humoral immune response was observed in all patients and an antibody against peptide #3 (121-150) was detected firstly and strongly after vaccination. NY-ESO-1 CD4 and CD8 T-cell responses were elicited in these patients and their epitopes were identified. Using a multifunctional cytokine assay, the number of single or double cytokine-producing cells was increased in NY-ESO-1-specific CD4 and CD8 T cells after vaccination. Multiple cytokine-producing cells were observed in PD-1 (-) and PD-1 (+) CD4 T cells. In conclusion, our study indicated that the NY-ESO-1 OLP vaccine mixed with Picibanil OK-432 and Montanide ISA-51 was well tolerated and elicited NY-ESO-1-specific humoral and CD4 and CD8 T-cell responses in immunized patients.

  13. Failure to Diagnose Hyperparathyroidism in 10,432 Patients With Hypercalcemia: Opportunities for System-level Intervention to Increase Surgical Referrals and Cure.

    Science.gov (United States)

    Balentine, Courtney J; Xie, Rongbing; Kirklin, James K; Chen, Herbert

    2017-10-01

    To determine whether a significant number of patients with hyperparathyroidism remain undiagnosed and untreated. Failure to diagnose primary hyperparathyroidism and refer patients to surgeons leads to impaired quality of life and increased costs. We hypothesized that many patients with hyperparathyroidism would be untreated due to not considering the diagnosis, inadequate evaluation of hypercalcemia, and under-referral to surgeons. We reviewed administrative data on 682,704 patients from a tertiary referral center between 2011 and 2015, and identified hypercalcemia (>10.5 mg/dL) in 10,432 patients. We evaluated whether hypercalcemic patients underwent measurement of parathyroid hormone (PTH), had documentation of hypercalcemia/hyperparathyroidism, or were referred to surgeons. The mean age of our cohort was 54 years, with 61% females, and 56% whites. Only 3200 (31%) hypercalcemic patients had PTH levels measured, 2914 (28%) had a documented diagnosis of hypercalcemia, and 880 (8%) had a diagnosis of hyperparathyroidism in the medical record. Only 592 (22%) out of 2666 patients with classic hyperparathyroidism (abnormal calcium and PTH) were referred to surgeons. A significant proportion of patients with hyperparathyroidism do not undergo appropriate evaluation and surgical referral. System-level interventions which prompt further evaluation of hypercalcemia and raise physician awareness about hyperparathyroidism could improve outcomes and produce long-term cost savings.

  14. Cryo-electron Microscopy Reconstruction and Stability Studies of the Wild Type and the R432A Variant of Adeno-associated Virus Type 2 Reveal that Capsid Structural Stability Is a Major Factor in Genome Packaging.

    Science.gov (United States)

    Drouin, Lauren M; Lins, Bridget; Janssen, Maria; Bennett, Antonette; Chipman, Paul; McKenna, Robert; Chen, Weijun; Muzyczka, Nicholas; Cardone, Giovanni; Baker, Timothy S; Agbandje-McKenna, Mavis

    2016-10-01

    The adeno-associated viruses (AAV) are promising therapeutic gene delivery vectors and better understanding of their capsid assembly and genome packaging mechanism is needed for improved vector production. Empty AAV capsids assemble in the nucleus prior to genome packaging by virally encoded Rep proteins. To elucidate the capsid determinants of this process, structural differences between wild-type (wt) AAV2 and a packaging deficient variant, AAV2-R432A, were examined using cryo-electron microscopy and three-dimensional image reconstruction both at an ∼5.0-Å resolution (medium) and also at 3.8- and 3.7-Å resolutions (high), respectively. The high resolution structures showed that removal of the arginine side chain in AAV2-R432A eliminated hydrogen bonding interactions, resulting in altered intramolecular and intermolecular interactions propagated from under the 3-fold axis toward the 5-fold channel. Consistent with these observations, differential scanning calorimetry showed an ∼10°C decrease in thermal stability for AAV2-R432A compared to wt-AAV2. In addition, the medium resolution structures revealed differences in the juxtaposition of the less ordered, N-terminal region of their capsid proteins, VP1/2/3. A structural rearrangement in AAV2-R432A repositioned the βA strand region under the icosahedral 2-fold axis rather than antiparallel to the βB strand, eliminating many intramolecular interactions. Thus, a single amino acid substitution can significantly alter the AAV capsid integrity to the extent of reducing its stability and possibly rendering it unable to tolerate the stress of genome packaging. Furthermore, the data show that the 2-, 3-, and 5-fold regions of the capsid contributed to producing the packaging defect and highlight a tight connection between the entire capsid in maintaining packaging efficiency. The mechanism of AAV genome packaging is still poorly understood, particularly with respect to the capsid determinants of the required capsid

  15. Efficacy of Dendritic Cells Matured Early with OK-432 (Picibanil®), Prostaglandin E2, and Interferon-α as a Vaccine for a Hormone Refractory Prostate Cancer Cell Line

    Science.gov (United States)

    Yoo, Changhee; Do, Hyun-Ah; Jeong, In Gab; Park, Hongzoo; Hwang, Jung-Jin; Hong, Jun Hyuk; Cho, Jin Seon; Choo, Myong-Soo; Ahn, Hanjong

    2010-01-01

    Dendritic cells (DCs) are potent antigen-presenting cells. OK432 (Picibanil®) was introduced as a potent stimulator of DC maturation in combination with prostaglandin-E2 and interferon-α. We compared the efficacy of a DC-prostate cancer vaccine using early-mature DCs stimulated with OK432, PGE2 and INF-α (OPA) with that of vaccines using other methods. On days 3 or 7 of DC culture, TNF-α (T), TNF-α and LPS (TL) or OPA were employed as maturation stimulators. DU145 cells subjected to heat stress were hybridized with mature DCs using polyethyleneglycol. T cells were sensitized by the hybrids, and their proliferative and cytokine secretion activities and cytotoxicity were measured. The yields of early-mature DCs were higher, compared to yields at the conventional maturation time (P<0.05). In the early maturation setting, the mean fusion ratios, calculated from the fraction of dual-positive cells, were 13.3%, 18.6%, and 39.9%, respectively (P=0.051) in the T only, TL, and OPA-treated groups. The function of cytotoxic T cells, which were sensitized with the hybrids containing DCs matured early with OPA, was superior to that using other methods. The antitumor effects of DC-DU145 hybrids generated with DCs subjected to early maturation with the OPA may be superior to that of the hybrids using conventional maturation methods. PMID:20808670

  16. Trial of validation of two devices for self-measurement of blood pressure according to the European Society of Hypertension International Protocol: the Citizen CH-432B and the Citizen CH-656C.

    Science.gov (United States)

    Cotte, Uwe V; Faltenbacher, Verena H; von Willich, Werner; Bogner, Johannes R

    2008-02-01

    Two devices for self-measurement of blood pressure, one at the upper arm (Citizen CH-432B) and one at the wrist (Citizen CH-656C), were evaluated according to the International Protocol of the European Society of Hypertension. The International Protocol is divided into two phases: the first phase is performed on 15 selected participants with five participants in three different blood pressure ranges. If the devices passed this phase, 18 additional participants selected on the basis of the same criteria as in phase 1 were included. Two skilled observers performed the following blood pressure measurements: five measurements were performed with the mercury standard alternating with four measurements with each of the test devices per participant. The first measurement result from each device instrument was not included in the analysis. The difference between the blood pressure value given by the devices and that obtained by the two observers (mean of the two observers) was calculated for each pair of measurements and classified into three categories (within 5, 10 and 15 mmHg). The results were compared to the pass criteria established by the European Society of Hypertension. Afterwards the number of measurement differences falling within 5 mmHg was determined for every person. At least 22 of the 33 participants should have two of their three comparisons within 5 mmHg and there should be a maximum of three participants without a measurement difference within the 5 mmHg range. Both tested devices passed the first phase of the validation process by exceeding the required number of comparisons falling within the 5, 10 and 15 mmHg error zones. Even the second phase confirmed the validation criteria with average differences between the device and the mercury sphygmomanometer of 0.7+/-4.4 and -3.6+/-4.0 mmHg for systolic blood pressure and diastolic blood pressure, respectively, for the Citizen CH-432B device and -0.7+/-6.0 and -1.2+/-4.5 mmHg for the Citizen CH-656C device

  17. A phase I study of vaccination with NY-ESO-1f peptide mixed with Picibanil OK-432 and Montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen.

    Science.gov (United States)

    Kakimi, Kazuhiro; Isobe, Midori; Uenaka, Akiko; Wada, Hisashi; Sato, Eiichi; Doki, Yuichiro; Nakajima, Jun; Seto, Yasuyuki; Yamatsuji, Tomoki; Naomoto, Yoshio; Shiraishi, Kenshiro; Takigawa, Nagio; Kiura, Katsuyuki; Tsuji, Kazuhide; Iwatsuki, Keiji; Oka, Mikio; Pan, Linda; Hoffman, Eric W; Old, Lloyd J; Nakayama, Eiichi

    2011-12-15

    We conducted a phase I clinical trial of a cancer vaccine using a 20-mer NY-ESO-1f peptide (NY-ESO-1 91-110) that includes multiple epitopes recognized by antibodies, and CD4 and CD8 T cells. Ten patients were immunized with 600 μg of NY-ESO-1f peptide mixed with 0.2 KE Picibanil OK-432 and 1.25 ml Montanide ISA-51. Primary end points of the study were safety and immune response. Subcutaneous injection of the NY-ESO-1f peptide vaccine was well tolerated. Vaccine-related adverse events observed were fever (Grade 1), injection-site reaction (Grade 1 or 2) and induration (Grade 2). Vaccination with the NY-ESO-1f peptide resulted in an increase or induction of NY-ESO-1 antibody responses in nine of ten patients. The sera reacted with recombinant NY-ESO-1 whole protein as well as the NY-ESO-1f peptide. An increase in CD4 and CD8 T cell responses was observed in nine of ten patients. Vaccine-induced CD4 and CD8 T cells responded to NY-ESO-1 91-108 in all patients with various HLA types with a less frequent response to neighboring peptides. The findings indicate that the 20-mer NY-ESO-1f peptide includes multiple epitopes recognized by CD4 and CD8 T cells with distinct specificity. Of ten patients, two with lung cancer and one with esophageal cancer showed stable disease. Our study shows that the NY-ESO-1f peptide vaccine was well tolerated and elicited humoral, CD4 and CD8 T cell responses in immunized patients. Copyright © 2011 UICC.

  18. 5 CFR 432.107 - Agency records.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE BASED REDUCTION IN... employee's performance continues to be acceptable for 1 year from the date of the advanced written notice... unacceptable performance and make it available for review by the affected employee or his or her representative...

  19. EAMJ September 432-448.indd

    African Journals Online (AJOL)

    2008-09-09

    Sep 9, 2008 ... Objectives: To determine the utilisation rate of design specific eye protection by surgeons and to ... Such infections include HIV, hepatitis B and C virus to name but a ... blood is literally running down the goggles this will be classified as ... procedure was 2.48 drops for the surgeons and 1.49 for the assistants ...

  20. 40 CFR 432.2 - General definitions.

    Science.gov (United States)

    2010-07-01

    ... and deboning, cooking, seasoning, smoking, canning, grinding, chopping, dicing, forming, breading.... (j) Raw material means the basic input materials to a renderer composed of animal and poultry...

  1. BDML Metadata: 432 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_AK BDML file for the result of computer simulation of male pronuclear migration ...in C. elegans embryo the result of computer simulation of male pronuclear migration in C. elegans embryo (me

  2. 16 CFR 432.4 - Optional disclosures.

    Science.gov (United States)

    2010-01-01

    ... other instantaneous power rating, such as music power or peak power, is represented under this section... are disclosed, and well known and generally recognized by the industry at the time the representations...

  3. Publications | Page 432 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4311 - 4320 of 6333 ... Visit the IDRC Digital Library now. ... Development Ventures Group and MIT Media Lab supported the testing of DINUBE ... from, about, or of interest to National Research and Education Networks (NRENs) in Africa.

  4. 42 CFR 432.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... that demand little or no formal education; a high school diploma; or less than 4 years of college... benefits means the employer's share of premiums for workmen's compensation, employees' retirement... specialized personnel who have professional education and training in the field of medical care or appropriate...

  5. EAMJ September 432-448.indd

    African Journals Online (AJOL)

    2008-09-09

    Sep 9, 2008 ... and three (19%) of 16 HIV-infected patients (p=0.0701) and QFTG was positive among two (14%) of 14 ..... specific T-cell responses increased 1.8 fold, peaking at. 26 days before ... Markowitz, N., Hansen, N.I., Wilcosky, T.C., et al. Tuberculin ... 737-742. 10. Rangaka, M.X., Wilkinson, K.A., Seldon, R., et al.

  6. 16 CFR 432.2 - Required disclosures.

    Science.gov (United States)

    2010-01-01

    ... is designed to amplify two or more channels simultaneously) at an impedance of 8 ohms, or, if the amplifier is not designed for an 8-ohm impedance, at the impedance for which the amplifier is primarily...

  7. 5 CFR 432.102 - Coverage.

    Science.gov (United States)

    2010-01-01

    ...) The Government Printing Office. (d) Agencies excluded. This part does not apply to: (1) A Government corporation; (2) The Central Intelligence Agency; (3) The Defense Intelligence Agency; (4) The National... principal function of which is the conduct of foreign intelligence or counterintelligence activities; (6...

  8. Case report 432: Granulocytic sarcoma (GS), with hypereosinophilic syndrome (HES)

    Energy Technology Data Exchange (ETDEWEB)

    Xipell, J M; Beamish, M R; Clark, D

    1987-07-01

    A case is presented of a 28-year-old man with a history of the hypereosinophilic syndrome, who subsequently developed granulocytic sarcoma of the tibia which proved resistant to aggressive therapy. He ultimately developed acute myeloid leukemia which also was resistant to therapy. The disease process was characterized by localised skeletal pain, the development of lytic lesions in several areas of the skeleton and progression to frank myeloid leukemia. (orig./SHA).

  9. All projects related to | Page 432 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: PEACE RESEARCH, CONFLICT RESOLUTION, DEMOCRATIZATION, ECONOMIC RECONSTRUCTION, Economic and social development ... South America, Brazil, Chile, Haiti, North and Central America, Mexico, Uruguay ... Shifting Cultivation : Promoting Innovative Policy and Development Options in the Eastern ...

  10. 27 CFR 4.32 - Mandatory label information.

    Science.gov (United States)

    2010-04-01

    ... Mandatory label information. (a) There shall be stated on the brand label: (1) Brand name, in accordance... the bottle. (c) There shall be stated on the brand label or on a back label a statement that the... the Office of Management and Budget under Control Number 1512-0469) [T.D. 6521, 25 FR 13835, Dec. 29...

  11. 432 Gender Inequality and its Challenge to Women Development in ...

    African Journals Online (AJOL)

    Obviously, discrimination with respect to gender inequality in. Nigeria is at the ... Gender inequality is a socio-cultural phenomenon that divides people into various .... feminist, see women as oppressed group who had to struggle for their own ...

  12. 29 CFR 1926.432 - Environmental deterioration of equipment.

    Science.gov (United States)

    2010-07-01

    ...) Protection against corrosion. Metal raceways, cable armor, boxes, cable sheathing, cabinets, elbows..., DEPARTMENT OF LABOR (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Electrical Safety-Related...

  13. EISA 432 Energy Audits Best Practices: Software Tools

    Energy Technology Data Exchange (ETDEWEB)

    Maryl Fisher

    2014-11-01

    Five whole building analysis software tools that can aid an energy manager with fulfilling energy audit and commissioning/retro-commissioning requirements were selected for review in this best practices study. A description of each software tool is provided as well as a discussion of the user interface and level of expertise required for each tool, a review of how to use the tool for analyzing energy conservation opportunities, the format and content of reports generated by the tool, and a discussion on the applicability of the tool for commissioning.

  14. 42 CFR 432.30 - Training programs: General requirements.

    Science.gov (United States)

    2010-10-01

    ... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS STATE PERSONNEL ADMINISTRATION Training Programs... of the program; (2) Be related to job duties performed or to be performed by the persons trained; and (3) Be consistent with the program objectives of the agency. ...

  15. 42 CFR 432.50 - FFP: Staffing and training costs.

    Science.gov (United States)

    2010-10-01

    ... organization or a degree in a medical field issued by a college or university certified by a professional... salary or other compensation, fringe benefits, travel, per diem, and training, at rates determined on the... education and training” means the completion of a 2-year or longer program leading to an academic degree or...

  16. Ammonothermal synthesis of alkali-alkaline earth metal and alkali-rare earth metal carbodiimides. K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}

    Energy Technology Data Exchange (ETDEWEB)

    Mallmann, Mathias; Haeusler, Jonas; Cordes, Niklas; Schnick, Wolfgang [Department of Chemistry, University of Munich (LMU) (Germany)

    2017-12-13

    Alkali-alkaline earth metal and alkali-rare earth metal carbodiimides, namely K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (x = 0 - 1) (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}, were synthesized under ammonothermal conditions in high-pressure autoclaves. The structures of the three compounds can be derived from homeotypic K{sub 5}H(CN{sub 2}){sub 3} and Na{sub 5}H(CN{sub 2}){sub 3} by partial substitution of K{sup +} or Na{sup +}by Sr{sup 2+} or Eu{sup 2+}. The reactions were carried out in two step syntheses (T{sub 1} = 673 K, T{sub 2} = 823 K) starting from sodium or potassium azide, dicyandiamide and strontium or Eu(NH{sub 2}){sub 2}, respectively. The crystal structures were solved and refined from single-crystal X-ray diffraction data [K{sub 4.16}Sr{sub 0.84}(CN{sub 2}){sub 2.84}(HCN{sub 2}){sub 0.16}: space group Im3m (no. 229), a = 7.8304(5) Aa, Z = 2, R{sub 1} = 0.024, wR{sub 2} = 0.052; K{sub 4.40}Eu{sub 0.60}(CN{sub 2}){sub 2.60}(HCN{sub 2}){sub 0.40}: space group Im anti 3m (no. 229), a = 7.8502(6) Aa, Z = 2, R{sub 1} = 0.022, wR{sub 2} = 0.049]. In contrast to the potassium carbodiimides, the sodium-strontium carbodiimide was only synthesized as microcrystalline powder. The crystal structure was determined by powder X-ray diffraction and refined by the Rietveld method [Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}: space group Im3m (no. 229), a = 7.2412(1) Aa, Z = 2, R{sub wp} = 0.050]. The presence of hydrogencyanamide units ([HNCN]{sup -}) next to carbodiimide units ([CN{sub 2}]{sup 2-}) in all compounds was confirmed by FT-IR spectroscopy. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. 9 CFR 93.432 - Cattle from the Republic of Ireland.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cattle from the Republic of Ireland... Cattle from the Republic of Ireland. (a) All cattle to be imported from the Republic of Ireland shall be... that the cattle originated from a herd which is officially certified by the Republic of Ireland as a...

  18. 432 püksipaari Riia kongresside palee fassaadil / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2000-01-01

    Filmifestivalil "Arsenals" sai parima režissööri kujukese Mait Laas nukufilmi "Teekond Nirvaanasse" eest, teise koha preemia Valentin Kuigi mängufilm "Lurjus" ja Riho Undi nukufilm "Saamuel internetis". Peaauhinna andis loos shoti naisrežissööri Lynne Ramsay mängufilmile "Rotipüüdja" ("Ratcatcher")

  19. Structural and spectroscopic properties of MITh2(PO4)32 (M = Cu+, Ag+, Na+, K+)

    International Nuclear Information System (INIS)

    Arsalane, S.; Ziyad, M.

    1996-01-01

    Phosphates of general formulae M I Th 2 (PO 4 ) 3 where M = Cu + and Ag + were synthesized using sol-gel type methods and Cu + /Ag + ion exchange. Their structures were investigated by X-ray diffraction, FTIR, and 31 P MAS NMR spectroscopies. AgTh 2 (PO 4 ) 3 and NaTh 2 (PO 4 ) 3 were found to be isostructural. Their 31 P NMR spectra exhibit three resonances agreeing with the noncentrosymmetric space group Cc to which they belong. On the other hand, CuTh 2 (PO 4 ) 3 does not show a real crystallographic resemblance with the other M I Th 2 (PO 4 ) 3 phosphates of this family. Its 31 P NMR spectrum is similar to that of KTh 2 (PO 4 ) 3 and exhibits two sharp resonances in good agreement with the C2/c space group. Nevertheless, the [PO 4 ] groups in this phosphate are highly distorted because of the linear coordination of the Cu + copper ions

  20. SU-E-T-432: A Rapid and Comprehensive Procedure for Daily Proton QA

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, T; Sun, B; Grantham, K; Knutson, N; Santanam, L; Goddu, S; Klein, E [Washington University, St. Louis, MO (United States)

    2014-06-01

    Purpose: The objective is to develop a rapid and comprehensive daily QA procedure implemented at the S. Lee Kling Proton Therapy Center at Barnes-Jewish Hospital. Methods: A scribed phantom with imbedded fiducials is used for checking lasers accuracy followed by couch isocentricity and for X-ray imaging congruence with isocenter. A Daily QA3 device (Sun Nuclear, FL) was used to check output, range and profiles. Five chambers in the central region possess various build-ups. After converting the thickness of the inherent build-ups into water equivalent thickness (WET) for proton, range of any beam can be checked with additional build-up on the Daily QA3 device. In our procedure, 3 beams from 3 bands (large, small and deep) with nominal range of 20 cm are checked daily. 17cm plastic water with WET of 16.92cm are used as additional build-up so that four chambers sit on the SOBP plateau at various depths and one sit on the distal fall off. Reading from the five chambers are fitted to an error function that has been parameterized to match the SOBP with the same nominal range. Shifting of the error function to maximize the correlation between measurements and the error function is deemed as the range shift from the nominal value. Results: We have found couch isocentricity maintained over 180 degrees. Imaging system exhibits accuracy in regard to imaging and mechanical isocenters. Ranges are within 1mm accuracy from measurements in water tank, and sensitive to change of sub-millimeter. Data acquired since the start of operation show outputs, profiles and range stay within 1% or 1mm from baselines. The whole procedure takes about 40 minutes. Conclusion: Taking advantage of the design of Daily QA3 device turns the device originally designed for photon and electron into a comprehensive and rapid tool for proton daily QA.

  1. Generating an Out-the-Window Cockpit Image with the iAPX 432.

    Science.gov (United States)

    1982-12-01

    SUBJECT ISUBJECT 1 7 1 9 ISTARTING PARAMETER I INITIAL TEXT 1 8 110 IGENERATE LOCATION IEQUATION FLIGHT I11 I INFORMATION OVERLAY 1 13 IRETRIEVE DATA BASE...1 9 112 IDETERMINE SIGHTABLE ISIGHT DESCRIPTION 1 13 IRETRIEVE DATA BASEI 1 10 1 14 IGENERATE DISPLAY IPICTURE I11 1 10 IGENERATE LOCATION IEQOATION...IRETRIEVE DATA BASE I . 10 1 13 IGENERATE DISPLAY IPICTURE 1 11 1 9 IGENERATE LOCATION IEQOATION MOTION 1 12 1 10 INFORMATION OVERLAY IINFORMATION

  2. Picibanil (OK-432 in the treatment of head and neck lymphangiomas in children

    Directory of Open Access Journals (Sweden)

    Elena Rebuffini

    2012-01-01

    Conclusions: Intracystic injection of Picibanil is an effective and safe treatment for macrocystic LMs in pediatric patients and may represent the treatment of choice in such cases, especially where surgical excision is associated with the risk of functional/cosmetic side effects.

  3. Treatment of Lymphatic Malformations With OK-432 (Picibanil) : Review of the Literature

    NARCIS (Netherlands)

    Poldervaart, Michelle T.; Breugem, Corstiaan C.; Speleman, Lucienne; Pasmans, Suzanne

    Introduction: Lymphatic malformations (LM) are benign structural defects that call cause serious complications because of their size and location. Traditionally surgical removal was the first treatment modality, but this Could be associated with many complications and risks. Since Ogita introduced

  4. OK-432 sclerotherapy in head and neck lymphangiomas: long-term follow-up result.

    Science.gov (United States)

    Yoo, Jae Chul; Ahn, Youngjin; Lim, Yune Syung; Hah, J Hun; Kwon, Tack-Kyun; Sung, Myung-Whun; Kim, Kwang Hyun

    2009-01-01

    Nonsurgical treatments, such as sclerotherapy have been attempted for head and neck lymphagiomas. Of the available sclerosing agents, picibanil has shown satisfactory short-term treatment results in many studies, but no study has presented long-term treatment results. Accordingly, in the present study, the authors retrospectively reviewed the long-term treatment results of picibanil sclerotherapy. Fifty-five lymphangioma patients who underwent picibanil sclerotherapy were enrolled. Data about initial and long-term response, recurrence, and excision rate were collected. Initial response rates were 83.5 percent and long-term response rates were 76.3 percent. Initial and the long-term response rate were equally good for lymphangioma.

  5. SU-E-T-432: A Rapid and Comprehensive Procedure for Daily Proton QA

    International Nuclear Information System (INIS)

    Zhao, T; Sun, B; Grantham, K; Knutson, N; Santanam, L; Goddu, S; Klein, E

    2014-01-01

    Purpose: The objective is to develop a rapid and comprehensive daily QA procedure implemented at the S. Lee Kling Proton Therapy Center at Barnes-Jewish Hospital. Methods: A scribed phantom with imbedded fiducials is used for checking lasers accuracy followed by couch isocentricity and for X-ray imaging congruence with isocenter. A Daily QA3 device (Sun Nuclear, FL) was used to check output, range and profiles. Five chambers in the central region possess various build-ups. After converting the thickness of the inherent build-ups into water equivalent thickness (WET) for proton, range of any beam can be checked with additional build-up on the Daily QA3 device. In our procedure, 3 beams from 3 bands (large, small and deep) with nominal range of 20 cm are checked daily. 17cm plastic water with WET of 16.92cm are used as additional build-up so that four chambers sit on the SOBP plateau at various depths and one sit on the distal fall off. Reading from the five chambers are fitted to an error function that has been parameterized to match the SOBP with the same nominal range. Shifting of the error function to maximize the correlation between measurements and the error function is deemed as the range shift from the nominal value. Results: We have found couch isocentricity maintained over 180 degrees. Imaging system exhibits accuracy in regard to imaging and mechanical isocenters. Ranges are within 1mm accuracy from measurements in water tank, and sensitive to change of sub-millimeter. Data acquired since the start of operation show outputs, profiles and range stay within 1% or 1mm from baselines. The whole procedure takes about 40 minutes. Conclusion: Taking advantage of the design of Daily QA3 device turns the device originally designed for photon and electron into a comprehensive and rapid tool for proton daily QA

  6. : tous les projets | Page 432 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: TOURISM DEVELOPMENT, SMALL ENTERPRISES, MEDIUM ENTERPRISES. Région: Costa Rica, North and Central America, South America. Programme: Fondements pour l'innovation. Financement total : CA$ 78,120.00. Renforcement des petites entreprises de tourisme responsable et durable au Costa Rica.

  7. Apis mellifera (Hymenoptera: Apidae as a potential Brassica napus pollinator (cv. Hyola 432 (Brassicaceae, in Southern Brazil Apis mellifera (Hymenoptera: Apidae como potencial polinizador de Brassica napus (cv. Hyola 432 (Brassicaceae, no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    AS. Rosa

    2010-11-01

    Full Text Available Brassica napus Linnaeus is considered a self-compatible crop; however, studies show that bee foraging elevates their seed production. Considering bee food shortages during the winter season and that the canola is a winter crop, this study aimed to evaluate the foraging behaviour of Apis mellifera Linnaeus, 1758 regarding those flowers, and to verify if it presents adequate behaviour for successfully pollinating this crop in Rio Grande do Sul State. The study was carried out in a canola field, in Southern Brazil. The anthesis stages were morphologically characterised and then related to stigma receptivity and pollen grain viability. Similarly, the behaviour of A. mellifera individuals on flowers was followed, considering the number of flowers visited per plant, the amount of time spent on the flowers, touched structures, and collected resources. Floral fidelity was inferred by analysing the pollen load of bees collected on flowers. The bees visited from 1-7 flowers/plant (x = 2.02; sd = 1.16, the time spent on the flowers varied between 1-43 seconds (x = 3.29; sd = 2.36 and, when seeking nectar and pollen, they invariably touched anthers and stigmas. The pollen load presented 100% of B. napus pollen. The bees' attendance to a small number of flowers/plants, their short permanence on flowers, their contact with anthers and stigma and the integral floral constancy allows their consideration as potential B. napus pollinators.Brassica napus Linnaeus é considerada uma cultura autocompatível, entretanto, estudos indicam que o forrageio de abelhas eleva sua produtividade de sementes. Considerando-se a escassez de alimento para abelhas no inverno e a canola sendo uma cultura desse período, objetivou-se avaliar o comportamento de forrageio de Apis mellifera Linnaeus, 1758 nas suas flores e verificar se apresenta comportamento propício ao sucesso de polinização dessa cultura no Rio Grande do Sul. O estudo foi desenvolvido em lavoura de canola, no Sul do Brasil. Os estágios da antese foram caracterizados morfologicamente e relacionados à receptividade do estigma e à viabilidade dos grãos de pólen. Paralelamente, o comportamento de indivíduos de A. mellifera nas flores foi acompanhado, considerando-se o número de flores visitadas por planta, o tempo de permanência nas flores, as estruturas tocadas e os recursos coletados. A fidelidade floral foi inferida analisando-se a carga polínica de abelhas coletadas em flores. As abelhas visitaram entre 1-7 flores/planta (x = 2,02; sd = 1,16, o tempo de permanência nas flores variou entre 1-43 segundos (x = 3,29; sd = 2,36 e, ao buscarem néctar e pólen, invariavelmente tocavam anteras e estigmas. A carga polínica apresentou 100% de pólen de B. napus. A visita a poucas flores/planta, a curta permanência sobre as flores, o contato das abelhas com anteras e estigma e a plena constância floral, permitem considerá-las como potenciais polinizadoras de B. napus.

