WorldWideScience

Sample records for alloy-ehi 432

  1. 7 CFR 1980.432 - Environmental requirements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Environmental requirements. 1980.432 Section 1980.432...) PROGRAM REGULATIONS (CONTINUED) GENERAL Business and Industrial Loan Program § 1980.432 Environmental... will review Form FmHA or its successor agency under Public Law 103-354 1940-20, “Request...

  2. 20 CFR 702.432 - Debarment process.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Debarment process. 702.432 Section 702.432 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR LONGSHOREMEN'S AND HARBOR... § 702.432 Debarment process. (a) Pertaining to health care providers. Upon receipt of...

  3. 5 CFR 551.432 - Sleep time.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Sleep time. 551.432 Section 551.432... FAIR LABOR STANDARDS ACT Hours of Work Special Situations § 551.432 Sleep time. (a) Except as provided in paragraph (b) of this section, bona fide sleep time that fulfills the following conditions...

  4. 16 CFR 432.4 - Optional disclosures.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Optional disclosures. 432.4 Section 432.4 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES POWER OUTPUT CLAIMS FOR AMPLIFIERS UTILIZED IN HOME ENTERTAINMENT PRODUCTS § 432.4 Optional disclosures. Other operating characteristics...

  5. 16 CFR 432.5 - Prohibited disclosures.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Prohibited disclosures. 432.5 Section 432.5 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES POWER OUTPUT CLAIMS FOR AMPLIFIERS UTILIZED IN HOME ENTERTAINMENT PRODUCTS § 432.5 Prohibited disclosures. No performance characteristics...

  6. 46 CFR 153.432 - Cooling systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Cooling systems. 153.432 Section 153.432 Shipping COAST... Control Systems § 153.432 Cooling systems. (a) Each cargo cooling system must have an equivalent standby... cooling system. (b) Each tankship that has a cargo tank with a required cooling system must have a...

  7. Dicty_cDB: SSG432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG432 (Link to dictyBase) - - - Contig-U13979-1 SSG432Z (Link... to Original site) - - SSG432Z 649 - - - - Show SSG432 Library SS (Link to library) Clone ID SSG432 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSG4-B/SSG432Q.Seq.d/ Representative seq. ID SSG43...2Z (Link to Original site) Representative DNA sequence >SSG432 (SSG432Q) /CSM/SS/SSG4-B/SSG432Q.Seq.d/ XXXXX... Amino Acid sequence ---YVPDIGIVVSSSFFGSWIFVAGIEQFIGTGFPNPMVVLFNRDWDRLVVIEESAFLEC LLVCSIMLTSLLIQIKTLVPSSNEVQ

  8. Dicty_cDB: SSA432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA432 (Link to dictyBase) - - - Contig-U01120-1 SSA432F (Link to Original site) SS...A432F 290 - - - - - - Show SSA432 Library SS (Link to library) Clone ID SSA432 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA432Q.Seq.d/ Representative seq. ID SSA43...2F (Link to Original site) Representative DNA sequence >SSA432 (SSA432Q) /CSM/SS/SSA4-B/SSA432Q.Seq.d/ GTAAA...LRGANLHKANLIG VNLKGANFDIRTVSSR*f*kkkni*fni*iqlqyiy--- Translated Amino Acid seque

  9. Dicty_cDB: CHR432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR432 (Link to dictyBase) - G21938 DDB0187836 Contig-U11942-1 CHR...432P (Link to Original site) CHR432F 688 CHR432Z 654 CHR432P 1322 - - Show CHR432 Library CH (Link to library) Clone ID CHR...Contig-U11942-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR4-B/CHR...432Q.Seq.d/ Representative seq. ID CHR432P (Link to Original site) Representative DNA sequence >CHR432 (CHR432Q) /CSM/CH/CHR...4-B/CHR432Q.Seq.d/ AATATTATAAAAATGGTTTTAACATTGAAAGAATTAATTAATAATATTTGTCAAACTAAA GATATAA

  10. 46 CFR 183.432 - Emergency lighting.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Lighting Systems § 183.432 Emergency lighting. (a) Each vessel must have adequate... accommodation spaces located below the main deck. (b) The emergency lighting required by paragraph (a) of...

  11. 16 CFR 432.2 - Required disclosures.

    Science.gov (United States)

    2010-01-01

    ... UTILIZED IN HOME ENTERTAINMENT PRODUCTS § 432.2 Required disclosures. (a) Whenever any direct or indirect... sound power amplification equipment in any product brochure or manufacturer specification sheet,...

  12. 16 CFR 432.1 - Scope.

    Science.gov (United States)

    2010-01-01

    ... HOME ENTERTAINMENT PRODUCTS § 432.1 Scope. (a) Except as provided in paragraph (b) of this section... entertainment purposes, such as for example, radios, record and tape players, radio-phonograph and/or...

  13. 40 CFR 432.1 - General Applicability.

    Science.gov (United States)

    2010-07-01

    ... products for human consumption and/or animal food and feeds. Meat and poultry products for human consumption include meat and poultry from cattle, hogs, sheep, chickens, turkeys, ducks and other fowl as well... STANDARDS MEAT AND POULTRY PRODUCTS POINT SOURCE CATEGORY § 432.1 General Applicability. As defined...

  14. 7 CFR 28.432 - Middling Tinged Color.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Middling Tinged Color. 28.432 Section 28.432... REGULATIONS COTTON CLASSING, TESTING, AND STANDARDS Standards Tinged Cotton § 28.432 Middling Tinged Color. Middling Tinged Color is color which is within the range represented by a set of samples in the custody...

  15. 10 CFR 35.432 - Calibration measurements of brachytherapy sources.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Calibration measurements of brachytherapy sources. 35.432 Section 35.432 Energy NUCLEAR REGULATORY COMMISSION MEDICAL USE OF BYPRODUCT MATERIAL Manual Brachytherapy § 35.432 Calibration measurements of brachytherapy sources. (a) Before the first medical use of...

  16. 42 CFR 432.55 - Reporting training and administrative costs.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Reporting training and administrative costs. 432.55 Section 432.55 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS STATE PERSONNEL ADMINISTRATION Staffing and Training Expenditures § 432.55 Reporting training...

  17. 48 CFR 432.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.202-4 Section 432.202-4 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 432.202-4 Security for Government financing. Prior to determining that an offeror's financial condition is...

  18. 48 CFR 432.003 - Simplified acquisition procedures financing.

    Science.gov (United States)

    2010-10-01

    ... procedures financing. 432.003 Section 432.003 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.003 Simplified acquisition procedures financing. (a) The chief of the contracting office may approve contract financing on a contract to...

  19. 48 CFR 432.113 - Customary contract financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing....

  20. 40 CFR 60.432 - Standard for volatile organic compounds.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for volatile organic compounds. 60.432 Section 60.432 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Graphic Arts Industry: Publication Rotogravure Printing § 60.432 Standard for volatile organic...

  1. 49 CFR 172.432 - INFECTIOUS SUBSTANCE label.

    Science.gov (United States)

    2010-10-01

    ... § 172.407, the background on the INFECTIOUS SUBSTANCE label must be white. ... 49 Transportation 2 2010-10-01 2010-10-01 false INFECTIOUS SUBSTANCE label. 172.432 Section 172... REQUIREMENTS, AND SECURITY PLANS Labeling § 172.432 INFECTIOUS SUBSTANCE label. (a) Except for size and...

  2. 20 CFR 410.432 - Cessation of disability.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Cessation of disability. 410.432 Section 410..., TITLE IV-BLACK LUNG BENEFITS (1969- ) Total Disability or Death Due to Pneumoconiosis § 410.432 Cessation of disability. (a) Where it has been determined that a miner is totally disabled under §...

  3. Percutaneous Sclerotherapy With OK-432 of a Cervicomediastinal Lymphangioma.

    Science.gov (United States)

    Golinelli, Gloria; Toso, Andrea; Borello, Giovanni; Aluffi, Paolo; Pia, Francesco

    2015-11-01

    The present study reports a case of percutaneous sclerotherapy of a giant cystic cervicomediastinal lymphangioma using OK-432. To the best of our knowledge, percutaneous sclerotherapy of a mediastinal lymphangioma using OK 432 has not previously been reported in the English literature. PMID:26522530

  4. 48 CFR 432.406 - Letters of credit.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Letters of credit. 432.406... REQUIREMENTS CONTRACT FINANCING Advance Payments for Non-Commercial Items 432.406 Letters of credit. The HCA is... of credit....

  5. 16 CFR 432.6 - Liability for violation.

    Science.gov (United States)

    2010-01-01

    ... UTILIZED IN HOME ENTERTAINMENT PRODUCTS § 432.6 Liability for violation. If the manufacturer or, in the..., of any product covered by this part furnishes the information required or permitted under this part, then any other seller of the product shall not be deemed to be in violation of § 432.5 of this part...

  6. Dicty_cDB: CHO432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHO432 (Link to dictyBase) - - - Contig-U16524-1 CHO432P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  7. Dicty_cDB: SFB432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFB432 (Link to dictyBase) - - - Contig-U14178-1 SFB432F (Link to Original ... 11-3L8 on chromosome 9 Contains the TYRP1 gene for tyrosinase -related protein 1 and part of a putative novel gen ...

  8. CAD/CAM system based upon the IAPX 432

    Energy Technology Data Exchange (ETDEWEB)

    Criscione, D.J.

    1983-01-01

    The Intel Corporation has developed a 32 bit microprocessor which provides hardware support for object oriented applications, accommodates concurrent processing in a manner invisible to the user, and allows easy interfacing to peripherals. These features, along with numerous others that have never been offered before in a microprocessor, makes the IAPX 432 an attractive base for CAD/CAM. The author outlines one possible implementation of a CAD/CAM system with the 432 at its heart. The advantages offered by the 432 are weighed against its limitations. 5 references.

  9. 16 CFR 432.3 - Standard test conditions.

    Science.gov (United States)

    2010-01-01

    ... AMPLIFIERS UTILIZED IN HOME ENTERTAINMENT PRODUCTS § 432.3 Standard test conditions. For purposes of..., unless a different nameplate rating is permanently affixed to the product by the manufacturer in...

  10. 46 CFR 197.432 - Surface-supplied air diving.

    Science.gov (United States)

    2010-10-01

    ... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Specific Diving Mode Procedures § 197.432 Surface..., another diver is stationed at the underwater point of entry and is line-tending the diver; (e) For...

  11. Dicty_cDB: VHA432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA432 (Link to dictyBase) - - - Contig-U11277-1 VHA432P (Link to Original ... hizosaccharomyces pombe phosphatidate phosphatase (TPP ) mRNA, partial cds. 50 0.082 1 D89225 |D89225.1 Sc ... 2 1 AJ242743 |AJ242743.1 Schizosaccharomyces pombe tpp 1+ gene for trehalose-6P phosphatase, exon 1. 50 0. ...

  12. 48 CFR 432.114 - Unusual contract financing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Unusual contract financing... CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.114 Unusual contract financing. The HCA is authorized to approve unusual contract financing. The signed determination and...

  13. 48 CFR 432.007 - Contract financing payments.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contract financing... CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.007 Contract financing payments. The HCA may prescribe, on a case-by-case basis, a shorter period for financing payments....

  14. 37 CFR 1.432 - Designation of States by filing an international application.

    Science.gov (United States)

    2010-07-01

    ... filing an international application. 1.432 Section 1.432 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES International Processing Provisions The International Application § 1.432 Designation of States by filing...

  15. Development of a high-power 432 MHz DTL

    International Nuclear Information System (INIS)

    A high-power model of a 432 MHz Drift-Tube Linac is under construction. It will accelerate H- ions from 3 to 5.4 MeV, and is a prototype of the DTL for the Japanese Hadron Project. Several new techniques have been developed for constructing the DTL: fabricating and assembling methods of permanent quadrupole magnet and a drift tube, alignment of the drift tube, and a method of connecting the tanks. (Author) 6 refs., 5 figs

  16. Effect of OK-432 on hemopoietic stem cells in normal and irradiated mice

    International Nuclear Information System (INIS)

    The effect of OK-432 on the hemopoietic stem cells was investigated using in vitro colony and spleen colony methods. Intravenous administration of 1 KE of OK-432 into BDF1 mice resulted in significant increase in the number of bone marrow and spleen CFU-c and spleen CFU-s. On the other hand, bone marrow CFU-s did not increase after the injection of OK-432. Marked recovery of CFU-s in femoral bone marrow and spleen was observed in 300 R whole-body irradiated mice by treatment with OK-432. Clinical value of these results as a hemopoietic stimulator is discussed. (author)

  17. Effects of OK-432 (picibanil) on the estrogen receptors of MCF-7 cells and potentiation of antiproliferative effects of tamoxifen in combination with OK-432.

    Science.gov (United States)

    Aoyagi, H; Iino, Y; Takeo, T; Horii, Y; Morishita, Y; Horiuchi, R

    1997-01-01

    OK-432 (picibanil), a streptococcal preparation, has a strong biological response modifier (BRM) function and is expected to produce clinical improvement and prolongation of survival in treated cancer patients in Japan. We were interested in whether OK-432 augments estrogen receptor (ER) levels in breast cancer. To investigate the effect of the BRMs on cellular growth and the characteristics of ER and progesterone receptors (PgR) in the human breast cancer cell line MCF-7, we used OK-432, Krestin (PSK), a protein-bound polysaccharide extracted from Coriolus versicolor, and lentinan, a fungal branched (1...3)-beta-D-glycan. OK432 and PSK dose dependently inhibited DNA synthesis of MCF-7 cells, and the 50% inhibitory concentrations of OK-432 and PSK were 1.2 KE (klinische Einheit, clinical unit)/ml and 200 micrograms/ml, respectively. Lentinan showed no direct anticancer effect in vitro. We found that OK-432 induced a 2-fold increase in ER levels in MCF-7 cells at 0.005 KE/ml, but not in PgR. Lentinan and low-dose PSK did not change ER or PgR levels, but high-dose PSK decreased ER and PgR. We also studied the combined effect of OK-432 and antiestrogens, tamoxifen (TAM) and DP-TAT-59. The combined treatment with OK-432 and TAM showed an additive inhibitory effect on MCF-7 cells. These results suggest that OK-432 may augment the therapeutic effect of TAM in breast cancer. PMID:9260604

  18. 48 CFR 432.006 - Reduction or suspension of contract payments upon finding of fraud.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reduction or suspension of contract payments upon finding of fraud. 432.006 Section 432.006 Federal Acquisition Regulations System... of contract payments upon finding of fraud....

  19. 27 CFR 4.32a - Voluntary disclosure of major food allergens.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Voluntary disclosure of major food allergens. 4.32a Section 4.32a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE...

  20. 27 CFR 4.32b - Petitions for exemption from major food allergen labeling.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Petitions for exemption from major food allergen labeling. 4.32b Section 4.32b Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF...

  1. Dicty_cDB: VHB432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rf1, phnA1b, phnA1, phnA2, phnC, trpB, orf7, phnA4, phnA3 and phnD genes for hypothetical protein, aromatic dioxygenase large subunit...AC clone BACR01N09, complete sequence. 36 9.5 1 AB036703 |AB036703.1 Patinopecten yessoensis SCP-b gene for sarcoplasmic calcium-bin..., PAH dioxygenase iron sulfer protein large subunit, PAH dioxygen...ase iron sulfer protein small subunit, extradiol dioxygenase, tryptophan synthase b subunit, hypothetical protein...VH (Link to library) VHB432 (Link to dictyBase) - - - Contig-U15287-1 - (Link to Original site

  2. Prevention of radiation-induced bacteraemia by post-treatment with OK-432 and aztreonam

    International Nuclear Information System (INIS)

    The effects of combined treatment with OK-432, an immunomodulator prepared from Streptococcus haemolyticus, and aztreonam, a monobactum antibiotic, in the prevention of radiation-induced bacteraemia and mortality were examined in ICR-MCH mice irradiated with 9.5 Gy. The organisms recovered from the irradiated mice were Streptococcus faecalis and Proteus mirabilis. Treatment with aztreonam reduced the incidence of mice infected with Proteus mirabilis (p<0.01), but it showed no efficacy on Streptococcus faecalis. OK-432 could reduce the frequency of bacteraemia attributed to both organisms (p<0.05). Combined treatment with OK-432 and aztreonam further decreased the incidence of bacteraemia by both organisms; no organisms were recovered at 14 days following irradiation. The survival rate at 30 days following irradiation was 80% in mice treated with OK-432 plus aztreonam and 55% with OK-432 alone, while it was 0% in the groups treated with aztreonam or saline alone. These results indicated that combined treatment with OK-432 and a suitable antibiotic such as aztreonam is more effective than OK-432 or aztreonam alone. (Author)

  3. Prevention of radiation-induced bacteraemia by post-treatment with OK-432 and aztreonam

    Energy Technology Data Exchange (ETDEWEB)

    Kurishita, A.; Ono, T. (Tohoku Univ., Sendai (Japan). School of Medicine); Uchida, A. (Kyoto Univ. (Japan). Radiation Biology Center)

    1993-03-01

    The effects of combined treatment with OK-432, an immunomodulator prepared from Streptococcus haemolyticus, and aztreonam, a monobactum antibiotic, in the prevention of radiation-induced bacteraemia and mortality were examined in ICR-MCH mice irradiated with 9.5 Gy. The organisms recovered from the irradiated mice were Streptococcus faecalis and Proteus mirabilis. Treatment with aztreonam reduced the incidence of mice infected with Proteus mirabilis (p<0.01), but it showed no efficacy on Streptococcus faecalis. OK-432 could reduce the frequency of bacteraemia attributed to both organisms (p<0.05). Combined treatment with OK-432 and aztreonam further decreased the incidence of bacteraemia by both organisms; no organisms were recovered at 14 days following irradiation. The survival rate at 30 days following irradiation was 80% in mice treated with OK-432 plus aztreonam and 55% with OK-432 alone, while it was 0% in the groups treated with aztreonam or saline alone. These results indicated that combined treatment with OK-432 and a suitable antibiotic such as aztreonam is more effective than OK-432 or aztreonam alone. (Author).