  8. SU-E-T-432: Field Size Influence On the Electron and Photon Spectra Within Small MV Field Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Benmakhlouf, H; Andreo, P [Department of Medical Physics, Karolinska University Hospital, Stockholm and Department of Physics, Medical Radiation Physics, Stockholm University (Sweden)

    2015-06-15

    Purpose: To investigate the influence of photon field size on the electron and photon fluence spectra in the active volume of small field detectors. Methods: The PENELOPE MC system based usercode PenEasy was used to calculate the material influence on the spectra by scoring the differential fluence in inserts of silicon, carbon, phosphorus and aluminium having 3 mm diameter and height. The spectra were then calculated inside the active volume of eleven detectors (ion chambers and solid-state detectors) whose geometry was simulated with great detail. The inserts/detectors were placed at 10 cm depth in a 30 cm x 30 cm x 30 cm water phantom and irradiated with 2.5 MeV photons and Varian Clinac 6 MV beams of small, medium and large size. Results: For all configurations, photon spectra in the scoring volume were similar to that in a small water volume except for additional characteristic x-ray peaks resulting from the material itself and from the materials surrounding the detectors (i.e. high-Z shielding the silicon). Electron fluence calculated in the inserts were up to 60% larger than in water; the difference increased with material density and decreasing field size. MC-calculated doses were compared to analytically determined collision kerma and restricted cema (cut-off=15keV). For the inserts, with large and medium fields K-col agreed with MC-dose, but K-col overestimated the dose for small fields due to lack of lateral CPE. For the detectors, up to 15% differences between K-col and the MC-dose were found. For all configurations the C-delta and MC-dose agreed within ±2%. Conclusion: The most relevant findings were that shielding affects substantially the photon spectra and material conditions the electron spectra, their field size dependence varying with the geometry configuration. These affect the values of factors entering into relative dosimetry.

  9. The incidence of apparent congenital urogenital anomalies in North Indian newborns: A study of 20,432 pregnancies

    Directory of Open Access Journals (Sweden)

    A. Bhat

    2016-09-01

    Conclusions: The incidence of apparent congenital urogenital anomalies was 3.91%. Infertility treatment, parity >2 and a maternal age >30 years were independently associated with an increased risk of congenital urogenital anomalies.

  10. 40 CFR 432.107 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT... BOD5 and TSS specified in paragraph (a) of this section were derived for a renderer which does not cure cattle hide. If a renderer does cure hide, the following formulas should be used to calculate BOD5 and...

  11. 40 CFR 432.102 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT... derived for a renderer which does not cure cattle hide. If a renderer does cure cattle hide, the following...

  12. 18 CFR 4.32 - Acceptance for filing or rejection; information to be made available to the public; requests for...

    Science.gov (United States)

    2010-04-01

    ...; and (B) The entities identified in paragraph (a)(2) of this section, as well as any other Federal... alleged in the application or other materials filed, be subscribed and verified under oath in the form set... petition. The applicant or petitioner must serve one copy of the application or petition on the Director of...

  13. Processing of fine-grained W materials without detrimental phases and their mechanical properties at 200-432 K

    Energy Technology Data Exchange (ETDEWEB)

    Ishijima, Y.; Kannari, S. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Kurishita, H. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan)], E-mail: kurishi@imr.tohoku.ac.jp; Hasegawa, M. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Hiraoka, Y. [Department of Applied Physics, Okayama University of Science, 1-1 Ridai-cho, Okayama, Okayama 700-0005 (Japan); Takida, T.; Takebe, K. [A.L.M.T. TECH Inc., 2 Iwasekoshi-machi, Toyama, Toyama 931-8543 (Japan)

    2008-01-25

    Low-temperature ductility improvements of tungsten (W) materials with microstructures of fine grains and fine transition metal-carbide dispersoids require sufficient reductions for consolidates that are free from detrimental dispersoids of the W{sub 2}C phase. In this paper the cause of the occurrence of the detrimental W{sub 2}C phase is studied and an appropriate processing method for its prevention and nearly full densification of mechanically alloyed powder is shown. By applying the method W-0.3 wt%Ti-0.006 wt%C (W-0.3TiC-0.006C) specimens with a negligible amount of the W{sub 2}C phase and reductions up to 78% were prepared. It is found that W-0.3TiC-0.006C exhibits an appreciable ductility even at room temperature by three-point bend impact tests and static tensile tests, with the ductile-to-brittle transition temperature of around 260 K. The observed ductility is likely due to elongated, very thin grain structures of the material. For further ductility improvements, control of oxygen impurities to suppress decarburization during sintering and assure appropriate amounts of (Ti,W)C dispersoids is required.

  14. 11 CFR 104.18 - Electronic filing of reports (2 U.S.C. 432(d) and 434(a)(11)).

    Science.gov (United States)

    2010-01-01

    ... committees or other persons with no history of campaign finance activity shall have reason to expect to... the report in one of the following ways: by submitting a signed certification on paper that is...

  15. 11 CFR 103.3 - Deposit of receipts and disbursements (2 U.S.C. 432(h)(1)).

    Science.gov (United States)

    2010-01-01

    ... receipts by a political committee shall be deposited in account(s) established pursuant to 11 CFR 103.2... the treasurer memorializing an oral communication explaining why the contribution is legal. If the... on new evidence not available to the political committee at the time of receipt and deposit, the...

  16. 32 CFR 644.432 - Assignment to Department of Health, Education, and Welfare (HEW) or successor agencies for health...

    Science.gov (United States)

    2010-07-01

    ... their removal from the site will increase the Government's restoration obligations under the lease... notification will include the same restoration obligations as would be placed in a sale of the property to a private party. (5) During the 20-day period, action will be taken preparatory to advertising the property...

  17. 1994 report on Tasks 4.3.1 and 4.3.2: Survey of anticipated requirements and qualification requirements for OSS

    International Nuclear Information System (INIS)

    Silvani, V.

    1995-01-01

    This is a preliminary report summarizing some topics related to the survey on functional and qualification requirements of Operator Support Systems (OSS's) in NPP's. This document has been prepared on the basis of the information presented in the previous meetings of this CRP working group. Additional information are expected when the answers to the working group questionnaire will be available. Functionalities examined are those referring to system functions and user's needs; technology trends are also considered. For practical purposes this document is divided in the followings: Summary of major OSS requirements and related problems as derived from the existing literature; appendix 1 reporting a summary of major functions performed by the OSS's presently in operation or under development in laboratories; appendix 2 reporting the list of standards for critical software. 18 refs, tabs

  18. SU-F-T-432: Magnetic Field Dose Effects for Various Radiation Beam Geometries for Patients Treated with Hypofractionated Partial Breast Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Lim-Reinders, S [Sunnybrook Odette Cancer Centre, Toronto (Canada); University of Toronto, Department of Physics (Canada); Keller, B; McCann, C; Sahgal, A; Lee, J; Kim, A [Sunnybrook Odette Cancer Centre, Toronto (Canada); University of Toronto, Department of Radiation Oncology (Canada)

    2016-06-15

    Purpose: Hypofractionated partial breast irradiation (HPBI) is being used at our clinic to treat inoperable breast cancer patients who have advanced disease. We are investigating how these patients could benefit from being treated in an MRI-linac, where real-time daily MRI tumor imaging and plan adaptation would be possible. As a first step, this study evaluates the dosimetric impact of the magnetic field for different radiation beam geometries on relevant OARs. Methods: Five patients previously treated using HPBI were selected. Six treatment plans were generated for each patient, evaluating three beam geometries (VMAT, IMRT, 3DCRT) with and without B{sub 0}=1.5 T. The Monaco TPS was used with the Elekta MRI-Linac beam model, where the magnetic field is orthogonal to the radiation beam. All plans were re-scaled to the same isocoverage with a prescription of 40Gy/5 to the PTV. Plans were evaluated for the effect of the magnetic field and beam modality on skin V{sub 3} {sub 0}, lung V{sub 2} {sub 0} and mean heart dose. Results: Averaged over all patients, skin V{sub 3} {sub 0}for 3DCRT was higher than VMAT and IMRT (by +22% and +21%, with B{sub 0}-ON). The magnetic field caused larger increases in skin V{sub 3} {sub 0}for 3DCRT (+8%) than VMAT (+3%) and IMRT (+4%) compared with B{sub 0}-OFF. With B{sub 0}-ON, 3DCRT had a markedly lower mean heart dose than VMAT (by 538cGy) and IMRT (by 562cGy); for lung V{sub 2} {sub 0}, 3DCRT had a marginally lower dose than VMAT (by −2.2%) and IMRT (also −2.2%). The magnetic field had minimal effect on the mean heart dose and lung V{sub 2} {sub 0} for all geometries. Conclusion: The decreased skin dose in VMAT and IMRT can potentially mitigate the effects of skin reactions for HPBI in an MRI-linac. This study illustrated that more beam angles may result in lower skin toxicity and better tumor conformality, with the trade-off of elevated heart and lung doses. We are receiving funding support from Elekta.

  19. Successful treatment of refractory hepatic lymphorrhea after gastrectomy for early gastric cancer, using surgical ligation and subsequent OK-432 (Picibanil) sclerotherapy.

    Science.gov (United States)

    Tanaka, Kouji; Ohmori, Yukinari; Mohri, Yasuhiko; Tonouchi, Hitoshi; Suematsu, Mina; Taguchi, Yukiko; Adachi, Yukihiko; Kusunoki, Masato

    2004-01-01

    Postoperative hepatic lymphorrhea is a very rare complication after abdominal surgery. Hepatic lymphorrhea, not containing chyle, involves an internal lymph fistula between the lymphatic channels toward the cisterna chyli and the peritoneal cavity. Over the past 20 years, 17 cases have been reported in Japan. Here, we report a further case, of a patient with successfully treated intractable hepatic lymphorrhea following gastrectomy for early gastric cancer. We review 18 cases, including the present case, with respect to the management of postoperative lymphorrhea refractory to conventional medical treatment.

  20. Nuclear Regulatory Commission issuances: Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1 - December 31, 1996. Volume 44, Pages 1 - 432

    International Nuclear Information System (INIS)

    1997-01-01

    The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors' Decisions--DD, and Decisions on Petitions for Rulemaking--DPRM

  1. Nuclear Regulatory Commission issuances: Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1--December 31, 1996. Volume 44, Pages 1--432

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-10-01

    The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors` Decisions--DD, and Decisions on Petitions for Rulemaking--DPRM.

  2. Teacher's Guide for Computational Models of Animal Behavior: A Computer-Based Curriculum Unit to Accompany the Elementary Science Study Guide "Behavior of Mealworms." Artificial Intelligence Memo No. 432.

    Science.gov (United States)

    Abelson, Hal; Goldenberg, Paul

    This experimental curriculum unit suggests how dramatic innovations in classroom content may be achieved through use of computers. The computational perspective is viewed as one which can enrich and transform traditional curricula, act as a focus for integrating insights from diverse disciplines, and enable learning to become more active and…

  3. 1994 report on Task 4.3.1 investigate how training should be planned to ensure efficient utilisation or OSS. Task 4.3.2 evaluate how the introduction of OSS influences requirements to the basic education of the operator

    International Nuclear Information System (INIS)

    1995-01-01

    According to the experience coming from countries where new concepts of nuclear power plants control rooms equipped with integrated system of OSSs have recently been largely tested in experimental centres equipped with powerful real-time plant simulators (e.g. NORWAY - Halden project; Japan) a training in use of the OSS is important, so that the operator can use it in the right situation and in right manner. Experiments, in which mostly experienced active control room operators from operating NPPs took part showed as well, that both the requirements for additional basic education of operators and the planning of training is influenced by a number of different factors like complexity of system structure and interface, system function, capabilities of training centres, operators background, experience and age and others. 6 refs

  4. Beliefs, practices and attitudes of portuguese undergraduate youth (Crenças, práticas e atitudes da juventude universitária portuguesa. DOI: 10.5752/P.2175-5841.2012v10n26p432

    Directory of Open Access Journals (Sweden)

    José Pereira Coutinho

    2012-07-01

    Full Text Available Abstract This paper presents results of the author’s PhD research: Catholic beliefs and practices, attitudes toward marriage, life and sexuality. The empirical support is a survey made to a sample of 500 students from Lisbon public universities, using a non-random sampling in two phases, first a quota sampling and after a convenience one. There are some results that stand out. More than half of students of the sample call themselves Catholic and believe in the dogmatic representations about God, Jesus and Mary, though other dogmatic beliefs as hell, purgatory and resurrection are much lower. There is some spirituality among students, although the importance of God is less important. The frequencies of the Mass, prayer, Holy Communion, confession are all very low. The attitudes toward marriage, life and sexuality lie between ‘some’ and ‘very’, with abortion having the smallest rating and contraception the highest. In general, undergraduate youth is away from the norms of the Church. At the same time, these youngsters believe and belong more than they practice. Keywords: Beliefs. Practices. Attitudes. Portugal. Undergraduate students.   Resumo Este artigo apresenta resultados da tese de doutoramento do autor: crenças e práticas católicas, atitudes em relação ao casamento, à vida e à sexualidade. O suporte empírico é um inquérito aplicado a uma amostra de 500 estudantes das universidades públicas de Lisboa, usando uma amostragem não aleatória em duas fases, primeiro a amostragem por quotas e depois a amostragem por conveniência. Há alguns resultados que se destacam. Mais do que metade da amostra denomina-se católica e acredita nas representações dogmáticas de Deus, Jesus e Maria, embora outras crenças dogmáticas como inferno, purgatório e ressurreição sejam bastante mais baixas. Há alguma espiritualidade entre os estudantes, embora menos considerem que Deus seja importante. A frequência da Missa, oração, comunhão, confissão é muito baixa. As atitudes relativamente ao casamento, vida e sexualidade estão entre ‘alguma’ e ‘muita’, tendo o aborto o valor mais pequeno e a contracepção o valor maior. Na generalidade, a juventude universitária está afastada das normas da Igreja. Ao mesmo tempo, eles acreditam e pertencem mais do que praticam. Palavras-chave: Crenças. Práticas. Atitudes. Portugal. Estudantes niversitários.

  5. Contribution to the Task 4.3.1 investigate how training should be planned to ensure efficient utilization of OSS. Task 4.3.2 evaluate how the introduction of OSS influences requirements to the basic education of the operator

    International Nuclear Information System (INIS)

    Balducelli, C.

    1995-01-01

    The introduction of computerized supports to improve efficiency in the activity of an intelligent agent (the operator in NPP case) increases the agent training demand. In fact also the informatic support can be viewed as an ''artificial agent'', more or less ''active'' depending on its internal degree of autonomy: the human agent needs to be trained to ''coordinate'' his behaviour with the behaviour of the artificial agent. The basic idea of this work is that a more safe, complete and integrated OSS could be a system (an artificial agent) that gives support to the human agent not only during the plant real operations, but also during the different phases of operator education and training for normal and emergency situations management. 7 refs, 2 figs

  6. Comparisons of CVID and IgGSD: Referring Physicians, Autoimmune Conditions, Pneumovax Reactivity, Immunoglobulin Levels, Blood Lymphocyte Subsets, and HLA-A and -B Typing in 432 Adult Index Patients

    Directory of Open Access Journals (Sweden)

    James C. Barton

    2014-01-01

    Full Text Available Common variable immunodeficiency (CVID and immunoglobulin (Ig G subclass deficiency (IgGSD are heterogeneous disorders characterized by respiratory tract infections, selective Ig isotype deficiencies, and impaired antibody responses to polysaccharide antigens. Using univariable analyses, we compared observations in 34 CVID and 398 IgGSD adult index patients (81.9% women referred to a hematology/oncology practice. Similarities included specialties of referring physicians, mean ages, proportions of women, reactivity to Pneumovax, median serum IgG3 and IgG4 levels, median blood CD56+/CD16+ lymphocyte levels, positivity for HLA-A and -B types, and frequencies of selected HLA-A, -B haplotypes. Dissimilarities included greater prevalence of autoimmune conditions, lower median IgG, IgA, and IgM, and lower median CD19+, CD3+/CD4+, and CD3+/CD8+ blood lymphocytes in CVID patients. Prevalence of Sjögren’s syndrome and hypothyroidism was significantly greater in CVID patients. Combined subnormal IgG1/IgG3 occurred in 59% and 29% of CVID and IgGSD patients, respectively. Isolated subnormal IgG3 occurred in 121 IgGSD patients (88% women. Logistic regression on CVID (versus IgGSD revealed a significant positive association with autoimmune conditions and significant negative associations with IgG1, IgG3, and IgA and CD56+/CD16+ lymphocyte levels, but the odds ratio was increased for autoimmune conditions alone (6.9 (95% CI 1.3, 35.5.

  7. Comparisons of CVID and IgGSD: referring physicians, autoimmune conditions, pneumovax reactivity, immunoglobulin levels, blood lymphocyte subsets, and HLA-A and -B typing in 432 adult index patients.

    Science.gov (United States)

    Barton, James C; Bertoli, Luigi F; Barton, J Clayborn

    2014-01-01

    Common variable immunodeficiency (CVID) and immunoglobulin (Ig) G subclass deficiency (IgGSD) are heterogeneous disorders characterized by respiratory tract infections, selective Ig isotype deficiencies, and impaired antibody responses to polysaccharide antigens. Using univariable analyses, we compared observations in 34 CVID and 398 IgGSD adult index patients (81.9% women) referred to a hematology/oncology practice. Similarities included specialties of referring physicians, mean ages, proportions of women, reactivity to Pneumovax, median serum IgG3 and IgG4 levels, median blood CD56+/CD16+ lymphocyte levels, positivity for HLA-A and -B types, and frequencies of selected HLA-A, -B haplotypes. Dissimilarities included greater prevalence of autoimmune conditions, lower median IgG, IgA, and IgM, and lower median CD19+, CD3+/CD4+, and CD3+/CD8+ blood lymphocytes in CVID patients. Prevalence of Sjögren's syndrome and hypothyroidism was significantly greater in CVID patients. Combined subnormal IgG1/IgG3 occurred in 59% and 29% of CVID and IgGSD patients, respectively. Isolated subnormal IgG3 occurred in 121 IgGSD patients (88% women). Logistic regression on CVID (versus IgGSD) revealed a significant positive association with autoimmune conditions and significant negative associations with IgG1, IgG3, and IgA and CD56+/CD16+ lymphocyte levels, but the odds ratio was increased for autoimmune conditions alone (6.9 (95% CI 1.3, 35.5)).

  8. Combined effects of radiotherapy and non-specific immunotherapy

    International Nuclear Information System (INIS)

    Yamashita, Takashi; Hayakawa, Yukiko; Mochizuki, Yukio

    1985-01-01

    Local and systemic effects of the combined use of radiotherapy and administration of OK-432 were examined using tumor-bearing mice. Tumor regrowth was inhibited by local administration of OK-432 following radiotherapy. Systemic inhibitory effects of OK-432 on tumors were not seen. When radiotherapy is performed in combination with administration of OK-432, synergistic effects will be observed. (Namekawa, K.)

  9. Chemical pleurodesis for prolonged postoperative air leak in primary spontaneous pneumothorax

    Directory of Open Access Journals (Sweden)

    Cheng-Hung How

    2014-05-01

    Conclusion: Chemical pleurodesis using OK-432 or minocycline is safe and convenient for prolonged air leak after thoracoscopic treatment for PSP. Our experience suggested that OK-432 may be more effective than minocycline in reducing air leak.

  10. Disease: H01471 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available HORS ... Ogita S, Tsuto T, Nakamura K, Deguchi E, Tokiwa K, Iwai N ... TITLE ... OK-432 therapy for lymphangioma in child...Rautio R, Rautiainen M, Airaksinen M ... TITLE ... OK-432 (Picibanil) therapy for lymphangiomas in children. ...

  11. ORF Alignment: NT_037436 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Drosophila melanogaster] ... Length = 72 ... Query: 373 DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTR...EKLAARTALSEARVQVWF 432 ... DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTR...EKLAARTALSEARVQVWF Sbjct: 1 ... DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWF 60 ...

  12. Novel inorganic precursors [Co.sub.4.32./sub.Zn.sub.1.68./sub.(HCO.sub.2./sub.).sub.18./sub.(C.sub.2./sub.H.sub.8./sub.N).sub.6./sub.]/SiO.sub.2./sub. and Co.sub.4.32./sub.Zn.sub.1.68./sub.(HCO2).sub.18./sub.(C.sub.2./sub.H.sub.8./sub.N).sub.6./sub.]/Al.sub.2./sub.O.sub.3./sub. for Fischer-Tropsch synthesis

    Czech Academy of Sciences Publication Activity Database

    Saheli, S.; Rezvani, A.R.; Malekzadeh, A.; Dušek, Michal; Eigner, Václav

    2018-01-01

    Roč. 43, č. 2 (2018), s. 685-694 ISSN 0360-3199 R&D Projects: GA ČR(CZ) GA15-12653S; GA MŠk(CZ) LO1603 EU Projects: European Commission(CZ) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : Fischer-Tropsch synthesis * coordination polymers * inorganic precursor * impregnation * catalytic performance Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 3.582, year: 2016

  13. Local Delivery System of Immune Modulating Drug for Unresectable Adenocarcinoma: In Vitro Experimental Study and In Vivo Animal Study

    International Nuclear Information System (INIS)

    Lee, Don Haeng; Kang, Sung-Gwon; Jeong, Seok; Yoon, Chang Jin; Choi, Jung-Ah; Byun, Ju Nam; Park, Jae Hyung; Lee, Kyu Back

    2006-01-01

    The purpose of the study was to evaluate the efficacy and safety of a developed drug delivery system containing OK-432 through in vitro and animal study. An OK-432-impregnated polycarbonate/polyurethane stent membrane was used to develop a drug delivery system (DDS) enabling the locoregional release of OK-432. Polyethyleneglycol was used as a detergent and porosity generator. The stability of OK-432 in solvent, releasing kinetics of drug, and cytotoxicity of the DDS were evaluated. OK-432-impregnated DDS was implanted in mice in which a human adenocarcinoma cell line was injected and grown in their back. Flow cytometry and enzyme-linked immunosorbent assay were used for quantifying the amount of drug. OK-432 exposed to phosphate-buffered saline and OK-432 exposed to N,N-dimethylacetamide showed similar results on dot graphs and histograms. However, OK-432 exposed to tetrahydrofurane showed different dot graphs and histograms, which means that the antigenicity of the drug was changed. The release rate of OK-432 was maintained at a constant level for 6 weeks. The local delivery of OK-432 was found to have an antitumor effect on a human adenocarcinoma cell line in an animal study, but no effect on this cell line in in vitro cell culture. Histologic examination showed minimal inflammatory reaction in surrounding tissue. Our study shows that local treatment using this OK-432 release system is safe and effective in reducing adenocarcinoma in a mouse model

  14. Clinical effect of concomitant use of non-specific immunopotentiator on 172 cases of primary lung cancer (stage 3, 4) treated with radiation combined with chemotherapy

    International Nuclear Information System (INIS)

    Hiyoshi, Yukio; Ogawa, Yasuhiro; Imajo, Yoshinari

    1981-01-01

    Between 1975 and 1979, 209 cases of primary lung cancer admitted the department of radiology were treated with radiation combined with chemotherapy. The clinical effect of concomitant use of non-specific immunopotentiator OK-432 and PSK was studied about stage 3, and stage 4. Survival curves were evaluated between the patients with OK-432 and/or PSK and those without immunotherapy. In 91 cases in stage 3, fifty percent survival period was found to be 12.2 months for 27 cases with OK-432, 14.4 months for 12 cases with combined use of OK-432 and PSK, 9.0 months for 24 cases with PSK, and 7.5 months for 28 cases without immunotherapy, respectively. Noticeable prolongation of fifty percent survival period was observed in the cases with combined use of OK-432 and PSK, OK-432, and PSK, inorder, as compared with those without immunotherapy. One-year survival rate was 51.9% for cases with OK-432, 66.7% with combined use OK-432 and PSK, 34.8% with PSK, and 25.0% without immunotherapy, respectively. In 81 cases in stage 4, fifty percent survival period was found to be 7.0 months for 24 cases with OK-432, 5.0 months for 8 cases with combined use of OK-432 and PSK, 7.6 months for 13 cases with PSK, and 3.3 months for 36 cases without immunotherapy, respectively. One-year survival rate was 16.7% for cases with OK-432, 25.0% with combined use of OK-432 and PSK, 15.4% with PSK and 5.6% without immunotherapy, respectively. (J.P.N.)

  15. Synthesis and evaluation of (S)-4-(3-(2'-[C-11]isopropylamino)-2-hydroxy-propoxy)-2H-benzimidazol-2-one ((S)-[C-11]CGP 12388) and (S)-4-(3-((1'-[F-18]-fluoroisopropyl)amino)-2-hydroxypropoxy)-2H-benzimidazol-2-one ((S)-[F-18]Fluoro-CGP 12388) for visualization of beta-adrenoceptors with positron emission tomography

    NARCIS (Netherlands)

    Elsinga, PH; vanWaarde, A; Jaeggi, KA; Schreiber, G; Heldoorn, M; Vaalburg, W

    1997-01-01

    The beta-adrenoceptor antagonist (S)-[C-11]CGP 12177 (4-(3-(tert-butylamino)-2-hydroxypropoxy)- 2H-benzimidazol-2[C-11]-one) is a generally accepted radioligand for cardiac and pulmonary PET studies. The synthesis of [C-11]CGP 12177 is a laborious and often troublesome procedure. Therefore, (S)-C GP

  16. Dark fermentative hydrogen and ethanol production from biodiesel waste glycerol using a co-culture of Escherichia coli and Enterobacter sp.

    NARCIS (Netherlands)

    Maru, B.T.; López, F.; Kengen, S.W.M.; Constantí, M.; Medina, F.

    2016-01-01

    In previous comparative studies, Enterobacter spH1 was selected as the best hydrogen and ethanol producer (Knothe, 2010). Here, glycerol fermentation was compared between three other strains: Escherichia coli CECT432, Escherichia coli CECT434 and Enterobacter cloacae MCM2/1. E. coli CECT432 was

  17. Evaluation of cement treated base courses : technical assistance report.

    Science.gov (United States)

    2000-12-01

    The objectives of this project are to determine the strength characteristics of soil cement bases that were constructed under stabilized procedures (DOTD TR 432M/432-99) and the cement treated design philosophy. This was accomplished by using the Fal...

  18. Study on Cyber Security and Threat Evaluation in SCADA Systems

    Science.gov (United States)

    2012-03-01

    125 4.3.2 ISO 27001 , 27002 ............................................................................................ 125 4.3.3...system environments. 4.3.2 ISO 27001 , 27002 The ISO 27001 and 27002 standards ensure proper security processes and technology are implemented in...asset owner, integrators, and vendors. Now it is an independent set of 3 standards which resemble the ISO /IEC 27001 and 27002 standards. ISO /IEC

  19. Non-bacterial etiologies of diarrheal diseases in Afghanistan.

    Science.gov (United States)

    Elyan, Diaa; Wasfy, Momtaz; El Mohammady, Hanan; Hassan, Khaled; Monestersky, Jesse; Noormal, Bashir; Oyofo, Buhari

    2014-08-01

    Microbial diarrheal diseases are one of the leading causes of child morbidity and mortality in developing countries. This study aimed to identify the main causes of non-bacterial diarrhea in Afghanistan. A total of 699 stools were collected from children aged under 5 years who presented with diarrhea at Indira Gandhi and Kandahar hospitals. Frozen aliquots were preserved for screening against rotavirus, astrovirus, adenovirus, norovirus, Cryptosporidium and Giardia, when bacterial cultures tested negative. Tests were performed at the hospitals after laboratory staff were trained and provided with enzyme-immunoassays and equipment. Results were confirmed at the U.S. Naval Medical Research Unit No. 3, Cairo, Egypt. Of the samples tested, 71.9% (503/699) were infected with one or more pathogens. However, the majority (85.8%; 432/503) showed single infections: rotavirus (72.2%; 329/432), Cryptosporidium (14.1%; 61/432), Giardia (5.1%; 22/432), astrovirus (2.3%; 10/432), adenovirus (1.6%; 7/432) and norovirus (0.7%; 3/432). The remaining 14% (71/503) showed mixed infections of the tested pathogens. Non-bacterial pathogens were identified that could enable health officials to adopt more effective treatment and control measures for diarrhea in Afghanistan. Published by Oxford University Press on behalf of Royal Society of Tropical Medicine and Hygiene 2014. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  20. Evaluation of concomitant use of non-specific immunopotentiator on 172 cases of primary lung cancer (Stage III, IV) treated with radiation combined with chemotherapy

    International Nuclear Information System (INIS)

    Ogawa, Yasuhiro; Kimura, Shuji; Imajo, Yoshinari; Hamada, Fumio; Miyaji, Chihiro

    1982-01-01

    The clinical effect of concomitant use of non-specific immunopotentiator OK-432 and/or PSK was studied about 172 cases of primary lung cancer (Stage III, IV). In 91 cases in stage III, fifty percent survival period was found to be 11.5 months for 63 cases with OK-432 and/or PSK, and 7.5 months for 28 cases without immunotherapy, respectively. In 81 cases in stage IV, fifty percent survival period was found to be 6.7 months for 45 cases with OK-432 and/or PSK, and 3.3 months for 36 cases without immunotherapy, respectively. (author)

  1. Increased tumor uptake of 67Ga citrate following a course of picibanil (NSC-B116209)

    International Nuclear Information System (INIS)

    Okuyama, Shinichi; Matsuzawa, Taiju; Mishina, Hitoshi.

    1979-01-01

    Exposure to exponential dose schedules of OK-432, penicillin-inactivated preparation of streptococcus hemolyticus (NSC-B116209), resulted in an increased retention of 67 Ga citrate. Its uptake in footpad tumors of AH 109A was also increased. The results may suggest that pretreatment with OK-432 would increase tumor uptake of 67 Ga citrate and help scintigraphic delineation of malignancies in man. It may probably augment tumor concentration of anticancer chemotherapeutics, too. Thus, the tumor affinitive property of OK-432 can be taken advantage of in anticancer strategy as well as cancer detection by 67 Ga scanning. (author)

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 432 ... ... lived experiences of late-adolescent female suicide survivors: 'A part of ... regarding psychosocial risk assessment during antenatal care, Abstract PDF ... Vol 22, No 1 (2017), The perceptions of professional nurses on ...

  3. c Nobl charact its an le silve terizat ntimicro er nano ion of obial e ...

    African Journals Online (AJOL)

    sunny

    Thin film of the sample was prepared on a carbon coated copper grid by just dropping a very ... structural characterization of nanoparticles, so the sizes of the synthesized ... particles by showing surface Plasmon absorption maxima at 432 nm.

  4. Download this PDF file

    African Journals Online (AJOL)

    Fr. Ikenga

    study investigated the effects of displacement on women and their protection regime as asylum seekers. ..... 4.3.2 of the Handbook on Internally Displaced Persons. ... for peace, self-determination, national liberation and independence, or who.

  5. Beyond a one-man show: The prelude of Revisionist Zionism, 1922-25

    Czech Academy of Sciences Publication Activity Database

    Zouplna, Jan

    2013-01-01

    Roč. 19, č. 3 (2013), s. 410-432 ISSN 1353-7121 Institutional support: RVO:68378009 Keywords : interwar Zionism * Israeli right * Russian-Jewish intelligentsia Subject RIV: AB - History Impact factor: 0.229, year: 2013

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 301 - 350 of 432 ... ... simultaneous cardiovascular workout and personal music device use on the ... Supply chain solutions to improve the distribution of antiretroviral drugs .... in traumatic brain injury and healthy comparisons, Abstract PDF.

  7. 2006 Volusia County Florida LiDAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset is the lidar data for Volusia County, Florida, approximately 1,432 square miles, acquired in early March of 2006. A total of 143 flight lines of Lidar...

  8. Preparation of aluminium lakes by electrocoagulation

    OpenAIRE

    Prapai Pradabkham

    2008-01-01

    Aluminium lakes have been prepared by electrocoagulation employing aluminium as electrodes. The electrocoagulation is conducted in an aqueous alcoholic solution and is completed within one hour. The dye content in the lake ranges approximately between 4-32%.

  9. Identification of Rhodococcus fascians cytokinins and their modus operandi to reshape the plant

    Czech Academy of Sciences Publication Activity Database

    Pertry, I.; Václavíková, Kateřina; Depuydt, S.; Galuszka, P.; Spíchal, Lukáš; Temmerman, W.; Stes, E.; Schmülling, T.; Kakimoto, T.; Van Montagu, M. C. E.; Strnad, Miroslav; Holsters, M.; Tarkowski, Petr; Vereecke, D.

    2009-01-01

    Roč. 106, č. 3 (2009), s. 929-934 ISSN 0027-8424 Institutional research plan: CEZ:AV0Z50380511 Keywords : phytopathogen * actinomycete * phytohormone Subject RIV: CE - Biochemistry Impact factor: 9.432, year: 2009

  10. Asteroid rotation excitation by subcatastrophic impacts

    Czech Academy of Sciences Publication Activity Database

    Henych, T.; Pravec, Petr

    2013-01-01

    Roč. 432, č. 2 (2013), s. 1623-1631 ISSN 0035-8711 Institutional support: RVO:67985815 Keywords : numerical methods * minor planets * general asteroids Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics Impact factor: 5.226, year: 2013

  11. Memory, place, and ecology in the contemporary American novel

    OpenAIRE

    Schliephake, Christopher

    2012-01-01

    Memory, place, and ecology in the contemporary American novel. - In: Literature, ecology, ethics / Timo Müller ... (eds.). - Heidelberg : Univ.-Verl. Winter, 2012. - S. 95-112. - (Anglistische Forschungen ; 432)

  12. Ecocriticism and ´The House of Mirth´?

    OpenAIRE

    Caupert, Christina

    2012-01-01

    Ecocriticism and ´The House of Mirth´? : imaginative literature and cultural-ecological ethics. - In: Literature, ecology, ethics / Timo Müller ... (eds.). - Heidelberg : Univ.-Verl. Winter, 2012. - S. 131-145. - (Anglistische Forschungen ; 432)

  13. 76 FR 5145 - Notice of Availability of the Final Long-Term Management and Storage of Elemental Mercury...

    Science.gov (United States)

    2011-01-28

    ..., Missouri; DOE Savannah River Site, Aiken, South Carolina; and Waste Control Specialists, LLC, Andrews... Andrews County Library, 109 NW. 1st Street, Andrews, TX 79714, (432) 523-9819. [[Page 5147

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 432 ... Vol 13, No 2 (2008), Evidence-based nursing interventions and guidelines ... Vol 9, No 4 (2004), Exercise and depression: A treatment manual, Abstract ... informed health education during comprehensive nursing care ...

  15. Significant Pre-Accession Factors Predicting Success or Failure During a Marine Corps Officer’s Initial Service Obligation

    Science.gov (United States)

    2015-12-01

    30 grams or less) CO MCD level waiver 317 Prostitution or solicitation for prostitution . 318 Reckless driving, careless, or imprudent (considered...property. 432 Public record; altering, concealing, destroying, mutilating, obligation, or removing. 433 Rape , sexual abuse, sexual assault

  16. Evidence of the use of a horn yoke in the Middle La Tène period, and an analysis of animal finds from La Tène features in the Velké Zboží and Malé Zboží cadasters, central Bohemia

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2015-01-01

    Roč. 67, č. 3 (2015), s. 432-437 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : cattle horn core * pathology * yoke * hornless sheep * Late Iron Age * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Stereotactic radiofrequency amygdalohippocampectomy: Two years of good neuropsychological outcomes

    Czech Academy of Sciences Publication Activity Database

    Malíková, H.; Krámská, L.; Vojtěch, Z.; Lukavský, Jiří; Liščák, R.

    2013-01-01

    Roč. 106, č. 3 (2013), s. 423-432 ISSN 0920-1211 Institutional support: RVO:68081740 Keywords : temporal lobe epilepsy * stereotactic surgery * neuropsychology outcome Subject RIV: AN - Psychology Impact factor: 2.190, year: 2013

  18. Physics Based Vision Systems for Robotic Manipulation

    Data.gov (United States)

    National Aeronautics and Space Administration — With the increase of robotic manipulation tasks (TA4.3), specifically dexterous manipulation tasks (TA4.3.2), more advanced computer vision algorithms will be...

  19. Chemical pleurodesis for prolonged postoperative air leak in primary spontaneous pneumothorax.

    Science.gov (United States)

    How, Cheng-Hung; Tsai, Tung-Ming; Kuo, Shuenn-Wen; Huang, Pei-Ming; Hsu, Hsao-Hsun; Lee, Jang-Ming; Chen, Jin-Shing; Lai, Hong-Shiee

    2014-05-01

    Prolonged air leak is the most common complication after thoracoscopic operation for primary spontaneous pneumothorax (PSP), and the role of chemical pleurodesis in treating air leaks remains unclear. This study evaluated the safety and efficacy of chemical pleurodesis with a comparison between minocycline and OK-432. Between 1994 and 2011, 1083 PSP patients were treated by thoracoscopic operation. After the operation, patients with persistent air leak for 3 days or more were managed by minocycline or OK-432 pleurodesis. The demographic and outcome data for these patients were collected by retrospective chart review. Seventy-nine patients (7.3%) with prolonged air leak after thoracoscopy underwent minocycline pleurodesis (60 patients) or OK-432 pleurodesis (19 patients) as the primary treatment. The primary success rate was 63% (38/60) for minocycline pleurodesis and 95% (18/19) for OK-432 pleurodesis (p = 0.009). Postpleurodesis pain was common and comparable between the two groups. No major complications were noted after a total of 121 treatments. Patients undergoing primary OK-432 pleurodesis had shorter durations of postpleurodesis chest drainage (mean 8.5 vs. 2.3 days; p < 0.001) and postoperative hospital stay (mean 11.9 vs. 6.8 days; p < 0.001) than those undergoing primary minocycline pleurodesis. After a median follow-up of 16 months, recurrence was noted in one patient in the OK-432 group and none in the minocycline group. Long-term pulmonary function in the two groups was comparable. Chemical pleurodesis using OK-432 or minocycline is safe and convenient for prolonged air leak after thoracoscopic treatment for PSP. Our experience suggested that OK-432 may be more effective than minocycline in reducing air leak. Copyright © 2013. Published by Elsevier B.V.

  20. A Broadband VHF-L Band Cavity-Backed Slot Spiral Antenna

    Science.gov (United States)

    2005-05-01

    each new frequency. When the frequency list is completed, the Flight Test Engineer will contact the Test Technician and request any necessary...immediately required elsewhere. Frequency List ; 50.05 MHz, 144.05 MHz, 432.05 MHz, 902.05 MHz, 1.29605 GHz...Repeat Completed? (Y/N) Test Completed? (Y/N) Frequency List ; 50.05 MHz, 144.05 MHz, 432.05 MHz, 902.05 MHz, 1.29605 GHz

  1. Analysis of the active site mechanism of Tyrosyl-DNA phosphodiesterase I: a member of the phospholipase D superfamily

    Science.gov (United States)

    Gajewski, Stefan; Comeaux, Evan Q.; Jafari, Nauzanene; Bharatham, Nagakumar; Bashford, Donald; White, Stephen W.; van Waardenburg, Robert C.A.M.

    2011-01-01

    Tyrosyl DNA phosphodiesterase I (Tdp1) is a member of the phospholipase D superfamily and hydrolyzes 3′phospho-DNA adducts via two conserved catalytic histidines, one acting as the lead nucleophile and the second as a general acid/base. Substitution of the second histidine specifically to arginine contributes to the neurodegenerative disease SCAN1. We investigated the catalytic role of this histidine in the yeast protein (His432) using a combination of X-ray crystallography, biochemistry, yeast genetics and theoretical chemistry. The structures of wild type Tdp1 and His432Arg both show a phosphorylated form of the nucleophilic histidine that is not observed in the structure of His432Asn. The phosphohistidine is stabilized in the His432Arg structure by the guanidinium group that also restricts access of a nucleophilic water molecule to the Tdp1-DNA intermediate. Biochemical analyses confirm that His432Arg forms an observable and unique Tdp1-DNA adduct during catalysis. Substitution of His432 by Lys does not affect catalytic activity or yeast phenotype, but substitution with Asn, Gln, Leu, Ala, Ser and Thr all result in severely compromised enzymes and Top1-camptothecin dependent lethality. Surprisingly, His432Asn did not show a stable covalent Tdp1-DNA intermediate which suggests another catalytic defect. Theoretical calculations revealed that the defect resides in the nucleophilic histidine and that the pKa of this histidine is crucially dependent upon the second histidine and the incoming phosphate of the substrate. This represents a unique example of substrate-activated catalysis that applies to the entire phospholipase D superfamily. PMID:22155078

  2. Degradation models and ecotoxicity in marine waters of two antifouling compounds: sodium hypochlorite and an alkylamine surfactant.

    Science.gov (United States)

    López-Galindo, Cristina; Garrido, M Carmen; Casanueva, José F; Nebot, Enrique

    2010-03-15

    Industrial wastes have a substantial impact on coastal environments. Therefore, to evaluate the impact of cooling water discharges from coastal power plants, we studied the kinetics of the degradative processes and the ecotoxicity of two antifouling products: (1) a classic antifouling product; sodium hypochlorite (NaClO) and (2) an alternative one; aliphatic amines (commercial under the registered trade mark Mexel432). To assess the persistence of both compounds the decay of sodium hypochlorite and the primary biodegradation rate of Mexel432 were determined in natural seawater at 20 degrees C. The results indicated a more rapid decay of NaClO than Mexel432. The degradation behavior of both chemicals was described following a logistic model, which permitted calculating kinetic parameters such as t(50) or t(90). The t(50) was 1h and 2d for NaClO and Mexel432, respectively. To evaluate the potential risks of the aforementioned treatments to marine organisms, the acute toxicity of both antifouling products was studied on the microalgae Isochrysis galbana and Dunaliella salina, and on the invertebrate Brachionus plicatilis, using growth inhibition and death tests as toxic response, respectively. For I. galbana, the 96-h EC(50) values were 2.91+/-0.15mg/L of NaClO and 4.55+/-0.11mg/L of Mexel432. D. salina showed values of 96-h EC(50) of 1.73+/-0.16mg/L of NaClO and 7.21+/-0.1mg/L of Mexel432. Brachionus plicatilis showed a 24-h LC(50) of 1.23+/-0.1mg/L of NaClO and 3.62+/-0.37mg/L of Mexel432. Acute toxicity was highly dependent on the chemical and species tested. NaClO presented more toxic effects than Mexel432, also B. plicatilis was the most sensitive species in both cases. The lowest NOECs obtained, 0.25mg/L for NaClO and 2.12mg/L for Mexel432, were similar to the theoretical residual concentrations of these biocides in cooling water discharges. Therefore, these discharges can cause undesirable negative effects upon the aquatic organisms present.

  3. Combination therapy of radiation and immunomodulators in the treatment of MM46 tumor transplanted in C3H/He mice

    Energy Technology Data Exchange (ETDEWEB)

    Miyaji, C.; Ogawa, Y.; Imajo, Y.; Kimura, S. (Kobe Univ. (Japan). School of Medicine)

    1982-06-01

    Female C3H/He mice aged 12 weeks, transplanted MM46 tumor, were used in this study on the timing of administration of immunomodulators, such as PSK (a proteinbound polysaccharide prepared from Coriolus versicolor), OK-432 (Streptococcal preparation), bestatin (inhibitor of aminopeptidases of microbial origin) and levamisole (a chemical substance belonging to anthelmintics) combined with two fractionated local irradiation with the total dose of 3,000 rads. The daily dose of 250 ng/kg of PSK, 1 KE/mouse of OK-432, 300 mu g/mouse of bestatin or 3mg/kg of levamisole was respectively injected intraperitoneally for four consecutive days before or after irradiation. The anti-tumor effect was evaluated by the changes of tumor volume and survival curves. When PSK, OK-432 or levamisole was administered after irradiation, tumor growth was decreased and sixty-day survival rate and survival curve were significantly elongated compared with the control group and the group to which PSK, OK-432 or levamisole administered before irradiation (p lt 0.01). As for bestatin, no remarkable difference was observed irrespective of the timing of administration. These results suggested that some immunomodulators showed different anti-tumor activity depending on its timing of administration in the combination with radiotherapy. Concerning PSK, OK-432 and levamisole, they seemed to be beneficial in combination with prior radiotherapy in the treatment of MM46 tumor.

  4. Combination therapy of radiation and immunomodulators in the treatment of MM46 tumor transplanted in C3H/He mice

    International Nuclear Information System (INIS)

    Miyaji, Chihiro; Ogawa, Yasuhiro; Imajo, Yoshinari; Kimura, Shuji

    1982-01-01

    Female C3H/He mice aged 12 weeks, transplanted MM46 tumor, were used in this study on the timing of administration of immunomodulators, such as PSK (a proteinbound polysaccharide prepared from Coriolus versicolor), OK-432 (Streptococcal preparation), bestatin (inhibitor of aminopeptidases of microbial origin) and levamisole (a chemical substance belonging to anthelmintics) combined with two fractionated local irradiation with the total dose of 3,000 rads. The daily dose of 250 ng/kg of PSK, 1 KE/mouse of OK-432, 300 mu g/mouse of bestatin or 3mg/kg of levamisole was respectively injected intraperitoneally for four consecutive days before or after irradiation. The anti-tumor effect was evaluated by the changes of tumor volume and survival curves. When PSK, OK-432 or levamisole was administered after irradiation, tumor growth was decreased and sixty-day survival rate and survival curve were significantly elongated compared with the control group and the group to which PSK, OK-432 or levamisole administered before irradiation (p lt 0.01). As for bestatin, no remarkable difference was observed irrespective of the timing of administration. These results suggested that some immunomodulators showed different anti-tumor activity depending on its timing of administration in the combination with radiotherapy. Concerning PSK, OK-432 and levamisole, they seemed to be beneficial in combination with prior radiotherapy in the treatment of MM46 tumor. (author)

  5. Combination therapy of radiation and immunomodulators in the treatment of MM46 tumor transplanted in C3H/He mice

    International Nuclear Information System (INIS)

    Miyaji, Chihiro; Imanaka, Kazufumi; Gose, Kyuhei; Ichiyanagi, Akihiro; Imajo, Yoshinari

    1983-01-01

    Female C3H/He mice aged 13 weeks with transplanted MM 46 tumor were used in histological and enzymohistochemical studies on the timing of administration of immunomodulators, PSK (a protein bound polysaccharide prepared from Coriolus versicolor), or OK-432 (Streptococcal preparation) combined with two fractionated local irradiation with the total dose of 3,000 rad. The daily dose of 250 mg/kg of PSK, or 1 KE/mouse of OK-432 was respectively injected intraperitoneally for four consecutive days before or after irradiation. Mice were sacrificed before irradiation and 7, 14 and 21 days after irradiation. Resected tumor tissues were examined using H-E staining and α-naphtyl acetate esterase (ANAE) staining to observe the stromal reactions such as the infiltration of mononuclear cells and fibroblasts around tumor tissues. When PSK or OK-432 was administered after irradiation, remarkable lymphocytic infiltration was observed compared with the control group and the group to which PSK or OK-432 was administered before irradiation. ANAE staining revealed most of infiltrating lymphocytes were T-cells. These results suggested that PSK and OK-432 which were received after radiotherapy enhanced the immunological responses against tumors which were represented by remarkable lymphocytic infiltration. (author)

  6. Combination therapy of radiation and immunomodulators in the treatment of MM46 tumor transplanted in C3H/He mice. Histological and histoenzymatic studies using alpha-naphtyl acetate esterase staining

    Energy Technology Data Exchange (ETDEWEB)

    Miyaji, Chihiro; Imanaka, Kazufumi; Gose, Kyuhei; Ichiyanagi, Akihiro; Imajo, Yoshinari (Kobe Univ. (Japan). School of Medicine)

    1983-12-01

    Female C3H/He mice aged 13 weeks with transplanted MM 46 tumor were used in histological and enzymohistochemical studies on the timing of administration of immunomodulators, PSK (a protein bound polysaccharide prepared from Coriolus versicolor), or OK-432 (Streptococcal preparation) combined with two fractionated local irradiation with the total dose of 3,000 rad. The daily dose of 250 mg/kg of PSK, or 1 KE/mouse of OK-432 was respectively injected intraperitoneally for four consecutive days before or after irradiation. Mice were sacrificed before irradiation and 7, 14 and 21 days after irradiation. Resected tumor tissues were examined using H-E staining and ..cap alpha..-naphtyl acetate esterase (ANAE) staining to observe the stromal reactions such as the infiltration of mononuclear cells and fibroblasts around tumor tissues. When PSK or OK-432 was administered after irradiation, remarkable lymphocytic infiltration was observed compared with the control group and the group to which PSK or OK-432 was administered before irradiation. ANAE staining revealed most of infiltrating lymphocytes were T-cells. These results suggested that PSK and OK-432 which were received after radiotherapy enhanced the immunological responses against tumors which were represented by remarkable lymphocytic infiltration.

  7. Experimental study on active specific immunotherapy utilizing the immune reaction of low-dose irradiated tumor tissue, 5

    International Nuclear Information System (INIS)

    Ogawa, Yasuhiro; Imanaka, Kazufumi; Gose, Kyuhei; Imajo, Yoshinari; Kimura, Shuji

    1982-01-01

    We have already reported the remarkable effect of the active specific immunotherapy utilizing cryopreserved tumor cells and infiltrating mononuclear cells prepared from a low-dose irradiated tumor tissue after cytoreductive radiotherapy. In the present study, the effect of a biological response modifier, OK-432 combined with this active specific immunotherapy was investigated. Twelve-week-aged female C3H/He mice transplanted with MM46 tumor cells were received local radiotherapy with the dose of 3,000 rads by high energy electron beam on the sixth day after inoculation. This active specific immunotherapy was performed on the thirteenth day, and daily dose of 1.0 KE of OK-432 was injected intraperitoneally from the thirteenth day to the seventeenth day. The inhibition of the tumor growth was observed in the group which received this active specific immunotherapy combined with a biological response modifier, OK-432 compared with that received this active specific immunotherapy alone. (author)

  8. [Severe iatrogenic airway obstruction due to lingual lymphangioma].

    Science.gov (United States)

    Segado Arenas, A; Flores González, J-C; Rubio Quiñones, F; Quintero Otero, S; Hernández González, A; Pantoja Rosso, S

    2011-09-01

    Lymphangioma of the tongue is a rare and benign tumour involving congenital and cystic abnormalities derived from lymphatic vessels. Treatment modalities include surgery and a large number of different intralesional injections of sclerosing agents. Presently, OK-432 (Picibanil(®)) is the preferred sclerosant and when administered intralesionally will result in inflammation, sclerosis, and cicatricial contraction of the lesion. We report a case of microcystic lymphangioma of the tongue in a 5-year-old boy treated with an intralesional injection of OK-432. In the immediate postoperative period, the patient suffered severe diffuse swelling, progressive upper airway obstruction with inspiratory stridor, and respiratory distress requiring emergency fiberoptic nasotracheal intubation. Although OK-432 injections are found to be safe and effective as a first line of treatment for lymphangiomas, local swelling with potentially life-threatening airway compromise should be anticipated, especially when treating lesions near the upper airway. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  9. Alleviation of acute radiation damages by post-irradiation treatments

    International Nuclear Information System (INIS)

    Kurishita, A.; Ono, T.

    1992-01-01

    Radiation induced hematopoietic and gastro-intestinal damages in mice were tried to alleviate experimentally by post-treatment. Combined treatment of OK-432 and aztreonam clearly prevented the radiation induced sepsis and elevated the survival rate in mice; the survival was 80% in the OK-432 plus aztreonam group while it was 55% in the group treated with OK-432 alone and 0% with saline. Irsogladine maleate, an anti-ulcer drug, increased the survival rate of jejunal crypt stem cells with a clear dose-related trend. The D 0 for irsogladine maleate was 2.8 Gy although it was 2.3 Gy for saline, These findings suggest that some conventional drugs are effective for radiation induced hematopoietic and gastro-intestinal damages and the possibility that they can be applied for people exposed to radiation accidentally. (author)

  10. Parallel Attack and the Enemy’s Decision Making Process

    Science.gov (United States)

    1998-04-01

    Theory Coursebook , Vol 2, Sept 1997, p 365 8 Joint Publication 3-0, Doctrine for Joint Operations, 1 Feb 1995, p III-11 9 Gorrell, LtCol Edgar S., “The...Behavioral Strategies,” Journal of the American Statistical Association, Vol 90, Issue 432, December, 1995, p1137 3 Joint Publication 5-0, Doctrine for...Strategies,” Journal of the American Statistical Association, Vol 90, Issue 432, December, 1995, p1137 Allison, Graham T., “Conceptual Models and the Cuban

  11. Defense Trade Data: Sources and Recommendations

    Science.gov (United States)

    2010-11-01

    Sabre reconnaissance vehicles and Spartan, Stormer and FV-432 Bulldog APC $144m deaJ GBP70 m ($126-129 m) deal; BGM-109 Tomahawk Block-JV (Tactical...6BTA-5.9 version;; for 189 BvS-10 APC from Sweden and modernization of some 2100 Scimitar and Sabre reconnaissance vehicles and Spartan. Stormer ...Viking CV variant 29 AFV 432 1487 Stormer APC 147 CVR(T) Scimitar 322 CVR(T) Spartan 494 CVR(T) Sturgeon 35 CVR(T) Salamander 32 Saxon 147

  12. Current Practices In Infant Nutrition In Benin City, Nigeria ...

    African Journals Online (AJOL)

    Of the 780 mothers 432 (55.6%) had children who were less than 6 months while 348(44.6%) had older infants. About 98.0% of the mothers were practicing one form of breast-feeding or the other. The exclusive breastfeeding rate (EBR), predominant breastfeeding rate (PBR) and bottle-feed rates (BOTFR) were respectively ...

  13. East African Medical Journal - Vol 78, No 8 (2001)

    African Journals Online (AJOL)

    Epidemiology of poliomyelitis in northwestern Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T. Tessema, A. Hailu, 430-432. http://dx.doi.org/10.4314/eamj.v78i8.8996 ...

  14. Fatigue mechanisms in ultrafine-grained copper

    Czech Academy of Sciences Publication Activity Database

    Lukáš, Petr; Kunz, Ludvík; Svoboda, Milan

    2009-01-01

    Roč. 47, č. 1 (2009), s. 1-9 ISSN 0023-432X R&D Projects: GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : ultrafine-grained copper * effect of purity * effect of temperature Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.345, year: 2007

  15. Unilateral renal agenesis associated with ovarian cysts in a 19 year ...

    African Journals Online (AJOL)

    MJP

    2015-10-28

    379. doi: http://dx.doi.org/10.14194/ijmbr.4.3.2. How to cite this article: Anyabolu E.N,. Chukwuonye I.I, Anyabolu A.E, Enwere O.O.. Unilateral renal agenesis associated with ovarian cysts in a 19 year old woman in Orlu,.

  16. Distribution, antibiotic susceptibility and tolerance of bacterial isolates in culture-positive cases of endocarditis in The Netherlands

    NARCIS (Netherlands)

    van der Meer, J. T.; van Vianen, W.; Hu, E.; van Leeuwen, W. B.; Valkenburg, H. A.; Thompson, J.; Michel, M. F.

    1991-01-01

    During a two-year period data were collected nationwide in The Netherlands on 438 episodes of bacterial endocarditis (BE) in 432 patients. Of the strains isolated in these patients 419 were available for analysis. Of these, 326 were isolated in native valve endocarditis (NVE) and 93 in prosthetic

  17. Eggshell strength of an obligate brood parasite: a test of the puncture resistance hypothesis

    Czech Academy of Sciences Publication Activity Database

    Antonov, A.; Stokke, B. G.; Moksnes, A.; Kleven, O.; Honza, Marcel; Roskaft, E.

    2006-01-01

    Roč. 60, č. 1 (2006), s. 11-18 ISSN 0340-5443 Grant - others:Research Council of Norway(NO) 151641/432 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * eggshell thickness * puncture resistance * Acrocephalus * cuckoo Subject RIV: EG - Zoology Impact factor: 2.316, year: 2006

  18. Enteroaggregative, Shiga Toxin-Producing Escherichia coli O111:H2 Associated with an Outbreak of Hemolytic-Uremic Syndrome

    Science.gov (United States)

    Morabito, Stefano; Karch, Helge; Mariani-Kurkdjian, Patrizia; Schmidt, Herbert; Minelli, Fabio; Bingen, Edouard; Caprioli, Alfredo

    1998-01-01

    Shiga toxin-producing Escherichia coli O111:H2 strains from an outbreak of hemolytic-uremic syndrome showed aggregative adhesion to HEp-2 cells and harbored large plasmids which hybridized with the enteroaggregative E. coli probe PCVD432. These strains present a novel combination of virulence factors and might be as pathogenic to humans as the classic enterohemorrhagic E. coli. PMID:9508328

  19. Intergrated dental care in nursing homes

    NARCIS (Netherlands)

    Gerritsen, P.F.M.

    2015-01-01

    The thesis deals with integrated dental care in nursing homes. First, the dental treatment needs were ascertained of 432 residents in three Dutch nursing homes that offer integrated dental care. Dentist researchers intra-orally examined the residents and found that 72% required dental treatment.

  20. Evaluating Gifted Identification Practice: Aptitude Testing and Linguistically Diverse Learners

    Science.gov (United States)

    Matthews, Michael S.; Kirsch, Lauri

    2011-01-01

    The authors examined individually administered IQ scores from an entire K-5 population (N = 432) of Limited English Proficient students referred for gifted program eligibility determination in a single large urban district in the southeastern United States. Of 8 IQ tests compared, only 1, the Stanford-Binet V, had scores appreciably lower than…

  1. Prevalence of hemoprotozoan diseases in cattle population of chittagong division, Bangladesh

    DEFF Research Database (Denmark)

    Alim, Md. Abdul; Das, Shubhagata; Roy, Krisna

    2012-01-01

    A one year (2009-10) prevalence study on hemoprotozoan diseases was conducted in crossbred and indigenous cattle, Chittagong, Bangladesh. Blood samples were collected randomly from 216 crossbred and 432 indigenous cattle of four representative areas in three consecutive seasons. Samples were exam...

  2. 49 CFR 393.62 - Emergency exits for buses.

    Science.gov (United States)

    2010-10-01

    ... (including a school bus used in interstate commerce for non-school bus operations) with a GVWR of more than 4... manufacture. (2) Each bus (including a school bus used in interstate commerce for non-school bus operations... passenger space provided, inclusive of the driver there shall be at least 432 cm2 (67 square inches) of...

  3. Nintedanib Plus Pemetrexed/Cisplatin in Patients With Malignant Pleural Mesothelioma

    DEFF Research Database (Denmark)

    Grosso, Federica; Steele, Nicola; Novello, Silvia

    2017-01-01

    ). Neutropenia was the most frequent grade ≥ 3 adverse event (AE; nintedanib 43.2% v placebo 12.2%); rates of febrile neutropenia were low (4.5% in nintedanib group v 0% in placebo group). AEs leading to discontinuation were reported in 6.8% of those receiving nintedanib versus 17.1% of those in the placebo...

  4. 78 FR 21151 - G4 Products, LLC a Subsidiary of G4 Holdings, Inc. Including Workers Whose Wages are Paid Under...

    Science.gov (United States)

    2013-04-09

    ... certification for G4 Products. Additional information provided by the company official revealed that the subject... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-81,432] G4 Products, LLC a...-Site Leased Workers from OSW and Maine Staffing Group Lewiston, ME; Amended Certification Regarding...

  5. Effects of feeding diets containing highly peroxidized dried distillers grains with solubles and increasing vitamin E levels to wean-finish pigs on growth performance, carcass characteristics, and pork fat composition

    Science.gov (United States)

    Lipid peroxidation in animal feed can negatively affect growth performance and meat quality. Weanling pigs (n = 432; BW = 6.6 ± 0.4 kg) were used to evaluate the effects of feeding a peroxidized dried distillers grains with solubles (DDGS) source with three levels of vitamin E (a-tocopheryl acetate)...

  6. The effect of cocaine sensitization on mouse immunoreactivity

    Czech Academy of Sciences Publication Activity Database

    Kubera, M.; Filip, M.; Basta-Kaim, A.; Nowak, E.; Siwanowicz, J.; Zajícová, Alena; Holáň, Vladimír; Maes, M.; Lasoń, W.