  4. Biodegradation of Mexel 432 By Bacteria From the Seine River

    International Nuclear Information System (INIS)

    This report deals with a study of the biodegradation of a filmogenic organic product (Mexel 432) usable in the fight against corrosion, scale and fouling, presenting a certain interest in the research of processes enabling a functional and environmental efficiency for the cooling systems of thermal power stations. The study of the degradation of this product is followed by a global colorimetric method. It shows that the product is stable on the long-term in demineralized water. On the other hand, its rate of disappearance in river waters is significant (50 % in 2 or 3 days). In this phenomenon of disappearance, biodegradation seems to play a part. Some bacteria from the natural environment (river Seine) have been isolated. Two of them seem to play a significant part, since they can degrade the product in three weeks. During the degradation, the amines with long chains (more than six carbons) of the Mexel, measured by the colorimetric method, disappear. The other compounds generated by the biodegradation process are not identified. (authors)

  5. OK-432 injection therapy for cystadenocarcinoma of the parotid gland: A case report.

    Science.gov (United States)

    Makiyama, Kiyoshi; Hirai, Ryoji; Iikuni, Fusako; Ikeda, Atsuo; Tomomatsu, Hirotaka

    2016-01-01

    OK-432 is an immunomodulator that has been reported to be efficacious as an injection therapy for cervical lymphomas and ranulas. We performed OK-432 injection therapy to treat a cystadenocarcinoma of the parotid gland in a 72-year-old man. The 50 × 46-mm tumor was located in the deep lobe of the gland. The tumor had compressed the glossopharyngeal, vagus, and hypoglossal nerves, causing neurally mediated syncope, hoarseness, dysphagia, and dysarthria. A concentration of 5 KE/2 ml of OK-432 was injected. Within 2 months, the cyst had disappeared; no recurrence was apparent during 59 months of follow-up. To the best of our knowledge, no previous report has described injection of OK-432 for malignant cystic disease. We describe the injection method, injection dose, and postinjection course in the hope that this information will prove useful for future applications against malignant cystic disease. PMID:27140021

  6. Effects of OK-432 on murine bone marrow and the production of natural killer cells

    International Nuclear Information System (INIS)

    The streptococcal preparation, OK-432, which augments anti-tumor responses in humans and mice, has been shown to be a potent immunomodulator. Among its effects is a pronounced augmentation of natural killer (NK) activity. The hypothesis that OK-432 alters the rates of production and maturation of NK cells in the bone marrow was tested. Studies to determine the kinetic parameters of NK cell production in normal C57BL/6J mice using tritiated thymidine, 3H-TdR, as a DNA marker are described. We are now extending those studies to determine the effect of OK-432 on the bone marrow and on the production of NK cells in the marrow. Initial observations are reported which indicate that OK-432 has profound effects on the cellularity and mitotic activity of the bone marrow, and in particular, on cells with the characteristics of natural killer cells within the marrow. 17 refs., 3 figs., 4 tabs

  7. Tiling 3-uniform hypergraphs with K_4^3-2e

    CERN Document Server

    Czygrinow, Andrzej; Nagle, Brendan

    2011-01-01

    Let K_4^3-2e denote the hypergraph consisting of two triples on four points. For an integer n, let t(n, K_4^3-2e) denote the smallest integer d so that every 3-uniform hypergraph G of order n with minimum pair-degree \\delta_2(G) \\geq d contains \\floor{n/4} vertex-disjoint copies of K_4^3-2e. K\\"uhn and Osthus proved that t(n, K_4^3-2e) = (1 + o(1))n/4 holds for large integers n. Here, we prove the exact counterpart, that for all sufficiently large integers n divisible by 4, t(n, K_4^3-2e) = n/4 when n/4 is odd, and t(n, K_4^3-2e) = n/4+1 when n/4 is even. A main ingredient in our proof is the recent `absorption technique' of R\\"odl, Ruci\\'nski and Szemer\\'edi.

  8. Combination therapy with radiation and OK-432 immunotherapy of cancer patients

    International Nuclear Information System (INIS)

    We treated cancer patients with radiotherapy alone and with radiation plus immunotherapy at the Department of Radiology, Keio University Hospital. In all of the cancer patients who had radiationtherapy alone, a general depression in their immune reactivity was seen, but not seen in those who received radiationtherapy plus immunotherapy. Immunotherapy is defined as a stimulator of cancer patient's immune reaction. Usually radiationtherapy caused lymphopenia in which mainly T lymphocytes were decreased in number selectively, but there was no lymphopenia in cases treated with immunotherapy. We have performed nonspecific immunotherapy with OK-432. The result indicated that T lymphocytes were increased by OK-432 in spite of radiationtherapy. From this fact, OK-432 will be useful for suppression of metastasis and regression of tumors. (auth.)

  9. 40 CFR 432.47 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... application of the best control technology for conventional pollutants (BCT). 432.47 Section 432.47 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  10. 40 CFR 432.13 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... 40 CFR 125.30 through 125.32, any existing point source subject to this subpart that slaughters more... application of the best available technology economically achievable (BAT). 432.13 Section 432.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  11. 40 CFR 432.103 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... application of the best available technology economically achievable (BAT). Except as provided by 40 CFR 125... application of the best available technology economically achievable (BAT). 432.103 Section 432.103 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  12. 40 CFR 432.123 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart that further... application of the best available technology economically achievable (BAT). 432.123 Section 432.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  13. 40 CFR 432.73 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... provided by 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... application of the best available technology economically achievable (BAT). 432.73 Section 432.73 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  14. 40 CFR 432.77 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... application of the best control technology for conventional pollutants (BCT). 432.77 Section 432.77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  15. 40 CFR 432.67 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... application of the best control technology for conventional pollutants (BCT). Except as provided in 40 CFR 125... application of the best control technology for conventional pollutants (BCT). 432.67 Section 432.67 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  16. 40 CFR 432.33 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart that slaughters... application of the best available technology economically achievable (BAT). 432.33 Section 432.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  17. 40 CFR 432.62 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... application of the best practicable control technology currently available (BPT). 432.62 Section 432.62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS...

  18. 40 CFR 432.27 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve the... application of the best control technology for conventional pollutants (BCT). 432.27 Section 432.27 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  19. 40 CFR 432.87 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... application of the best control technology for conventional pollutants (BCT). Except as provided in 40 CFR 125... application of the best control technology for conventional pollutants (BCT). 432.87 Section 432.87 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  20. 40 CFR 432.113 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart that slaughters... application of the best available technology economically achievable (BAT). 432.113 Section 432.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  1. 40 CFR 432.43 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart that slaughters... application of the best available technology economically achievable (BAT). 432.43 Section 432.43 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  2. 40 CFR 432.37 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... application of the best control technology for conventional pollutants (BCT). 432.37 Section 432.37 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  3. 40 CFR 432.63 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... application of the best available technology economically achievable (BAT). Except as provided in 40 CFR 125... application of the best available technology economically achievable (BAT). 432.63 Section 432.63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  4. 40 CFR 432.97 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve the... application of the best control technology for conventional pollutants (BCT). 432.97 Section 432.97 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  5. 40 CFR 432.17 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve the... application of the best control technology for conventional pollutants (BCT). 432.17 Section 432.17 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  6. 40 CFR 432.23 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... 40 CFR 125.30 through 125.32, any existing point source subject to this subpart that slaughters more... application of the best available technology economically achievable (BAT). 432.23 Section 432.23 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  7. 40 CFR 432.83 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... application of the best available technology economically achievable (BAT). Except as provided by 40 CFR 125... application of the best available technology economically achievable (BAT). 432.83 Section 432.83 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  8. 40 CFR 432.93 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve the... application of the best available technology economically achievable (BAT). 432.93 Section 432.93 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  9. 40 CFR 432.57 - Effluent limitations attainable by the application of the best control technology for...

    Science.gov (United States)

    2010-07-01

    ... application of the best control technology for conventional pollutants (BCT). Except as provided in 40 CFR 125... application of the best control technology for conventional pollutants (BCT). 432.57 Section 432.57 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MEAT...

  10. Experimental intraperitoneal infusion of OK-432 in rats: Evaluation of peritoneal complications and pathology

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong Wook [Department of Radiology, Busan Paik Hospital, Inje University College of Medicine, Busan (Korea, Republic of); Kim, Hak Jin, E-mail: hakjink@pusan.ac.k [Department of Radiology, Pusan National University Hospital, Pusan National University College of Medicine, Medical Research Institute, Busan (Korea, Republic of); Lee, Jun Woo [Department of Radiology, Pusan National University Hospital, Pusan National University College of Medicine, Medical Research Institute, Busan (Korea, Republic of)

    2010-06-15

    Purpose: OK-432 is known to be a potent sclerosant of cystic lesions. The purpose of this study was to evaluate both its safety and pathologic effects after the infusion of OK-432 into the peritoneal cavity of rats. Materials and methods: Twenty male rats were used in this study. Twelve rats were infused intraperitoneally with 0.2 Klinishe Einheit of OK-432 melted in 2 mL of normal saline (group 1: the treated group); four rats each were infused intraperitoneally with 0.5 mL of 99% ethanol (group 2) and normal saline (group 3), and served as the control groups. An abdominal ultrasonographic examination was performed both before and after the infusions in all rats. Three rats in group 1 and one rat in each of groups 2 and 3 were sacrificed each week following the infusion. Gross and microscopic evaluations of the peritoneum and abdominal cavity were performed on each rat. Results: In group 1, the abdomen was clear on gross inspection and the peritoneum was unremarkable on microscopic examination. In group 2, mild-to-moderate peritoneal adhesions were revealed grossly, and inflammation and fibrosis of the peritoneum were demonstrated microscopically. In group 3, no specific abnormalities were noted on gross or microscopic examinations. Conclusion: Leakage or abnormal infusion of OK-432 solution into the peritoneal cavity during sclerotherapy of intra-abdominal or retroperitoneal cystic lesions does not result in any significant complications.

  11. Experimental intraperitoneal infusion of OK-432 in rats: Evaluation of peritoneal complications and pathology

    International Nuclear Information System (INIS)

    Purpose: OK-432 is known to be a potent sclerosant of cystic lesions. The purpose of this study was to evaluate both its safety and pathologic effects after the infusion of OK-432 into the peritoneal cavity of rats. Materials and methods: Twenty male rats were used in this study. Twelve rats were infused intraperitoneally with 0.2 Klinishe Einheit of OK-432 melted in 2 mL of normal saline (group 1: the treated group); four rats each were infused intraperitoneally with 0.5 mL of 99% ethanol (group 2) and normal saline (group 3), and served as the control groups. An abdominal ultrasonographic examination was performed both before and after the infusions in all rats. Three rats in group 1 and one rat in each of groups 2 and 3 were sacrificed each week following the infusion. Gross and microscopic evaluations of the peritoneum and abdominal cavity were performed on each rat. Results: In group 1, the abdomen was clear on gross inspection and the peritoneum was unremarkable on microscopic examination. In group 2, mild-to-moderate peritoneal adhesions were revealed grossly, and inflammation and fibrosis of the peritoneum were demonstrated microscopically. In group 3, no specific abnormalities were noted on gross or microscopic examinations. Conclusion: Leakage or abnormal infusion of OK-432 solution into the peritoneal cavity during sclerotherapy of intra-abdominal or retroperitoneal cystic lesions does not result in any significant complications.

  12. Experimental studies on the incidence of metastases after failure of radiotherapy and the effect of salvage surgery with OK-432

    International Nuclear Information System (INIS)

    This study was carried out to determine the effect of OK-432 and salvage surgery on the incidence of lung metastases from regrowing tumor after radiotherapy. NFSA and SANH, spontaneous and poorly immunogenic sarcomas, were isotransplanted in the right thigh of C3H mice. Tumors, grown to 7 mm in diameter, received 30 Gy of electron beam (RTx) either with or without OK-432. NFSA was more radioresistant but developed less spontaneous lung metastases than SANH. When tumor bearing legs were not amputated, the number of lung nodules from NFSA was decreased by OK-432 but the incidence of metastasis was not. On the other hand, OK-432 was not effective for development of metastasis in SANH. Tumor bearing legs were amputated at 7 and 12 mm, and the effect of OK-432 with salvage surgery on development of metastasis was determined. OK-432 could reduce the incidence and number of lung metastases in 12 mm NFSA and 7 mm SANH, however, only number of nodules in 12 mm SANH. These results suggest that OK-432 can decrease the number of metastatic lung nodules, but it is important to remove the recurrent tumor as soon as possible to reduce the incidence of metastasis. (author)

  13. Effect of Picibanil (OK 432 on the Scavenging Effect of Free Radicals Produced during Liver Regeneration in the Rat

    Directory of Open Access Journals (Sweden)

    Okamoto,Ko

    1995-04-01

    Full Text Available We administered a biological response modifier Picibanil (OK-432, attenuated Streptococcus pyogenes, via the dorsal vein of the penis after 70% hepatectomy in rats, and clarified the scavenging effect of Picibanil on free radicals generated in the regenerating liver. A group of 5 rats was intravenously administered with 25 KE/kg of OK-432 after hepatectomy, while the control group was given saline after hepatectomy. Serum levels of aspartate aminotransferase and alanine aminotransferase and the value of thiobarbituric acid-reactive substances in serum and hepatic tissue after hepatectomy were serially measured, and these values were significantly lower in Picibanil treated animals than in control animals. Free radical production in the regenerating liver was also measured by electron spin resonance spectrometry, and OK-432 injection significantly reduced free radical production. These results suggested that OK-432 reduced hepatocellular damage in regenerating liver by inhibiting lipid peroxidation.

  14. Effect of Picibanil (OK 432) on the Scavenging Effect of Free Radicals Produced during Liver Regeneration in the Rat

    OpenAIRE

    Okamoto, Ko; Hamazaki,Keisuke; Iwagaki, Hiromi; Orita,Kunzo; Mori, Akitane

    1995-01-01

    We administered a biological response modifier Picibanil (OK-432), attenuated Streptococcus pyogenes, via the dorsal vein of the penis after 70% hepatectomy in rats, and clarified the scavenging effect of Picibanil on free radicals generated in the regenerating liver. A group of 5 rats was intravenously administered with 25 KE/kg of OK-432 after hepatectomy, while the control group was given saline after hepatectomy. Serum levels of aspartate aminotransferase and alanine aminotransferase and ...

  15. Japanese Encephalitis Virus exploits the microRNA-432 to regulate the expression of Suppressor of Cytokine Signaling (SOCS) 5.