    2004-01-01

    Roč. 483, - (2004), s. 309-315 ISSN 0014-2999 R&D Projects: GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5052915 Keywords : cocaine sensitization, cytokine Subject RIV: EC - Immunology Impact factor: 2.432, year: 2004

  7. Composition and Physicochemical Properties of Starch from Christ ...

    African Journals Online (AJOL)

    Starch was extracted from seeds of Christ Thorn by hot water extraction method. The composition and physicochemical properties of the extracted starch were determined using standard methods. The results obtained from the analyses revealed that the % yield of starch was 43.2%, while moisture content, ash content, ...

  8. intra-species variation of the properties of gum exudates from Acacia

    African Journals Online (AJOL)

    a

    The results show that significant inter-species variation of the properties of the gum exudates from the two species exist, whereas only some parameters show significant intra-species variation. The specific optical rotations of the gum exudates have been found to vary from ---43.2o to ---52o for Acacia senegal var. senegal ...

  9. Should I Stay or Should I Go? Physical Education Teachers' Career Intentions

    Science.gov (United States)

    Mäkelä, Kasper; Hirvensalo, Mirja; Whipp, Peter R.

    2014-01-01

    Purpose: This study investigated Finnish physical education (PE) teachers' intentions to leave the profession and the reasons behind them. Method: A large sample (N = 808) of PE teachers who graduated between 1980 and 2008 (432 women, 376 men) answered a modified job satisfaction and teacher follow-up questionnaire that elicited career…

  10. Flood duration determines the reproduction success of fish in artificial oxbows in a floodplain of a potamal river

    Czech Academy of Sciences Publication Activity Database

    Janáč, Michal; Ondračková, Markéta; Jurajda, Pavel; Valová, Zdenka; Reichard, Martin

    2010-01-01

    Roč. 19, č. 4 (2010), s. 644-655 ISSN 0906-6691 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : young-of-the-year * flood pulse concept * regression * recruitment * reproductive guilds Subject RIV: EH - Ecology, Behaviour Impact factor: 1.432, year: 2010

  11. Blood Pressure and Impedance Cardiography duríng Tilt Table Test

    Czech Academy of Sciences Publication Activity Database

    Jurák, Pavel; Halámek, Josef; Vondra, Vlastimil; Plachý, M.; Fráňa, P.; Leinveber, Pavel

    2009-01-01

    Roč. 36, - (2009), s. 429-432 ISSN 0276-6574 R&D Projects: GA AV ČR IAA200650801 Institutional research plan: CEZ:AV0Z20650511 Keywords : blood pressure * heart rate * thoracic impedance cardiography Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering http://cinc.mit.edu/archives/2009/pdf/0429.pdf

  12. Transport of Butane in a Porous Vycor Glass Membrane in the Region of Condensation Pressure.

    Czech Academy of Sciences Publication Activity Database

    Uchytil, Petr; Petričkovič, Roman; Seidel-Morgenstern, A.

    2007-01-01

    Roč. 293, 1-2 (2007) , s. 15-21 ISSN 0376-7388 R&D Projects: GA AV ČR(CZ) IAA4072402 Institutional research plan: CEZ:AV0Z40720504 Keywords : mass transport * porous vycor glass * capillary condensation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.432, year: 2007

  13. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  14. Effect of preparation procedure on the formation of nanostructuredceria–zirconia mixed oxide catalysts for ethyl acetate oxidation:Homogeneous precipitation with urea vs template-assistedhydrothermal synthesis

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Ivanova, R.; Henych, Jiří; Dimitrov, M.; Kormunda, M.; Kovacheva, D.; Scotti, N.; Dal Santo, V.; Štengl, Václav

    2015-01-01

    Roč. 502, JUL (2015), s. 418-432 ISSN 0926-860X Institutional support: RVO:61388980 Keywords : Ceria–zirconia mixed oxides * Template -assisted hydrothermal method * Urea hydrolysis * Ethyl acetate oxidationa Subject RIV: CA - Inorganic Chemistry Impact factor: 4.012, year: 2015

  15. Analytical Method Details (MS): SE2_MS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available 00.0-1500.0); 2: ITMS + c norm !corona !pi Dep MS/MS Most intense ion from (1)., Rejected mass=284.2000;300.2000;328.2000;344.2000;372.2000;388.2000;416.3000;432.3000;460.0000. ...

  16. The development of a new class of inhibitors for betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Pícha, Jan; Vaněk, Václav; Buděšínský, Miloš; Mládková, Jana; Garrow, T. A.; Jiráček, Jiří

    2013-01-01

    Roč. 65, July (2013), s. 256-275 ISSN 0223-5234 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : BHMT * inhibitor * homocysteine * phosphonate * phosphinate * amino acid derivative * bioisostere * S-alkylated homocysteine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  17. Microstructure evolution of an Al-Pd-Co alloy

    Czech Academy of Sciences Publication Activity Database

    Kahalová, Ĺ.; Kusý, M.; Buršík, Jiří; Svoboda, Milan; Illeková, E.; Švec, P.; Dolinšek, J.; Janovec, J.

    2008-01-01

    Roč. 46, č. 4 (2008), s. 221-227 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/07/1259 Institutional research plan: CEZ:AV0Z20410507 Keywords : complex metallic alloys * Al-Pd-Co system * differential thermal analysis Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  18. Phase analysis of Fe-B-V system

    Czech Academy of Sciences Publication Activity Database

    Homolová, V.; Výrostková, A.; Čiripová, L.; Kroupa, Aleš

    2013-01-01

    Roč. 51, č. 2 (2013), s. 135-139 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/10/1908 Institutional support: RVO:68081723 Keywords : CALPHAD method * Fe-B-V system * phase diagram Subject RIV: BJ - Thermodynamics Impact factor: 0.546, year: 2013

  19. Structure and pervaporation properties of poly(phenylene-iso-phthalamide) membranes modified by Fullerene C-60

    Czech Academy of Sciences Publication Activity Database

    Penkova, A. V.; Polotskaya, G. A.; Toikka, A. M.; Trchová, Miroslava; Šlouf, Miroslav; Urbanová, Martina; Brus, Jiří; Brožová, Libuše; Pientka, Zbyněk

    2009-01-01

    Roč. 294, 6-7 (2009), s. 432-440 ISSN 1438-7492 Institutional research plan: CEZ:AV0Z40500505 Keywords : fullerene * methanol/cyclohexane mixture * modification Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.742, year: 2009

  20. 75 FR 61386 - Emergency Escape Breathing Apparatus Standards

    Science.gov (United States)

    2010-10-05

    ... operator RSIA--Rail Safety Improvement Act of 2008, Public Law 110-432, Division A SCBA--self-contained.... Compliance With the Unfunded Mandates Reform Act of 1995 G. Environmental Assessment H. Energy Impact I... pose an inhalation hazard in the event of a release''; (2) provide a place for convenient storage of...

  1. Petrological and geochemical studies of ultramafic–mafic rocks from ...

    Indian Academy of Sciences (India)

    rocks from the North Puruliya Shear Zone (eastern India). Aditi Mandal∗ ..... quently replaced by hornblende along margin and are greater in ...... tion and accumulation. ..... J. Petrol. 43(2) 219–241. Das D K 1977 A review on sulphide zone around Belamu hill, ... implication for trans-continental Gondwanaland correla-.

  2. Afløbsinstallationer

    DEFF Research Database (Denmark)

    Ovesen, K.; Faldager, I.; Nielsen, V.

    Denne SBI-anvisning gennemgår hele afløbsområdet og giver beskrivelser, dimensioneringsvejledninger og eksempler med udgangspunkt i Norm for afløbsinstallationer, DS 432, 2.udgave 1994. I anvisningen behandles spildevands-, regnvands- og drænvandsinstallationer både i forbindelse med separat- og...

  3. Recent progress in research on tungsten materials for nuclear fusion applications in Europe

    Czech Academy of Sciences Publication Activity Database

    Rieth, M.; Dudarev, S.L.; Gonzalez de Vicente, S.M.; Aktaa, J.; Ahlgren, T.; Antusch, S.; Armstrong, D.E.J.; Balden, M.; Baluc, N.; Barthe, M.-F.; Basuki, W.W.; Battabyal, M.; Becquart, C.S.; Blagoeva, N.; Boldyryeva, Hanna; Brinkmann, J.; Celino, M.; Ciupinski, L.; Correia, J.B.; De Backer, A.; Domain, C.; Gaganidze, E.; García-Rosales, C.; Gibson, J.; Gilbert, M.R.; Giusepponi, S.; Gludovatz, B.; Greuner, H.; Heinola, K.; Höschen, T.; Hoffmann, A.; Holstein, A.; Koch, F.; Krauss, W.; Li, H.; Lindig, S.; Linke, J.; Linsmeier, Ch.; López-Ruiz, P.; Maier, H.; Matějíček, Jiří; Mishra, T.P.; Muhammed, M.; Muñoz, A.; Muzyk, M.; Nordlund, K.; Nguyen-Manh, D.; Opschoor, J.; Ordás, N.; Palacios, Y.; Pintsuk, G.; Pippan, R.; Reiser, J.; Riesch, J.; Roberts, S. G.; Romaner, L.; Rosiński, M.; Sanchez, M.; Schulmeyer, W.; Traxler, H.; Ureña, G.; van der Laan, J.G.; Veleva, L.; Wahlberg, S.; Walter, M.; Weber, T.; Weitkamp, T.; Wurster, S.; Yar, M.A.; You, J.H.; Zivelonghi, A.

    2013-01-01

    Roč. 432, 1-3 (2013), s. 482-500 ISSN 0022-3115 Institutional support: RVO:61389021 Keywords : tungsten * joining * composites * graded materials * fusion materials Subject RIV: JF - Nuclear Energetics Impact factor: 2.016, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022311512004278

  4. Closed-cell polymeric foam for hydrogen separation and storage

    Czech Academy of Sciences Publication Activity Database

    Pientka, Zbyněk; Pokorný, P.; Bélafi-Bakó, K.

    2007-01-01

    Roč. 304, 1-2 (2007), s. 82-87 ISSN 0376-7388 R&D Projects: GA ČR GA203/06/1207 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymeric foam * gas separation * hydrogen storage Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.432, year: 2007

  5. A New "online" Method to Measure Increased Exhaled Isoprene in end-stage Renal Failure

    Czech Academy of Sciences Publication Activity Database

    Davies, S.; Španěl, Patrik; Smith, D.

    2001-01-01

    Roč. 16, - (2001), s. 836-839 ISSN 0931-0509 R&D Projects: GA ČR GA203/97/P130 Institutional research plan: CEZ:AV0Z4040901 Keywords : biocompatibility * haemodialysis * SIFT-MS Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.432, year: 2001

  6. A novel approach for phytotoxicity assessment by CCD fluorescence imaging

    Czech Academy of Sciences Publication Activity Database

    Gavel, Alan; Maršálek, Blahoslav

    2004-01-01

    Roč. 19, - (2004), s. 429-432 ISSN 1520-4081 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : phytotoxicity * chlorophyll fluorescence * algal bioassay Subject RIV: EF - Botanics Impact factor: 1.373, year: 2004

  7. Preparation and photocatalytic property of a novel dumbbell-shaped ZnO microcrystal photocatalyst

    DEFF Research Database (Denmark)

    Sun, Jian-Hui; Dong, Shu-Ying; Wang, Yong-Kui

    2009-01-01

    achieved 68.0%, 99.0% and 98.5%, the TOC removal efficiencies achieved 43.2%, 59.4% and 70.6%, respectively. Compared to commercial ZnO, 16-22% higher TOC removal efficiency was obtained by the dumbbell-shaped ZnO. The results indicated that the prepared dumbbell-shaped ZnO microcrystal photocatalyst...

  8. The Stability and Reliability of a Modified Work Components Study Questionnaire in the Educational Organization.

    Science.gov (United States)

    Miskel, Cecil; Heller, Leonard E.

    The investigation attempted to establish the factorial validity and reliability of an industrial selection device based on Herzberg's theory of work motivation related to the school organization. The questionnaire was reworded to reflect an educational work situation; and a random sample of 197 students, 118 administrators, and 432 teachers was…

  9. Towards Distributed Intelligence: A High Level Definition

    Science.gov (United States)

    2004-12-01

    Some of the first research in multi-robot systems came in the foraging /sorting area by Parker [77] and Beckers [9] and was likely fueled by the bio...chapter 24, pages 28–39. Artificial Intelligence at MIT. The MIT Press, 1989. 15. R.A. Brooks. Robotic Science, chapter 11, The Whole Iguana , pages 432

  10. Synchronous population fluctuations of forest and field voles: implications for population management

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Suchomel, J.; Purchart, L.; Heroldová, Marta; Čepelka, L.; Homolka, Miloslav

    2011-01-01

    Roč. 432, - (2011), s. 97-98 ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. Berlin, 26.09.2011-30.09.2011] R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bank vole * common vole * correlation of population fluctuations Subject RIV: EH - Ecology, Behaviour

  11. Relative bioavailability of the flavonoids quercetin, hesperetin and naringenin given simultaneously through diet

    DEFF Research Database (Denmark)

    Krogholm, Kirstine Suszkiewicz; Bredsdorff, Lea; Knuthsen, Pia

    2010-01-01

    .5 +/- 1%) compared with hesperetin (14.2 +/- 9.1%) and naringenin (22.6 +/- 11.5%) and shows that this is not due to a lower bioavailability of quercetin, but rather reflects different clearance mechanisms. European Journal of Clinical Nutrition (2010) 64, 432-435; doi: 10.1038/ejcn.2010.6; published...

  12. Acid-base-driven matrix-assisted mass spectrometry for targeted metabolomics

    Czech Academy of Sciences Publication Activity Database

    Shroff, R.; Rulíšek, Lubomír; Doubský, J.; Svatoš, Aleš

    2009-01-01

    Roč. 106, č. 25 (2009), s. 10092-10096 ISSN 0027-8424 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : clinical diagnostic * matrix design * positive/negative ions * MALDI Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 9.432, year: 2009

  13. A Culture of Extrinsically Motivated Students: Chemistry

    Science.gov (United States)

    Orvis, Jessica N.; Sturges, Diana; Tysinger, P. Dawn; Riggins, Keenya; Landge, Shainaz

    2018-01-01

    Recent research indicates that students are adopting a consumerist approach to education, while data shows that the best academic outcomes are associated with intrinsic motivation. The goal of the study was to explore student academic motivation in an undergraduate Principles of Chemistry I class. The study targeted 432 students enrolled in 9…

  14. Runoff Responses to Forest Thinning at Plot and Catchment Scales in a Headwater Catchment Draining Japanese Cypress Forest

    Science.gov (United States)

    We examined the effect of forest thinning on runoff generation at plot and catchment scales in headwater basins draining a Japanese cypress (Chamaecyparis obtusa) forest. We removed 58.3% of the stems (corresponding to 43.2% of the basal area) in the treated headwater basin (catc...

  15. Ethnic Identity and Career Development among First-Year College Students

    Science.gov (United States)

    Duffy, Ryan D.; Klingaman, Elizabeth A.

    2009-01-01

    The current study explored the relation of ethnic identity achievement and career development progress among a sample of 2,432 first-year college students who completed the Career Decision Profile and Phinney's Multigroup Ethnic Identity Measure. Among students of color, correlational analyses revealed a series of statistically significant, but…

  16. 78 FR 24197 - Product Cancellation Order for Certain Pesticide Registrations

    Science.gov (United States)

    2013-04-24

    ...; MI110003)..... Syngenta Crop Protection, LLC, 410 Swing Rd., P.O. Box 18300, Greensboro, NC 27419-8300. 264 (ME090004) Bayer CropScience LP, 2 T.W. Alexander Dr., P.O. Box 12014, Research Triangle Park, NC 27709. 432 Bayer Environmental Science, 2 T.W. Alexander Dr., P.O. Box 12014, Research Triangle Park, NC 27709. 675...

  17. 78 FR 59917 - Limitations of Duty- and Quota-Free Imports of Apparel Articles Assembled in Beneficiary Sub...

    Science.gov (United States)

    2013-09-30

    ... of Apparel Articles Assembled in Beneficiary Sub-Saharan African Countries From Regional and Third... 6002 of the Tax Relief and Health Care Act of 2006 (TRHCA 2006), Public Law 109-432, and section 1... apparel articles wholly assembled in one or more beneficiary sub-Saharan African countries from fabric...

  18. Assessment of the thermodynamic properties and phase diagram of the Bi–Pd system

    Czech Academy of Sciences Publication Activity Database

    Vřešťál, J.; Pinkas, J.; Watson, A.; Scott, A.; Houserová, Jana; Kroupa, Aleš

    2006-01-01

    Roč. 30, č. 1 (2006), s. 14-17 ISSN 0364-5916 R&D Projects: GA MŠk(CZ) OC 531.002 Institutional research plan: CEZ:AV0Z2041904 Keywords : phase diagram * thermodynamic modelling Subject RIV: BJ - Thermodynamics Impact factor: 1.432, year: 2006

  19. Assessment of the thermodynamic properties and phase diagram of the Bi-Pd system

    Czech Academy of Sciences Publication Activity Database

    Vřešťál, Jan; Pinkas, J.; Watson, A.; Scott, A.; Houserová, Jana; Kroupa, Aleš

    2006-01-01

    Roč. 30, č. 1 (2006), s. 14-17 ISSN 0364-5916 R&D Projects: GA MŠk OC 531.001; GA MŠk OC 531.002 Institutional research plan: CEZ:AV0Z20410507 Keywords : phase diagram * ab initio calculations * calorimetry Subject RIV: BJ - Thermodynamics Impact factor: 1.432, year: 2006

  20. Flow mechanisms in creep of a short-fibre AZ91 alloy-based composite

    Czech Academy of Sciences Publication Activity Database

    Pahutová, Marie; Sklenička, Václav; Kuchařová, Květa; Svoboda, Milan; Langdon, T. G.

    43 2005, č. 1 (2005), s. 34-44 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/03/0901 Institutional research plan: CEZ:AV0Z20410507 Keywords : AZ91 magnesium alloy * metal matrix composite * short fibre reinforcement Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  1. Anomalous high temperature creep behaviour of an Al-8.5Fe-1.3V-1.7Si (8009Al type) alloy reinforced with alumina short fibres

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2004-01-01

    Roč. 42, č. 1 (2004), s. 9-20 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : High temperature creep- load transfer Subject RIV: JI - Composite Materials Impact factor: 1.056, year: 2004

  2. Load transfer effect in the true threshold creep behaviour

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2003-01-01

    Roč. 41, č. 2 (2003), s. 127-132 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Dispersion strengthening * load transfer Subject RIV: JI - Composite Materials Impact factor: 0.563, year: 2003

  3. PAVE PAWS Early Warning Radar Operation Cape Cod Air Force Station, MA. Record of Decision

    Science.gov (United States)

    2009-06-01

    Effects of Electromagnetic Super-high Frequency Fields]. Moscow, Medicina (In Russian) (English Translation in NASA Rep. TT-F-633). Guy, A.W...Baselines. Ann. New York Acad. Sci., 247: 425-432. Tjagin, N.W., 1971. [Clinical Aspects of Super-high Frequency Irradiation]. Leningrad, Medicina , pp

  4. The initial bearing capacities of subchondral bone replacements considerably contributing to chondrogenesis

    Czech Academy of Sciences Publication Activity Database

    Petrtýl, M.; Danešová, J.; Lísal, J.; Šenolt, L.; Hulejová, H.; Polanská, M.; Bastl, Zdeněk; Kruliš, Zdeněk; Černý, P.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 59-65 ISSN 1509-409X R&D Projects: GA ČR GA106/06/0761 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z40500505 Keywords : biomechanics * osteochondral defects * polymer replacement Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.432, year: 2010

  5. Západ Today, 1992-1993

    Czech Academy of Sciences Publication Activity Database

    Přibáň, Michal

    2001-01-01

    Roč. 49, č. 4 (2001), s. 419-432 ISSN 0009-0468 R&D Projects: GA ČR GA405/97/S017 Institutional research plan: CEZ:AV0Z9056905 Keywords : czech literature * czech literary magazines Subject RIV: AJ - Letters, Mass-media, Audiovision

  6. Parenting Styles and Health-Related Behavior in Childhood and Early Adolescence: Results of a Longitudinal Study

    Science.gov (United States)

    Lohaus, Arnold; Vierhaus, Marc; Ball, Juliane

    2009-01-01

    This study addresses the development of health-related behavior during childhood and adolescence and the protective influence of an authoritative parenting style. The study is based on two samples followed from Grades 2 through 5 and from Grades 4 through 7. The first sample consisted of 432 second graders with a mean age of 7.9 years at the…

  7. 78 FR 8821 - Abandoned Mine Land Reclamation Program; Limited Liability for Noncoal Reclamation by Certified...

    Science.gov (United States)

    2013-02-06

    ... Federal laws. It does not preclude liability for gross negligence or intentional misconduct by a state or... Law 109-432 (the ``2006 amendments'') substantially modified the AML reclamation program in title IV... tribe shall be liable under Federal law for any costs or damages as a result of any action or omitted...

  8. A Bildung-psychological investigation into student motives : McKinsey- or von Humboldt-oriented?

    NARCIS (Netherlands)

    Koops, Willem; van den Kerkhof, Michael; Ostermeier, Carlien; van de Schoot, Rens

    2016-01-01

    This study examined differential student motives among students from a social sciences bachelor’s degree, and whether this difference related to participating in educational programmes for broader intellectual formation (Bildung). Survey research was conducted among 432 Dutch students (79.5%

  9. 5. Beethoven-Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik, 27.– 29. srpna 2012

    Czech Academy of Sciences Publication Activity Database

    Kolátorová, Petra

    2012-01-01

    Roč. 49, č. 4 (2012), s. 432-433 ISSN 0018-7003. [5. Beethoven-Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik,. Bonn, 27.08.2012-29.08.2012] Institutional support: RVO:68378076 Keywords : Beethoven * editorial work * music scores Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Počáteční stadium oxidace železa a ocelí žíhaných při vysokých teplotách na vzduchu

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jaroslav; Adamaszek, K.

    2001-01-01

    Roč. 39, č. 5 (2001), s. 289-301 ISSN 0023-432X R&D Projects: GA ČR GA106/98/1367 Institutional research plan: CEZ:AV0Z2041904 Keywords : iron oxidation * high temperature Subject RIV: JG - Metallurgy Impact factor: 0.343, year: 2001

  11. Cameroonian Dentists' Opinion On Training And Quality Of Dental ...

    African Journals Online (AJOL)

    Chi square. P≤0.05 was considered significant. Results. The proportion of the respondents who had worked with dental auxiliaries, dental therapists, dental surgery assistants, dental technicians and dental aids was 100%,. 59.5%, 43.2%, 45.9% and 5.4% respectively (Fig. 1). More than half (51.4%) of the respondents had ...

  12. Survey on Knowledge of Healthcare Providers about Childhood ...

    African Journals Online (AJOL)

    IRORO YARHERE

    were 80 (43.2%) nurses, and 105 (56.8%) doctors, 41 (22.2%) of which were paediatricians or ... A pretested self-administered questionnaire was distributed to health care personnel, doctors and nurses in the University of Port ..... house staff.

  13. Zítra se bude tančit všude, aneb jak jsme se protancovali ke svobodě. Dichotomie tzv. folklorního hnutí druhé poloviny 20. století

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2017-01-01

    Roč. 104, č. 4 (2017), s. 411-432 ISSN 0009-0794 R&D Projects: GA ČR(CZ) GA17-26672S Institutional support: RVO:68378076 Keywords : folklore revival movement * folklorism * folk ensembles * oral history * narratives * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  14. Physico-chemical shelf-life indicators of meat from broilers given ...

    African Journals Online (AJOL)

    The objective of the study was to determine the effect of using Moringa oleifera leaf meal (MOLM) as an additive on physico-chemical shelf life indicators of meat from broilers. A total of 432 1-day-old chicks were randomly allocated to four treatments (TRT's). Water and feed was provided ad libitum. The feeding phases were ...

  15. Preparation of aluminium lakes by electrocoagulation

    Directory of Open Access Journals (Sweden)

    Prapai Pradabkham

    2008-07-01

    Full Text Available Aluminium lakes have been prepared by electrocoagulation employing aluminium as electrodes. The electrocoagulation is conducted in an aqueous alcoholic solution and is completed within one hour. The dye content in the lake ranges approximately between 4-32%.

  16. Italský přehled slovanského literárního písemnictví

    Czech Academy of Sciences Publication Activity Database

    Bláhová, Emilie

    2010-01-01

    Roč. 79, 3-4 (2010), s. 422-432 ISSN 0037-6736 R&D Projects: GA AV ČR IAA900920901 Institutional research plan: CEZ:AV0Z90920516 Keywords : Slavonic literature * Medieval * Slavia orthodoxa * Slavia romana Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Sociodemographic Characteristics Of Young Adults Screened For ...

    African Journals Online (AJOL)

    Method: HIV screening was performed on all (n = 673) young adults referred to the retrovirology unit of the Haematology Department of the University of Port Harcourt Teaching Hospital between January 2003 to December 2003 comprising of 205 males and 432 females were screened for HIV using a double ELISA ...

  18. Influence of cooling rate and cerium addition on rapidly solidified Al-TM alloys

    Czech Academy of Sciences Publication Activity Database

    Michalcová, A.; Vojtěch, D.; Schumacher, G.; Novák, P.; Klementová, Mariana; Šerák, J.; Mudrová, M.; Valdaufová, J.

    2010-01-01

    Roč. 48, č. 1 (2010), s. 1-7 ISSN 0023-432X Institutional research plan: CEZ:AV0Z40320502 Keywords : rapid solidification * Al-TM * microstructure * aluminium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2010

  19. 77 FR 29753 - CaterParrott Railnet, L.L.C.-Sublease and Operation Exemption-Georgia & Florida Railway, L.L.C.

    Science.gov (United States)

    2012-05-18

    ... Railnet, L.L.C.--Sublease and Operation Exemption-- Georgia & Florida Railway, L.L.C. CaterParrott Railnet, L.L.C. (CPR), a noncarrier, has filed a verified notice of exemption under 49 CFR 1150.31 to sublease from Georgia & Florida Railway, L.L.C. (GRF) and operate approximately 43.2 miles of rail line...

  20. Knowledge And Experience Of Work-Related Hazards And ...

    African Journals Online (AJOL)

    Tropical Journal of Health Sciences ... Health status of scavengers is therefore a public health concern, as they could be potential pathways for ... recorded for nose guard, face mask and overall/apron with 43.2%, 39.3% and 9.3% respectively.

  1. 2018-02-15T08:42:37Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    The results showed that marketing activities should be centered on female who are mostly married (83.0%) within the age group 31-40 since women are the one to purchase the meat at home, although men (56.8%) responded to the questionnaire than their female (43.2%) counterpart. It was clearly shown that respondents ...

  2. Rational design, efficient syntheses and biological evaluation of N,N '-symmetrically bis-substituted butylimidazole analogs as a new class of potent Angiotensin II receptor blockers

    Czech Academy of Sciences Publication Activity Database

    Agelis, G.; Resvani, A.; Koukoulitsa, C.; Tůmová, Tereza; Slaninová, Jiřina; Kalavrizioti, D.; Spyridaki, K.; Afantitis, A.; Melagraki, G.; Siafaka, A.; Gkini, E.; Megariotis, G.; Grdadolnik, S. G.; Papadopoulos, M. G.; Vlahakos, D.; Maragoudakis, M.; Liapakis, G.; Mavromoustakos, T.; Matsoukas, J.

    2013-01-01

    Roč. 62, Apr (2013), s. 352-370 ISSN 0223-5234 Institutional support: RVO:61388963 Keywords : AT1 receptor blockers * N,N '-Bis-alkylated butylimidazole analogs * synthesis * Wittig reaction * hydroxymethylation * structure elucidation Subject RIV: CC - Organic Chemistry Impact factor: 3.432, year: 2013

  3. Experimental determination and computational interpretation of biophysical properties of lipid bilayers enriched by cholesteryl hemisuccinate

    Czech Academy of Sciences Publication Activity Database

    Kulig, W.; Jurkiewicz, Piotr; Olžyńska, Agnieszka; Tynkkynen, J.; Javanainen, M.; Manna, M.; Rog, T.; Hof, Martin; Vattulainen, I.; Jungwirth, Pavel

    2015-01-01

    Roč. 1848, č. 2 (2015), s. 422-432 ISSN 0005-2736 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : Time-dependent fluorescence shift * Molecular dynamics simulations * Cholesterol -mimicking detergents Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.687, year: 2015

  4. Fulltext PDF

    Indian Academy of Sciences (India)

    IAS Admin

    1947-08-15

    behavior of some animals are affected by solar activity and lunar phases, that ... system, for instance, August 15, 1947 would be JD 2,432,412. ... intertwining of motion and time-measurement is at the origin of what is known as ... current cosmology proclaims that the universe is some fifteen billion years old, an unspecified.

  5. Analysis of Medication Errors of Health Care Providers on the Basis of Data from the Czech Toxicological Information Centre over an 11-Year Period (2000-2010)

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Navrátil, Tomáš; Pelclová, D.

    2012-01-01

    Roč. 110, č. 5 (2012), s. 427-432 ISSN 1742-7835 R&D Projects: GA AV ČR IAA400400806; GA ČR GAP206/11/1638 Institutional research plan: CEZ:AV0Z40400503 Keywords : ADVERSE DRUG EVENTS * PEDIATRIC INPATIENTS * ADMINISTRATION ERRORS Subject RIV: CG - Electrochemistry Impact factor: 2.124, year: 2012

  6. 78 FR 74226 - Hankook Tire America Corp, Receipt of Petition for Decision of Inconsequential Noncompliance

    Science.gov (United States)

    2013-12-10

    ... model year Hankook Roadhandler Sport (H432) tires manufactured between June 21, 2013 and August 29, 2013...: Logging onto the Federal Docket Management System (FDMS) Web site at http://www.regulations.gov/ . Follow... information provided. Documents submitted to a docket may be viewed by anyone at the address and times given...

  7. Výběr středního vzdělání v rodinách podle skupinových diskuzí

    Czech Academy of Sciences Publication Activity Database

    Vojtíšková, Kateřina

    2009-01-01

    Roč. 5, 019 (2009), s. 3-38 ISSN 1801-5999 R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : focus groups * family * secondary education Subject RIV: AM - Education http://publication.fsv.cuni.cz/eng/attachments/432_019%20-%20Vojtiskova.pdf

  8. Characteristic of monotonicity of Orlicz function spaces equipped with the Orlicz norm

    Czech Academy of Sciences Publication Activity Database

    Foralewski, P.; Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2013-01-01

    Roč. 53, č. 2 (2013), s. 421-432 ISSN 0373-8299 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : Orlicz space * Köthe space * characteristic of monotonicity Subject RIV: BA - General Mathematics

  9. Effects of irrigation strategies and soils on field grown potatoes

    DEFF Research Database (Denmark)

    Ahmadi, Seyed Hamid; Andersen, Mathias Neumann; Plauborg, Finn

    2010-01-01

    Yield and water productivity of potatoes grown in 4.32 m2 lysimeters were measured in coarse sand, loamy sand, and sandy loam and imposed to full (FI), deficit (DI), and partial root-zone drying (PRD) irrigation strategies. PRD and DI as water-saving irrigation treatments received 65% of FI after...

  10. Cyclic plastic response and fatigue life of duplex and superduplex stainless steel

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav

    43 2005, č. 4 (2005), s. 280-289 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/02/0584 Institutional research plan: CEZ:AV0Z20410507 Keywords : duplex steel * fatigue life * cyclic plasticity Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  11. Acceleration of multiply charged ions by a high-contrast femtosecond laser pulse of relativistic intensity from the front surface of a solid target

    Czech Academy of Sciences Publication Activity Database

    Shulyapov, S. A.; Mordvintsev, I. M.; Ivanov, K. A.; Volkov, P. V.; Zarubin, P. I.; Ambrožová, Iva; Turek, Karel; Savelyev, A. B.

    2016-01-01

    Roč. 46, č. 5 (2016), s. 432-436 ISSN 1063-7818 Institutional support: RVO:61389005 Keywords : relativistic intensity * contrast * laser plasma * ion acceleration * multiply charged ions * collision ionisation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.119, year: 2016

  12. New treatment of early fetal chylothorax

    DEFF Research Database (Denmark)

    Nygaard, Ulrikka; Sundberg, Karin; Nielsen, Henriette Svarre

    2007-01-01

    OBJECTIVE: To evaluate OK-432, a preparation of Streptococcus pyogenes, in the treatment of early fetal chylothorax. METHODS: A prospective study of all fetuses (n=7) with persistent early chylothorax (gestational ages 16-21 weeks) referred to the tertiary center of fetal medicine in Denmark in 2...

  13. Prepubertal unilateral gynecomastia and the presence of 47,XXY mosaicism in breast epithelial cells

    DEFF Research Database (Denmark)

    Andersen, Peter Stemann; Petersen, Bodil Laub; Juul, Anders

    2013-01-01

    , and sclerotherapy with Picibanil (OK-432) was attempted without any detectable effect on size. The mass was later excised. The pathological examination revealed mammary gland tissue suggestive of idiopathic gynecomastia. FISH revealed 47, XXY mosaicism in the abnormal breast epithelial cells, but not in peripheral...

  14. 75 FR 29296 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-05-25

    ... Tanana An area north of the Tanana +431 +432 Fairbanks-North Star River and Chena River. River levee and... of Old Airport Road and Mitchell Expressway to the west. An area north of the Tanana None +446 River...)....... Approximately 460 feet None +1004 Unincorporated Areas upstream of West Charles of Fayette County. Street. City...

  15. Prevalence of falciparum malaria amongst pregnant women in Aba ...

    African Journals Online (AJOL)

    Malaria during pregnancy poses a substantial risk to mother and foetus especially an infection with Plasmodium falciparum. This study was undertaken to assess the prevalence of falciparum malaria among pregnant women in Aba South Local Government Area, Abia State, south-east Nigeria. Blood samples from 432 ...

  16. Endosomal sorting of VAMP3 is regulated by PI4K2A

    Czech Academy of Sciences Publication Activity Database

    Jovic, M.; Kean, M. J.; Dubánková, Anna; Bouřa, Evžen; Gingras, A. C.; Brill, J. A.; Balla, T.

    2014-01-01

    Roč. 127, č. 17 (2014), s. 3745-3756 ISSN 0021-9533 Institutional support: RVO:61388963 Keywords : PI4K2A * VAMP3 * PtdIns4P * vesicle fusion * sorting * SNARE Subject RIV: CE - Biochemistry Impact factor: 5.432, year: 2014

  17. 3,3´-(Ethane-1,2-diyl)bis(6-methyl-3.4-dihydro-2H-1,3-benzoxazine)

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Camacho, J.; Ríos-Motta, J.; Pojarová, Michaela; Dušek, Michal

    2011-01-01

    Roč. 67, Part 8 (2011), o2028-u432 ISSN 1600-5368 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : crystal structure * SHELX97 * benzoxazine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.347, year: 2011

  18. 2017-2018 Travel Expense Reports for Sylvain Dufour, Vice ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    09-30 to 2017-10-06. Destination(s):. Orlando, FL (USA). Airfare: $751.97. Other. Transportation: $228.39. Accommodation: $1,102.96. Meals and. Incidentals: $1,342.07. Other: $7.51. Total: $3,432.90. Comments: 2017-2018 Travel Expense ...

  19. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 5 (6630-7530).

    Science.gov (United States)

    1984-01-01

    08 DU PONT El DE NEMOURS AND CO NEW JERSEY ARMY GASES COMPRESSED AND LIQUEFIED 31 USAF GASES COMPRESSED AND LIQUEFIED 25 STATE TOTAL 56 FOREX CHEMICAL... FOREX CHEMICAL CORP NEW JERSEY DLA MISCELLANEOUS CHEMICAL SPECIALTIES 11l OASTON POWER TOOLS ARKANSAS DLA MISCELLANEOUS CHEMICAL SPECIALTIES 432

  20. 75 FR 76003 - Tricor Ten Section Hub LLC; Notice of Availability of the Environmental Assessment for the...

    Science.gov (United States)

    2010-12-07

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP09-432-000] Tricor Ten Section Hub LLC; Notice of Availability of the Environmental Assessment for the Proposed Ten Section Gas... Commission) has prepared an environmental assessment (EA) for the Ten Section Gas Storage Project, in Kern...

  1. 76 FR 14968 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2011-03-18

    ... ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-8995-9] Environmental Impacts Statements; Notice of....epa.gov/compliance/nepa/ . Weekly Receipt of Environmental Impact Statements Filed 03/07/2011 Through.... McKoy 1-800-432-8330 Ext 4426. EIS No. 20110083, Final EIS, USFS, MT, Beaver Creek Landscape Management...

  2. Dependence of the length of the hydrogen bond on the covalent and cationic radii of hydrogen, and additivity of bonding distances

    Czech Academy of Sciences Publication Activity Database

    Heyrovská, Raji

    2006-01-01

    Roč. 432, č. 1-3 (2006), s. 348-351 ISSN 0009-2614 R&D Projects: GA MŠk(CZ) LC06035 Institutional research plan: CEZ:AV0Z50040507 Keywords : length of the hydrogen bond * ionic radius * Golden ratio Subject RIV: BO - Biophysics Impact factor: 2.462, year: 2006

  3. Implementation Guidance Document: Properties and Types of Significant Photothermal Retinal Lesion Injuries

    Science.gov (United States)

    2017-04-17

    Include area code) (703) 432-0899 Standard Form 298 (Rev. 8/98) Prescribed 1::r;< ANSI S1d. Z39.18 Adobe Professional 7 .O Properties and Types of...are above MPE yet well below an irradiance that could cause significant retinal injuries. Estimating RSI in Practice - Some Illustrative Examples

  4. 30 CFR 75.204 - Roof bolting.

    Science.gov (United States)

    2010-07-01

    ... accessories addressed in ASTM F432-95, “Standard Specification for Roof and Rock Bolts and Accessories,” the.... (4) In each roof bolting cycle, the actual torque or tension of the first tensioned roof bolt... during each roof bolting cycle shall be tested during or immediately after the first row of bolts has...

  5. Gender in plants: sex chromosomes are emerging from the fog

    Czech Academy of Sciences Publication Activity Database

    Vyskot, Boris; Hobza, Roman

    2004-01-01

    Roč. 20, č. 9 (2004), s. 432-438 ISSN 0168-9525 R&D Projects: GA AV ČR(CZ) KSK5052113 Keywords : sex chromosomes * dioecious papaya * evolution Subject RIV: BO - Biophysics Impact factor: 14.643, year: 2004

  6. Analysis of Small Muscle Movement Effects on EEG Signals

    Science.gov (United States)

    2016-12-22

    different conditions are recorded in this experiment. These conditions are the resting state, left finger keyboard press, right finger keyboard...51 4.3.2. Right and Left Finger Keyboard Press Conditions ..................................... 57 4.4. Detection of Hand...solving Gamma 30 Hz and higher Blending of multiple brain functions ; Muscle related artifacts 2.2. EEG Artifacts EEG recordings are intended to

  7. Effects of grain size and grain boundary segregation on fracture behaviour of a polycrystalline Fe-2.65Si-0.028P alloy

    Czech Academy of Sciences Publication Activity Database

    Janovec, J.; Lejček, Pavel; Pokluda, J.; Jenko, M.

    2006-01-01

    Roč. 44, - (2006), s. 81-87 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/05/0134 Institutional research plan: CEZ:AV0Z10100520 Keywords : iron alloys * interface segregation * intergranular brittleness * Auger electron spectroscopy * scanning electron microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

  8. Influence of long-term ageing upon the capacity of hydrogen\

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Král, Lubomír; Roupcová, Pavla

    2016-01-01

    Roč. 54, č. 6 (2016), s. 389-396 ISSN 0023-432X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : magnesium alloys * indium * hydrogen * hydrogen storage Subject RIV: BJ - Thermodynamics Impact factor: 0.366, year: 2016

  9. Normalized difference vegetation index (NDVI) in the management of mountain meadows

    Czech Academy of Sciences Publication Activity Database

    Mašková, Z.; Zemek, František; Květ, Jan

    2008-01-01

    Roč. 13, - (2008), s. 417-432 ISSN 1239-6095 R&D Projects: GA ČR(CZ) GA206/99/1410 Institutional research plan: CEZ:AV0Z60870520 Keywords : normalized difference vegetation index * mountain medows * mulching Subject RIV: EH - Ecology, Behaviour Impact factor: 1.620, year: 2008 www.borenv.net

  10. Current status of Co-Re-based alloys being developed to supplement Ni-based superalloys for ultra-high temperature applications in gas turbines

    Czech Academy of Sciences Publication Activity Database

    Mukherji, D.; Strunz, Pavel; Gilles, R.; Karge, L.; Rösler, J.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 287-294 ISSN 0023-432X EU Projects: European Commission(XE) 283883 - NMI3-II Institutional support: RVO:61389005 Keywords : Co-base alloy * scanning electron microscopy (SEM) * neutron scattering Subject RIV: JG - Metallurgy Impact factor: 0.365, year: 2015

  11. Magnitude and determinants of stunting in children under- five years ...

    African Journals Online (AJOL)

    Bernt Lindtjorn

    bekates@yahoo.com; 2Unit of Applied Human Nutrition Program, University of Nairobi, ... Both bivariate analysis and multivariate analysis (logistic ... Results: The analyses revealed that 43.2 (12.0-17.6) 95% CI percent of the children under age .... reliability were maintained through close supervision of ... Statistical analysis.

  12. Social Support and Low-Income, Urban Mothers: Longitudinal Associations with Adolescent Delinquency

    Science.gov (United States)

    Ghazarian, Sharon R.; Roche, Kathleen M.

    2010-01-01

    The current study examined the role of engaged parenting in explaining longitudinal associations between maternal perceptions of social network support and whether youth engage in delinquent behaviors during the transition into adolescence. The sample included 432 low-income, African American and Latino youth (49% female) and their mothers…

  13. Longitudinální studium lidského vývoje: historie, výsledky a perspektivy pražské a brněnské studie celoživotního vývoje člověka

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Kebza, V.

    2011-01-01

    Roč. 55, č. 5 (2011), s. 422-432 ISSN 0009-062X R&D Project s: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : life -span development * longitudinal study * optimal development * personality * well-being * human strenghts Subject RIV: AN - Psychology Impact factor: 0.087, year: 2011

  14. Analysis of the Cost Effectiveness and Applicability of the Reliability Tasks of MIL-STD-785B.

    Science.gov (United States)

    1985-09-01

    M by designating specific requirements and objectives for each of the following organizations: HQ USAF/LE - Deputy Chief of Staff for Logistics IHQ ...Department of the Navy. Product Assurance Requirements Guide for Naval Ocean Systems Center Projects. NOSC TD 432. Naval Ocean Systems Center: San Diego

  15. 48 CFR 452.232-70 - Reimbursement for Bond Premiums-Fixed-Price Construction Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reimbursement for Bond... Provisions and Clauses 452.232-70 Reimbursement for Bond Premiums—Fixed-Price Construction Contracts. As prescribed in 432.111, insert the following clause: Reimbursement for Bond Premiums—Fixed-Price Construction...

  16. 25 CFR 1000.433 - When and how must a Tribe/Consortium appeal an adverse pre-award decision?

    Science.gov (United States)

    2010-04-01

    ... rights under § 1000.432(b)(1), it must make a written request for review to the appropriate bureau head... also be sent to the Director of the Office of Self-Governance. (c) If the initial decision was made by...

  17. Oxidation of aniline with strong and weak oxidants

    Czech Academy of Sciences Publication Activity Database

    Sapurina, I. Yu.; Stejskal, Jaroslav

    2012-01-01

    Roč. 82, č. 2 (2012), s. 256-275 ISSN 1070-3632 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * oxidant Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.432, year: 2012

  18. Properties of exponential many-body interatomic potentials

    Czech Academy of Sciences Publication Activity Database

    Ostapovets, Andrej; Paidar, Václav

    2009-01-01

    Roč. 47, č. 3 (2009), s. 193-199 ISSN 0023-432X R&D Projects: GA AV ČR IAA100100920 Institutional research plan: CEZ:AV0Z10100520 Keywords : many-body potentials * elastic constants * multilayer surface relaxations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.345, year: 2007

  19. Formation of Layered Double Hydroxides on Alumina Surface in Aqueous Solutions Containing Divalent Metal Cations

    Czech Academy of Sciences Publication Activity Database

    Kovanda, F.; Mašátová, P.; Novotná, P.; Jirátová, Květa

    2009-01-01

    Roč. 57, č. 4 (2009), s. 425-432 ISSN 0009-8604 R&D Projects: GA ČR GA104/07/1400 Institutional research plan: CEZ:AV0Z40720504 Keywords : deposition * layered double hydroxides * supported mixed oxides Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.431, year: 2009

  20. Temporal stability of diagnostic criteria for antisocial personality disorder in male alcohol dependent patients

    NARCIS (Netherlands)

    Verheul, R.; van den Brink, W.; Koeter, M. W.

    1998-01-01

    We evaluated the temporal stability of diagnostic criteria for antisocial personality disorder in 432 male alcohol dependent patients. Indicators for temporal stability were criterion continuation (i.e., the proportion of current or recent diagnoses among those with a lifetime diagnosis) and

  1. Comparing the harmful effects of nontuberculous mycobacteria and Gram negative bacteria on lung function in patients with cystic fibrosis

    DEFF Research Database (Denmark)

    Qvist, Tavs; Taylor-Robinson, David; Waldmann, Elisabeth

    2015-01-01

    BACKGROUND: To better understand the relative effects of infection with nontuberculous mycobacteria and Gram negative bacteria on lung function decline in cystic fibrosis, we assessed the impact of each infection in a Danish setting. METHODS: Longitudinal registry study of 432 patients with cystic...

  2. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  3. Non-collective oblate states in iodine isotopes at high spin

    Energy Technology Data Exchange (ETDEWEB)

    Paul, E S; Ali, I; Cullen, D M; Fallon, P; Forbes, S A; Hanna, F; Nolan, P J [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Bentley, M A; Bruce, A M; Simpson, J [Daresbury Lab. (United Kingdom); Clark, R M; Regan, P H; Wadsworth, R [York Univ. (United Kingdom). Dept. of Physics; Fossan, D B; Hughes, J R; Lafosse, D R; Vaska, P; Waring, M P [Department of Physics, SUNY at Stony Brook, NY (United States); Liang, Y [Argonne National Lab., IL (United States); Ma, R [Brookhaven National Lab., Upton, NY (United States)

    1992-08-01

    Competition between single-particle and collective modes of excitation has been observed in the odd-A {sup 113-119}I isotopes at high spin. A maximally-aligned non-collective 43/2{sup -} configuration at {gamma}=+ 60 degrees is seen at similar excitation energies in these nuclei. 7 refs., 4 figs.

  4. Evaluation of a Heuristic Model for Tropical Cyclone Resilience

    Science.gov (United States)

    2015-01-26

    Phys. Fluids, 13, 421–432. 4 Corbosiero, K. L. and J. Molinari, 2003: The relationship between storm motion, vertical 5 wind shear, and convective...Atlantic extratropical transition. J. Atmos. Sci., 65, 714–736. 9 Durran, D. R. and J. B. Klemp, 1982: On the effects of moisture on the Brunt-Väisälä

  5. Diagnosing Contributions of Sensory and Cognitive Deficits to Hearing Dysfunction in Blast-Exposed/TBI Service Members

    Science.gov (United States)

    2017-10-01

    The speech, spatial and qualities of hearing scale (SSQ). International Journal of Audiology, 43(2), 85–99. 11 Quad Chart Diagnosing contributions... Service Members” PRINCIPAL INVESTIGATOR: Dr. Barbara Shinn-Cunningham CONTRACTING ORGANIZATION: Boston University Boston, MA 02215-1703 REPORT DATE...information, including suggestions for reducing this burden to Department of Defense, Washington Headquarters Services , Directorate for Information Operations

  6. Extremely low-frequency electromagnetic fields disrupt magnetic alignment of ruminants

    Czech Academy of Sciences Publication Activity Database

    Burda, H.; Begall, S.; Červený, Jaroslav; Neef, J.; Němec, P.

    2009-01-01

    Roč. 106, č. 14 (2009), s. 5708-5713 ISSN 0027-8424 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : cattle * magnetoreception * roe deer * power lines Subject RIV: EH - Ecology, Behaviour Impact factor: 9.432, year: 2009

  7. Clinton, Trump In A Tie.

    Science.gov (United States)

    2016-09-01

    Forty-seven percent of the 432 respondents to our online survey said they plan to vote for Clinton, and the exact same percentage said they intend to vote for Trump. Most respondents thought Trump would do a better job making the system more efficient. A clear majority said that Clinton would do better job limiting cost shifting to consumers.

  8. Disease: H00917 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00917 Congenital dyserythropoietic anemias (CDAs) Congenital dyserythropoietic anemia...ion, gene) ... AUTHORS ... Iolascon A, Russo R, Delaunay J ... TITLE ... Congenital dyserythropoietic anemias. ... J...AUTHORS ... Kamiya T, Manabe A ... TITLE ... Congenital dyserythropoietic anemia. ... JOURNAL ... Int J Hematol 92:432-8 (2010) DOI:10.1007/s12185-010-0667-9 ...

  9. Novel Interpretation of High Temperature Creep in an ODS Cu-ZrO2 Alloy

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2002-01-01

    Roč. 40, č. 3 (2002), s. 133-145 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : ODS Cu Alloy s * Creep Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

  10. Negative Intrusive Thoughts and Dissociation as Risk Factors for Self-Harm

    Science.gov (United States)

    Batey, Helen; May, Jon; Andrade, Jackie

    2010-01-01

    Relationships between self-harm and vulnerability factors were studied in a general population of 432 participants, of whom 30% reported some experience of self-harm. This group scored higher on dissociation and childhood trauma, had lower self-worth, and reported more negative intrusive thoughts. Among the non-harming group, 10% scored similarly…

  11. Constant structure creep experiments on aluminium

    Czech Academy of Sciences Publication Activity Database

    Milička, Karel

    2011-01-01

    Roč. 49, č. 5 (2011), s. 307-318 ISSN 0023-432X R&D Projects: GA AV ČR IAA2041203 Institutional research plan: CEZ:AV0Z20410507 Keywords : mechanical properties * high temperature deformation * creep * aluminium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.451, year: 2011

  12. Acute flaccid paralysis: a five–year review of cases managed by ...

    African Journals Online (AJOL)

    kemrilib

    A 5-year (1999-2004) review of acute flaccid paralysis (AFP) cases managed at the physiotherapy ... Sciatic nerve palsy accounted for majority (72.0%) of the AFP; only. 43.2% of the ... children with febrile illnesses is suggested. Importance of ...

  13. Notes on Hilbert and Cauchy Matrices

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav

    2010-01-01

    Roč. 432, č. 1 (2010), s. 351-356 ISSN 0024-3795 Institutional research plan: CEZ:AV0Z10300504 Keywords : Hilbert matrix * Cauchy matrix * combined matrix * AT-property Subject RIV: BA - General Mathematics Impact factor: 1.005, year: 2010

  14. Spectral Radius and Hamiltonicity of Graphs

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Nikiforov, V.

    2010-01-01

    Roč. 432, č. 9 (2010), s. 2170-2173 ISSN 0024-3795 Institutional research plan: CEZ:AV0Z10300504 Keywords : Hamiltonian cycle * Hamiltonian path * spectral radius Subject RIV: BA - General Mathematics Impact factor: 1.005, year: 2010

  15. Calculation of ternary interdiffusion coefficients using a single diffusion couple

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Rothová, Věra

    2016-01-01

    Roč. 54, č. 5 (2016), s. 305-314 ISSN 0023-432X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : diffusion * interdiffusion * ternary alloys * ternary diffusion coefficients Subject RIV: BJ - Thermodynamics Impact factor: 0.366, year: 2016

  16. AcEST: DK949197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 432 e-121 sp|O24339|CATA_SOLAP Catalase OS=Soldanella al...t: 181 ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH 225 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina

  17. Lexikos - Vol 19 (2009)

    African Journals Online (AJOL)

    Zum Stand und zu den Perspek-tiven der allgemeinsprachlichen Lexikographie mit Deutsch und Slowenisch · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. V Jesenšek, HE Wiegand. http://dx.doi.org/10.5788/19-0-432 ...

  18. The significance of methionine, histidine and tryptophan in plant responses and adaptation to cadmium stress

    Czech Academy of Sciences Publication Activity Database

    Zemanová, V.; Pavlík, Milan; Pavlíková, D.; Tlustoš, P.

    2014-01-01

    Roč. 60, č. 9 (2014), s. 426-432 ISSN 1214-1178 Institutional support: RVO:61389030 Keywords : abiotic stress * amino acids * heavy metals Subject RIV: CE - Biochemistry Impact factor: 1.226, year: 2014 http://www.agriculturejournals.cz/publishedArticles/PSE/2014-60-9-426

  19. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 116; Issue 5. Polyphase deformation and garnet growth in politic schists of Sausar Group in Ramtek area, Maharashtra, India: A study of porphyroblast–matrix relationship. A Chattopadhyay N Ghosh. Volume 116 Issue 5 October 2007 pp 423-432 ...

  20. Gender Divide and Acceptance of Collaborative Web 2.0 Applications for Learning in Higher Education

    Science.gov (United States)

    Huang, Wen-Hao David; Hood, Denice Ward; Yoo, Sun Joo

    2013-01-01

    Situated in the gender digital divide framework, this survey study investigated the role of computer anxiety in influencing female college students' perceptions toward Web 2.0 applications for learning. Based on 432 college students' "Web 2.0 for learning" perception ratings collected by relevant categories of "Unified Theory of Acceptance and Use…

  1. Appraising Gender Role Portrayals in TV Commercials.

    Science.gov (United States)

    Kolbe, Richard H.; Langefeld, Carl D.

    1993-01-01

    Examines gender role orientations of characters in prime time television advertisements through the Bem Sex-Role Inventory (BSRI) completed by 426 college students (43.2% females). Results confirm the appropriateness of the scale for self- and person-perception ratings. Uses of the BSRI in gender role research are discussed. (SLD)

  2. Mikromechanistické aspekty vlivu délky trhliny na lomovou houževnatost a tranzitní chování ocelí

    Czech Academy of Sciences Publication Activity Database

    Chlup, Zdeněk; Dlouhý, Ivo

    2002-01-01

    Roč. 40, č. 4 (2002), s. 254-267 ISSN 0023-432X R&D Projects: GA AV ČR IAA2041003; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : fracture toughness * transition behaviour * constraint Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.493, year: 2002

  3. Heterogeneous membranes based on a composite of a hypercrosslinked microparticle adsorbent and polyimide binder

    Czech Academy of Sciences Publication Activity Database

    Hradil, Jiří; Sysel, P.; Brožová, Libuše; Kovářová, Jana; Kotek, Jiří

    2007-01-01

    Roč. 67, č. 5 (2007), s. 432-441 ISSN 1381-5148 R&D Projects: GA ČR GA104/03/0680 Institutional research plan: CEZ:AV0Z40500505 Keywords : membrane * hypercrosslinked adsorbent * polyimide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.720, year: 2007

  4. 2017-2018 Expense report for Sylvain Dufour | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-09-30

    Total travel expenses: CA$13,130.42. Participate in the Gartner Symposium and ITxpo 2017. September 30, 2017 to October 6, 2017. CA$3,432.90. Participate in the Chief Economist Roundtable organized by the Business Development Bank of Canada. September 21, 2017 to September 22, 2017. CA$654.38. Review of ...

  5. Constructing robust and highly-selective hydrogel membranes by bioadhesion-inspired method for CO 2 separation

    KAUST Repository

    Wu, Yingzhen; Zhou, Tiantian; Wu, Hong; Fu, Weixian; Wang, Xinru; Wang, Shaofei; Yang, Leixin; Wu, Xingyu; Ren, Yanxiong; Jiang, Zhongyi; Wang, Baoyi

    2018-01-01

    -size gas molecules and thus enhancing the CO2/CH4 selectivity. Moreover, the abundant amine groups from PDA nanoaggregates could facilitate CO2 transport. The optimized hybrid hydrogel membrane exhibited CO2/CH4 selectivity of 43.2, which was 43.85% higher

  6. Does a Claims Diagnosis of Autism Mean a True Case?

    Science.gov (United States)

    Burke, James P.; Jain, Anjali; Yang, Wenya; Kelly, Jonathan P.; Kaiser, Marygrace; Becker, Laura; Lawer, Lindsay; Newschaffer, Craig J.

    2014-01-01

    The purpose of this study was to validate autism spectrum disorder cases identified through claims-based case identification algorithms against a clinical review of medical charts. Charts were reviewed for 432 children who fell into one of the three following groups: (a) more than or equal to two claims with an autism spectrum disorder diagnosis…

  7. Relations among Student Attention Behaviors, Teacher Practices, and Beginning Word Reading Skill

    Science.gov (United States)

    Saez, Leilani; Folsom, Jessica Sidler; Al Otaiba, Stephanie; Schatschneider, Christopher

    2012-01-01

    The role of student attention for predicting kindergarten word reading was investigated among 432 students. Using "Strengths and Weaknesses of ADHD Symptoms and Normal Behavior Rating Scale" behavior rating scores, the authors conducted an exploratory factor analysis, which yielded three distinct factors that reflected selective…

  8. 78 FR 26523 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2013 and 2014 Atlantic...

    Science.gov (United States)

    2013-05-07

    .... 130104009-3416-02] RIN 0648-XC432 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2013 and 2014 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS... final specifications for the 2013 and 2014 Atlantic bluefish fishery, including annual catch limits...

  9. 78 FR 11809 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2013-2014 Atlantic...

    Science.gov (United States)

    2013-02-20

    .... 130104009-3099-01] RIN 0648-XC432 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2013-2014 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS), National... comments. SUMMARY: NMFS proposes specifications for the 2013 and 2014 Atlantic bluefish fishery, including...

  10. Wave of fire: an anthropogenic signal in historical fire regimes across central Pennsylvania, USA

    Science.gov (United States)

    Michael C. Stambaugh; Joseph M. Marschall; Erin R. Abadir; Benjamin C. Jones; Patrick H. Brose; Daniel C. Dey; Richard P. Guyette

    2018-01-01

    Increasingly detailed records of long-term fire regime characteristics are needed to test ecological concepts and inform natural resource management and policymaking. We reconstructed and analyzed twelve 350+ yr-long fire scar records developed from 2612 tree-ring dated fire scars on 432 living and dead pine (Pinus pungens, Pinus rigida, Pinus resinosa, Pinus...

  11. Normobaric Hypoxia Induces Mild Damage to Epithelium of Terminal Bronchioles in Rabbits (Ultrastructural Study)

    Czech Academy of Sciences Publication Activity Database

    Uhlík, J.; Konrádová, V.; Vajner, L.; Adášková, Jana

    2005-01-01

    Roč. 50, č. 10 (2005), s. 432-438 ISSN 0375-8427 Source of funding: V - iné verejné zdroje Keywords : airways * Clara cells * ciliated cells * electron microscopy Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.621, year: 2005

  12. Time-on-task impairment of psychomotor vigilance is affected by mild skin warming and changes with aging and insomnia

    NARCIS (Netherlands)

    Raymann, R.J.E.M.; Someren, E.J. van

    2007-01-01

    Study Objectives: To investigate the effect of mild manipulations of core and skin temperature on psychomotor vigilance (PVT) in young adults, elderly, and elderly insomniacs. Design: 432 PVTs were obtained during a 2-day semi-constant routine protocol, while differentially manipulating core and

  13. In-building Unlicensed WiFi Band OFDM Signal Distribution over MMF&BIF Using VCSEL

    DEFF Research Database (Denmark)

    Deng, Lei; Jensen, Jesper Bevensee; Yu, Xianbin

    2011-01-01

    For in-building applications, an OFDM-VCSEL RoF system operating in unlicensed WiFi band is experimentally tested using MMF and bend insensitive fiber (BIF). A spectral efficiency of 4.32 bit/s/Hz with 0.9 Gbps data rate is achieved....