    Science.gov (United States)

    Sharma, Nikhil; Kumawat, Kanhaiya L; Rastogi, Meghana; Basu, Anirban; Singh, Sunit K

    2016-01-01

    Japanese encephalitis virus (JEV) is a plus strand RNA virus, which infects brain. MicroRNAs are regulatory non-coding RNAs which regulate the expression of various genes in cells. Viruses modulate the expression of various microRNAs to suppress anti-viral signaling and evade the immune response. SOCS (Suppressor of cytokine signalling) family of proteins are negative regulators of anti-viral Jak-STAT pathway. In this study, we demonstrated the regulatory role of SOCS5 in Jak-STAT signaling and its exploitation by JEV through a microRNA mediated mechanism. JEV infection in human brain microglial cells (CHME3) downregulated the expression of miR-432, and upregulated SOCS5 levels. SOCS5 was validated as a target of miR-432 by using 3'UTR clone of SOCS5 in luciferase vector along with miR-432 mimic. The overexpression of miR-432 prior to JEV infection enhanced the phosphorylation of STAT1 resulting into increased ISRE activity and cellular inflammatory response resulting into diminished viral replication. The knockdown of SOCS5 resulted into increased STAT1 phosphorylation and suppressed viral replication. JEV infection mediated downregulation of miR-432 leads to SOCS5 upregulation, which helps the virus to evade cellular anti-viral response. This study demonstrated that JEV utilizes this microRNA mediated strategy to manipulate cellular immune response promoting JEV pathogenesis. PMID:27282499

  16. Immunochemotherapy for advanced bladder cancer using FT-207, adriamycin and OK-432.

    Science.gov (United States)

    Mishina, T; Watanabe, H; Fujiwara, T; Kobayashi, T; Maegawa, M; Nakao, M; Nakagawa, S

    1982-10-01

    A combination therapy consisting of daily intrarectal administration of 1,500 mg of FT-207 suppository, daily or every three day bladder instillation of 40 mg adriamycin for a total of 20 applications, and once per week intramuscular administration of 5 KE OK-432 was described. The therapy was performed in 30 cases of advanced bladder cancer. The effectiveness evaluated by Karnofsky's criteria was as follows: 8 cases of 0-0, 2 of 0-A, 1 of 0-B, 2 of 0-C, 7 of 1-A and 10 of 1-B, showing an effective rate of 57%. Local pain was observed in 20 cases (67%), pancytopenia in 1 (3%), hepatitis in 4 (13%), stomatitis in 5 (17%) and anorexia in 6 (20%). From this clinical trial, it is presumed that combination therapy administering FT-207 intrarectally, adriamycin intravesically and OK-432 intramuscularly might be used for the treatment of advanced bladder cancer provided sufficient care is taken of general side effects. PMID:6817468

  17. On the ternary UCu6.68Al4.32 phase

    International Nuclear Information System (INIS)

    Uranium copper aluminide, UCu6.68Al4.32, has been synthesized by arc-melting, followed by annealing at 600 C. The phase belongs to the tetragonal BaCd11-type (space group I41/amd, Pearson symbol tI48, Z = 4, a = 10.2471(4) and c = 6.5883(3) Angstroms, V = 691.78(4) Angstroems3). Electrical resistivity, specific heat and magnetic susceptibility data, measured from room temperature down to ∼3 K do not show any magnetic phase transition. The compound stays in its paramagnetic state, and at high temperatures can be adjusted according to the modified Curie-Weiss model (μeff ∼ 2.7 μB/U-atom). The Sommerfeld value of the specific heat, γ ∼ 98 mJ/molK2, is well above the values derived for simple metallic systems. In this context, with the overall shape of the temperature dependent electrical resistivity, spin fluctuations can be concluded, dominating the ground state behaviour in UCu6.68Al4.32. (authors)

  18. New combined therapy of radiation and local administration of OK-432 for esophageal cancer

    International Nuclear Information System (INIS)

    We devised new combination therapy of radiation and local administration of OK-432 and performed for 26 patients with esophageal cancer between March, 1987 and December, 1988 as a pilot study. The average age was 73 years. Among 26 patients, males were 20 and females were six. Patients were irradiated at the schedule of under 2 Gy/day and the dose of TDF (time, dose and fractionation factor) 100 totally. OK-432, 10KE was endoscopically administered around cancer lesion at the beginning of the radiotherapy, and two weeks later, 5KE was given in the same manner. Complete response was obtained in 20 out of 26 cases (77%) and partial response was obtained in the remaining six cases (23%). All six patients with tumor length less than five cm showed complete response. All 16 patients who could not eat food orally before treatment, became to take food enough orally after the treatment and could discharge in good condition. One year and two years survival rate of 26 patients by Kaplan Meier method were 67.4% and 47.2%, respectively. Six patients with tumor length less than five cm, are all alive without a sign of recurrence. This combination therapy will improve not only the response rate and the survival rate, but also the quality of life of patients with esophageal cancer. (author)

  19. Sublethal responses of the common mussel (Mytilus galloprovincialis) exposed to sodium hypochlorite and Mexel432 used as antifoulants.

    Science.gov (United States)

    López-Galindo, Cristina; Vargas-Chacoff, Luis; Nebot, Enrique; Casanueva, José F; Rubio, Daniel; Mancera, Juan M; Solé, Montserrat

    2010-07-01

    The sublethal effects of two antifoulants currently used in power plant cooling systems were assessed in the common mussel Mytilus galloprovincialis. The concentrations of sodium hypochlorite (NaClO) and an alkyl amine surfactant (Mexel432) assayed, were within the range of those currently discharged by power plants into receiving waters. Enzymatic activities and oxidative stress responses were measured in digestive gland and gill of mussels after 1, 3, 7 and 14 days of exposure, as well as histopathology in gill tissue. Both antifoulants caused a pathological response in gills and the activities of the enzymes glutathione S-transferase, catalase, acetylcholinesterase and the lipid peroxidation levels were also affected. Exposure to NaClO caused a greater toxicological response than Mexel432. In both treatments, gills appeared to be the most affected tissue, although Mexel432 also significantly affected digestive gland parameters. PMID:20106525

  20. Mechanical and RF characteristics for a high-power model of the 432 MHz DTL

    International Nuclear Information System (INIS)

    A high-power model of the 432-MHz Drift Tube Linac (DTL) has been constructed at KEK for the 1-GeV proton linac of the Japanese Hadron Project (JHP). The model is the lowest energy end of the DTL being connected to a RFQ for a beam test. Radio-frequency qualities of the model significantly depend upon the mechanical qualities of the tank. We thus developed a number of new techniques in order to obtain the mechanical qualities. The mechanical and rf characteristics has been measured in order to confirm the properties of the DTL. We discuss the accuracy of the construction and the alignment of the model. We also discuss rf characteristics of the model. (author)

  1. Comparative analysis of pellet-cladding interaction from IFA-431 and IFA-432 Halden reactor tests

    International Nuclear Information System (INIS)

    Two test assemblies containing a total of 12 instrumented fuel rods were irradiated in the HBWR to obtain well-characterized data for fuel operating in the linear heat ranges of commercial nuclear power plants. These data are needed for verification of GAPCON-THERMAL and FRAP computer codes and will provide a series of benchmarks for indexing other thermal performance codes used for reactor safety analysis. Two essentially identical test assemblies, IFA-431 and IFA-432, each containing six instrumented fuel rods, were irradiated under similar conditions. Parameters in the test include pellet-cladding gap size and/or gap eccentricity, fill gas composition, fuel density and stability, linear heat rating, and burnup. The BWR-6 geometry except for length, a 95% theoretical density (TD) pellet, a 0.229 mm (9 mils) diameter gap, and helium fill gas were selected for the reference rod

  2. 17 CFR 4.32 - Trading on a Registered Derivatives Transaction Execution Facility for Non-Institutional Customers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Trading on a Registered... Securities Exchanges COMMODITY FUTURES TRADING COMMISSION COMMODITY POOL OPERATORS AND COMMODITY TRADING ADVISORS Commodity Trading Advisors § 4.32 Trading on a Registered Derivatives Transaction...

  3. 11 CFR 102.12 - Designation of principal campaign committee (2 U.S.C. 432(e) (1) and (3)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Designation of principal campaign committee (2 U.S.C. 432(e) (1) and (3)). 102.12 Section 102.12 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REGISTRATION, ORGANIZATION, AND RECORDKEEPING BY POLITICAL COMMITTEES (2 U.S.C. 433) § 102.12 Designation of principal campaign committee (2...

  4. 韩泰万途仕H432豪华舒适型静音轮胎上市%HanKook Ventus H432 Type of Luxury Cozy Silent Tyre Come into Market

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    @@ 近日,韩泰轮胎推出了专为高级轿车设计的VENTUS S1 noble(万途仕H432豪华舒适型静音轮胎)其凤凰花纹胎面、无孔模具技术、生态合成硅配方等尖端技术,首次被应用于中国市场.

  5. [Treatment of advanced renal cell carcinoma with interferon alpha and OK-432 (streptococcal preparation)].

    Science.gov (United States)

    Shinoda, M; Naide, Y

    1992-11-01

    A total of 12 patients with advanced renal cell carcinoma received interferon alpha (3 million units intramuscularly 6 times weekly) and OK-432 (5 KE (Klinische Einheit) intramuscularly twice weekly). Metastatic lesions appeared before operation in six patients and after operation in six patients. Among them 5 patients had received interferon therapy and this combination therapy was started after the judgment of progressive disease for interferon therapy. Eleven pulmonary and 5 bone metastases were evaluable. The median duration of the combination therapy was 89.3 weeks. There were 4 partial responses and no complete responses among the 12 patients, giving a response rate of 33.3%. The median duration of response was 25 months, with a range of 6 to 54 months. Responses were seen predominantly in patients in whom metastases appeared after operation (3 of 4 responders). However, regarding the individual organs, two complete and 2 partial responses were observed among 11 pulmonary metastases and 2 partial responses among 5 bone metastases. The survival period after discovery of the metastasis was 10 to 67 months and the 5-year survival rate was 70.5%. Almost all patients had fever and induration at the injection site. Other side effects included leukopenia, anorexia, and depression. This combination therapy is thought to be effective against bone or other organs metastasis resistant to interferon alone. PMID:1485585

  6. Data report for the NRC/PNL Halden Assembly IFA-432

    International Nuclear Information System (INIS)

    The report presents the in-reactor data collected from the NRC/PNL Halden Assembly IFA-432 as a part of the program entitled ''Experimental Vertification of Steady State Fuel Codes,'' sponsored by the Fuel Behavior Research Branch of the USNRC. The purpose of this program is to reduce the uncertainties of calculating the thermal stored energy in an operating nuclear fuel rod. The report presents fuel centerline thermocouple readings, cladding elongation monitor readings, rod internal pressure readings, and neutron detector readings. The neutron detector readings were corrected to represent rod local powers at the thermocouple locations. These data are presented in the form of plots of the variables versus time during the portion of the irradiation period from December 1975 to January 1978. Also included are descriptions of the test rationale, assembly and rod designs, test facility, instrument array and calibration, and data processing methods. Topical reports discussing specific aspects and results of the data analysis are referenced. As of May 1978, the assembly burnup had reached its design goal of 20,000 MWd/MTM. However, it has been decided to leave the assembly in core to collect high burnup fission gas release data. The xenon-filled Rod 4 was replaced with the non-instrumented Rod 8 (Rod 1 design) after the first cycle. Six of the twelve original thermocouples, four of the six cladding elongation monitors, all SPND'S and all pressure transducers remain operable at this writing

  7. The modification of radiation therapy by RP-170, hypoxic cell sensitizer, and OK-432, biological response modifier (BRM)

    International Nuclear Information System (INIS)

    Combination therapy with radiation, RP-170 and OK-432, was applied aiming a high therapeutic gain. C3H/HeN mice bearing SCC VII tumors in their legs were irradiated locally 40 min after administration of 200 mg/kg RP-170 orally. OK-432 was administered at 2KE one day before irradiation, at 4KE immediately after irradiation, and 4KE 6 days later. After this multimodal treatment, its TCD50 (the radiation dose to control 50% of irradiated tumor) reduced markedly and as a result, dose modifying factor (DMF) increased to more than 2. Moreover, this combination therapy could reduce the dose of RP-170; radiotherapy with 50 mg/kg RP-170 and OK-432 could produce the same DMF as that from irradiation with 150 mg/kg of RP-170. The higher antitumor effect in this study could also be demonstrated by the significantly increased autologous tumor-cell killing (ATK) activity in tumor infiltrating lymphocyte. (author)

  8. OK-432 reduces mortality and bacterial translocation in irradiated and granulocyte-colony stimulating factor (G-CSF)-treated mice

    Energy Technology Data Exchange (ETDEWEB)

    Nose, Masako; Uzawa, Akiko; Ogyu, Toshiaki [National Inst. of Radiological Sciences, Chiba (Japan); Suzuki, Gen

    2001-06-01

    Acute radiation induces bacterial translocation from the gut, followed by systemic infection and sepsis. In order to reduce the mortality after acute whole body irradiation, it is essential to control bacterial translocation. In this study, we established a bacterial translocation assay as a sensitive method to detect minor mucosal injury by radiation. By utilizing this assay, we evaluated the adverse effects, if any, of hematopoietic reagents on the mucosal integrity in the respiratory and gastro-intestinal tracts. Bacterial translocation to the liver and spleen occurred after whole-body irradiation if the dose exceeded 6 Gy. The administration of G-CSF unexpectedly increased the bacterial translocation in 8 Gy-irradiated mice. The pharmaceutical preparation of low-virulent Streptococcus pyogenes, OK-432, significantly reduced the endotoxin levels in peripheral blood without any reduction of bacterial translocation. A combined treatment with G-CSF and OK-432 decreased bacterial translocation and prevented death. This result indicates that the early administration of G-CSF has an adverse effect on bacterial translocation, and that a combined treatment of G-CSF and OK-432 attenuates the adverse effect of G-CSF and improves the survival rate after acute irradiation. (author)

  9. OK-432 reduces mortality and bacterial translocation in irradiated and granulocyte-colony stimulating factor (G-CSF)-treated mice

    International Nuclear Information System (INIS)

    Acute radiation induces bacterial translocation from the gut, followed by systemic infection and sepsis. In order to reduce the mortality after acute whole body irradiation, it is essential to control bacterial translocation. In this study, we established a bacterial translocation assay as a sensitive method to detect minor mucosal injury by radiation. By utilizing this assay, we evaluated the adverse effects, if any, of hematopoietic reagents on the mucosal integrity in the respiratory and gastro-intestinal tracts. Bacterial translocation to the liver and spleen occurred after whole-body irradiation if the dose exceeded 6 Gy. The administration of G-CSF unexpectedly increased the bacterial translocation in 8 Gy-irradiated mice. The pharmaceutical preparation of low-virulent Streptococcus pyogenes, OK-432, significantly reduced the endotoxin levels in peripheral blood without any reduction of bacterial translocation. A combined treatment with G-CSF and OK-432 decreased bacterial translocation and prevented death. This result indicates that the early administration of G-CSF has an adverse effect on bacterial translocation, and that a combined treatment of G-CSF and OK-432 attenuates the adverse effect of G-CSF and improves the survival rate after acute irradiation. (author)

  10. 432例急诊心肺复苏患者回顾性分析

    Institute of Scientific and Technical Information of China (English)

    郭感恩

    2006-01-01

    目的了解本院急诊科10年来急诊心肺复苏(CPR)状况,探讨如何进一步提高院内心肺复苏的水平.方法对1995~2004年在本院急诊科(包括ICU)、门诊就诊时发生心脏骤停(cardiac arrest,CA)并在急诊科进行抢救、记录完整的432例患者资料进行院内CPR回顾性研究.对病例数量、疾病种类、CPR相关时间、2h CPR成功率、24h存活率及脑复苏成功率等方面的数据进行统计、分析.结果CPR病例数量逐年上升;心血管病、脑血管病患者仍为CPR主要对象,创伤后CPR患者逐年增多;CA时间大于10min者CPR成功率明显低于10min内开始CPR者(P<0.01);CPR持续时间与CPR成功率、脑复苏成功率间无关联(P>0.05);早期电除颤者复苏成功率高;全部病例CPR成功率为41.4%,24h生存率为7.2%;脑复苏成功率仅为3.5%.结论CPR成功率与疾病种类、CA后开始CPR时间、早期电除颤等相关;脑复苏成功率仍极低.

  11. 432例女性不孕患者抗精子抗体和抗子宫内膜抗体检测分析%Detection and analysis of antisperm antibody and antiendometrial antibody in 432 female infertile patients

    Institute of Scientific and Technical Information of China (English)

    李仁良; 夏淑琦; 朱丽丹; 王悦华

    2012-01-01

    目的:探讨抗精子抗体(AsAb)、抗子宫内膜抗体(EMAb)检测在女性不孕中的检测意义.方法:选取432例女性不孕患者为女性不孕组,88例正常孕妇为对照组,采用ELISA法对所有受试者血清检测AsAb总抗体、EMAb总抗体,同时与对照组作对比分析.结果:不孕组抗精子总抗体(AsAb)的阳性率为13.2%( 57/432),对照组抗精子总抗体阳性率为4.6%(4/88),经统计学处理,两组差异有显著性(x2=5.28,P<0.05);EMAb总抗体检测不孕组总阳性率为15.2% (66/432),对照组阳性率为6.8%(6/88),两组差异有显著性(x2=4.39,P<0.05).结论:AsAb、EMAb与女性不孕密切相关,高水平的AsAb、EMAb可能是女性不孕的一个重要因素;AsAb、EMAb检测有必要列为女性不孕检查的一项常规项目.%Objective:To explore the detection value of antisperm antibody ( AsAb) and antiendometrial antibody (EmAb) in female infertile patients. Methods: 432 female infertile patients as infertility group,and 88 pregnant women as normal comparison group were involved, AsAb and EmAb in serum of both groups were determined by ELISA and the results of two groups were compared and analyzed. Results: Positive rate of AsAb in female infertility group accounted for 13. 2% (57/432) , that of normal comparison group was 4. 6% (4/88) , the difference of two groups had significant difference by statistical analysis(χ =5. 28 ,P <0. 05 ) . The positive rate of EmAb in female infertility group accounted for 15. 2% (66/432) , that of normal comparison group was 6. 8% (6/88) , and the difference of two groups was significant (χ2 = 4. 39 , P < 0. 05 ). Conclusion: Detection of AsAb and EmAb had close relation to female infertility, female infertility.