  14. The Relevance Of Research And Development (R&D) Programmes ...

    African Journals Online (AJOL)

    The purpose of this study was to assess the relevance of Research and Development (R&D) programmes of Nigerian universities in national development. Data was collected form 432 senior academic staff of five selected universities in Nigeria. Indicators of relevance such as quality, results, dissemination, utilization and ...

  15. Efficacy of the Social Skills Improvement System Classwide Intervention Program (SSIS-CIP) Primary Version

    Science.gov (United States)

    DiPerna, James Clyde; Lei, Puiwa; Bellinger, Jillian; Cheng, Weiyi

    2015-01-01

    A multisite cluster randomized trial was conducted to examine the effects of the Social Skills Improvement System Classwide Intervention Program (SSIS-CIP; Elliott & Gresham, 2007) on students' classroom social behavior. The final sample included 432 students across 38 second grade classrooms. Social skills and problem behaviors were measured…

  16. A case with Lichen planus in the lines of Blaschko

    Directory of Open Access Journals (Sweden)

    Metehan Gençoğlu

    2011-12-01

    Full Text Available Lichen planus is an inflammatory disorder that may involveskin and mucous membranes. Linear lichen planusis a rare disorder occurring in approximately 0.2% of patientswith lichen planus. We report a case of linear lichenplanus on the upper extremity which lesions followed thelines of Blaschko. J Clin Exp Invest 2011; 2 (4: 430-432

  17. Residual stresses determination by neutron diffraction in a 100Cr6 chromium steel bearing ring

    Czech Academy of Sciences Publication Activity Database

    Rogante, M.; Martinat, G.; Mikula, Pavol; Vrána, Miroslav

    2013-01-01

    Roč. 51, č. 5 (2013), s. 275-281 ISSN 0023-432X R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : 100Cr6 steel * rings * martensitic hardening * tempering * residual stress es * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.546, year: 2013

  18. Creep of three-phase alloy Fe-30%Al-5.2%Zr

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Ferdinand; Kratochvíl, P.; Kejzlar, P.

    2015-01-01

    Roč. 53, č. 3 (2015), s. 127-132 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/12/1452 Institutional support: RVO:68081723 Keywords : iron aluminides * creep * precipitation Subject RIV: JG - Metallurgy Impact factor: 0.365, year: 2015

  19. Creep properties of aluminium processed by ECAP

    Czech Academy of Sciences Publication Activity Database

    Král, Petr; Dvořák, Jiří; Jäger, Aleš; Kvapilová, Marie; Horita, Z.; Sklenička, Václav

    2016-01-01

    Roč. 54, č. 6 (2016), s. 441-451 ISSN 0023-432X R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 ; RVO:68378271 Keywords : equal channel angular pressing (ECAP) * aluminium * ultrafine-grained microstructure * creep Subject RIV: JG - Metallurgy; JG - Metallurgy (FZU-D) Impact factor: 0.366, year: 2016

  20. Improved thermostability and enzyme activity of a recombinant phyA mutant phytase from Aspergillus niger N25 by directed evolution and site-directed mutagenesis.

    Science.gov (United States)

    Tang, Zizhong; Jin, Weiqiong; Sun, Rong; Liao, Yan; Zhen, Tianrun; Chen, Hui; Wu, Qi; Gou, Lin; Li, Chenlei

    2018-01-01

    We previously constructed three recombinant phyA mutant strains (PP-NP m -8, PP-NP ep -6A and I44E/T252R-PhyA), showing improved catalytic efficiency or thermostability of Aspergillus niger N25 phytase, by error-prone PCR or site-directed mutagenesis. In this study, directed evolution and site-directed mutagenesis were further applied to improve the modified phytase properties. After one-round error-prone PCR for phytase gene of PP-NP ep -6A, a single transformant, T195L/Q368E/F376Y, was obtained with the significant improvements in catalytic efficiency and thermostability. The phytase gene of T195L/Q368E/F376Y, combined with the previous mutant phytase genes of PP-NP ep -6A, PP-NP m -8 and I44E/T252R-PhyA, was then sequentially modified by DNA shuffling. Three genetically engineered strains with desirable properties were then obtained, namedQ172R, Q172R/K432R andQ368E/K432R. Among them, Q172R/K432R showed the highest thermostability with the longest half-life and the greatest remaining phytase activity after heat treatment, while Q368E/K432R showed the highest catalytic activity. Five substitutions (Q172R, T195L, Q368E, F376Y, K432R) identified from random mutagenesis were added sequentially to the phytase gene of PP-NP ep -6A to investigate how the mutant sites influence the properties of phytase. Characterization and structural analysis demonstrated that these mutations could produce cumulative or synergistic improvements in thermostability or catalytic efficiency of phytase. Copyright © 2017 Elsevier Inc. All rights reserved.

  1. Acute Kidney Injury Classification in Neuro-ICU Patient Group

    Directory of Open Access Journals (Sweden)

    Canan Akıncı

    2012-12-01

    Full Text Available Objective: To investigate the role of acute kidney injury (AKI classification system for kidney injury outcome in neuro-Intensive care unit (ICU patients. Material and Method: Total 432 patients who admitted to ICU between 2005 and 2009 evaluated in this study. All patients’ AKI stage, Acute Physiology and Chronic Health Evaluation (APACHE-II, Sequential Organ Failure Assessment Score (SOFA, Glasgow Coma Score (GCS, Glasgow Outcome Score (GOS, mortality rate, length of ICU stay, need for intubation, and mechanical ventilation were recorded. Results: AKI was found in 24 of all 432 patents’ (5.5%. We found that, patients with AKI had higher APHACE-II score, SOFA score and mortality rates; longer ICU stay, duration of mechanical ventilation and intubation and lower GCS and GOS than without AKI group. Conclusion: Length of ICU stay and mortality rate were higher in AKI positive group.

  2. Risk of leukemia in first degree relatives of patients with nonsyndromic cleft lip and palate

    Directory of Open Access Journals (Sweden)

    Eduardo GONÇALVES

    2014-01-01

    Full Text Available The aim of this study was to determine the frequency of leukemia in parents of patients with nonsyndromic cleft lip and/or cleft palate (NSCL/P. This case-control study evaluated first-degree family members of 358 patients with NSCL/P and 1,432 subjects without craniofacial alterations or syndromes. Statistical analysis was carried out using Fisher’s test. From the 358 subjects with NSCL/P, 3 first-degree parents had history of leukemia, while 2 out of 1,432 subjects from the unaffected group had a family history of leukemia. The frequency of positive family history of leukemia was not significantly increased in first-degree relatives of patients with NSCL/P.

  3. Experimental study on active specific immunotherapy utilizing the immune reaction of low-dose irradiated tumor tissue, 4

    International Nuclear Information System (INIS)

    Imanaka, Kazufumi; Ogawa, Yasuhiro; Gose, Kyuhei; Imajo, Yoshinari; Kimura, Shuji

    1982-01-01

    We have already reported that the effectiveness of active specific immunotherapy using low-dose irradiated tumor cells and infiltrating mononuclear cells. The present study was designed to investigate the effect of non-specific immunopotentiator combined with the active specific immunotherapy. Twelve-week-aged female C3H/He mice transplanted with MM46 tumor were received local radiotherapy with the dose of 3,000 rads by high energy electron beam on the sixth day after inoculation. Active specific immunotherapy was performed on the 13th day, and daily dose of 1.0 KE of OK-432 was injected intraperitoneally from the 13th day to the 17th day. The inhibition of the tumor growth and the elongation of survival period were noted in the group which received active specific immunotherapy combined with non-specific immunopotentiator, OK-432 compared with that active specific immunotherapy alone. (author)

  4. The Caribbean Basin: A Refractivity Study

    Science.gov (United States)

    1989-12-01

    482 110.1 90 137 603 18.6 394 6360 20072 1 3.4 90 432 1614 ;7000-6000 1 7.6 33 236 432 110.6 36 235 831 13.7 384 037 27003 3.6 80 60e 1090 6000-3000 3...1 - -- - - - - ---- - - - - - - - - - - - - - - - - - - - --- -2906-4100 ll -J IO.4 Z 9,0 .12 70 12 . .1.200Z0 25000_27IGUR o og3o ! Iso -C 0 2?.)O...S00 4.7 g1 292 ISO 19.9 91 292 310 94.3 2306 9461 30207 16.0 194 290 sea 500-1000 : 0.2 91 344 492 0.5 so L97 1003 1 3.4 94 $841 34246 0.9 as as

  5. Web monitoring of industrial signals using embedded systems

    Directory of Open Access Journals (Sweden)

    Cesar Augusto Romero-Molano

    2016-01-01

    Full Text Available The paper presents the design of software and hardware for a system of web monitoring of industrial signals. This prototype provides a web interface which can observe in real time the status of four industrial-type signal on-off. MSP432 microcontroller is used for sampling and transmitting monitored signals to a Raspberry PI which receives by a UART link the MSP432 monitored data and presents them immediately in the front-end web application. The prototype design was verified with a pneumatic application that consists of four single-acting cylinders and it was observed an efficient synchronization between the occurrence of the triggering event or change in status of any of the monitored cylinder and web publishing.

  6. α4He elastic scattering at high energies

    International Nuclear Information System (INIS)

    Usmani, A.A.; Usmani, Q.N.

    1988-03-01

    Differential cross sections for α 4 He elastic scattering have been calculated at incident α particle momenta of 4.32, 5.07 and 7.0 GeV/c within the framework of the Glauber multiple scattering theory. The full Glauber amplitude is calculated using the Monte Carlo method for evaluating multidimensional integrals. We find that, in general, the more realistic double Gaussian model for the density brings theory closer to experiment as compared to the generally used single Gaussian model. Our results with the double Gaussian model are in fairly good agreement with the experimented data at 4.32 and 5.07 GeV/c. (author). 11 refs, 4 figs, 1 tab

  7. No more than conjectures: Popper and the ethics of scientific enterprise.

    Science.gov (United States)

    Doria, Nilson Guimarães

    2009-06-01

    Karl Popper dealt with both problems Yurevich (Integrative Psychological and Behavioral Science, 43(2), 2009, doi: 10.1007/s12124-008-9082-7 ) deals: the crisis in Psychology and in the discourse about the nature of science. Although he failed to provide a complete response for both problems, his proposals can yet be fruitful to the reflection on these matters in the context of the present discussion. He offers some tentative answers to what could be considered a healthy epistemic activity, something Yurevich does not provide. More interestingly, some of the Popper proposals seem to fit, and in some extent correct, the quest for "collaborative work" proposed by Zittoun et al. (Integrative Psychological and Behavioral Science, 43(2), 2009, doi: 10.1007/s12124-008-9082-7 ) as a way of transforming crisis in development.

  8. Powder metallurgy processing of high strength turbine disk alloys

    Science.gov (United States)

    Evans, D. J.

    1976-01-01

    Using vacuum-atomized AF2-1DA and Mar-M432 powders, full-scale gas turbine engine disks were fabricated by hot isostatically pressing (HIP) billets which were then isothermally forged using the Pratt & Whitney Aircraft GATORIZING forging process. While a sound forging was produced in the AF2-1DA, a container leak had occurred in the Mar-M432 billet during HIP. This resulted in billet cracking during forging. In-process control procedures were developed to identify such leaks. The AF2-1DA forging was heat treated and metallographic and mechanical property evaluation was performed. Mechanical properties exceeded those of Astroloy, one of the highest temperature capability turbine disk alloys presently used.

  9. Simultaneous circulation of all four dengue serotypes in Manaus, State of Amazonas, Brazil in 2011

    Directory of Open Access Journals (Sweden)

    Michele de Souza Bastos

    2012-06-01

    Full Text Available INTRODUCTION: Manaus, the capital city of the state of Amazon with nearly 2 million inhabitants, is located in the middle of the Amazon rain forest and has suffered dengue outbreaks since 1998. METHODS: In this study, blood samples were investigated using reverse transcriptase-polymerase chain reaction (RT-PCR, aimed at identifying dengue virus serotypes. RESULTS: Acute phase sera from 432 patients were tested for the presence of dengue virus. Out of the 432 patients, 137 (31.3% were found to be positive. All the four dengue virus serotypes were observed. CONCLUSIONS: The simultaneous circulation of the four dengue serotypes is described for the first time in Manaus and in Brazil.

  10. Fluctuations of pol I and fibrillarin contents of the nucleoli

    Czech Academy of Sciences Publication Activity Database

    Hornaceka, M.; Kováčik, L.; Mazel, T.; Cmarko, D.; Bártová, Eva; Raška, I.; Smirnov, E.

    2017-01-01

    Roč. 8, č. 4 (2017), s. 421-432 ISSN 1949-1034 R&D Projects: GA ČR GBP302/12/G157 Institutional support: RVO:68081707 Keywords : ribosomal-rna genes * transcription sites * human-lymphocytes Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 2.387, year: 2016

  11. Únavové poškození v aluminium lithiových slitinách, Část II. Iniciace a šíření krátkých trhlin

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav; Man, Jiří; Obrtlík, Karel

    2001-01-01

    Roč. 39, č. 3 (2001), s. 179-189 ISSN 0023-432X R&D Projects: GA ČR GA106/95/1529; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium- lithium alloy * fatigue crack initiation * short crack growth Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.343, year: 2001

  12. Únavové poškození v aluminium lithiových slitinách Část I. Cyklická plastická odezva a únavová životnost

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav; Kruml, Tomáš; Očenášek, V.

    2001-01-01

    Roč. 39, č. 2 (2001), s. 132-147 ISSN 0023-432X R&D Projects: GA ČR GA106/95/1529; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium- lithium alloy * cyclic plasticity * fatigue life Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.343, year: 2001

  13. Significance of epidermal growth factor receptor signaling for acquisition of meiotic and developmental competence in mammalian oocytes

    Czech Academy of Sciences Publication Activity Database

    Procházka, Radek; Blaha, Milan; Němcová, Lucie

    2017-01-01

    Roč. 97, č. 4 (2017), s. 537-549 ISSN 0006-3363 R&D Projects: GA MZe(CZ) QJ1510138; GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : amphiregulin * cumulus cells * epidermal growth factor receptor Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Reproductive biology (medical aspects to be 3) Impact factor: 3.432, year: 2016

  14. The relationship between DRM and misinformation false memories

    OpenAIRE

    Zhu, B; Chen, C; Loftus, EF; Lin, C; Dong, Q

    2013-01-01

    This research investigated the relationship between false memories induced by two different paradigms (misinformation and Deese-Roediger-McDermott [DRM]). The misinformation effect refers to the phenomenon that a person's recollection of a witnessed event can be altered after exposure to misleading information about the event. DRM false memory represents the intrusion of words that are semantically related but not actually presented in the study session. Subjects (N = 432) completed both misi...

  15. The Relationship Between Coat Color and Aggressive Behaviors in the Domestic Cat

    OpenAIRE

    Stelow, EA; Bain, MJ; Kass, PH

    2015-01-01

    © 2016 Taylor & Francis. The authors explored a possible relationship between coat color and aggressive behaviors in the domestic cat. This study used an Internet-based survey to collect information on coat color, affiliative behaviors toward cats/humans, agonistic behaviors toward cats/humans, other “problem” behaviors, and cat and guardian demographic data. A total of 1,432 cat guardians completed the online survey; after exclusions based on study protocol, data analysis included 1,274 co...

  16. A short note on multivariate dependence modeling

    Czech Academy of Sciences Publication Activity Database

    Bína, V.; Jiroušek, Radim

    2013-01-01

    Roč. 49, č. 3 (2013), s. 420-432 ISSN 0023-5954 Grant - others:GA ČR(CZ) GAP403/12/2175 Program:GA Institutional support: RVO:67985556 Keywords : multivariate distribution * dependence * copula Subject RIV: IN - Informatics, Computer Science Impact factor: 0.563, year: 2013 http://library.utia.cas.cz/separaty/2014/MTR/jirousek-0427848.pdf

  17. P1-10: The Association between Colors and Emotions

    OpenAIRE

    Yen-Yu Chen; Chih-Hao Lien; Cho-Han Yang; Yi-Jae Jhong; Tsun-Yu Chen; Shiau-Hua Liu

    2012-01-01

    Wexner (1954 Journal of Applied Psychology 38 432–435) demonstrated colors were associated with specific emotions. Colors have many meanings, such as that red can lead to induce positive or negative emotions (Kaya & Epps, 2011 College Student Journal 38 396–406). This study extends previous findings and aims to investigate two questions, (1) whether colors are associated with the emotions of pictures in IAPS (International Affective Picture System) and (2) whether perceiving IAPS consciously ...

  18. States of Confusion: Regulation of Surrogacy in the United States

    OpenAIRE

    Mohapatra, Seema

    2017-01-01

    Introduction Some countries, including Switzerland, Germany, Spain, France, Greece, and Norway, ban commercial surrogacy (Patton 2010, 523). Others, such as India and the Ukraine, have actively tried to be seen as commercial surrogacy destinations (Mohapatra 2012, 412, 432–437, 441–448). Unlike either of these approaches, the United States (US) has no national stance on surrogacy. In fact, there are no national laws or regulations related to surrogacy in the US (Margalit 2014). Instea...

  19. 14 CFR Appendix B of Part 415 - Safety Review Document Outline

    Science.gov (United States)

    2010-01-01

    ... Performance Graphs 2.0Launch Operator Organization (§ 415.111) 2.1Launch Operator Organization (§ 415.111 and... Plan 4.3.1Flight Safety Personnel 4.3.2Flight Safety Rules 4.3.3Flight Safety System Summary and... Instrumentation Plan 6.2Configuration Management and Control Plan 6.3Frequency Management Plan 6.4Flight...

  20. 14 CFR 415.204-415.400 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... Events 1.6Vehicle Performance Graphs 2.0Launch Operator Organization (§ 415.111) 2.1Launch Operator... applicable) 4.3Flight Safety Plan 4.3.1Flight Safety Personnel 4.3.2Flight Safety Rules 4.3.3Flight Safety... and Instrumentation Plan 6.2Configuration Management and Control Plan 6.3Frequency Management Plan 6...

  1. Non-contact methods for NDT of aeronautical structures : An image processing workstation for thermography

    OpenAIRE

    Azzarelli, Luciano; Chimenti, Massimo; Salvetti, Ovidio

    1992-01-01

    The main goals of the Istituto di Elaborazione della Informazione in Task 4., Subtasks 4.3.1 (Image Processing) and 4.3.2 (Workstation Architecture) were the study of thermograms features, the design of the architecture of a customized workstation and the project of specialized algorithms for thermal image analysis. Thermograms features pertain to data acquisition, data archiving and data processing; following general study some basic requirements for the workstation were defined. "Data acqui...

  2. Plasma spraying of Fe-Cr-Al alloy powder

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Leitner, J.; Kolman, Blahoslav Jan; Písačka, Jan; Schneeweiss, Oldřich

    2008-01-01

    Roč. 46, č. 1 (2008), s. 17-25 ISSN 0023-432X R&D Projects: GA AV ČR IAA1041404 Institutional research plan: CEZ:AV0Z20430508; CEZ:AV0Z20410507 Keywords : Fe-Cr-Al alloy powder * plasma spraying * oxidation * vaporization * composition changes Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.345, year: 2007

  3. Isothermal oxidation of metallic coatings deposited by a water-stabilized plasma gun

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Nop, P.; Kopřiva, P.; Kolman, Blahoslav Jan; Dubský, Jiří

    2006-01-01

    Roč. 44, č. 1 (2006), s. 41-48 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/03/0710 Institutional research plan: CEZ:AV0Z20430508 Keywords : plasma spraying * metallic coatings * oxidation tests * oxidation kinetics * oxide structure * element distribution Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.138, year: 2006

  4. A Measure of Maintenance Training/Qualification Readiness and Its Impact on Billet Life Cycle Coast.

    Science.gov (United States)

    1983-09-01

    Intelligence is collected and an appraisal made of the threat to the security of the nation. 2. National Stratmov Based upon national policy decisions , a...Corrosion Control School. 432)2-5AQI * P-3C Electrical Maintenance Technician PQa �-Q - P-3C Brake Rider/Wing Walker PQS &323$-Q2 e P-IC Auxillary ...identified in a squadron utilizing the automated Skill Level Maintenance Matrices, the decision can be made to determine if extraordinary action is

  5. Synthesis and biological evaluation of guanidino analogues of roscovitine

    Czech Academy of Sciences Publication Activity Database

    Dolečková, Iva; Česnek, Michal; Dračínský, Martin; Brynda, Jiří; Voller, J.; Janeba, Zlatko; Kryštof, Vladimír

    2013-01-01

    Roč. 62, April 2013 (2013), s. 443-452 ISSN 0223-5234 R&D Projects: GA MŠk 1M0508; GA ČR GAP305/12/0783 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Keywords : 6-Guanidinopurine * Olomoucine * Roscovitine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  6. Elevated Levels of Serum Tumor Markers CEA and CA15-3 Are Prognostic Parameters for Different Molecular Subtypes of Breast Cancer

    OpenAIRE

    Shao, Yingbo; Sun, Xianfu; He, Yaning; Liu, Chaojun; Liu, Hui

    2015-01-01

    Background & Aims The utility of measuring carcinoembryonic antigen(CEA) and cancer antigen 15-3 (CA15-3) levels in patients with breast cancer remains controversial. The present study aims to investigate the prognostic value of preoperative serum CEA and CA15-3 levels in breast cancer patients. Methods Serum preoperative CEA and CA 15-3 concentration levels were measured in a total of 432 breast cancer patients. The association of tumor markers levels with clinicopathological parameters and ...

  7. Comparative study of in vitro antibacterial activity of leaves, bark, heart wood and seed extracts of Caesalpinia sappan L.

    OpenAIRE

    Arunkumar Naik Bukke; Fathima Nazneen Hadi; Chandramati Shankar Produtur

    2015-01-01

    Objective: To evaluate and compare the maximum antimicrobial activity by screening different parts of Caesalpinia sappan L. extracted in different solvents against Salmonella ebony (MTCC 3384) (S. ebony), Klebsiella pneumoniae (MTCC 432) (K. pneumoniae), Escherichia coli (MTCC 443) (E. coli) and Bacillus subtilis (MTCC 10619) (B. subtilis). Methods: Dried plant parts were extracted with petroleum ether, methanol, chloroform and water by Soxhlet extraction method. The extracts w...

  8. Functional diversity of staphylinid beetles (Coleoptera: Staphylinidae) in maize fields: testing the possible effect of genetically modified, insect resistant maize

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Zdeňka; Skoková Habuštová, Oxana; Boháč, J.; Sehnal, František

    2016-01-01

    Roč. 106, č. 4 (2016), s. 432-445 ISSN 0007-4853 R&D Projects: GA MZe QH91093 Grant - others:GA JU(CZ) 038/2014/P; project MOBILITY(CZ) 7AMB14SK096 Program:7A Institutional support: RVO:60077344 Keywords : GM crops * Bt maize * Cry3Bb1 Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.758, year: 2016

  9. Synergy between pathogen release and resource availability in plant invasion

    Czech Academy of Sciences Publication Activity Database

    Blumenthal, D.; Mitchell, C. E.; Pyšek, Petr; Jarošík, Vojtěch

    2009-01-01

    Roč. 106, č. 19 (2009), s. 7899-7904 ISSN 0027-8424 R&D Projects: GA MŠk LC06073 Grant - others:Evropská komise(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * enemy release * resource availability Subject RIV: EG - Zoology Impact factor: 9.432, year: 2009

  10. Oligofenylenacetyleny nesoucí tetrathiafulvalenové jednotky jako materiály pro molekulární elektroniku

    Czech Academy of Sciences Publication Activity Database

    Dekoj, Václav; Bělohradský, Martin; Starý, Ivo

    2009-01-01

    Roč. 103, č. 5 (2009), s. 432-433 ISSN 0009-2770. [Mezioborové setkání mladých biologů, biochemiků a chemiků. Konference Sigma-Aldrich /9./. 26.05.2009-29.05.2009, Devět skal - Žďárské vrchy] Institutional research plan: CEZ:AV0Z40550506 Keywords : oligophenylacetylenes * tetrahiafulvalene * molecular electronics Subject RIV: CC - Organic Chemistry

  11. Energy use in the U.S. steel industry: An historical perspective and future opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Stubbles, John [Steel Industry Consultant, Mason, OH (United States)

    2000-09-01

    Renowned industry expert Dr. John Stubbles has projected the energy savings that the U.S. steel industry could reasonably expect to achieve in the report, Energy Use in the U.S. Steel Industry: Historical Perspective and Future Opportunities (PDF 432 KB). The report examines the potential impacts of state-of-the-art technologies and operating practices, as well as structural changes in the industry itself.

  12. A Continuum Diffusion Model for Viscoelastic Materials

    Science.gov (United States)

    1988-11-01

    ZIP Code) 7b. ADDRESS (CJI. Slow, and ZIP Code) Mechanics Div isi on Office of Naval Research; Code 432 Collge Satio, T as 7843800 Quincy Ave. Collge ...these studies, which involved experimental, analytical, and materials science aspects, were conducted by researchers in the fields of physical and...thermodynamics, with irreversibility stemming from the foregoing variables yr through "growth laws" that correspond to viscous resistance. The physical ageing of

  13. Bora and Aurora-A continue to activate Plk1 in mitosis

    Czech Academy of Sciences Publication Activity Database

    Bruinsma, W.; Macůrek, Libor; Freire, R.; Lindqvist, A.; Medema, R.H.

    2014-01-01

    Roč. 127, č. 4 (2014), s. 801-811 ISSN 0021-9533 R&D Projects: GA ČR GA13-18392S Grant - others:Ministerio de Economía y Competitividad(ES) SAF2010-22357; CONSOLIDER-Ingenio(NL) CDS2007-0015 Keywords : Aurora-A * Bora * Mitosis * Plk1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  14. High-temperature low-cycle fatigue behaviour of HIP treated and untreated superalloy MAR-M247

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel; Čelko, L.

    2016-01-01

    Roč. 54, č. 6 (2016), s. 471-481 ISSN 0023-432X R&D Projects: GA TA ČR(CZ) TA04011525; GA ČR(CZ) GA15-20991S Institutional support: RVO:68081723 Keywords : hot isostatic pressing * high-temperature low cycle fatigue * fatigue life curves * Ni-based superalloy * dislocation structures * planar bands Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.366, year: 2016

  15. Resurgence of diphtheria in rural areas of North Karnataka, India

    OpenAIRE

    Mahantesh V Parande; Subarna Roy; B G Mantur; Aisha M Parande; Rupali S Shinde

    2017-01-01

    Background: A diphtheria outbreak was identified from Vijayapura (formerly Bijapur) district in the South Indian state of Karnataka in 2011. There was a surge in the number of throat swab samples received under the Integrated Disease Surveillance Programme (IDSP) in North Karnataka since then. Objectives: A microbiological study was undertaken to generate information on the status of resurgence of the disease in the region. Materials and Methods: Throat swabs from 432 suspected cases of dipht...

  16. Brane-world cosmology and inflation

    Indian Academy of Sciences (India)

    A Lukas and D Skinner, J. High Energy Phys. 0109, 020 (2001). M C Bento, O Bertolami and A A Sen, Phys. Rev. D67, 063511 (2003). [8] J Garriga and M Sasaki, Phys. Rev. D62, 043523 (2000). [9] K Koyama and J Soda, Phys. Lett. B483, 432 (2000). [10] S Kanno, M Sasaki and J Soda, Prog. Theor. Phys. 109, 357 (2003).

  17. Quantification of Gains and Risks of Static Thermal Rating Based on Typical Meteorological Year

    Czech Academy of Sciences Publication Activity Database

    Heckenbergerová, Jana; Musílek, P.; Filimonenkov, K.

    2013-01-01

    Roč. 44, č. 1 (2013), s. 227-235 ISSN 0142-0615 R&D Projects: GA MŠk LD12009 Grant - others:GA AV ČR(CZ) M100300904 Institutional support: RVO:67985807 Keywords : Overhead power transmission lines * Conductor ampacity * Probabilistic static thermal rating * Typical meteorological year * Risk tolerance * Energy throughput Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 3.432, year: 2012

  18. Gulf War Illness and the Health of Gulf War Veterans

    Science.gov (United States)

    2008-11-01

    after his return.432 Seventy- five Gulf War personnel were hospitalized for chicken pox during deployment.1431 Only a few cases of viral hepatitis were...and independent of circulating uranium levels. Of particular interest are findings from an ongoing study at the University of New Mexico indicating that...periods, can produce chronic neurological or behavioral effects. The New Mexico study is an important example of a particularly relevant approach

  19. Spatial decisions and cognitive strategies of monkeys and humans based on abstract spatial stimuli in rotation test

    Czech Academy of Sciences Publication Activity Database

    Nekovářová, Tereza; Nedvídek, Jan; Klement, Daniel; Bureš, Jan

    2009-01-01

    Roč. 136, č. 36 (2009), s. 15478-15482 ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517; GA ČR(CZ) GA309/09/0286; GA AV ČR KJB500110704 Institutional research plan: CEZ:AV0Z50110509 Keywords : spatial cognition * geometry of space * mental rotations Subject RIV: FH - Neuro logy Impact factor: 9.432, year: 2009

  20. Cascades of convergent evolution: The corresponding evolutionary histories of euglenozoans and dinoflagellates

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; Leander, B. S.; Keeling, P. J.

    2009-01-01

    Roč. 106, č. 1 (2009), s. 9963-9970 ISSN 0027-8424 R&D Projects: GA ČR GA204/09/1667; GA MŠk LC07032; GA MŠk 2B06129 Institutional research plan: CEZ:AV0Z60220518 Keywords : comparative genomics * convergent evolution * dinoflagellates * Euglenozoa * mitochondria * molecular evolution * plastids * RNA editing * RNA editing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.432, year: 2009

  1. Investigation of the refractive status of preschool children in Xiantao, Hubei Province

    OpenAIRE

    Nian Guan; Hao-Ming Chen; Zhi-Guang Hu

    2014-01-01

    AIM: To investigate the refractive status of the preschool children in Xiantao, Hubei Province in order to find out the abnormal refraction error beyond the physiological range. METHODS: In this cross-sectional study, we investigated preschool children in kindergartens and the scattered ones were 12 716(25 432 eyes)ranging from 6mo~6 years old. 1 581 children(3 162 eyes)were diagnosed ametropia by Suresight refractive screening instrument, which were confirmed again after mydriasis optometry....

  2. Rapports 2017-2018 sur les frais de voyage pour Sylvain Dufour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    But: Participer au Symposium Gartner et ExpoIT 2017. Date(s). 2017-09-30 au 2017-10-06. Destination(s). Orlando, Floride (É.-U.) Billet d'avion. 751.97 $. Frais de transport au sol ou autrement. 228.39 $. Frais de logement. 1 102.96 $. Repas et frais divers. 1 342.07 $. Autre frais. 7.51 $. Total. 3 432.90 $. Commentaires.

  3. Influence of surrounding atmosphere on crystallization of as-quenched Fe-Ni-Zr ribbon

    Czech Academy of Sciences Publication Activity Database

    Roupcová, Pavla; Schneeweiss, Oldřich; Bezdička, Petr; Petrovič, P.

    2006-01-01

    Roč. 44, č. 3 (2006), s. 127-132 ISSN 0023-432X R&D Projects: GA MŠk 1M0512 Institutional research plan: CEZ:AV0Z20410507; CEZ:AV0Z40320502 Keywords : as-quenched material * kinetics of crystallization * Mossbauer spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

  4. Structure changes in two chosen metallic materials exposed to molten LiF-NaF eutectic mixture – model of corrosion behaviour

    Czech Academy of Sciences Publication Activity Database

    Král, Lubomír; Čermák, Jiří; Matal, O.; Šimo, T.; Nesvadba, L.; Jílek, M.

    2009-01-01

    Roč. 47, č. 2 (2009), s. 63-73 ISSN 0023-432X R&D Projects: GA MPO 2A-1TP1/067 Institutional research plan: CEZ:AV0Z20410507 Keywords : steels and nickel alloys * corrosion * diffusion Subject RIV: JF - Nuclear Energetics Impact factor: 1.345, year: 2007 http://www.kovmat.sav.sk/abstract.php?rr=47&cc=2&ss=63

  5. State-space Generalized Predicitve Control for redundant parallel robots

    Czech Academy of Sciences Publication Activity Database

    Belda, Květoslav; Böhm, Josef; Valášek, M.

    2003-01-01

    Roč. 31, č. 3 (2003), s. 413-432 ISSN 1539-7734 R&D Projects: GA ČR GA101/03/0620 Grant - others:CTU(CZ) 0204512 Institutional research plan: CEZ:AV0Z1075907 Keywords : parallel robot construction * generalized predictive control * drive redundancy Subject RIV: BC - Control Systems Theory http://library.utia.cas.cz/separaty/historie/belda-0411126.pdf

  6. Atypical and Typical Winter Depressive Symptoms and Responsiveness to Light Therapy, Cognitive-Behavioral Therapy, or Combination Treatment

    Science.gov (United States)

    2005-01-01

    064 -.053 Anxiety Somatic (H13) .248 .148 .246 .370 Hypochondriasis (H14) .179 .432 -.016 .156 Retardation (H16) .157...TREATMENT BDI-II SCORE, POST-TREATMENT SOMATIC SUBSCALE SCORE, AND POST-TREATMENT COGNITIVE-AFFECTIVE SUBSCALE SCORE ……………………………76...Post-Treatment, Percent BDI-II Improvement From Pre- to Post-Treatment, Post-Treatment BDI-II Score, Post-Treatment Somatic

  7. Supernova SN 2008iz in M82 Galaxy

    African Journals Online (AJOL)

    kagoyire

    models to the data, a simple power-law model and a simplified Weiler model, yielding a decline index, β = -1.23±0.01 and ... (4.8 GHz), X (8.4 GHz), K (22.3 GHz) and Q-bands (43.2 GHz) to trace the evolution of the radio ... with a total bandwidth of 128 MHz, each in dual circular polarization. The flux calibrator 3C48 was ...

  8. Development of an Injectable Salmon Fibrinogen-Thrombin Matrix to Enhance Healing of Compound Fractures of Extremities

    Science.gov (United States)

    2012-09-01

    previously [11]. A transdermal fentanyl patch (50 ug/hr; Watson Laboratories, Inc., Corona , CA) was placed on each animal 18 hours prior to surgery...pigs were been vaccinated 108 for Mycoplasma hyopneumoniae, porcine circovirus type 2, swine influenza virus , Bordetella 109 bronchiseptica...Analg 525 35:432-448. 526 11. Duke T. 2000. Local and regional anesthetic and analgesic techniques in the dog and cat : Part I, 527 Pharmacology of

  9. 2006 Chemical Biological Individual Protection (CBIP) Conference and Exhibition

    Science.gov (United States)

    2006-03-09

    Requirements Office (JRO), MAJ W. Scott Smedley , Joint Requirements Office for Chemical, Biological, Radiological, and Nuclear Defense JPEO...Decker Director of Engineering 410-436-5600 www.ecbc.army.mil Gabe Patricio, JPEO 703 681-0808 Robert Wattenbarger, JPMOIP 703 432-3198 Canadian CBRN...UNCLASSIFIED Joint Requirements Office for Chemical, Biological, and Nuclear Defense MAJ W. Scott Smedley 8 March 2006 Individual Protection Conference

  10. Propagation Aspects of Frequency Sharing, Interference and System Diversity

    Science.gov (United States)

    1983-03-01

    DRSEL-COM-RN-1 Fort Monmouth, N.J. 07703 USA 11.Pages 432 12. Distribution Statement This document is distributed in accordance with AGARD policies ...OD ■rtCMCO •«^ CD CD -rt ■rtCU -T CD coo-^in vinNoi CDCOOO cDhvcno CMCUOO cncD o o oooo oooo CO oo o -rtCOCD N N X X 2: z o o in o

  11. Aphid parasitoids (Hymenoptera, Braconidae, Aphidiinae) and their associations related to biological control in Brazil

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Sampaio, M. V.; Bueno, V. H. P.

    2007-01-01

    Roč. 51, č. 1 (2007), s. 107-118 ISSN 0085-5626 R&D Projects: GA AV ČR IBS5007102 Grant - others:FAO programmers(BR) TCP/BRA/8908 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphid * host range * insect-plant interactions Subject RIV: EH - Ecology, Behaviour Impact factor: 0.432, year: 2007

  12. Marginal Integrity of Glass Ionomer and All Ceramic Restorations

    Science.gov (United States)

    2016-06-01

    that would be expected with daily food and beverage intake. And no toothbrush or flossing abrasion occurred. Future studies could incorporate... management of dental caries. Quintessence International, 33(6), 427-432. 65. Frencken J.E., Peters M.C., Manton D.J., Leal S.C., Gordan V.V., Eden E...2012). Minimal intervention dentistry for managing dental caries - a review: Report of a FDI task group. International Dental Journal, 62(5), 223

  13. Percutaneous sclerotherapy of pediatric lymphatic malformations: experience and outcomes according to the agent used.

    Science.gov (United States)

    Gallego Herrero, C; Navarro Cutillas, V

    Analyze statistically the success, number of sessions required and complete duration of treatment of agents used in pediatric percutaneous sclerotherapy of lymphatic malformations, to determine the most suitable. Retrospective study based on outcomes from percutaneous sclerotherapy performed on lymphatic malformations of 56 patients conducted by pediatric interventional radiologist for 14 years. As first approach, the procedure consists of ultrasound-guided introduction of sclerosing agent. Sessions were repeated until clinical resolution. Success, number of sessions and the duration of treatment were recorded and statistical treatment of the data was performed to obtain further conclusions. Lost patients in follow up and other minority agents used were excluded from the data. Eventually, 52 patients treated with OK432 (n=29), Ethibloc (n=5) and combination therapy (n=18) were included. The average number of sessions and duration in months of treatment was respectively 2.38 and 8.6 for OK432, 1.4 and 5.6 for Ethibloc, and 1.83 and 2.30 for dual therapy. The results were statistically significant for the difference in duration between OK432 and dual therapy. Also, 60-80% of patients reached proper results related to success, but the difference was no significant among the agents. Other demographic and anatomical variables were analyzed, not showing any difference, which supports the homogeneity of the sample. Despite of no significant difference in success and number of sessions among agents, longer duration of treatment with OK432 than dual therapy could mean greater health costs and probably greater disturb for patient and family. Copyright © 2017 SERAM. Publicado por Elsevier España, S.L.U. All rights reserved.

  14. Molecular diversity of fungi from marine oxygen-deficient environments (ODEs)

    Digital Repository Service at National Institute of Oceanography (India)

    Manohar, C.S.; Forster, D.; Kauff, F.; Stoeck, T.

    . Sparrow Jr F K (1936) Biological observations of the marine fungi of woods hole waters. Biol Bull 70: 236-263. States JS & Christensen M (2001) Fungi Associated with Biological Soil Crusts in Desert Grasslands of Utah and Wyoming. Mycologia 93: 432... version: Biology of marine fungi. Ed. by: Raghukumar, C. (Prog. Mol. Subcellular Biol). Springer, vol.53 (Chap 10); 2012; 189-208 Chapter # 10 Molecular diversity of fungi from marine oxygen-deficient environments (ODEs) Cathrine S. Jebaraj 1...

  15. Networks for the weak topology of Banach and Fréchet spaces

    Czech Academy of Sciences Publication Activity Database

    Gabriyelyan, S.; Kąkol, Jerzy; Kubiś, Wieslaw; Marciszewski, W.

    2015-01-01

    Roč. 432, č. 2 (2015), s. 1183-1199 ISSN 0022-247X R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : Fréchet space * space of continuous functions * locally convex space Subject RIV: BA - General Mathematics Impact factor: 1.014, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022247X15006836

  16. Intra-Articular Lubricin Gene Therapy for Post-Traumatic Arthritis

    Science.gov (United States)

    2015-09-01

    Healing in a Rabbit Model Sponsor Agency: American Orthopaedic Foot & Ankle Society Contract Specialist: Joy Keller, MS, MSUS, Director of Research...coefficient (μ).(75, 110, 111) 4.3.2 Friction test on explants Fresh bovine osteochondral explants were anchored along the bone surface to the base...explant plugs (12 mm) were anchored along the bone surface to the base plate with new designed plate. The centers of the explants were subject to a

  17. 2017 INFORMS PRIZE. The Nomination of The United States Air Force

    Science.gov (United States)

    2017-02-08

    Member Lt Col Nicholas J. Zeisler Senior Operations Research Analyst, Headquarters Air Force (AF/A9RP) ROLE NAME ORGANIZATIONAL POSITION Publications...effective at detecting North Vietnamese trucks hidden under jungle canopy. Seventh Air Force Headquarters (top) Tan Son Nhut Air Base, Vietnam, 1962...1969 MACV Headquarters “Pentagon East” at Tan Son Nhut 432 0 17 I N F O R M S P R I Z E required the same kind of competent analysts, and applied the

  18. Studies on the Pulse Rate, Pedometer Count and Satisfactoin Degree at Various Exercise

    OpenAIRE

    小原, 史朗

    2004-01-01

    This investigation examined whether free exercise of students became good stimulation of breathing circulation function from relation of pulse rate and pedometer count. And, I examined it on satisfaction degree after exercise. Object person was 432 man students (total of 1391) and 94 woman students (total of 472). As for relation of pulse rate and pedometer count, statistical meaning was recognized by man and women. The exercise that a pulse rate and pedometer count were high together seemed ...

  19. A mathematical model for the third-body concept

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; Petrov, A.

    2018-01-01

    Roč. 23, č. 3 (2018), s. 420-432 ISSN 1081-2865 R&D Projects: GA ČR(CZ) GA15-12227S Institutional support: RVO:67985840 Keywords : third-body * hysteresis operators * variational inequality Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics Impact factor: 2.953, year: 2016 http://journals.sagepub.com/doi/abs/10.1177/1081286517732827

  20. Analyzing the Effects of Technological Change: A Computable General Equilibrium Approach

    Science.gov (United States)

    1988-09-01

    present important simplifying assumptions about the nature of consumer preferences and production possibility sets. If a general equilibrium model...important assumptions are in such areas as consumer preferences , the actions of the government, and the financial structure of the model. Each of these is...back in the future. 4.3.2 Consumer demand Consumer preferences are a second important modeling assumption affecting the results of the study. The PILOT

  1. Social Anxiety and Internet Addiction among Rural Left-behind Children: The Mediating Effect of Loneliness

    OpenAIRE

    REN, Yujia; YANG, Jiao; LIU, Liqiong

    2017-01-01

    Background: At present, the mental health of rural left-behind children is a major social problem in China. Internet addiction, social anxiety, and loneliness are common psychological and behavioral problems among rural left-behind children, but the relationships among these issues have not been clearly identified. Methods: A total of 432 junior year 1 to senior year 3 students were randomly selected from 2 rural middle schools in Hunan Province of China as the research subjects. The Internet...

  2. Residual stress determination by neutron diffraction in a car gear-shaft made of 20NiCrMo2 alloyed case hardening steel

    Czech Academy of Sciences Publication Activity Database

    Rogante, M.; Mazzanti, M.; Mikula, Pavol; Vrána, Miroslav

    2012-01-01

    Roč. 50, č. 4 (2012), s. 213-220 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP204/12/1360 Institutional support: RVO:61389005 Keywords : 20NiCrMo2 steel * gear-shaft * caser hardening * residual stress * neutron diffraction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.687, year: 2012

  3. Spectral analysis of coniferous foliage and possible links to soil chemistry: Are spectral chlorophyll indices related to forest floor dissolved organic C and N?

    Czech Academy of Sciences Publication Activity Database

    Albrechtová, Jana; Seidl, Z.; Aitkenhead-Peterson, J. A.; Lhotáková, Z.; Rock, B. N.; Alexander, J.E.; Malenovský, Zbyněk; McDowell, W. H.

    2008-01-01

    Roč. 404, 2-3 (2008), s. 424-432 ISSN 0048-9697 R&D Projects: GA MŠk(CZ) ME 658 Grant - others:NSF(US) DEB108385 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60870520 Keywords : chlorophyll indexes * reflectance * DON and DOC Subject RIV: EF - Botanics Impact factor: 2.579, year: 2008

  4. Sequencing wheat chromosome arm 7BS delimits the 7BS/4AL translocation and reveals homoeologous gene conservation

    Czech Academy of Sciences Publication Activity Database

    Berkman, P.J.; Skarshewski, A.; Manoli, S.; Lorenc, M. T.; Stiller, J.; Smits, L.; Lai, K.; Cambell, E.; Kubaláková, Marie; Šimková, Hana; Batley, J.; Doležel, Jaroslav; Hernandez, P.; Edwards, D.

    2012-01-01

    Roč. 124, č. 3 (2012), s. 423-432 ISSN 0040-5752 R&D Projects: GA MŠk(CZ) LC06004 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : POLYPLOID WHEAT * BIN MAP * BRACHYPODIUM-DISTACHYON Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.658, year: 2012

  5. Crystal structure of 4-aminobenzoic acid–4-methylpyridine (1/1

    Directory of Open Access Journals (Sweden)

    M. Krishna Kumar

    2015-02-01

    Full Text Available In the title 1:1 adduct, C6H7N·C7H7NO2, the carboxylic acid group is twisted at an angle of 4.32 (18° with respect to the attached benzene ring. In the crystal, the carboxylic acid group is linked to the pyridine ring by an O—H...N hydrogen bond, forming a dimer. The dimers are linked by N—H...O hydrogen bonds, generating (010 sheets.

  6. Influence of yttrium content on the Ce.sub.Lu1./sub. and Ce.sub.Lu2./sub. luminescence characteristics in (Lu.sub.1-x./sub.Y.sub.x./sub.).sub.2./sub.SiO.sub.5./sub.: Ce single crystal

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Ren, G.; Horodysky, P.; Pazzi, G.P.; Kučerková, Romana

    2011-01-01

    Roč. 34, č. 2 (2011), s. 428-432 ISSN 0925-3467 R&D Projects: GA MŠk(CZ) ME10084; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * excited state ionization * temperature dependence * L(Y)SO: Ce Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.023, year: 2011

  7. Search for doubly-charged Higgs boson production at HERA

    Czech Academy of Sciences Publication Activity Database

    Aktas, A.; Andreev, V.; Anthonis, A.; Cvach, Jaroslav; Reimer, Petr; Zálešák, Jaroslav

    2006-01-01

    Roč. 638, - (2006), s. 432-440 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LC527; GA MŠk(CZ) 1P05LA259 Institutional research plan: CEZ:AV0Z10100502 Keywords : HI experiment * ep scattering * Higgs boson Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 5.043, year: 2006

  8. Workplace and HIV-related sexual behaviours and perceptions among female migrant workers

    OpenAIRE

    YANG, H.; LI, X.; STANTON, B.; FANG, X.; LIN, D.; MAO, R.; LIU, H.; CHEN, X.; SEVERSON, R.

    2005-01-01

    Data from 1,543 female migrants working in eight occupational clusters in Beijing and Nanjing, China were analysed to examine the association of workplace with HIV-related behaviours and perceptions. For sexually experienced women (n = 666, 43.2%), those working in entertainment establishments or personal service (e.g., nightclubs, dancing halls, barbershops, beauty salons, massage parlours, etc.) engaged in risky sexual practices twice as frequently as those working in non-entertainment esta...

  9. Investigation of Strouhal numbers of iced cable models of cable-supported bridges with respect to angle of wind attack

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Tatara, M.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Marušić, A.

    2015-01-01

    Roč. 112, 2-B (2015), s. 417-432 ISSN 1897-628X R&D Projects: GA MŠk(CZ) LO1219; GA MPO(CZ) FR-TI3/654 Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JN - Civil Engineering http://suw.biblos.pk.edu.pl/resources/i5/i6/i6/i8/i4/r56684/GorskiP_InvestigationsStrouhal.pdf

  10. Multiple Instance Fuzzy Inference

    Science.gov (United States)

    2015-12-02

    Fashion models 5.19 14 Sunset scenes 3.52 15 Cars 4.93 16 Waterfalls 2.56 17 Antique furniture 2.30 18 Battle ships 4.32 19 Skiing 3.34 20 Desserts ...1000, in addition 10% of the Desserts category images were confused with Beach and 20.9% of Mountains and glaciers images were misclassified as

  11. Estimating the Effects of Damping Treatments on the Vibration of Complex Structures

    Science.gov (United States)

    2012-09-26

    26 4.3 Literature review 26 4.3.1 CLD Theory 26 4.3.2 Temperature Profiling 28 4.4 Constrained Layer Damping Analysis 29 4.5 Results 35...Coordinate systems and length scales are noted. Constraining layer, viscoelastic layer and base layer pertain to the nomenclature used through CLD ...for vibrational damping 4.1 Introduction Constrained layer damping ( CLD ) treatment systems are widely used in complex structures to dissipate

  12. Bulimic behaviours and psychopathology in obese adolescents and in their parents

    OpenAIRE

    Isnard, Pascale; Quantin, Laure; Cortese, Samuele; Falissard, Bruno; Musher-Eizenman, Dara; Guedeney, Antoine; Frelut, Marie-Laure; Mouren, Marie-Christine

    2010-01-01

    Objective. To help identify and advance the understanding of the potential mechanisms underlying the association between parents? and adolescents? psychological maladjustment in obesity, we evaluated bulimic behaviours and psychopathology in a clinical sample of obese adolescents and in their parents. Methods. This is a cross-sectional cohort study including 115 severely obese, treatment-seeking adolescents aged 12?17 years (mean age: 14.2; mean body mass index z-score: 4.32), and their paren...

  13. Neutron energy distribution function reconstructed from time-of-flight signals in deuterium gas-puff Z-pinch

    Czech Academy of Sciences Publication Activity Database

    Klír, D.; Kravárik, J.; Kubeš, J.; Rezac, K.; Ananev, S.S.; Bakshaev, Y. L.; Blinov, P. I.; Chernenko, A. S.; Kazakov, E.D.; Korolev, V. D.; Ustroev, G. I.; Juha, Libor; Krása, Josef; Velyhan, Andriy

    2009-01-01

    Roč. 37, č. 3 (2009), s. 425-432 ISSN 0093-3813 R&D Projects: GA MŠk(CZ) LC528; GA MŠk LA08024 Grant - others:IAEA(XE) RC 14817 Institutional research plan: CEZ:AV0Z10100523 Keywords : deuterium * fusion reaction * gas puff * Monte Carlo reconstruction * neutron energy spectra * neutron s * Z-pinch Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.043, year: 2009

  14. Extremely slow carbon diffusion in carbon-supersaturated surface of ferrite

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Král, Lubomír

    2014-01-01

    Roč. 52, č. 3 (2014), s. 125-133 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/11/0148; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : carbon diffusion * carbon supersaturation * diffusion barrier * ferrite * P91 Subject RIV: BJ - Thermodynamics Impact factor: 0.406, year: 2014

  15. Vliv podmínek šíření trhliny na dimenzi fraktálu lomové plochy

    Czech Academy of Sciences Publication Activity Database

    Němec, Ondřej; Dlouhý, Ivo; Strnadel, B.

    2003-01-01

    Roč. 41, č. 3 (2003), s. 177-192 ISSN 0023-432X R&D Projects: GA ČR GA106/01/0342; GA AV ČR IAA2041003 Institutional research plan: CEZ:AV0Z2041904 Keywords : tempered microalloyed steel * fractography * fracture toughness Subject RIV: JL - Materials Fatigue , Friction Mechanics Impact factor: 0.563, year: 2003 http://www.kovmat.sav.sk/km3-03.htm

  16. Prediction of fracture toughness temperature dependance from tensile test parameters

    Czech Academy of Sciences Publication Activity Database

    Šmida, T.; Babjak, J.; Dlouhý, Ivo

    2010-01-01

    Roč. 48, č. 6 (2010), s. 345-352 ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/10/0466; GA AV ČR 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : steels * brittle to ductile transition * fracture Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.471, year: 2010

  17. The Frölicher–Nijenhuis bracket and the geometry of G_2-and Spin(7)-manifoldser

    Czech Academy of Sciences Publication Activity Database

    Kawai, K.; Le, Hong-Van; Schwachhöfer, L.

    2018-01-01

    Roč. 197, č. 2 (2018), s. 411-432 ISSN 0373-3114 Institutional support: RVO:67985840 Keywords : Frölicher-Nijenhuis backet * G2 manifold * Fernández classification Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.864, year: 2016 https://link.springer.com/article/10.1007%2Fs10231-017-0685-9

  18. Sphaeromyxa artedielli sp. n. (Myxozoa: Sphaeromyxidae), a parasite of sculpins (Cottidae) in northern Norway

    Czech Academy of Sciences Publication Activity Database

    Karlsbakk, E.; Bårdsgjære Einen, A.C.; Bartošová, Pavla

    2013-01-01

    Roč. 60, č. 5 (2013), s. 425-432 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GPP506/11/P724 Institutional support: RVO:60077344 Keywords : Myxosporeans * marine fish * new species * Artediellus atlanticus * Triglops murrayi * SSU rRNA gene sequences * pseudogene * northern Atlantic Ocean * Sphaeromyxa balbianii Subject RIV: EE - Microbiology, Virology Impact factor: 1.211, year: 2013

  19. Evaluation of two approaches to genotyping major histocompatibility complex class I in a passerine—CE-SSCP and 454 pyrosequencing

    Czech Academy of Sciences Publication Activity Database

    Promerová, Marta; Babik, W.; Bryja, Josef; Albrecht, Tomáš; Stuglik, M.; Radwan, J.

    2012-01-01

    Roč. 12, č. 2 (2012), s. 285-292 ISSN 1755-098X R&D Projects: GA AV ČR IAA600930608; GA ČR GA206/06/0851; GA ČR GAP505/10/1871 Institutional research plan: CEZ:AV0Z60930519 Keywords : avian * Carpodacus erythrinus * major histocompatibility complex * next-generation sequencing * scarlet rosefinch Subject RIV: EG - Zoology Impact factor: 7.432, year: 2012

  20. Analysis of water-soluble fraction of metals in atmospheric aerosols using aerosol counterflow two-jets unit and chemiluminescent detection

    Czech Academy of Sciences Publication Activity Database

    Vojtěšek, Martin; Mikuška, Pavel; Večeřa, Zbyněk; Křůmal, Kamil

    2012-01-01

    Roč. 92, č. 4 (2012), s. 432-449 ISSN 0306-7319 R&D Projects: GA MŽP SP/1A3/148/08; GA MŽP SP/1B7/189/07; GA MŽP SP/1A3/55/08 Institutional research plan: CEZ:AV0Z40310501 Keywords : atmospheric aerosols * metals * continuous aerosol collector Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.240, year: 2012

  1. Low-cost auxiliary system for broadband NMR on strongly magnetic systems

    DEFF Research Database (Denmark)

    Nevald, Rolf; Hansen, Poul Erik

    1978-01-01

    . The distance from the NMR oscillator to the sample is only 55 cm (wavelength of ~550 MHz radiation), giving a tolerable He evaporation rate of 0.35 l/h. The maximum field at 4.2 K is 43.2 kG, which can be measured with an accuracy better than ±100 ppm. The homogeneity at maximum field over a central sphere 8...

  2. Preliminary Feasibility and Risk Analysis of a Carbon Dioxide Barrier at Brandon Road Lock and Dam

    Science.gov (United States)

    2017-09-01

    General ...................................................................................................................... 26 4.3.2 Effects on plants ...culverts are rare , their existence indicates that passage of ANS through them must be considered as part of any ANS barrier or containment strategy. As...aeration (McAliley and D’Adamo 2010) or a Venturi jet injector as used in the aeration chambers of treatment plants (Baylar et al. 2006) or used to inject

  3. The Frölicher–Nijenhuis bracket and the geometry of G_2-and Spin(7)-manifoldser

    Czech Academy of Sciences Publication Activity Database

    Kawai, K.; Le, Hong-Van; Schwachhöfer, L.

    2018-01-01

    Roč. 197, č. 2 (2018), s. 411-432 ISSN 0373-3114 Institutional support: RVO:67985840 Keywords : Frölicher-Nijenhuis backet * G2 manifold * Fernández classification Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.864, year: 2016 https://link.springer.com/ article /10.1007%2Fs10231-017-0685-9

  4. High Temperature Creep of an Al-8,5Fe-1,3V-1,7Si Alloy

    Czech Academy of Sciences Publication Activity Database

    Kuchařová, Květa; Zhu, S. J.; Čadek, Josef

    2002-01-01

    Roč. 40, č. 2 (2002), s. 69-84 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Al-8,5Fe 1,3V 1,7Si alloy * creep behavior , true threshold stress Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

  5. Differences on self-perception of organizational pride and loyalty in Millennial & Generation X, considering gender and seniority variables

    OpenAIRE

    Arredondo Trapero, Florina G.; Villa Castaño, Lida Esperanza; Vázquez Parra, José C.; De la Garza García, Jorge

    2017-01-01

    The research objective is to compare the differences in self-perception of organizational pride and loyalty between millennials and generation x, considering the variables of gender and seniority. The reason for this study is the importance of millennials’ influence in the business sector, and the effect it is having in terms of turnover toward companies. The study was conducted on 432 employees working in a cluster of companies located in northeastern Mexico. For statistical purposes, an...

  6. RBE of 0.85 MeV neutrons in Guinea pigs with a cerebral form of radiation sickness

    International Nuclear Information System (INIS)

    Shaporov, V.N.; Sokolova, T.I.; Nasonova, T.A.; Aleshin, S.I.

    1989-01-01

    The RBE coefficient of neutrons (0.85 MeV) was 1.87 in comparison with that of electron radiation (8 MeV) as determined by the death rate of guinea pigs with the cerebral form of radiation sickness. LD 50/1.5 amounted to 43.2 and 80.7 Gy. The dynamics of clinical symptoms at the height of the disease is discussed

  7. Studies in Intelligence. Volume 54, Number 2, June 2010

    Science.gov (United States)

    2010-06-01

    432 pp., bibliography, no index. The murky chronicle of Alexander Litvinenko’s poisoning with the highly toxic polonium - 210 in a posh London hotel bar...nearly everything, too: naviga- tion, parachute jumping, how to kill wild animals and use them as food , lock picking, hiding microscopic sized...dispatched into desolate areas with only a minimum of food , forced to live on fish they could catch or game they could shoot. Subsequently they were

  8. 49 CFR 172.400 - General labeling requirements.

    Science.gov (United States)

    2010-10-01

    ... 172.411 1.6 EXPLOSIVES 1.6 172.411 2.1 FLAMMABLE GAS 172.417 2.2 NONFLAMMABLE GAS 172.415 2.3 POISON GAS 172.416 3 (flammable liquid) Combustible liquid FLAMMABLE LIQUID (none) 172.419 4.1 FLAMMABLE... B) POISON 172.430 6.2 INFECTIOUS SUBSTANCE 1 172.432 7 (see § 172.403) RADIOACTIVE WHITE-I 172.436 7...

  9. Effects of rind removal on physicochemical quality characteristics of fresh-cut watermelon [Citrus lanatus (Thunb) Matsum & Nakai] during cold storage

    NARCIS (Netherlands)

    Petrou, P.; Soteriou, G.; Schouten, R.E.; Kyriacou, C.

    2013-01-01

    The impact of removing the rind from fresh-cut watermelon slices was assessed on the quality of the product during storage at 4 °C for 9 days. Flesh lycopene declined from 55.4 to 47.9 mg kg-1 f.w. and colour lightness (L*) increased from 43.2 to 45.8 after 2 days of storage. Initial heart and

  10. Kloakering i landbruget og ved mindre beboelser i landzone

    DEFF Research Database (Denmark)

    Petersen, H.W.

    Publikationen er beregnet til at bruges sammen med DIF's "Norm for afløbsinstallationer", DS 432, og "Norm for mindre afløbsanlæg med nedsivning", DS 440. Den giver vejledning i planlægning og udførelse af afløbsanlæg med rørledninger i jord for ajle og spildevand ført til opbevaringstank eller v...