  12. Evaluation of the in-pile pressure data from instrumented fuel assemblies IFA-431 and IFA-432

    International Nuclear Information System (INIS)

    This report includes results of the examination of the in-pile pressure data from instrumented test assemblies IFA-431 and 432. The pressure data have been used to estimate the fission gas release fraction as a function of fuel burnup. Included are comparisons of the estimated release functions and those predicted by three fission gas release models using the experimental temperature histories of the fuel rods. These comparisons show that fuel temperature is the primary factor in determining fission gas release and that burnup-enhanced fission gas release is not important in UO2 fuels irradiated to 1700 GJ/kgU

  13. M1 macrophage infiltrations and histological changes in the liver after portal vein embolization using fibrinogen and OK432 in the rat.

    Science.gov (United States)

    Sato, Tetsu; Marubashi, Shigeru; Kenjo, Akira; Tsuchiya, Takao; Kimura, Takashi; Sato, Naoya; Watanabe, Junichiro; Tasaki, Kazuhiro; Hashimoto, Yuko; Wada, Ikuo; Gotoh, Mitsukazu

    2016-05-01

    The mechanism of anti-tumor effect of transarterial Immuno-Embolization (TIE) using OK-432 has not been well elucidated. In this study, we aimed to investigate the tissue injury and immune response after portal venous embolization (PVE) with/without OK-432. Embolic materials (L group: lipiodol, LF group: lipiodol+fibrinogen, LO group: lipiodol+OK-432, LFO group: lipiodol+fibrinogen+OK-432) were administered via the right portal vein in Wistar rats. The histological findings in LFO group demonstrated liver damage with severe architectural changes. The concentrations of CD68(+) cells were observed in a time-dependent manner; it was significantly increased in the LO group on day 1 and in the LFO group on day 3. CD68(+)CD163(-) macrophages significantly increased in the LFO group on day 7 (P<0.05). In conclusion, PVE with fibrinogen and OK-432 markedly increased the CD68(+)CD163(-) infiltrating macrophages around the peri-portal area in the liver. This novel technique could be applied as immune-enhanced chemo-embolization of liver tumors. PMID:27062693

  14. 1ES 1113+432: Luminous, soft X-ray outburst from a nearby cataclysmic variable (AR Ursae Majoris)

    Science.gov (United States)

    Remillard, R. A.; Schachter, J. F.; Silber, A. D.; Slane, P.

    1994-01-01

    A remarkable X-ray transient from the Einstein Slew Survey, 1 ES 1113+432, is identified with a nearby, short-period cataclysmic variable. Wenzel (1993) has confirmed that the optical counterpart is the variable star, AR UMa (cataloged as 'semiregular'), erroneously reported 5.7 min southeast of the true position. One of the Einstein slew observations recorded a flux of 43 IPC counts/s, which is an order of magnitude above the flux observed from the brightest cataclysmic variables in other X-ray surveys. The outburst spectrum is extremely 'soft,' with an implied blackbody temperature of approximately 22 eV. The optical counterpart (V = 16.5) exhibits a strong UV component, TiO bands from an M star, and broadened Balmer emission lines. Optical states as bright as V approx. 13 were found on photographs from the Harvard Plate Library, confirming outburst behavior in the optical counterpart. The historical photographic record suggests that 1ES 1113+432 remains in a low-accretion state most of the time. Both of the soft X-ray spectrum and the transitions between high and low-accretion states are suggestive of the AM Her (magnetic) subclass. Photometric observations in the I band show 0.18 mag modulations at a period of 0.966 hr. These are interpreted as ellipsiodal variations in the secondary star for a binary period of 1.932 hr, which is near the lower boundary of the 'period gap' in the histogram, of orbital periods of accreting white dwarfs. Thus 1ES 1113+432 provides the rare opportunity to study a secondary star in a cataclysmic binary that has evolved through the period gap. The optical spectral features from the secondary imply a spectral type of approximately M6 and a distance of approximately 88 pc. The peak luminosity in the soft X-ray component (unabsorbed) is then estimated to be 3 X 10(exp 33) ergs/s, assuming emission from a blackbody slab with a temperature of 22 eV. While this luminosity is higher than previous measures of the soft X-ray component, it

  15. Comparative analysis of pellet-cladding interaction from IFA-431 and IFA-432 Halden reactor tests. [BWR

    Energy Technology Data Exchange (ETDEWEB)

    Hann, C.R.; Marshall, R.K.

    1977-07-01

    Two test assemblies containing a total of 12 instrumented fuel rods were irradiated in the HBWR to obtain well-characterized data for fuel operating in the linear heat ranges of commercial nuclear power plants. These data are needed for verification of GAPCON-THERMAL and FRAP computer codes and will provide a series of benchmarks for indexing other thermal performance codes used for reactor safety analysis. Two essentially identical test assemblies, IFA-431 and IFA-432, each containing six instrumented fuel rods, were irradiated under similar conditions. Parameters in the test include pellet-cladding gap size and/or gap eccentricity, fill gas composition, fuel density and stability, linear heat rating, and burnup. The BWR-6 geometry except for length, a 95% theoretical density (TD) pellet, a 0.229 mm (9 mils) diameter gap, and helium fill gas were selected for the reference rod.

  16. ABO blood types and cancer risk—A cohort study of 339,432 subjects in Taiwan

    Science.gov (United States)

    Sun, Wenjie; Wen, Chi-Pang; Lin, Jie; Wen, Christopher; Pu, Xia; Huang, Maosheng; Tsai, Min Kuang; Tsao, Chwen Keng; Wu, Xifeng; Chow, Wong-Ho

    2016-01-01

    Background The associations of laboratory-based ABO phenotypes with cancer risks and mortality have not been systematically determined. Methods The study subjects were 339,432 healthy individuals with laboratory-based blood types from a Taiwan cohort. Results Compared to blood type O, blood type A was significantly associated with an elevated risk of stomach cancer incidence (Hazard Ratio [HR], 1.38 [95% CI, 1.11–1.72]) and mortality (HR, 1.38 [95% CI, 1.02–1.86]) compared with blood type O, after adjusting for age, sex, education, smoking, alcohol drinking, physical activity, and body mass index. Non-O blood types were associated with an elevated risk of pancreatic cancer, with blood type B reaching statistical significance for incidence (HR, 1.59 [95% CI, 1.02–2.48]) and mortality (HR, 1.63 [95% CI, 1.02–2.60]). In contrast, kidney cancer risk was inversely associated with blood type AB (HR, 0.41 [95% CI, 0.18–0.93]) compared to type O. Conclusion Cancer risks vary in people with different ABO blood types, with elevated risks of stomach cancer associated with blood type A and pancreatic cancer associated with non-O blood types (A, B, and AB). PMID:25600007

  17. Analysis of fuel relocation for the NRC/PNL Halden assemblies IFA-431, IFA-432, and IFA-513. Interim report

    International Nuclear Information System (INIS)

    The effects of the thermally-induced cracking and subsequent relocation of UO2 fuel pellets on the thermal and mechanical behavior of light-water reactor fuel rods during irradiation are quantified in this report. Data from the Nuclear Regulatory Commission/Pacific Northwest Laboratory Halden experiments on instrumented fuel assemblies (IFA) IFA-431, IFA-432, and IFA-513 are analyzed. Beginning-of-life in-reactor measurements of fuel center temperatures, linear heat ratings, and cladding axial elongations are used in a new model to solve for the effective thermal conductivity and elastic moduli of the cracked fuel column. The primary assumptions of the new model are that (1) the cracked fuel is in a hydrostatic state of stress in the (r,theta) plane, and that (2) there is no axial slipping between fuel and cladding. Three basic parameters are used to describe the cracked fuel: (1) the crack pattern, (2) the crack roughness, and (3) the fuel surface (gap) roughness. Recommendations are made on refining the model

  18. A Case of Sublingual Ranula That Responded Successfully to Localized Injection Treatment with OK-432 after Healing from Drug Induced Hypersensitivity Syndrome

    Directory of Open Access Journals (Sweden)

    Kunio Yoshizawa

    2016-01-01

    Full Text Available A ranula is a mucus retention cyst or pseudocyst caused by leakage of mucus from the sublingual gland and generally occurs in the oral floor. In addition, drug induced hypersensitivity syndrome (DIHS is a rare but well-recognized serious adverse effect characterized by fever, skin rashes, generalized lymphadenopathy, hepatitis, and hepatosplenomegaly and oral stomatitis. This paper presents the first case of successfully treated sublingual ranula with localized injection of OK-432 after healing from drug induced hypersensitivity syndrome, which has previously been unreported in the literature. We present the case of a 38-year-old Japanese woman with sublingual ranula that responded successfully to localized injection treatment with OK-432 after healing from drug induced hypersensitivity syndrome. She was affected with cutaneous myositis and interstitial lung disease when she was 26 years old. At the age 34 years, she received additional oral treatment of diaminodiphenyl-sulfone due to deterioration of the cutaneous myositis, which resulted in drug induced hypersensitivity syndrome (DIHS with severe oral stomatitis. Local injection of OK-432 to the ranula may be a very safe and useful treatment method even if the patient has a history of drug allergy and has connective tissue disease such as cutaneous myositis.

  19. A Case of Sublingual Ranula That Responded Successfully to Localized Injection Treatment with OK-432 after Healing from Drug Induced Hypersensitivity Syndrome.

    Science.gov (United States)

    Yoshizawa, Kunio; Moroi, Akinori; Kawashiri, Shuichi; Ueki, Koichiro

    2016-01-01

    A ranula is a mucus retention cyst or pseudocyst caused by leakage of mucus from the sublingual gland and generally occurs in the oral floor. In addition, drug induced hypersensitivity syndrome (DIHS) is a rare but well-recognized serious adverse effect characterized by fever, skin rashes, generalized lymphadenopathy, hepatitis, and hepatosplenomegaly and oral stomatitis. This paper presents the first case of successfully treated sublingual ranula with localized injection of OK-432 after healing from drug induced hypersensitivity syndrome, which has previously been unreported in the literature. We present the case of a 38-year-old Japanese woman with sublingual ranula that responded successfully to localized injection treatment with OK-432 after healing from drug induced hypersensitivity syndrome. She was affected with cutaneous myositis and interstitial lung disease when she was 26 years old. At the age 34 years, she received additional oral treatment of diaminodiphenyl-sulfone due to deterioration of the cutaneous myositis, which resulted in drug induced hypersensitivity syndrome (DIHS) with severe oral stomatitis. Local injection of OK-432 to the ranula may be a very safe and useful treatment method even if the patient has a history of drug allergy and has connective tissue disease such as cutaneous myositis. PMID:27144039

  20. A phase II study of cisplatin, oral administration of etoposide, OK-432 and radiation therapy for inoperable stage III non-small cell lung cancer

    International Nuclear Information System (INIS)

    This study was designed to evaluate the feasibility and efficiency of giving cisplatin, etoposide, and OK-432 concurrently with conventional radiotherapy (RTx) for patient's with inoperable stage III, based on the TNM classification according to the International Union against Cancer staging system for lung cancer (1987) non-small cell lung cancer (NSCLC). From January 1992 to December 1994, 31 patients with cytologically or histologically confirmed stage III NSCLC were treated with RTx, to a total dose of 56-64 Gy, with concurrent daily oral administration of etoposide (25 mg) and cisplatin (20 mg) for 5 days during the third or fourth week from the start of RTx. The subcutaneous injection of 1 or 2 KE of OK-432, three times a week, for the duration of radiotherapy also started from the beginning of RTx. The number of eligible patients was 29 (26 men and 3 women). Their mean age was 66 years (range, 55-77 years). Six patients had an Eastern Cooperative Oncology Group performance status (PS) of 0; 15, 1; 8; 2. Three were stage IIIA, and 26, stage IIIB. Histologically, 2 had adenocarcinoma, 23, squamous cell carcinoma, and 4, large cell carcinoma. In 27 of the 29 patients, the RTx schedule was completed. There were no treatment-related deaths. Grade 4 toxicity (according to World Health Organisation criteria) leukopenia (700/μl) was observed in 1 patient. The response rate was 79% and the median survival was 17 months. Survival rates at 1, 2 and 3 years were 62%, 31%, and 21%, respectively. The local failure rate was 51%. The combination of cisplatin, etoposide, and OK-432, given concurrently with conventional RTx is feasible and effective for inoperable stage III NSCLC. (author)

  1. Identification of proteases produced by entomopathogenic fungi Beauveria bassiana (Bals) Vuill. strain CG432 previously activated in coffee berry borer alive (Hypothenemus hampei)
    Identificação de proteases produzidas pelo fungo entomopatogênico Beauveria bassiana (Bals) Vuill. Cepa CG432 previamente ativada em insetos vivos de broca do café ((Hypothenemus hampei))

    OpenAIRE

    Luiz Filipe Protásio Pereira; Diogo Maciel de Magalhães; Humberto Josué de Oliveira Ramos; Dalva Trevisan; Eliana Tiemi Ito; Jurandir Pereira Pinto; Vanessa Hitomi Sugahara; Geni Silva Varéa; Jakeliny Akemi Yamamoto Oliveira

    2012-01-01

    Conídios de fungos entomopatogênicos atravessam o exoesqueleto do inseto pela ação mecânica do tubo germinativo e produção de múltiplas isoformas de proteases, quitinases e lipases em resposta à composição da cutícula do inseto. Desta forma o objetivo deste trabalho foi extrair, purificar e caracterizar a estrutura de proteases produzidas em cultivo submerso por Beauveria bassiana CG432 previamente ativada em adultos vivos de broca-do-café (Hypothenemus hampei). Uma suspensão contendo 106 con...

  2. Observation of a Broad Structure at an Invariant Mass of 4.32 GeV/$c^2$ in the Reaction $e^+e^-\\to\\pi^+\\pi^-\\psi(2S)$ Measured at BaBar