  11. Effect of grain refinement by ECAP on creep of pure Cu

    Czech Academy of Sciences Publication Activity Database

    Blum, W.; Dvořák, Jiří; Král, Petr; Eisenlohr, P.; Sklenička, Václav

    2014-01-01

    Roč. 590, JAN (2014), s. 423-432 ISSN 0921-5093 R&D Projects: GA ČR(CZ) GAP108/11/2260; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Cu * ECAP * Static recrystallization * Creep * Ductility * High- angle boundaries Subject RIV: JJ - Other Materials Impact factor: 2.567, year: 2014

  12. Texture Development in Friction Stir Welds

    Science.gov (United States)

    2011-01-01

    and J. J. Jonas: Acta Metall., 1989, 37, (8), 2197–2210. 17. S. Li, I. J. Beyerlein and M. A. M. Bourke : Mater. Sci. Eng. A, 2005, A394, (1–2), 66–77...M. Bourke , D. Brown, B. Clausen, C. Tome, R. V. Dreele, C. Xu and T. Langdon: Mater. Sci. Forum, 2003, 426–432, 2661–2666. 26. J. A. Schneider and A

  13. Компонентный состав эфирного масла полыни австрийской, произрастающей в Ставропольском крае

    OpenAIRE

    Коновалов, Д.; Коновалов, Ю.

    2006-01-01

    The componental structure of essential oil of Artemisia austriaca Jacq. growing in Stavropol region was investigated by GC-MS method. 31 compounds are identified. The basic components are: a-thujone (55,26%), eucalyptol (12,01%), b-thujone (7,21%), terpineol-4 (4,32%), (+)-camphor (4,11%), (S)-cis-verbenol (2,68%), borneol (1,94%), o-cymene (1,72%), (-)-cis-sabinol (1,25%).

  14. Non-suicidal self-injuries in a sample of Mexican university students

    OpenAIRE

    Castro Silva, Everardo; Benjet, Corina; Juárez García, Francisco; Jurado Cárdenas, Samuel; Lucio Gómez-Maqueo, María Emilia; Valencia Cruz, Alejandra

    2017-01-01

    Abstract Introduction Non-suicidal self-injuries (NSSI) are a worldwide health problem that affects principally young people, and can impact negatively the mental and physical health of those that self-injure. Objective To examine the frequency of NSSI in 564 undergraduate students (132 male, 432 female) from Mexico City and the association of NSSI with depressive symptoms, anxiety, impulsivity, self-efficacy, and emotion regulation. Method A convenience sample of 564 undergraduate student...

  15. Determinants of exchange rate volatility: the case of the new EU members

    Czech Academy of Sciences Publication Activity Database

    Stančík, Juraj

    2007-01-01

    Roč. 57, 9-10 (2007), s. 414-432 ISSN 0015-1920 R&D Projects: GA ČR GA402/06/1293; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : exchange - rate volatility * TARCH model * EMU integration Subject RIV: AH - Economics Impact factor: 0.382, year: 2007 http://journal.fsv.cuni.cz/storage/1085_fau_9_10_2007_00000002.pdf

  16. Microstructure stability and creep behaviour of advanced high chromium ferritic steels

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Kudrman, J.; Svoboda, Milan; Kloc, Luboš

    43 2005, č. 1 (2005), s. 20-33 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/02/0608; GA AV ČR(CZ) IAA2041101; GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : 9-12%Cr steels * microstructure stability * creep behaviour * nonsteady creep loading Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  17. Knockdown of proteins involved in iron metabolism limits tick reproduction and development

    Czech Academy of Sciences Publication Activity Database

    Hajdušek, O.; Sojka, Daniel; Kopáček, Petr; Burešová, Veronika; Franta, Zdeněk; Šauman, Ivo; Winzerling, J.; Grubhoffer, L.

    2009-01-01

    Roč. 106, č. 4 (2009), s. 1033-1038 ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC06009; GA MŠk LC07032; GA AV ČR IAA600220603 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50070508 Keywords : tick ferritin * iron metabolism * RNA interference Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.432, year: 2009

  18. The liability of historical mine authorization holders for rehabilitation / Suzette Hartzer

    OpenAIRE

    Hartzer, Suzette

    2009-01-01

    Historically, irresponsible mining companies have escaped their duty to rehabilitate. The Mineral Petroleum Resources Development Act does not oblige mining companies to rehabilitate if their operations ceased before the Minerals Act came into force. In the court case De Beers Consolidated Mines v Ataqua Mining (Pty) Ltd and others 2006 1 SA 432 (T), the court held that the Mineral Petroleum Resources Development Act is not applicable to tailings dumps that were created thro...

  19. The effect of novel [3-fluoro-(2-phosphonoethoxy)propyl]purines on the inhibition of Plasmodium falciparum, Plasmodium vivax and human hypoxanthine-guanine-(xanthine) phosphoribosyltransferases

    Czech Academy of Sciences Publication Activity Database

    Baszczyňski, Ondřej; Hocková, Dana; Janeba, Zlatko; Holý, Antonín; Jansa, Petr; Dračínský, Martin; Keough, D. T.; Guddat, L. W.

    2013-01-01

    Roč. 67, Sep (2013), s. 81-89 ISSN 0223-5234 R&D Projects: GA MV VG20102015046; GA ČR GAP207/11/0108 Grant - others:National Health and Madical Research Council(AU) 1030353; National Health and Medical Research Council(AU) 569703 Institutional support: RVO:61388963 Keywords : Malaria * nucleoside phosphonates * fluorine * purines * FPMP Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.432, year: 2013

  20. Mechanisms of nuclear lamina growth in interphase

    Czech Academy of Sciences Publication Activity Database

    Zhironkina, O.A.; Kurchashova, S.Y.; Pozharskaia, V.A.; Cherepanynets, V.D.; Strelkova, O.S.; Hozák, Pavel; Kireev, I.I.

    2016-01-01

    Roč. 145, č. 4 (2016), s. 419-432 ISSN 0948-6143 R&D Projects: GA ČR GA16-03403S Grant - others:Russian Fund for Basic Research(RU) 13-04-00885; Russian Fund for Basic Research(RU) 15-54-78077 Institutional support: RVO:68378050 Keywords : Nuclear lamina * Microdomains * Interphase * Nucleus * DNA replication * Cell cycle Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.553, year: 2016

  1. Abrasive wear of WC-NiMoCrFeCo thermally sprayed coatings in dependence on different types of abrasive sands

    Czech Academy of Sciences Publication Activity Database

    Kašparová, M.; Zahálka, F.; Houdková, Š.; Ctibor, Pavel

    2010-01-01

    Roč. 48, č. 1 (2010), s. 75-85 ISSN 0023-432X R&D Projects: GA AV ČR 1QS200430560 Institutional research plan: CEZ:AV0Z20430508 Keywords : WC-Hastelloy * abrasive wear * Al2O3 sand * SiO2 sand * braun size * abrasive efficiency Subject RIV: JG - Metallurgy Impact factor: 0.471, year: 2010 http://kovmat.sav.sk/abstract.php?rr=48&cc=1&ss=73

  2. Effect of Tb and Al substitution within the rare earth and cobalt sublattices on magnetothermal properties of Dy.sub.0.5./sub.Ho.sub.0.5./sub.Co.sub.2./sub.

    Czech Academy of Sciences Publication Activity Database

    Chzhan, V.B.; Tereshina, Evgeniya; Mikhailova, A.B.; Politova, G.A.; Tereshina, I. S.; Kozlov, V.I.; Ćwik, J.; Nenkov, K.; Alekseeva, O.A.; Filimonov, A.V.

    2017-01-01

    Roč. 432, June (2017), s. 461-465 ISSN 0304-8853 R&D Projects: GA ČR GA16-03593S Institutional support: RVO:68378271 Keywords : rare- earth intermetallics * laves phase * heat capacity * magnetocaloric effect Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  3. Difuze a termodynamika fosforu, uhlíku, chromu a niklu ve svarech ocelí

    Czech Academy of Sciences Publication Activity Database

    Million, Bořivoj; Stránský, K.; Michalička, Petr; Rek, A.

    2001-01-01

    Roč. 39, č. 3 (2001), s. 161-178 ISSN 0023-432X R&D Projects: GA ČR GA106/98/1367; GA AV ČR IBS2041105 Institutional research plan: CEZ:AV0Z2041904 Keywords : weld joints of steel * P, C, Cr and Ni redistribution * diffusion Subject RIV: JG - Metallurgy Impact factor: 0.343, year: 2001

  4. Brain cancer and pesticide relationship in orchard farmers of Kashmir

    OpenAIRE

    Bhat, Abdul Rashid; Wani, Muhammed Afzal; Kirmani, A. R.

    2010-01-01

    Background: The increasing trend in the incidence of primary malignant brain tumors in orchard farmers and their families in Kashmir. Aim: To determine the relationship between the patients of primary malignant brain tumors and their occupation. Materials and Methods: Retrospectively, case files along with death certificates of 432 patients of primary malignant brain tumors and 457 controls (non-tumor neurologic diseases), admitted for treatment simultaneously over a period of 4 years from Ja...

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    We note that one may start from any of the above 12 cards and complete the Flush by taking two more on its right, such as. QJI0, 765, etc. In the case we start with 4 or 3, we may complete the Flush with 432 or 32A, respectively. But one cannot start from 2 and proceed because the combination 2AK is not allowed. Hence 2 ...

  6. Applicability of empirical formulas and fractography for assessment of creep life and creep fracture modes of tempered martensitic 9%Cr steel

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Král, Petr; Kvapilová, Marie; Dvořák, Jiří

    2017-01-01

    Roč. 55, č. 2 (2017), s. 69-80 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA16-09518S; GA MŠk LM2015069 Institutional support: RVO:68081723 Keywords : P92 steel * mechanical characterisation * creep * plasticity * fracture * electron microscopy Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 0.366, year: 2016

  7. Adaptation to chronic continuous hypoxia potentiates Akt/HK2 anti-apoptotic pathway during brief myocardial ischemia/reperfusion insult

    Czech Academy of Sciences Publication Activity Database

    Kolář, D.; Grešíková, M.; Wasková-Arnoštová, P.; Elsnicová, B.; Kohutová, J.; Horníková, D.; Vebr, P.; Neckář, Jan; Blahová, T.; Kašparová, D.; Novotný, J.; Kolář, František; Nováková, O.; Žurmanová, J.M.

    2017-01-01

    Roč. 432, 1-2 (2017), s. 99-108 ISSN 0300-8177 R&D Projects: GA ČR(CZ) GA13-10267S Institutional support: RVO:67985823 Keywords : heart * hypoxia * ischemia/reperfusion * hexokinase * protein kinase B/Akt * mitochondria Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery OBOR OECD: Biochemistry and molecular biology Impact factor: 2.669, year: 2016

  8. The Vibrio cholerae Mrp system: cation/proton antiport properties and enhancement of bile salt resistance in a heterologous host.

    Science.gov (United States)

    Dzioba-Winogrodzki, Judith; Winogrodzki, Olga; Krulwich, Terry A; Boin, Markus A; Häse, Claudia C; Dibrov, Pavel

    2009-01-01

    The mrp operon from Vibrio cholerae encoding a putative multisubunit Na(+)/H(+) antiporter was cloned and functionally expressed in the antiporter-deficient strain of Escherichia coli EP432. Cells of EP432 expressing Vc-Mrp exhibited resistance to Na(+) and Li(+) as well as to natural bile salts such as sodium cholate and taurocholate. When assayed in everted membrane vesicles of the E. coli EP432 host, Vc-Mrp had sufficiently high antiport activity to facilitate the first extensive analysis of Mrp system from a Gram-negative bacterium encoded by a group 2 mrp operon. Vc-Mrp was found to exchange protons for Li(+), Na(+), and K(+) ions in pH-dependent manner with maximal activity at pH 9.0-9.5. Exchange was electrogenic (more than one H(+) translocated per cation moved in opposite direction). The apparent K(m) at pH 9.0 was 1.08, 1.30, and 68.5 mM for Li(+), Na(+), and K(+), respectively. Kinetic analyses suggested that Vc-Mrp operates in a binding exchange mode with all cations and protons competing for binding to the antiporter. The robust ion antiport activity of Vc-Mrp in sub-bacterial vesicles and its effect on bile resistance of the heterologous host make Vc-Mrp an attractive experimental model for the further studies of biochemistry and physiology of Mrp systems. Copyright 2008 S. Karger AG, Basel.

  9. Association of CYP1B1 Polymorphisms with Breast Cancer: A Case-Control Study in the Han Population in Ningxia Hui Autonomous Region, P. R. China

    Science.gov (United States)

    Jiao, Haiyan; Liu, Chunlian; Guo, Weidong; Peng, Liang; Chen, Yintao; Martin, Francis L.

    2010-01-01

    Studies investigating possible associations between cytochrome P4501B1 (CYP1B1) polymorphisms and breast cancer risk have been inconsistent. We set out to ascertain whether there might be an association between polymorphisms in exon 2 (codon 119, G→T) and exon 3 (codon 432, G→C) of CYP1B1 and breast cancer in a Chinese Han population in the rural region of Ningxia. Using an allele-specific polymerase chain reaction method and direct DNA sequencing, the presence or absence of the two CYP1B1 polymorphisms was investigated. Genotype and allele frequencies were analyzed in breast cancer cases (n = 152) and healthy age-matched controls (n = 156). The odds ratio (OR) of 119G→T or 432G→C in breast cancer cases and controls was 3.3 (95% CI: 1.28 to 8.28) and 2.8 (95% CI: 1.04 to 7.51), respectively. In addition, the OR for people with both polymorphisms (119T and 432C) was 4.69 (95% CI: 1.97 to 11.19). Our results suggest that certain polymorphisms in the CYP1B1 gene might increase risk for breast cancer among Han Chinese, perhaps because they influence the efficiency of CYP1B1 bio-transformation of oestrogens or pro-carcinogens into DNA-reactive electrophiles that may act as cancer-initiating agents. PMID:20212917

  10. Experimental study on active specific immunotherapy utilizing the immune reaction of low-dose irradiated tumor tissue, 9

    International Nuclear Information System (INIS)

    Ogawa, Yasuhiro; Maeda, Tomoho; Yoshida, Shoji

    1983-01-01

    We have already reported the remarkable effect of an active specific immunotherapy using cryopreserved tumor cells and infiltrating mononuclear cells prepared from a low-dose irradiated tumor tissue after cytoreductive radiotherapy. In the present study, the effect of a biological response modifier, OK-432 combined with the active specific immunotherapy was investigated. Twelve-week-aged female C3H/He mice transplanted with MM 46 tumor cells were received local radiotherapy with a dose of 3,000 rads by high energy electron beams on the fifth day after inoculation. The tumor cells and infiltrating mononuclear cells cryopreserved for two months were thawed and treated with mitomycin-C at concentration of 20 μg/10 7 cells at 37 0 C for 30 min. Then, these cells were injected subcutaneously into the left hind paws as a mitomycin C-treated, cryopreserved active specific immunotherapy on the thirteenth day, and daily dose of 1 KE of OK-432 was injected intraperitoneally from the sixth to the tenth days. The inhibition of the tumor growth was similarly observed in the group which received this active specific immunotherapy combined with a biological response modifier, OK-432. (author)

  11. Sclerotherapy for lymphatic malformations in children: a scoping review.

    Science.gov (United States)

    Churchill, Paige; Otal, Damanjot; Pemberton, Julia; Ali, Abdullah; Flageole, Helene; Walton, J Mark

    2011-05-01

    This scoping review assesses the literature and summarizes the current evidence on sclerotherapy for the treatment of lymphatic malformations in pediatric patients. A comprehensive search of published and unpublished literature was conducted using multiple databases. Title, abstract, and full-text screening was conducted by 2 independent clinicians. All discrepancies were resolved during consensus meetings. A total of 182 articles were retrieved. Forty-four articles were removed as duplicates, and 11 articles were added after reviewing prominent studies. After full-text abstraction, 44 articles and 2 conference proceedings (N = 882 patients) were included in the final results. Twelve articles were classified as level II and 34 articles as level IV evidence. Picibanil (OK-432) was the primary agent used in most included studies. Postinjection symptoms with OK-432 were primarily fever, swelling, and erythema at the site. Life-threatening complications were uncommon and involved postinjection swelling of cervical lesions causing airway compromise. The literature regarding sclerotherapy for lymphatic malformations is of a low level of evidence and suffers from a lack of standardization. Randomized clinical trials focused on OK-432, bleomycin, or alcoholic solution of zein; standardized dosing protocols; and consistent and reliable outcome reporting will be necessary for further development of treatment guidelines. Copyright © 2011 Elsevier Inc. All rights reserved.

  12. Intrapleural chemo- and hyperthermotherapies for malignant pleural effusion: a randomized prospective study.

    Science.gov (United States)

    Chen, Wen-Jun; Yuan, Shao-Fei; Yan, Qing-Yuan; Xiong, Jian-Ping; Wang, Sen-Ming; Zheng, Wei-E; Zhang, Wu; Sun, Hong-Yu; Chen, Hua; Wu, Li-Li

    2012-02-01

    The current prospective randomized study was designed to evaluate the safety and efficacy of combined intrapleural cisplatin and OK-432 (picibanil) plus hyperthermotherapy in patients with malignant pleural effusion (MPE). A total of 358 patients with MPE due to end-stage malignancies were enrolled and randomly divided into two groups, A and B: the intrapleural combination of cisplatin and OK-432 with hyperthermotherapy (n = 179) or without hyperthermotherapy (n = 179), respectively. Mild toxicities such as nausea, vomiting or anorexia, bone marrow depression, and pyrexia were similar in both groups. Patients in Group A (with hyperthermotherapy) showed a significantly higher overall response (93.4%) compared to those in Group B (79.8%, χ(2) = 43.11, p .05). After treatment, the quality of life scores were significantly increased in both groups as compared to prior treatment (p < .05). In conclusion, our study suggests that combined intrapleural cisplatin and OK-432 followed by hyperthermotherapy are more effective in the control of MPE and improve patients' quality of life.

  13. Microbubbles in macrocysts - Contrast-enhanced ultrasound assisted sclerosant therapy of a congenital macrocystic lymphangioma: a case report.

    Science.gov (United States)

    Menendez-Castro, Carlos; Zapke, Maren; Fahlbusch, Fabian; von Goessel, Heiko; Rascher, Wolfgang; Jüngert, Jörg

    2017-07-06

    Congenital cystic lymphangiomas are benign malformations due to a developmental disorder of lymphatic vessels. Besides surgical excision, sclerosant therapy of these lesions by intracavitary injection of OK-432 (Picibanil®), a lyophilized mixture of group A Streptococcus pyogenes, is a common therapeutical option. For an appropriate application of OK-432, a detailed knowledge about the structure and composition of the congenital cystic lymphangioma is essential. SonoVue® is a commercially available contrast agent commonly used in sonography by intravenous and intracavitary application. Here we report the case of 2 month old male patient with a large thoracic congenital cystic lymphangioma. Preinterventional imaging of the malformation was performed by contrast-enhanced ultrasound after intracavitary application of SonoVue® immediately followed by a successful sclerotherapy with OK-432. Contrast agent-enhanced ultrasound imaging offers a valuable option to preinterventionally clarify the anatomic specifications of a congenital cystic lymphangioma in more detail than by single conventional sonography. By the exact knowledge about the composition and especially about the intercystic communications of the lymphangioma sclerosant therapy becomes safer and more efficient.

  14. Inside-out signaling promotes dynamic changes in the carcinoembryonic antigen-related cellular adhesion molecule 1 (CEACAM1) oligomeric state to control its cell adhesion properties.

    Science.gov (United States)

    Patel, Prerna C; Lee, Hannah S W; Ming, Aaron Y K; Rath, Arianna; Deber, Charles M; Yip, Christopher M; Rocheleau, Jonathan V; Gray-Owen, Scott D

    2013-10-11

    Cell-cell contacts are fundamental to multicellular organisms and are subject to exquisite levels of control. The carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) can engage in both cis-homophilic (parallel) oligomerization and trans-homophilic (anti-parallel) binding. In this study, we establish that the CEACAM1 transmembrane domain has a propensity to form cis-dimers via the transmembrane-embedded (432)GXXXG(436) motif and that this basal state is overcome when activated calmodulin binds to the CEACAM1 cytoplasmic domain. Although mutation of the (432)GXXXG(436) motif reduced CEACAM1 oligomerization, it did not affect surface localization of the receptor or influence CEACAM1-dependent cellular invasion by the pathogenic Neisseria. The mutation did, however, have a striking effect on CEACAM1-dependent cellular aggregation, increasing both the kinetics of cell-cell association and the size of cellular aggregates formed. CEACAM1 association with tyrosine kinase c-Src and tyrosine phosphatases SHP-1 and SHP-2 was not affected by the (432)GXXXG(436) mutation, consistent with their association with the monomeric form of wild type CEACAM1. Collectively, our results establish that a dynamic oligomer-to-monomer shift in surface-expressed CEACAM1 facilitates trans-homophilic binding and downstream effector signaling.

  15. Physical, Chemicals and Flavors of Some Varieties of Arabica Coffee

    Directory of Open Access Journals (Sweden)

    Yusianto .

    2014-08-01

    Full Text Available Export of Arabica coffee was 28,100 tons/year or 8.28% total export of Indonesian coffee, most of them are specialty coffee. Beside their origin, variety and determine the of physical, chemical and flavors characters. The promising clones or varieties i.e. BP 416A, BP 418A, BP 430A, BP 431A, BP 432A, BP 507A, BP 508A, BP 509A, BP 511A, BP 513A, BP 516A, BP 517A and BP 518A still not be determined their quality This research was conducted to analyze their physicals, chemicals and flavors during 2 periods of harvesting (2004 and 2005, using AS 1, S 795 and USDA 762 as the control. Mature coffee berry was harvested, sorted manually, and depulped, cleaned manually and then fermented in plastic sacks during 36 hours. The fermented parchment was washed, and then sun dried, dehulled to get green coffee. Observations wre conducted on green coffee yield, husk content, color of green coffee, distribution of size, bulk density of green and roasted coffee, roasting characters, color of roasted beans, and pH, acidity and flavors. The results showed (a The lowest content of husk was BP 432A and the highest was USDA 762. The control varieties of AS 1, S 795 and USDA 762, showed husk content >15%, while those potential varieties were < 15% except BP 416A. (b Beans size >6,5 mm and more than 80% were BP 416A, BP 430A, BP 432A, BP 509A, P 88 and S 795. Green coffee of BP 430A, BP 432A and BP 509A were uniform, but S 795 was not uniform. AS 1 and BP 416A and P 88 was one group; S 795 was one group with BP 542A; BP 509 was a group with BP 432A; but BP4 30A and USDA 762 were the other groups. (c Green coffee of USDA 762 was the palest color, but BP 542A was the darkest color. AS 1 and S 795 were a group with all potential varieties, except BP 542A. (d Roasted coffee of USDA 762 was the palest color and AS 1 was the darkest. In this case, AS 1 was a group with BP 430A, BP 509A and P 88, while S 795 was a group with BP 416A and BP 432A, but USDA 762 and BP 542A were

  16. A Novel Supra-Brow Combined with Infra-Brow Lift Approach for Asian Women.

    Science.gov (United States)

    Shu, Maoguo; He, Lin; Su, Yingjun; Shi, Junli; Zhang, Xi; Liu, Xiangyu; Yu, Xueyuan

    2016-06-01

    Direct brow lift surgery remains popular among Asian women despite its disadvantages. The traditional direct brow lift by a supra-brow incision is not suitable for Asian women because of their unique facial features, such as higher eyebrows, wider upper eyelids, and more orbital fat. Therefore, we designed a novel brow lift technique via a supra-brow combined with an infra-brow approach for Asian women. An area of skin above and below the eyebrow was measured, demarcated, and surgically removed. The redundant orbicularis oculi muscle (OOM) was excised while keeping the frontalis muscle intact. The OOM in the inferior flap was elevated and sutured to the frontalis muscle. In cases of puffy eyelids, orbital fat was partially removed through an infra-brow incision. Finally, a series of modifications were performed to reduce post-operative scarring. A total of 496 patients underwent this surgery from July 2009 to December 2013 and 432 patients were followed up for at least 6 months after surgery. Post-operative scars, in most patients (428/432), were inconspicuous. There were no facial nerve injuries documented and eight patients reported transient forehead numbness. The height of the palpebral fissure was increased but there was no marked increase observed of the distance between the upper eyelid edge and the eyebrow. In follow-up visits, 409 out of 432 patients (94.7 %) were satisfied with their surgical results. This new brow lift technique via a supra-brow combined with an infra-brow approach provided a simple and safe surgical repair of lateral brow ptosis, upper eyelids hooding, and crows' feet in Asian women. The surgical outcomes were predictable and the scars were inconspicuous. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .

  17. Genome-scale metabolic analysis of Clostridium thermocellum for bioethanol production

    Directory of Open Access Journals (Sweden)

    Brooks J Paul

    2010-03-01

    Full Text Available Abstract Background Microorganisms possess diverse metabolic capabilities that can potentially be leveraged for efficient production of biofuels. Clostridium thermocellum (ATCC 27405 is a thermophilic anaerobe that is both cellulolytic and ethanologenic, meaning that it can directly use the plant sugar, cellulose, and biochemically convert it to ethanol. A major challenge in using microorganisms for chemical production is the need to modify the organism to increase production efficiency. The process of properly engineering an organism is typically arduous. Results Here we present a genome-scale model of C. thermocellum metabolism, iSR432, for the purpose of establishing a computational tool to study the metabolic network of C. thermocellum and facilitate efforts to engineer C. thermocellum for biofuel production. The model consists of 577 reactions involving 525 intracellular metabolites, 432 genes, and a proteomic-based representation of a cellulosome. The process of constructing this metabolic model led to suggested annotation refinements for 27 genes and identification of areas of metabolism requiring further study. The accuracy of the iSR432 model was tested using experimental growth and by-product secretion data for growth on cellobiose and fructose. Analysis using this model captures the relationship between the reduction-oxidation state of the cell and ethanol secretion and allowed for prediction of gene deletions and environmental conditions that would increase ethanol production. Conclusions By incorporating genomic sequence data, network topology, and experimental measurements of enzyme activities and metabolite fluxes, we have generated a model that is reasonably accurate at predicting the cellular phenotype of C. thermocellum and establish a strong foundation for rational strain design. In addition, we are able to draw some important conclusions regarding the underlying metabolic mechanisms for observed behaviors of C. thermocellum

  18. The structural revision of piericidin A by combination of CMR spectroscopic and biosynthetic studies

    International Nuclear Information System (INIS)

    Yoshida, Shigeo; Shiraishi, Shiro; Takahashi, Nobutaka

    1977-01-01

    The structure of piericidin A was reexamined by means of the CMR spectroscopy and the 13 C feeding studies, and the structure Ia was revised to IIa. This structure was further confirmed by the selective reduction of PA and by the mass spectral analysis. Twelve signals due to sp 3 carbons were readily assigned by selective 13 C-H decoupling technique. On the other hand, assignment of five signals due to sp 2 carbons carrying a proton could not be done by the technique because five olefinic protons appear in a narrow region in the PMR spectrum of PA. This problem was solved by the introduction of ''the graphical decoupling method''. Notwithstanding that the assignment of residual signals due to eight substituted sp 2 carbons, C-3, C-7, C-11 and the piridine carbons, could not be made at this stage, the analysis of the CMR spectrum of PA afforded enough information on the recognition of two carbons in question, C-4 and C-6. Thus the signals at delta 43.2 and delta 135.9 should be assigned to C-6 and C-4 in Ia, or C-4 and C-6 in IIa respectively. Then the feeding experiments of sodium acetate-1-13C were carried out. The spectrum of 13 C-enriched PA by acetate-1- 13 C shows a clear intensified signal at delta 43.2. On the other hand, another signal at delta 135.9 was enhanced by the feeding of propionate-1- 13 C. Obviously, these evidences indicate that the signal at delta 43.2 should be assigned to C-4 and that at delta 135.9 to C-6. Therefore, IIa represents the correct structure of PA, excluding Ia. (Iwakiri, K.)

  19. Evaluation of SNP Data from the Malus Infinium Array Identifies Challenges for Genetic Analysis of Complex Genomes of Polyploid Origin.

    Directory of Open Access Journals (Sweden)

    Michela Troggio

    Full Text Available High throughput arrays for the simultaneous genotyping of thousands of single-nucleotide polymorphisms (SNPs have made the rapid genetic characterisation of plant genomes and the development of saturated linkage maps a realistic prospect for many plant species of agronomic importance. However, the correct calling of SNP genotypes in divergent polyploid genomes using array technology can be problematic due to paralogy, and to divergence in probe sequences causing changes in probe binding efficiencies. An Illumina Infinium II whole-genome genotyping array was recently developed for the cultivated apple and used to develop a molecular linkage map for an apple rootstock progeny (M432, but a large proportion of segregating SNPs were not mapped in the progeny, due to unexpected genotype clustering patterns. To investigate the causes of this unexpected clustering we performed BLAST analysis of all probe sequences against the 'Golden Delicious' genome sequence and discovered evidence for paralogous annealing sites and probe sequence divergence for a high proportion of probes contained on the array. Following visual re-evaluation of the genotyping data generated for 8,788 SNPs for the M432 progeny using the array, we manually re-scored genotypes at 818 loci and mapped a further 797 markers to the M432 linkage map. The newly mapped markers included the majority of those that could not be mapped previously, as well as loci that were previously scored as monomorphic, but which segregated due to divergence leading to heterozygosity in probe annealing sites. An evaluation of the 8,788 probes in a diverse collection of Malus germplasm showed that more than half the probes returned genotype clustering patterns that were difficult or impossible to interpret reliably, highlighting implications for the use of the array in genome-wide association studies.

  20. Evaluación de competencias básicas en TIC en docentes de educación superior en México

    OpenAIRE

    Vera Noriega, José Ángel; Torres Moran, Lilia Elisa; Martínez García, Edgar Emmanuel

    2014-01-01

    Este estudio evaluó las competencias básicas en TIC de docentes en Educación Superior en México, la muestra se integró por 432 docentes. Los datos se obtuvieron a través de un instrumento de medida basado en el modelo "Estándares UNESCO de Competencias en TIC para Docentes 2008". Entre los resultados destacó que los docentes poseen un dominio de moderado a moderado alto de las TIC, asimismo, después de los análisis ANOVA y las pruebas t de Student, se encontró que los factores como correo ele...