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, R; Allen, M T; Allison, J; Allmendinger, T; Altenburg, D D; Andreotti, M; Angelini, C; Anulli, F; Arnaud, N; Aston, D; Azzolini, V; Baak, M; Back, J J; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Battaglia, M; Bauer, J M; Bechtle, P; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Benelli, G; Berger, N; Bernard, D; Berryhill, J W; Best, D S; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bhuyan, B; Bianchi, F; Biasini, M; Biesiada, J; Blanc, F; Blaylock, G; Blinov, V E; Bloom, P C; Blount, N L; Bomben, M; Bondioli, M; Bonneaud, G R; Bosisio, L; Boutigny, D; Bowerman, D A; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Briand, H; Brown, C M; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Bugg, W; Bukin, A D; Bula, R; Burchat, P R; Burke, J P; Button-Shafer, J; Buzzo, A; Bóna, M; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Cenci, R; Chai, X; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, C; Chen, E; Chen, J C; Chen, S; Chen, X; Chen, X R; Cheng, B; Cheng, C H; Chia, Y M; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Coleman, J P; Contri, R; Convery, M R; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L; Cristinziani, M; Cunha, A; Curry, S; Côté, D; D'Orazio, A; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; De Nardo, Gallieno; De Sangro, R; De, N; Del Amo-Sánchez, P; Del Buono, L; Del Re, D; Della Ricca, G; Denig, A G; Di Lodovico, F; Di Marco, E; Dingfelder, J C; Dittongo, S; Dong, L; Dorfan, J; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Ebert, M; Eckhart, E A; Eckmann, R; Edgar, C L; Edwards, A J; Egede, U; Eigen, G; Eisner, A M; Elmer, P; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Eyges, V; Fabozzi, F; Faccini, R; Fang, F; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flacco, C J; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B; Frey, R; Fritsch, M; Fry, J R; Fulsom, B G; Gabathuler, E; Gaidot, A; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Gaz, A; George, K A; Gill, M S; Giorgi, M A; Gladney, L; Glanzman, T; Godang, R; Golubev, V B; Gowdy, S J; Gradl, W; Graham, M T; Graugès-Pous, E; Grenier, P; Gritsan, A V; Groot; Grosdidier, G; Groysman, Y; Hadavand, H K; Haire, M; Halyo, V; Hamano, K; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hartfiel, B L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hill, E J; Hirschauer, J F; Hitlin, D G; Hollar, J J; Hong, T M; Honscheid, K; Hopkins, D A; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Höcker, A; Igonkina, O; Innes, W R; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jain, V; Jasper, H; Jawahery, A; Jessop, C P; John, M J J; Judd, D; Kadyk, J A; Kagan, H; Karyotakis, Yu; Kass, R; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Klose, V; Knecht, N S; Koch, H; Kolomensky, Yu G; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kreisel, A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; La Vaissière, C de; Lacker, H M; Lae, C K; Lafferty, G D; Lanceri, L; Lange, D J; Lankford, A J; Latham, T E; Latour, E; Lau, Y P; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, S; Li, X; Lista, L; Liu, H; Lo Vetere, M; LoSecco, J M; Lockman, W S; Lombardo, V; Long, O; Lou, X C; Lu, M; Luitz, S; Lund, P; Luppi, E; Lusiani, A; Lutz, A M; Lynch, G; Lynch, H L; Lü, C; Lüth, V; MacFarlane, D B; Macri, M M; Mader, W F; Majewski, S A; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Marchiori, G; Margoni, M; Marks, J; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Mclachlin, S E; Meadows, B T; Mellado, B; Menges, W; Messner, R; Meyer, N T; Meyer, W T; Mihályi, A; Mir, L M; Mishra, K; Mohanty, G B; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Muheim, F; Müller, D R; Nagel, M; Naisbit, M T; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; Nugent, I M; O'Grady, C P; Ocariz, J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Oyanguren, A; Ozcan, V E; Paar, H P; Pacetti, S; Palano, A; Palombo, F; Pan, B; Pan, Y; Panduro-Vazquez, W; Panetta, J; Paolucci, P; Pappagallo, M; Park, W; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Peters, K; Petersen, B A; Petrella, A; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Piredda, G; Playfer, S; Poireau, V; Polci, F; Pompili, A; Porter, F C; Posocco, M; Prell, S; Prencipe, E; Prepost, R; Pripstein, M; Pruvot, S; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rahmat, R; Rama, M; Ratcliff, B N; Raven, G; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, A I; Robertson, S H; Robutti, E; Rodier, S; Roe, N A; Ronan, M T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Roudeau, P; Rubin, A E; Ruddick, W O; Ryd, A; Röthel, W; Sacco, R; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Santroni, A; Saremi, S; Satpathy, A; Schalk, T; Schenk, S; Schilling, C J; Schindler, R H; Schofield, K C; Schott, G; Schröder, T; Schröder, H; Schubert, J; Schubert, K R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shen, B C; Sherwood, D J; Simard, M; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Y I; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spitznagel, M; Spradlin, P; Steinke, M; Stelzer, J; Stocchi, A; Stoker, D P; Stroili, R; Strom, D; Strube, J; Stugu, B; Stängle, H; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; Suzuki, K; Swain, S K; Taras, P; Taylor, F; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thompson, J M; Tisserand, V; Todyshev, Y K; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Ulmer, K A; Uwer, U; Van Bakel, N; Vasseur, G; Vavra, J; Verderi, M; Viaud, F B; Vitale, L; Voci, C; Voena, C; Volk, A; Wagner, S R; Wagoner, D E; Waldi, R; Walker, D; Walsh, J J; Wang, K; Wang, P; Wang, W F; Wappler, F R; Watson, A T; Weaver, M; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winklmeier, F; Wisniewski, W J; Wittgen, M; Wong, Q K; Wormser, G; Wren, A C; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yarritu, A K; Ye, S; Yi, J I; Yi, K; Young, C C; Yu, Z; Yéche, C; Zain, S B; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Ziegler, V; Zito, M; Çuhadar-Dönszelmann, T; al, et

    2006-01-01

    We measure the cross section for the process $e^+e^-\\to\\pi^+\\pi^-\\psi(2S)$ from threshold up to 8 GeV center-of-mass energy using events containing initial-state radiation, produced at the PEP-II $e^+e^-$ storage rings. The study is based on 298 fb$^{-1}$ of data recorded with the BaBar detector. A structure is observed in the cross-section not far above threshold, near 4.32 GeV. This structure is not compatible with the Y(4260) previously reported by this experiment. A single resonance is adequate to describe the cross-section in the low-energy region ($<$5.7 GeV).

  3. Identification of proteases produced by entomopathogenic fungi Beauveria bassiana (Bals Vuill. strain CG432 previously activated in coffee berry borer alive (Hypothenemus hampeiIdentificação de proteases produzidas pelo fungo entomopatogênico Beauveria bassiana (Bals Vuill. Cepa CG432 previamente ativada em insetos vivos de broca do café ((Hypothenemus hampei

    Directory of Open Access Journals (Sweden)

    Luiz Filipe Protásio Pereira

    2012-02-01

    Full Text Available Conídios de fungos entomopatogênicos atravessam o exoesqueleto do inseto pela ação mecânica do tubo germinativo e produção de múltiplas isoformas de proteases, quitinases e lipases em resposta à composição da cutícula do inseto. Desta forma o objetivo deste trabalho foi extrair, purificar e caracterizar a estrutura de proteases produzidas em cultivo submerso por Beauveria bassiana CG432 previamente ativada em adultos vivos de broca-do-café (Hypothenemus hampei. Uma suspensão contendo 106 conídios ativados/mL foi inoculada em meio de cultura líquido a 28ºC, 150 rpm por 3 dias. O extrato de proteases (EP foi obtido da centrifugação a 8000 g por 20 minutos, fracionado e concentrado por ultrafiltração em membrana de porosidade controlada 100 kDa e 3 kDa, respectivamente. A cromatografia de gel filtração em Sephadex G-100 separou um pico proteico (Pico II que apresentou 56% de resíduos do aminoácido ácido aspártico quando analisado por HPLC em coluna de fase reversa ODS-C18; atividade específica 43 vezes superior ao EP sobre soro albumina bovina; atividade de protease tipo-subtilisina e uma única banda proteica revelada por nitrato de prata e Coomassie Brilhant Blue em zimograma sobre gelatina por eletroforese PAGE em condições nativas. A homogeneidade do Pico II foi confirmada pela revelação de uma única banda durante a determinação do pH isoelétrico igual a 4,5, porém a determinação da massa molecular separou 2 bandas de 23 e 26 kDa por eletroforese PAGE-2D. As proteases foram caracterizadas como serino proteases com resíduo cisteína importante para a atividade, pois foram inibidas por fluoreto fenil-metil-sufonil e ácido p-cloromercúriobenzóico. As proteases do Pico II apresentaram Km 4x10-4 sobre substrato tipo-subtilisina.

  4. Radiofrequency Ablation of Liver Tumors in Combination with Local OK-432 Injection Prolongs Survival and Suppresses Distant Tumor Growth in the Rabbit Model with Intra- and Extrahepatic VX2 Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Kageyama, Ken, E-mail: kageyamaken0112@gmail.com; Yamamoto, Akira, E-mail: loveakirayamamoto@gmail.com; Okuma, Tomohisa, E-mail: o-kuma@msic.med.osaka-cu.ac.jp; Hamamoto, Shinichi, E-mail: hamashin_tigers1975@yahoo.co.jp; Takeshita, Toru, E-mail: takeshita3595@view.ocn.ne.jp; Sakai, Yukimasa, E-mail: sakaiy@trust.ocn.ne.jp; Nishida, Norifumi, E-mail: norifumin@med.osaka-cu.ac.jp; Matsuoka, Toshiyuki, E-mail: tmatsuoka@msic.med.osaka-cu.ac.jp; Miki, Yukio, E-mail: yukio.miki@med.osaka-cu.ac.jp [Osaka City University, Department of Radiology, Graduate School of Medicine (Japan)

    2013-10-15

    Purpose: To evaluate survival and distant tumor growth after radiofrequency ablation (RFA) and local OK-432 injection at a single tumor site in a rabbit model with intra- and extrahepatic VX2 tumors and to examine the effect of this combination therapy, which we termed immuno-radiofrequency ablation (immunoRFA), on systemic antitumor immunity in a rechallenge test. Methods: Our institutional animal care committee approved all experiments. VX2 tumors were implanted to three sites: two in the liver and one in the left ear. Rabbits were randomized into four groups of seven to receive control, RFA alone, OK-432 alone, and immunoRFA treatments at a single liver tumor at 1 week after implantation. Untreated liver and ear tumor volumes were measured after the treatment. As the rechallenge test, tumors were reimplanted into the right ear of rabbits, which survived the 35 weeks and were followed up without additional treatment. Statistical significance was examined by log-rank test for survival and Student's t test for tumor volume. Results: Survival was significantly prolonged in the immunoRFA group compared to the other three groups (P < 0.05). Untreated liver and ear tumor sizes became significantly smaller after immunoRFA compared to controls (P < 0.05). In the rechallenge test, the reimplanted tumors regressed without further therapy compared to the ear tumors of the control group (P < 0.05). Conclusion: ImmunoRFA led to improved survival and suppression of distant untreated tumor growth. Decreases in size of the distant untreated tumors and reimplanted tumors suggested that systemic antitumor immunity was enhanced by immunoRFA.

  5. Radiofrequency Ablation of Liver Tumors in Combination with Local OK-432 Injection Prolongs Survival and Suppresses Distant Tumor Growth in the Rabbit Model with Intra- and Extrahepatic VX2 Tumors

    International Nuclear Information System (INIS)

    Purpose: To evaluate survival and distant tumor growth after radiofrequency ablation (RFA) and local OK-432 injection at a single tumor site in a rabbit model with intra- and extrahepatic VX2 tumors and to examine the effect of this combination therapy, which we termed immuno-radiofrequency ablation (immunoRFA), on systemic antitumor immunity in a rechallenge test. Methods: Our institutional animal care committee approved all experiments. VX2 tumors were implanted to three sites: two in the liver and one in the left ear. Rabbits were randomized into four groups of seven to receive control, RFA alone, OK-432 alone, and immunoRFA treatments at a single liver tumor at 1 week after implantation. Untreated liver and ear tumor volumes were measured after the treatment. As the rechallenge test, tumors were reimplanted into the right ear of rabbits, which survived the 35 weeks and were followed up without additional treatment. Statistical significance was examined by log-rank test for survival and Student’s t test for tumor volume. Results: Survival was significantly prolonged in the immunoRFA group compared to the other three groups (P < 0.05). Untreated liver and ear tumor sizes became significantly smaller after immunoRFA compared to controls (P < 0.05). In the rechallenge test, the reimplanted tumors regressed without further therapy compared to the ear tumors of the control group (P < 0.05). Conclusion: ImmunoRFA led to improved survival and suppression of distant untreated tumor growth. Decreases in size of the distant untreated tumors and reimplanted tumors suggested that systemic antitumor immunity was enhanced by immunoRFA

  6. 5 CFR 432.102 - Coverage.

    Science.gov (United States)

    2010-01-01

    ... principal function of which is the conduct of foreign intelligence or counterintelligence activities; (6... Executive Service to a civil service position outside the Senior Executive Service under part 359 of this... disability under part 831 of this chapter. (c) Agencies covered. This part applies to: (1) The...

  7. 43 CFR 4.432 - Postponements.

    Science.gov (United States)

    2010-10-01

    ... postponement must be served upon all parties to the proceeding and filed in the office of the administrative... postponement served or filed less than 10 days in advance of the hearing or made at the hearing be granted... anticipated and which justifies beyond question the granting of a postponement. In any such emergency, if...

  8. 46 CFR 120.432 - Emergency lighting.

    Science.gov (United States)

    2010-10-01

    ... PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS ELECTRICAL INSTALLATION Lighting... the line of escape to the main deck from all passenger and crew accommodation spaces located below...

  9. 12 CFR 4.32 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... examination of a national bank, a bank holding company, or an affiliate; (ii) A record compiled by the OCC in... loaned to the bank or holding company for its confidential use only. (c) Relevant means could contribute... banks as well as their subsidiaries and their affiliates; and (vii) A Suspicious Activity Report...

  10. BDML Metadata: 432 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_AK BDML file for the result of computer simulation of male pronuclear migration ...in C. elegans embryo the result of computer simulation of male pronuclear migration in C. elegans embryo (me

  11. 75 FR 432 - Notice of Extension of Concession Contracts

    Science.gov (United States)

    2010-01-05

    ... National Park Service Notice of Extension of Concession Contracts AGENCY: National Park Service, Interior... given that the National Park Service proposes to extend the following expiring concession contracts for a period of up to 1 year, or until such time as a new contract is executed, whichever occurs...

  12. Dicty_cDB: SFC432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ia and immune antigen for suppressing growth of plasmodium. 76 5e-50 9 BD183625 |...BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 5e-50

  13. Solving the 432 pieces of the puzzle called measurement invariance

    NARCIS (Netherlands)

    J.M. Wicherts

    2011-01-01

    Reviews the book Statistical approaches to measurement invariance by Roger E. Millsap. The reviewer found this book to be well written and feels it deserves to become the classic reference in the field, but also that the reader should be prepared to invest time to read it. Millsap’s book is not the

  14. Dicty_cDB: AFK432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sculentum clone 132068F, mRNA sequence. 74 3e-10 2 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersico...ntum cDNA clone cLEZ19K24 5', mRNA sequence. 74 5e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lyco...c, DNA sequence. 80 8e-11 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clon...ato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA sequence. 74 5e-09 1 dna update 2004. 7.30 Hom...rkiscrksc*krsrrs**rrrrsr*rrlvktrqkrrsqkinqks Homology vs CSM-cDNA Score E Sequences producing

  15. EISA 432 Energy Audits Best Practices: Software Tools

    Energy Technology Data Exchange (ETDEWEB)

    Maryl Fisher

    2014-11-01

    Five whole building analysis software tools that can aid an energy manager with fulfilling energy audit and commissioning/retro-commissioning requirements were selected for review in this best practices study. A description of each software tool is provided as well as a discussion of the user interface and level of expertise required for each tool, a review of how to use the tool for analyzing energy conservation opportunities, the format and content of reports generated by the tool, and a discussion on the applicability of the tool for commissioning.

  16. Dicty_cDB: CHS432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ete sequence. 1392 0.0 3 CJ438186 |CJ438186.1 Macaca fascicularis mRNA, clone: QccE-15390, 5' end, expressed...X347137 |AX347137.1 Sequence 2208 from Patent WO0200928. 34 0.069 5 CJ480078 |CJ480078.1 Macaca fascicularis...l*nncreiki cfsnq*yqqspqwrwyfk**kw*yhs*ynfk**sfktitres*kvyfllfnylsfhysny fitrsfk*isitstsihyktksfqsitiitfnsigfl*ktldelfpnclsq*mdhskfii...lf hhqif*mn*yyfnihtlqnkvvsiyhnyhv*fnrfslknlg*iisqlfisingsfkihhp linsfvkwhkyqi*mn*ftianimkscwkiilnfvq*lislrsf...( AM600681 |pid:none) Oncorhynchus mykiss partial mRNA f... 67 2e-09 CR858800_1(

  17. 42 CFR 432.50 - FFP: Staffing and training costs.

    Science.gov (United States)

    2010-10-01

    ... organization or a degree in a medical field issued by a college or university certified by a professional medical organization. Experience in the administration, direction, or implementation of the Medicaid... those professional medical knowledge and skills. (iv) A State-documented employer-employee...

  18. 48 CFR 432.102 - Description of contract financing methods.

    Science.gov (United States)

    2010-10-01

    ... authorized for use as a payment method under USDA contracts or subcontracts for construction, alteration or... other contracts, progress payment provisions shall be based on costs except that the HCA may...

  19. 40 CFR 432.15 - New source performance standards (NSPS).

    Science.gov (United States)

    2010-07-01

    ... expiration of the applicable time period specified in 40 CFR 122.29(d)(1) after which it must achieve the... daily 1 Maximum monthly avg. 1 Ammonia (as N) 0.34 0.17 1 Pounds per 1000 lbs (or g/kg) LWK. (2) In...: Performance Standards Regulatedparameter Maximum daily 1 Maximum monthly avg. 1 Ammonia (as N) 0.06 0.03...

  20. 40 CFR 432.115 - New source performance standards (NSPS).

    Science.gov (United States)

    2010-07-01

    ... Regulatedparameter Maximum daily 1 Maximum monthly avg. 1 Ammonia (as N) 8.0 4.0 BOD5 26 16 Fecal Coliform ( 2 ) ( 3... Regulatedparameter Maximum daily 1 Maximum monthly avg. 1 Ammonia (as N) 8.0 4.0 BOD5 26 16 Fecal Coliform (2) (3)...

  1. 40 CFR 432.125 - New source performance standards (NSPS).

    Science.gov (United States)

    2010-07-01

    ...: Performance Standards Regulatedparameter Maximum daily 1 Maximum monthly avg. 1 Ammonia (as N) 8.0 4.0 BOD5 26... standards: Effluent Limitations Regulatedparameter Maximum daily 1 Maximum monthly avg. 1 Ammonia (as N)...

  2. 9 CFR 93.432 - Cattle from the Republic of Ireland.

    Science.gov (United States)

    2010-01-01

    ... eligible for export to the United States. Brucellosis bacteriologically positive animals, if known... accompanying the cattle offered for importation must also show the dates and places of testing, names of the... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cattle from the Republic of...

  3. 432 püksipaari Riia kongresside palee fassaadil / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2000-01-01

    Filmifestivalil "Arsenals" sai parima režissööri kujukese Mait Laas nukufilmi "Teekond Nirvaanasse" eest, teise koha preemia Valentin Kuigi mängufilm "Lurjus" ja Riho Undi nukufilm "Saamuel internetis". Peaauhinna andis loos shoti naisrežissööri Lynne Ramsay mängufilmile "Rotipüüdja" ("Ratcatcher")

  4. 24 CFR 203.432 - Effect of sale of insured mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Effect of sale of insured mortgage... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Sale, Assignment and Pledge...

  5. 42 CFR 432.31 - Training and use of subprofessional staff.

    Science.gov (United States)

    2010-10-01

    ... community service aides, in accordance with the requirements of this section. (b) Recruitment and selection. The Medicaid agency must have methods of recruitment and selection that afford opportunity for full... 42 Public Health 4 2010-10-01 2010-10-01 false Training and use of subprofessional staff....

  6. At the Cutting Edge of Bright Beams: The NSLS Source Development Lab (432nd Brookhaven Lecture)

    International Nuclear Information System (INIS)

    Inspired by the discoveries with synchrotron light at the National Synchrotron Light Source (NSLS) and similar facilities around the world, researchers are looking for more brilliant beams of light. To develop this next-generation of light sources, accelerator physicists at the NSLS Source Development Laboratory (SDL) make use of a magnesium photocathode irradiated by ultraviolet laser light to produce electron beams of unprecedented brightness. As Murphy will describe in his talk, he and fellow researchers have developed various techniques to catch molecules and atoms in action. In one recent study, the researchers used a laser to control the pulse duration of light from a free-electron laser (FEL), a type of light source with a potential peak brightness up to one billion times higher than that of ordinary synchrotron light. In another technique, Murphy and his colleagues generated extremely short pulses of terahertz radiation that are the highest intensity of their type ever produced.

  7. SU-E-T-432: A Rapid and Comprehensive Procedure for Daily Proton QA

    International Nuclear Information System (INIS)

    Purpose: The objective is to develop a rapid and comprehensive daily QA procedure implemented at the S. Lee Kling Proton Therapy Center at Barnes-Jewish Hospital. Methods: A scribed phantom with imbedded fiducials is used for checking lasers accuracy followed by couch isocentricity and for X-ray imaging congruence with isocenter. A Daily QA3 device (Sun Nuclear, FL) was used to check output, range and profiles. Five chambers in the central region possess various build-ups. After converting the thickness of the inherent build-ups into water equivalent thickness (WET) for proton, range of any beam can be checked with additional build-up on the Daily QA3 device. In our procedure, 3 beams from 3 bands (large, small and deep) with nominal range of 20 cm are checked daily. 17cm plastic water with WET of 16.92cm are used as additional build-up so that four chambers sit on the SOBP plateau at various depths and one sit on the distal fall off. Reading from the five chambers are fitted to an error function that has been parameterized to match the SOBP with the same nominal range. Shifting of the error function to maximize the correlation between measurements and the error function is deemed as the range shift from the nominal value. Results: We have found couch isocentricity maintained over 180 degrees. Imaging system exhibits accuracy in regard to imaging and mechanical isocenters. Ranges are within 1mm accuracy from measurements in water tank, and sensitive to change of sub-millimeter. Data acquired since the start of operation show outputs, profiles and range stay within 1% or 1mm from baselines. The whole procedure takes about 40 minutes. Conclusion: Taking advantage of the design of Daily QA3 device turns the device originally designed for photon and electron into a comprehensive and rapid tool for proton daily QA

  8. Clinical response, drug survival and predictors thereof in 432 ankylosing spondylitis patients after switching tumour necrosis factor α inhibitor therapy

    DEFF Research Database (Denmark)

    Glintborg, Bente; Østergaard, Mikkel; Krogh, Niels Steen; Tarp, Ulrik; Manilo, Natalia; Loft, Anne Gitte Rasmussen; Hansen, Annette; Schlemmer, Annette; Fana, Victoria; Lindegaard, Hanne M; Nordin, Henrik; Rasmussen, Claus; Ejstrup, Leif; Jensen, Dorte Vendelbo; Petersen, Peter Mosborg; Hetland, Merete Lund

    2013-01-01

    OBJECTIVE: To investigate frequencies and reasons for switching, treatment responses and drug survival in patients with ankylosing spondylitis (AS) switching tumour-necrosis-factor-α inhibitor (TNFi) treatment in routine clinical care. METHODS: AS patients were identified in the Danish nationwide...

  9. Processing of fine-grained W materials without detrimental phases and their mechanical properties at 200-432 K

    International Nuclear Information System (INIS)

    Low-temperature ductility improvements of tungsten (W) materials with microstructures of fine grains and fine transition metal-carbide dispersoids require sufficient reductions for consolidates that are free from detrimental dispersoids of the W2C phase. In this paper the cause of the occurrence of the detrimental W2C phase is studied and an appropriate processing method for its prevention and nearly full densification of mechanically alloyed powder is shown. By applying the method W-0.3 wt%Ti-0.006 wt%C (W-0.3TiC-0.006C) specimens with a negligible amount of the W2C phase and reductions up to 78% were prepared. It is found that W-0.3TiC-0.006C exhibits an appreciable ductility even at room temperature by three-point bend impact tests and static tensile tests, with the ductile-to-brittle transition temperature of around 260 K. The observed ductility is likely due to elongated, very thin grain structures of the material. For further ductility improvements, control of oxygen impurities to suppress decarburization during sintering and assure appropriate amounts of (Ti,W)C dispersoids is required

  10. 32 CFR 644.432 - Assignment to Department of Health, Education, and Welfare (HEW) or successor agencies for health...

    Science.gov (United States)

    2010-07-01

    ... property. (3) That the property will be withheld from advertisement for bids for a period of 20 days from... would clearly duplicate the function assigned to the Department of HEW. Doubtful cases would only...

  11. 40 CFR 432.12 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... daily 1 Maximum monthly avg. 1 BOD 5 0.24 0.12 Fecal Coliform (2) (3) O&G 4 0.12 0.06 TSS 0.40 0.20 1... Limitations Regulatedparameter Maximum daily 1 Maximum monthly avg. 1 BOD 5 0.04 0.02 TSS 0.08 0.04 1...

  12. 40 CFR 432.42 - Effluent limitations attainable by the application of the best practicable control technology...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart must achieve... daily 1 Maximum monthly avg. 1 BOD5 2 0.48 0.24 Fecal Coliform (3) (4) O&G 5 0.26 0.13 TSS 2 0.62 0.31 1... where the ratio of avg. wt. of processed meat products/avg. LWK is 0.55. Adjustments can be made...

  13. 18 CFR 4.32 - Acceptance for filing or rejection; information to be made available to the public; requests for...

    Science.gov (United States)

    2010-04-01

    ..., citizen, association of citizens, domestic corporation, municipality, or state that has or intends to...; (iii) Every irrigation district, drainage district, or similar special purpose political subdivision... license under section 15 of the Federal Power Act) state that the applicant has made, either at the...

  14. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2011-01-05

    ... October 1, 2010 (75 FR 60655). That NPRM proposed to correct an unsafe condition for the specified...'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have... definition review against explosion hazards. * * * * * Failure of the auxiliary power unit (APU) bleed...

  15. Nuclear Regulatory Commission issuances: Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1 - December 31, 1996. Volume 44, Pages 1 - 432

    International Nuclear Information System (INIS)

    The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors' Decisions--DD, and Decisions on Petitions for Rulemaking--DPRM

  16. Nuclear Regulatory Commission issuances: Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1--December 31, 1996. Volume 44, Pages 1--432

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-10-01

    The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors` Decisions--DD, and Decisions on Petitions for Rulemaking--DPRM.

  17. ISO 14001:2004标准4.3.2和4.5.2的实施与审核

    Institute of Scientific and Technical Information of China (English)

    周璐

    2005-01-01

    @@ ISO 14001标准于1996年颁布实施以来,在全球得到了广泛实施,尤其在日本和中国等国家取得了较好的推行效果,一定程度上促进了全球的环境保护,推动了国际贸易和经济全球化的进程.几年间,国际标准化组织(ISO)、国际认可论坛(IAF)、各成员国政府、认可机构、认证机构对ISO 14001标准的引入和实施给予了积极的引导和推动,广大组织给予了充分重视并进行了实践.

  18. Beliefs, practices and attitudes of portuguese undergraduate youth (Crenças, práticas e atitudes da juventude universitária portuguesa. DOI: 10.5752/P.2175-5841.2012v10n26p432

    Directory of Open Access Journals (Sweden)

    José Pereira Coutinho

    2012-06-01

    Full Text Available Abstract This paper presents results of the author’s PhD research: Catholic beliefs and practices, attitudes toward marriage, life and sexuality. The empirical support is a survey made to a sample of 500 students from Lisbon public universities, using a non-random sampling in two phases, first a quota sampling and after a convenience one. There are some results that stand out. More than half of students of the sample call themselves Catholic and believe in the dogmatic representations about God, Jesus and Mary, though other dogmatic beliefs as hell, purgatory and resurrection are much lower. There is some spirituality among students, although the importance of God is less important. The frequencies of the Mass, prayer, Holy Communion, confession are all very low. The attitudes toward marriage, life and sexuality lie between ‘some’ and ‘very’, with abortion having the smallest rating and contraception the highest. In general, undergraduate youth is away from the norms of the Church. At the same time, these youngsters believe and belong more than they practice. Keywords: Beliefs. Practices. Attitudes. Portugal. Undergraduate students.   Resumo Este artigo apresenta resultados da tese de doutoramento do autor: crenças e práticas católicas, atitudes em relação ao casamento, à vida e à sexualidade. O suporte empírico é um inquérito aplicado a uma amostra de 500 estudantes das universidades públicas de Lisboa, usando uma amostragem não aleatória em duas fases, primeiro a amostragem por quotas e depois a amostragem por conveniência. Há alguns resultados que se destacam. Mais do que metade da amostra denomina-se católica e acredita nas representações dogmáticas de Deus, Jesus e Maria, embora outras crenças dogmáticas como inferno, purgatório e ressurreição sejam bastante mais baixas. Há alguma espiritualidade entre os estudantes, embora menos considerem que Deus seja importante. A frequência da Missa, oração, comunhão, confissão é muito baixa. As atitudes relativamente ao casamento, vida e sexualidade estão entre ‘alguma’ e ‘muita’, tendo o aborto o valor mais pequeno e a contracepção o valor maior. Na generalidade, a juventude universitária está afastada das normas da Igreja. Ao mesmo tempo, eles acreditam e pertencem mais do que praticam. Palavras-chave: Crenças. Práticas. Atitudes. Portugal. Estudantes niversitários.

  19. 'Direct and Indirect Shadow Price Estimates of Nitrate Pollution Treated as an Undesirable Output and Input', Journal of Agricultural and Resource Economics Vol. 27, No. 2 (December 2002) pp: 420-432.

    OpenAIRE

    Saleem Shaik; Helmers, Glenn A.; Michael Langemeier

    2005-01-01

    The implication of treating environmental pollution as an undesirable output (weak disposability) as well as a normal input (strong disposability) on the direct and indirect shadow price and cost estimates of nitrogen pollution abatement is analyzed using Nebraska agriculture sector data. The shadow price of nitrogen pollution abatement treated as an undesirable output represents the reduced revenue from reducing nitrogen pollution. In contrast, the shadow price of nitrogen pollution abatemen...

  20. Dicty_cDB: Contig-U13560-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ), Expect = 0.0 Identities = 495/503 (98%) Strand = Plus / Plus Query: 13 atatggtttaccnacaangattttcagaccaggn...acaatntttagtnanacccaatttgg 72 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 atatggtttaccna...attggatngatgntcaacttaatttttc 372 Query: 373 aaataatccnttgtattttattaaacntttatttaaaaanaatgatcgtttcccnattgg 432... |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 373 aaataatccnttgtattttattaaacntttatttaaaaanaatgatcgtttcccna...ttgg 432 Query: 433 ttttcagtcaattaaaaatccnaaaactattaaagattta

  1. Erratum: Hunaefi, D., et al. The Effect of Lactobacillus plantarum ATCC 8014 and Lactobacillus acidophilus NCFM Fermentation on Antioxidant Properties of Selected in Vitro Sprout Culture of Orthosiphon aristatus (Java Tea) as a Model Study. Antioxidants 2012, 1, 4-32.

    Science.gov (United States)

    Office, Antioxidants Editorial

    2015-01-01

    Article [1] was published on 26 September 2012. In order to update the spelling of the second author's name-"Divine N. Akumo" was written as "Divine Akumo", it was updated a few days after publication and prior to issue release. [...]. PMID:26783952

  2. 4) 周生期異常としての先天性代謝異常症(シンポジウム 周産期をめぐる諸問題, 第432回新潟医学会)

    OpenAIRE

    浅見, 直; 松井, 俊晴; 須田, 昌司; Asami, Tadashi; Matsui, Toshiharu; Suda, Masashi

    1988-01-01

    More than 350 kinds of congenital metabolic diseases are described in the pediatric textbook by Nelson. During the past fifteen years, we have found 81 patients with 15 kinds of congenital metabolic diseases. In these 81 patients, only 3 patients (congenital urea cycle enzyme deficiency and galactosemia) presented with abnormal signs and symptoms such as vomiting, failure to thrive or hyperammonemia in perinatal period. Although the incidence of congenital metabolic diseases presenting with a...

  3. Ket qua hop tác nghiên cuu ve quan ly tài nguyên &273;at giua vien nghiên cuu phát trien pháp và vien tho nh&432;ong nông hóa

    OpenAIRE

    Rochelle Newall, Emma; Do Duy Phai; Janeau, Jean-Louis; Jouquet, Pascal; Henry des Tureaux, Thierry; Maeght, Jean-Luc; Nguyen Duy Phuong; Nguyen Van Thiet; Orange, Didier; Pham Dinh Rinh; Podwojewski, Pascal; Ribolzi, Olivier; De Rouw, Anneke; Silvera, Norbert; Doan Thi Thuy

    2015-01-01

    For almost two decades, the French Institut de Recherche pour le Développement (IRD) has been working in partnership with the Soils and Fertilizer Research Institute (SFRI) to study soil erosion and land use change in the small catchment of Dong Cao, Tien Xuan, North Vietnam. This partnership forms one of the main pillars of the regional Multi - Scale Environmental Changes observatory (MSEC, http://msec.obs - mip.fr/) that was launched in 1998. This network studies three headwater...

  4. Composite materials of graphene derivatives and conducting polymers: potential cycling stability and applications in solid-state chemical sensors

    Czech Academy of Sciences Publication Activity Database

    Lindfors, T.; Österholm, A.; Boeva, Z.; Kauppila, J.; Milakin, K.; Bober, Patrycja; Gyurcsányi, R. E.

    Turku: University of Turku, 2014. W4.3-2, s. 57. [International Conference on Synthetic Metals - ICSM 2014. 30.06.2014-05.07.2014, Turku] Institutional support: RVO:61389013 Keywords : polymers * chemical sensors Subject RIV: CD - Macromolecular Chemistry

  5. Asteroid rotation excitation by subcatastrophic impacts

    Czech Academy of Sciences Publication Activity Database

    Henych, T.; Pravec, Petr

    2013-01-01

    Roč. 432, č. 2 (2013), s. 1623-1631. ISSN 0035-8711 Institutional support: RVO:67985815 Keywords : numerical methods * minor planets * general asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.226, year: 2013

  6. Dicty_cDB: FC-IC0565 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N BJ163777 |BJ163777.1 Physcomitrella patens subsp. paten...s cDNA clone:pph14m13, 5' end, single read. 432 e-118 1 BJ158566 |BJ158566.1 Physcomitrella patens subsp. paten...s cDNA clone:pph12g01, 5' end, single read. 432 e-118 1 BJ200225 |BJ200225.1 Physcomitrella pate...ns subsp. patens cDNA clone:pphn3o10, 5' end, single read. 432 e-118 1 BJ161194 |BJ...161194.1 Physcomitrella patens subsp. patens cDNA clone:pph21f21, 5' end, single read. 432 e-118 1 BJ190579

  7. ClEST cluster :Cl_contig0436 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_contig0436 lethal essential for life ... l2efl Cimex lectularius nuclear gene 432 TAAGAATCTCTCCCG ... GACGTTATT fs18066 fw18019 2 lethal(2)essential for life ... protein-like protein [Maconellicoccus hirsutus] AB ...

  8. Disease: H00464 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available the nail-patella syndrome. Pediatr Radiol. 27:432-5 (1997) PMID:12666288 (description) Sferopoulos NK, Tsit...a syndrome. Overview on clinical and molecular findings. Pediatr Nephrol 17:703-12 (2002) PMID:11175791 (des

  9. International Scientific Technology Exchanges in 2011

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    In 2012, CIAE sent 432 scholars abroad for taking part in international meeting, technical visiting, further studying and training. CIAE received more than 300 foreign scholars from about 30 countries, and some reports were given by foreign scholars as follows:

  10. Identification of Rhodococcus fascians cytokinins and their modus operandi to reshape the plant

    Czech Academy of Sciences Publication Activity Database

    Pertry, I.; Václavíková, Kateřina; Depuydt, S.; Galuszka, P.; Spíchal, Lukáš; Temmerman, W.; Stes, E.; Schmülling, T.; Kakimoto, T.; Van Montagu, M. C. E.; Strnad, Miroslav; Holsters, M.; Tarkowski, Petr; Vereecke, D.

    2009-01-01

    Roč. 106, č. 3 (2009), s. 929-934. ISSN 0027-8424 Institutional research plan: CEZ:AV0Z50380511 Keywords : phytopathogen * actinomycete * phytohormone Subject RIV: CE - Biochemistry Impact factor: 9.432, year: 2009

  11. 76 FR 31964 - Announcement of the Award of Nine Single-Source Expansion Supplement Grants

    Science.gov (United States)

    2011-06-02

    ... supplement grants will ensure that during the eight-month adjustment period, the ORR-eligible populations.... (Hebrew Immigrant Aid New York, NY........ 1,432,200 Society)/Refugee and Immigrant...

  12. The role of palmitoylation and transmembrane domain in sorting of transmembrane adaptor proteins

    Czech Academy of Sciences Publication Activity Database

    Chum, Tomáš; Glatzová, Daniela; Kvíčalová, Zuzana; Malínský, Jan; Brdička, Tomáš; Cebecauer, Marek

    2016-01-01

    Roč. 129, č. 1 (2016), s. 95-107. ISSN 0021-9533 Institutional support: RVO:61388955 ; RVO:68378050 ; RVO:68378041 Keywords : LAT * PAG * Palmitoylation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.432, year: 2014

  13. Stereotactic radiofrequency amygdalohippocampectomy: Two years of good neuropsychological outcomes

    Czech Academy of Sciences Publication Activity Database

    Malíková, H.; Krámská, L.; Vojtěch, Z.; Lukavský, Jiří; Liščák, R.

    2013-01-01

    Roč. 106, č. 3 (2013), s. 423-432. ISSN 0920-1211 Institutional support: RVO:68081740 Keywords : temporal lobe epilepsy * stereotactic surgery * neuropsychology outcome Subject RIV: AN - Psychology Impact factor: 2.190, year: 2013

  14. Beyond a one-man show: The prelude of Revisionist Zionism, 1922-25

    Czech Academy of Sciences Publication Activity Database

    Zouplna, Jan

    2013-01-01

    Roč. 19, č. 3 (2013), s. 410-432. ISSN 1353-7121 Institutional support: RVO:68378009 Keywords : interwar Zionism * Israel i right * Russian-Jewish intelligentsia Subject RIV: AB - History Impact factor: 0.229, year: 2013

  15. 2006 Volusia County Florida LiDAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset is the lidar data for Volusia County, Florida, approximately 1,432 square miles, acquired in early March of 2006. A total of 143 flight lines of Lidar...

  16. Genetics Home Reference: horizontal gaze palsy with progressive scoliosis

    Science.gov (United States)

    ... palsy and progressive scoliosis with mutations in ROBO3. Neurology. 2005 Apr 12;64(7):1196-203. Citation ... with progressive scoliosis maps to chromosome 11q23-25. Neurology. 2002 Aug 13;59(3):432-5. Citation ...

  17. Evidence of the use of a horn yoke in the Middle La Tène period, and an analysis of animal finds from La Tène features in the Velké Zboží and Malé Zboží cadasters, central Bohemia

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2015-01-01

    Roč. 67, č. 3 (2015), s. 432-437. ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : cattle horn core * pathology * yoke * hornless sheep * Late Iron Age * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Secondhand Smoke

    Science.gov (United States)

    ... 5 (43.2%) nonsmokers who lived below the poverty level were exposed to secondhand smoke. Occupation 10 ... OIG 1600 Clifton Road Atlanta , GA 30329-4027 USA 800-CDC-INFO (800-232-4636) , TTY: 888- ...

  19. Serious games for higher education: a framework for reducing design complexity

    OpenAIRE

    WESTERA, Wim; Nadolski, Rob; Hummel, Hans; Wopereis, Iwan

    2008-01-01

    Westera, W., Nadolski, R., Hummel, H. G. K., & Wopereis, I. (2008). Serious games for higher education: a framework for reducing design complexity. Journal of Computer Assisted Learning, 24(5), 420-432.

  20. Evolution variational inequalities and multidimensional hysteresis operators

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel

    London : Chapman & Hall/CRC, 1999 - (Drábek, P.; Krejčí, P.; Takáč, P.), s. 47-110 ISBN 1-58488-036-8. - (Research Notes in Mathematics. 404). [The Seminar in Differential Equations. Chvaletice (CZ), 29.07.1998-03.08.1998] Subject RIV: BA - General Mathematics http://www.wias-berlin.de/preprint/432/wias_preprints_432. pdf

  1. 49 CFR 571.201 - Standard No. 201; Occupant protection in interior impact.

    Science.gov (United States)

    2010-10-01

    ... incorporates an upper seat belt anchorage conforming to the requirements of S4.2.1 and S4.3.2 of 49 CFR 571.210... the requirements of S4.2.1 and S4.3.2 of 49 CFR 571.210, that is located forward of the rearmost... occupant crash protection requirements of S5.1 of 49 CFR 571.208 by means of inflatable restraint...

  2. Analysis of the Active-Site Mechanism of Tyrosyl-DNA Phosphodiesterase I: A Member of the Phospholipase D Superfamily

    Energy Technology Data Exchange (ETDEWEB)

    Gajewski, Stefan; Comeaux, Evan Q.; Jafari, Nauzanene; Bharatham, Nagakumar; Bashford, Donald; White, Stephen W.; van Waardenburg, Robert C.A.M. (UAB); (SJCH)

    2012-03-15

    Tyrosyl-DNA phosphodiesterase I (Tdp1) is a member of the phospholipase D superfamily that hydrolyzes 3'-phospho-DNA adducts via two conserved catalytic histidines - one acting as the lead nucleophile and the second acting as a general acid/base. Substitution of the second histidine specifically to arginine contributes to the neurodegenerative disease spinocerebellar ataxia with axonal neuropathy (SCAN1). We investigated the catalytic role of this histidine in the yeast protein (His432) using a combination of X-ray crystallography, biochemistry, yeast genetics, and theoretical chemistry. The structures of wild-type Tdp1 and His432Arg both show a phosphorylated form of the nucleophilic histidine that is not observed in the structure of His432Asn. The phosphohistidine is stabilized in the His432Arg structure by the guanidinium group that also restricts the access of nucleophilic water molecule to the Tdp1-DNA intermediate. Biochemical analyses confirm that His432Arg forms an observable and unique Tdp1-DNA adduct during catalysis. Substitution of His432 by Lys does not affect catalytic activity or yeast phenotype, but substitutions with Asn, Gln, Leu, Ala, Ser, and Thr all result in severely compromised enzymes and DNA topoisomerase I-camptothecin dependent lethality. Surprisingly, His432Asn did not show a stable covalent Tdp1-DNA intermediate that suggests another catalytic defect. Theoretical calculations revealed that the defect resides in the nucleophilic histidine and that the pK{sub a} of this histidine is crucially dependent on the second histidine and on the incoming phosphate of the substrate. This represents a unique example of substrate-activated catalysis that applies to the entire phospholipase D superfamily.

  3. Degradation models and ecotoxicity in marine waters of two antifouling compounds: sodium hypochlorite and an alkylamine surfactant.

    Science.gov (United States)

    López-Galindo, Cristina; Garrido, M Carmen; Casanueva, José F; Nebot, Enrique

    2010-03-15

    Industrial wastes have a substantial impact on coastal environments. Therefore, to evaluate the impact of cooling water discharges from coastal power plants, we studied the kinetics of the degradative processes and the ecotoxicity of two antifouling products: (1) a classic antifouling product; sodium hypochlorite (NaClO) and (2) an alternative one; aliphatic amines (commercial under the registered trade mark Mexel432). To assess the persistence of both compounds the decay of sodium hypochlorite and the primary biodegradation rate of Mexel432 were determined in natural seawater at 20 degrees C. The results indicated a more rapid decay of NaClO than Mexel432. The degradation behavior of both chemicals was described following a logistic model, which permitted calculating kinetic parameters such as t(50) or t(90). The t(50) was 1h and 2d for NaClO and Mexel432, respectively. To evaluate the potential risks of the aforementioned treatments to marine organisms, the acute toxicity of both antifouling products was studied on the microalgae Isochrysis galbana and Dunaliella salina, and on the invertebrate Brachionus plicatilis, using growth inhibition and death tests as toxic response, respectively. For I. galbana, the 96-h EC(50) values were 2.91+/-0.15mg/L of NaClO and 4.55+/-0.11mg/L of Mexel432. D. salina showed values of 96-h EC(50) of 1.73+/-0.16mg/L of NaClO and 7.21+/-0.1mg/L of Mexel432. Brachionus plicatilis showed a 24-h LC(50) of 1.23+/-0.1mg/L of NaClO and 3.62+/-0.37mg/L of Mexel432. Acute toxicity was highly dependent on the chemical and species tested. NaClO presented more toxic effects than Mexel432, also B. plicatilis was the most sensitive species in both cases. The lowest NOECs obtained, 0.25mg/L for NaClO and 2.12mg/L for Mexel432, were similar to the theoretical residual concentrations of these biocides in cooling water discharges. Therefore, these discharges can cause undesirable negative effects upon the aquatic organisms present. PMID:20153019

  4. Combination therapy for advanced thyroid cancer with immunochemotherapeutic agents and Co60 irradiation

    International Nuclear Information System (INIS)

    In this clinical study OK-432 and/or PSK and BCG preparation were used for potentiation of cell-mediated immunity, Mitomycin and/or Bleomycin and Carboquone for carcinostatic chemotherapeutics. Local and systemic administration of these agents and Co60 irradiation were applied in various combination for 5 patients with advanced thyroid papillary adeno-carcinoma. All patients except one showed remarkable reduction in the tumor size. The tumor reduction continued a variety of period from several months to years. In a 69-year-old woman her huge neck tumor necrotized and disappeared without any paticular untoward effects, and she is in complete remission at least for 2 years. The principal effect of OK-432 appeared to be on increase of cell-mediated immunity. The data suggests that OK-432 may be useful in combination with conventional carcinostatic chemotherapeutics and/or radiation. (author)

  5. Alleviation of acute radiation damages by post-irradiation treatments

    International Nuclear Information System (INIS)

    Radiation induced hematopoietic and gastro-intestinal damages in mice were tried to alleviate experimentally by post-treatment. Combined treatment of OK-432 and aztreonam clearly prevented the radiation induced sepsis and elevated the survival rate in mice; the survival was 80% in the OK-432 plus aztreonam group while it was 55% in the group treated with OK-432 alone and 0% with saline. Irsogladine maleate, an anti-ulcer drug, increased the survival rate of jejunal crypt stem cells with a clear dose-related trend. The D0 for irsogladine maleate was 2.8 Gy although it was 2.3 Gy for saline, These findings suggest that some conventional drugs are effective for radiation induced hematopoietic and gastro-intestinal damages and the possibility that they can be applied for people exposed to radiation accidentally. (author)

  6. Dicty_cDB: VSG683 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available L432 (SHL432Q) /CSM/SH/SHL4-B/SHL432Q.Seq.d/ 38 0.10 own update 2004. 8. 6 Homology vs DNA Score E Sequences producing signific...2 Pima Gossypium barbadense genomic, genomic survey sequence. 44 1.4 1 Y16168 |Y16168.1 Allogromia laticolla...1CSE. 42 2.8 2 AX345528 |AX345528.1 Sequence 599 from Patent WO0200928. 40 3.5 3 dna update 2003. 8.25 Homology vs Protein Sco...sn*sn*ly*ssyk**w*i*fk*ye*rywyqssp sq****qqy************************q*q*q*x***xitkir**i**ekx*vl slyvskxtsxd*srs--- Homolog...auschii putative NBS-LRR resistance protein gene, complete cds. 46 0.34 1 AL731837 |AL731837.2 Sminthopsis D

  7. New treatment of early fetal chylothorax

    DEFF Research Database (Denmark)

    Nygaard, Ulrikka; Sundberg, Karin; Nielsen, Henriette Svarre;

    2007-01-01

    OBJECTIVE: To evaluate OK-432, a preparation of Streptococcus pyogenes, in the treatment of early fetal chylothorax. METHODS: A prospective study of all fetuses (n=7) with persistent early chylothorax (gestational ages 16-21 weeks) referred to the tertiary center of fetal medicine in Denmark in...... 2003-2005. Fetuses were injected with 0.2-1.0 mg of OK-432 into the pleural cavity. The treatment was repeated if there were persistent or increasing pleural effusions after 1-3 weeks. The main outcome measures included remission of pleural effusions and fetal and infant morbidity and mortality....... RESULTS: Total remission of pleural effusions was obtained in all fetuses after one or two intrapleural injections of OK-432. No adverse effects of the treatment were observed. No fetus developed hydrops, and all experienced an uncomplicated third trimester. All children were born healthy without pleural...

  8. In-building Unlicensed WiFi Band OFDM Signal Distribution over MMF&BIF Using VCSEL

    DEFF Research Database (Denmark)

    Deng, Lei; Jensen, Jesper Bevensee; Yu, Xianbin;

    2011-01-01

    For in-building applications, an OFDM-VCSEL RoF system operating in unlicensed WiFi band is experimentally tested using MMF and bend insensitive fiber (BIF). A spectral efficiency of 4.32 bit/s/Hz with 0.9 Gbps data rate is achieved.......For in-building applications, an OFDM-VCSEL RoF system operating in unlicensed WiFi band is experimentally tested using MMF and bend insensitive fiber (BIF). A spectral efficiency of 4.32 bit/s/Hz with 0.9 Gbps data rate is achieved....

  9. AcEST: BP914278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_B03 617 Adiantum capillus-veneris mRNA. clone: YMU001_000057_B03. BP914278 CL3891C ... TFIDIRFNSF 178 Query: 399 EGALPADLFSKDLDAIFINDNRFSSSIP --PTLGLSPVSVLVLANTPVSGCVPAGIGGMS 226 G++P + ++L+ +F ... INDN F++S+P P G + + L LAN +G +P I Sbjct: 179 SGSIP PQILGQNLEVLFINDNGFTASLPEIPGDGTTHILFLTLANNKFNGPLPRSI ... 310 Query: 432 LKYLDLRFNEFEGALPADLFSKDLDAIFINDNRFSSSIP PTLGLSPVSVLVLANTPVSGC 253 LR N L + ++DN F+ P GL VL ... 39 Query: 432 LKYLDLRFNEFEGALPADLFS-KDLDAIFINDNRFSSSIP PTLGL-SPVSVLVLANTPVS 259 L+ LD+ N+F G +PA L L+ + ++ ...

  10. ADAPT-A Drainage Analysis Planning Tool

    OpenAIRE

    Boelee, Leonore; Kellagher, Richard

    2015-01-01

    HR Wallingford are a partner in the EU funded TRUST project. They are involved in Work package 4.3 Wastewater and stormwater systems, to produce a model and report on a system sustainability analysis and potential for improvements for stormwater systems as Deliverable 4.3.2. This report is deliverable 4.3.2. It details the development of the tool ADAPT (A Drainage Analysis and Planning Tool). The objective of the tool is to evaluate the improvement requirements to a stormwat...

  11. Genetic and bibliographic information: AIF1 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available AIF1 allograft inflammatory factor 1 human Crohn disease (MeSH); Myocardial Infarct...205) > Inflammatory Bowel Diseases (C06.405.205.731) > Crohn Disease (C06.405.205.731.500) Digestive System Diseases (C06) > Gastro...05.469) > Inflammatory Bowel Diseases (C06.405.469.432) > Crohn Disease (C06.405.469.432.500) Cardiovascular...ion (MeSH) Digestive System Diseases (C06) > Gastrointestinal Diseases (C06.405) > Gastroenteritis (C06.405.

  12. The fatty acid and cholesterol composition of enriched egg yolk lipids obtained by modifying hens’ diets with fish oil and flaxseed

    OpenAIRE

    Yalçyn, Hasan; Basmacyoolu, Hatice; Kemal Ünal, Mustafa

    2007-01-01

    The effects of fish oil and flaxseed in the diets of laying hens on the cholesterol and fatty acid composition of egg lipids were studied. Isa-White laying hens and five experimental diets were used. The first diet was used as the control. Fish oil (1.5%), flaxseed (4.32% and 8.64) or both of them (1.5% fish oil and 4.32% flaxseed) were added to the others and hens were fed for 30 and 60 days. The cholesterol and fatty acid composition of the yolks were determined. No significant difference (p

  13. Západ Today, 1992-1993

    Czech Academy of Sciences Publication Activity Database

    Přibáň, Michal

    2001-01-01

    Roč. 49, č. 4 (2001), s. 419-432. ISSN 0009-0468 R&D Projects: GA ČR GA405/97/S017 Institutional research plan: CEZ:AV0Z9056905 Keywords : czech literature * czech literary magazines Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. The influence of PWHT regime on microstructure and creep rupture behaviour of dissimilar T92/TP316H ferritic/austenitic welded joints with Ni-based filler metal

    Czech Academy of Sciences Publication Activity Database

    Falat, L.; Výrostková, A.; Svoboda, Milan; Milkovič, O.

    2011-01-01

    Roč. 49, č. 6 (2011), s. 417-426. ISSN 0023-432X Institutional research plan: CEZ:AV0Z20410507 Keywords : dissimilar weldment T92/TP316H * post-weld heat treatment (PWHT) * microstructure Subject RIV: JG - Metallurgy Impact factor: 0.451, year: 2011

  15. Normobaric Hypoxia Induces Mild Damage to Epithelium of Terminal Bronchioles in Rabbits (Ultrastructural Study)

    Czech Academy of Sciences Publication Activity Database

    Uhlík, J.; Konrádová, V.; Vajner, L.; Adášková, Jana

    2005-01-01

    Roč. 50, č. 10 (2005), s. 432-438. ISSN 0375-8427 Source of funding: V - iné verejné zdroje Keywords : airways * Clara cells * ciliated cells * electron microscopy Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.621, year: 2005

  16. 76 FR 55819 - Track Safety Standards; Concrete Crossties

    Science.gov (United States)

    2011-09-09

    ... concrete crossties. See 76 FR 18,073. FRA received two petitions for reconsideration in response to the... 403(d), of the Rail Safety Improvement Act of 2008 (Pub. L. 110-432, Division A) (RSIA). See 75 FR 52..., FRA delayed the effective date of the final rule until October 1, 2011. See 76 FR 34,890 (June...

  17. File list: DNS.Oth.20.DNase-Seq.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.Oth.20.DNase-Seq.AllCell hg19 DNase-seq DNase-Seq Others SRX201256,SRX040399,SR...432 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.Oth.20.DNase-Seq.AllCell.bed ...

  18. Plant biomass and prediction of debarking caused by rodents in artificial regeneration of forest stands

    Czech Academy of Sciences Publication Activity Database

    Homolka, Miloslav; Heroldová, Marta; Kamler, Jiří

    2011-01-01

    Roč. 432, - (2011), s. 99-100. ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. Berlin, 26.09.2011-30.09.2011] R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : density * seed crop * snow cover * voles Subject RIV: EH - Ecology, Behaviour

  19. Dicty_cDB: Contig-U14921-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A4 alpha... 514 e-144 DQ980509_1( DQ980509 |pid:none) Thaumatomonas sp. TMT002 alpha tub... 514 e-144 EF432...1 e-140 DQ980507_1( DQ980507 |pid:none) Synura sphagnicola clone sptua3 al... 501 e-140 EF455794_1( EF455794 |pid:none) Thaumatomo

  20. 77 FR 38229 - Rules Prohibiting the Aggregation of Orders To Satisfy Minimum Block Sizes or Cap Size...

    Science.gov (United States)

    2012-06-27

    ... trades.\\10\\ \\7\\ See Real-Time Public Reporting of Swap Transaction Data, 75 FR 76,139 (Dec. 7, 2010), as corrected in Real-Time Public Reporting of Swap Transaction Data Correction, 75 FR 76,930 (Dec. 10, 2010.... 43.2(l), 75 FR 76,171. The Adopting Release finalized the term as ``large notional off-facility...

  1. Mikrotvrdost plazmově nitridovaných vrstev ocelí po implantaci a následném tepelném zpracování při teplotách 500-600°C

    Czech Academy of Sciences Publication Activity Database

    Hrubý, V.; Million, Bořivoj; Stránský, K.

    2001-01-01

    Roč. 39, č. 2 (2001), s. 110-120. ISSN 0023-432X R&D Projects: GA ČR GA106/98/1368 Institutional research plan: CEZ:AV0Z2041904 Keywords : plasma-nitrided layers * structurals steels * microhardness testing Subject RIV: JG - Metallurgy Impact factor: 0.343, year: 2001

  2. Eggshell strength of an obligate brood parasite: a test of the puncture resistance hypothesis

    Czech Academy of Sciences Publication Activity Database

    Antonov, A.; Stokke, B. G.; Moksnes, A.; Kleven, O.; Honza, Marcel; Roskaft, E.

    2006-01-01

    Roč. 60, č. 1 (2006), s. 11-18. ISSN 0340-5443 Grant ostatní: Research Council of Norway(NO) 151641/432 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * eggshell thickness * puncture resistance * Acrocephalus * cuckoo Subject RIV: EG - Zoology Impact factor: 2.316, year: 2006

  3. Updating RIGs: Including the Systematic Influence of Online Study on Student Evaluation of Teaching

    Science.gov (United States)

    Palmer, Stuart; Smith, Calvin

    2013-01-01

    Based on student evaluation of teaching (SET) ratings from 1,432 units of study over a period of a year, representing 74,490 individual sets of ratings, and including a significant number of units offered in wholly online mode, we confirm the significant influence of class size, year level, and discipline area on at least some SET ratings. We also…

  4. Synthesis of Novel N-9-Substituted Purine Derivatives from Polymer Supported alpha-Amino Acids

    Czech Academy of Sciences Publication Activity Database

    Vanda, D.; Jorda, Radek; Lemrová, B.; Volná, T.; Kryštof, Vladimír; McMaster, C.; Soural, M.

    2015-01-01

    Roč. 17, č. 7 (2015), s. 426-432. ISSN 2156-8952 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk(CZ) LO1304 Institutional support: RVO:61389030 Keywords : alpha-amino acids * solid-phase synthesis * purine derivatives Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.032, year: 2014

  5. Přejatá slova ve filmovém a divadelním lexiku v češtině a v ruštině

    Czech Academy of Sciences Publication Activity Database

    Součková, Ludmila

    2012-01-01

    Roč. 81, č. 4 (2012), s. 423-432. ISSN 0037-6736 R&D Projects: GA AV ČR IAA900920703 Institutional support: RVO:68378017 Keywords : loan words * Russian and Czech * film and theatre * vocabulary Subject RIV: AI - Linguistics

  6. K odborné kvalifikaci pěstounské rodiny

    Czech Academy of Sciences Publication Activity Database

    Mitlöhner, Miroslav

    Praha: ASPI, 2009 - (Winterová, A.; Dvořák, J.), s. 335-340 ISBN 978-80-7357-432-1 Institutional research plan: CEZ:AV0Z70680506 Keywords : family law * foster family Subject RIV: AG - Legal Sciences

  7. Experiment list: SRX1388769 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX1388769 ce10 Histone H3K9me3 Adult Young adult NA 3183642,96.9,6.1,432 GSM191965...5: WT 23C G2 rep2 H3K9me3ChIP; Caenorhabditis elegans; ChIP-Seq source_name=Young adult whole animal || geno

  8. A case with Lichen planus in the lines of Blaschko

    Directory of Open Access Journals (Sweden)

    Metehan Gençoğlu

    2011-12-01

    Full Text Available Lichen planus is an inflammatory disorder that may involveskin and mucous membranes. Linear lichen planusis a rare disorder occurring in approximately 0.2% of patientswith lichen planus. We report a case of linear lichenplanus on the upper extremity which lesions followed thelines of Blaschko. J Clin Exp Invest 2011; 2 (4: 430-432

  9. Afløbsinstallationer

    DEFF Research Database (Denmark)

    Ovesen, K.; Faldager, I.; Nielsen, V.

    Denne SBI-anvisning gennemgår hele afløbsområdet og giver beskrivelser, dimensioneringsvejledninger og eksempler med udgangspunkt i Norm for afløbsinstallationer, DS 432, 2.udgave 1994. I anvisningen behandles spildevands-, regnvands- og drænvandsinstallationer både i forbindelse med separat- og...

  10. Prepubertal unilateral gynecomastia and the presence of 47,XXY mosaicism in breast epithelial cells

    DEFF Research Database (Denmark)

    Andersen, Peter Stemann; Petersen, Bodil Laub; Juul, Anders;

    2013-01-01

    sclerotherapy with Picibanil (OK-432) was attempted without any detectable effect on size. The mass was later excised. The pathological examination revealed mammary gland tissue suggestive of idiopathic gynecomastia. FISH revealed 47, XXY mosaicism in the abnormal breast epithelial cells, but not in peripheral...

  11. Crystal structures of salts of mono- and triprotonated [3(6)]adamanzane, 1,5,9,13-tetraazatricyclo[7.7.3.3(5,13)]docosane, and equilibrium studies of the reactions between mono-, di- and triprotonated species, respectively, having none, one and two lone pairs pointing outwards

    DEFF Research Database (Denmark)

    Springborg, Johan; Pretzmann, Ulla; Olsen, Carl Erik;

    1998-01-01

    (4).3(2)]adz(+) is shown to undergo an acid catalyzed cleavage of one of the trimethylene bridges to give quantitatively the parent bowl adamanzane [2(4).3(1)]adz without further cleavage of N-C bonds. In contrast, the H[3(6)]adz(+) species withstands boiling for days in concentrated hydrochloric acid....

  12. Should I Stay or Should I Go? Physical Education Teachers' Career Intentions

    Science.gov (United States)

    Mäkelä, Kasper; Hirvensalo, Mirja; Whipp, Peter R.

    2014-01-01

    Purpose: This study investigated Finnish physical education (PE) teachers' intentions to leave the profession and the reasons behind them. Method: A large sample (N = 808) of PE teachers who graduated between 1980 and 2008 (432 women, 376 men) answered a modified job satisfaction and teacher follow-up questionnaire that elicited career…

  13. Does a Claims Diagnosis of Autism Mean a True Case?

    Science.gov (United States)

    Burke, James P.; Jain, Anjali; Yang, Wenya; Kelly, Jonathan P.; Kaiser, Marygrace; Becker, Laura; Lawer, Lindsay; Newschaffer, Craig J.

    2014-01-01

    The purpose of this study was to validate autism spectrum disorder cases identified through claims-based case identification algorithms against a clinical review of medical charts. Charts were reviewed for 432 children who fell into one of the three following groups: (a) more than or equal to two claims with an autism spectrum disorder diagnosis…

  14. 10 CFR 35.2432 - Records of calibration measurements of brachytherapy sources.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Records of calibration measurements of brachytherapy... Records § 35.2432 Records of calibration measurements of brachytherapy sources. (a) A licensee shall maintain a record of the calibrations of brachytherapy sources required by § 35.432 for 3 years after...

  15. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259. ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  16. Effect of preparation procedure on the formation of nanostructuredceria–zirconia mixed oxide catalysts for ethyl acetate oxidation:Homogeneous precipitation with urea vs template-assistedhydrothermal synthesis

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Ivanova, R.; Henych, Jiří; Dimitrov, M.; Kormunda, M.; Kovacheva, D.; Scotti, N.; Dal Santo, V.; Štengl, Václav

    2015-01-01

    Roč. 502, JUL (2015), s. 418-432. ISSN 0926-860X Institutional support: RVO:61388980 Keywords : Ceria–zirconia mixed oxides * Template-assisted hydrothermal method * Urea hydrolysis * Ethyl acetate oxidationa Subject RIV: CA - Inorganic Chemistry Impact factor: 3.942, year: 2014

  17. Rational design, efficient syntheses and biological evaluation of N,N '-symmetrically bis-substituted butylimidazole analogs as a new class of potent Angiotensin II receptor blockers

    Czech Academy of Sciences Publication Activity Database

    Agelis, G.; Resvani, A.; Koukoulitsa, C.; Tůmová, Tereza; Slaninová, Jiřina; Kalavrizioti, D.; Spyridaki, K.; Afantitis, A.; Melagraki, G.; Siafaka, A.; Gkini, E.; Megariotis, G.; Grdadolnik, S. G.; Papadopoulos, M. G.; Vlahakos, D.; Maragoudakis, M.; Liapakis, G.; Mavromoustakos, T.; Matsoukas, J.

    2013-01-01

    Roč. 62, Apr (2013), s. 352-370. ISSN 0223-5234 Institutional support: RVO:61388963 Keywords : AT1 receptor blockers * N,N '-Bis-alkylated butylimidazole analogs * synthesis * Wittig reaction * hydroxymethylation * structure elucidation Subject RIV: CC - Organic Chemistry Impact factor: 3.432, year: 2013

  18. 77 FR 25740 - Notice of Inventory Completion: Yale Peabody Museum of Natural History, New Haven, CT

    Science.gov (United States)

    2012-05-01

    ... National Park Service Notice of Inventory Completion: Yale Peabody Museum of Natural History, New Haven, CT...: Professor Derek E.G. Briggs, Director, Yale Peabody Museum of Natural History, P.O. Box 208118, New Haven... Natural History, P.O. Box 208118, New Haven, CT 06520-8118, telephone (203) 432-3752 before May 31,...

  19. Poznámky k práci moderátorů televizních politických debat a rozhlasových interview

    Czech Academy of Sciences Publication Activity Database

    Havlík, Martin

    2008-01-01

    Roč. 45, 1/2 (2008), s. 4-32. ISSN 1212-5326 R&D Projects: GA AV ČR KJB900610701 Institutional research plan: CEZ:AV0Z90610518 Keywords : turn-taking * interruptions * poitical debates * interviews Subject RIV: AI - Linguistics

  20. Genital forekomst af Chlamydia trachomatis hos abortsøgende--korrelerer med ung alder og nulliparitet, men ikke tidligere underlivsbetoendelse

    DEFF Research Database (Denmark)

    Sørensen, Jette Led; Thranov, I R; Hoff, G E

    1992-01-01

    Out of 432 women applying for termination of pregnancy, 7.9% (34/428) had cervical Chlamydia trachomatis and 0.7% (3/431) genital Neisseria gonorrhoeae. The prevalence of Chlamydia was 19.2% among the women applying for termination who were under 20 years and 12.8% among those aged 21-25 years. The...

  1. Longitudinální studium lidského vývoje: historie, výsledky a perspektivy pražské a brněnské studie celoživotního vývoje člověka

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Kebza, V.

    2011-01-01

    Roč. 55, č. 5 (2011), s. 422-432. ISSN 0009-062X R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : life-span development * longitudinal study * optimal development * personality * well-being * human strenghts Subject RIV: AN - Psychology Impact factor: 0.087, year: 2011

  2. Progress in sub-picosecond event timing

    Czech Academy of Sciences Publication Activity Database

    Pánek, Petr; Procházka, I.

    Warszawa: Polska Akademia Nauk, 2009 - (Schillak, S.), s. 428-432 [16th International Workshop on Laser Ranging. Poznaň (PL), 13.10.2008-17.10.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : time measurement Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  3. DISEASE CAUSED BY CHEMICAL AND PHYSICAL AGENTS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    2004001 Renal dysfunction in workers exposed to arsenic and cadmium. HONG Feng (洪峰), et al. Dept Occup Health & Toxicol, Public Health Sch, Fudan Univ, Shanghai 200032. Chin J Ind Hyg Occup Dis 2003;21(6) : 432-436.Objective: To examine the nephrotoxicity induced by

  4. Creep of three-phase alloy Fe-30%Al-5.2%Zr

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Ferdinand; Kratochvíl, P.; Kejzlar, P.

    2015-01-01

    Roč. 53, č. 3 (2015), s. 127-132. ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP108/12/1452 Institutional support: RVO:68081723 Keywords : iron aluminides * creep * precipitation Subject RIV: JG - Metallurgy Impact factor: 0.406, year: 2014

  5. Influence of annealing on the microstructure of commercial Mg alloy AZ31 after mechanical forming

    Czech Academy of Sciences Publication Activity Database

    Jäger, A.; Lukáč, P.; Gärtnerová, Viera; Haloda, J.; Dopita, M.

    2006-01-01

    Roč. 432, 1-2 (2006), 20-25. ISSN 0921-5093 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnesium * texture * static recrystallization * grain boundaries * twinning * electron backscatter diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.490, year: 2006

  6. Microstructural mechanisms of creep in gamma Ti-52Al

    Czech Academy of Sciences Publication Activity Database

    Orlová, Alena; Kuchařová, Květa; Dlouhý, Antonín

    43 2005, č. 1 (2005), s. 55-65. ISSN 0023-432X R&D Projects: GA MŠk(CZ) OC 522.100; GA AV ČR(CZ) IBS2041001 Institutional research plan: CEZ:AV0Z20410507 Keywords : intermetallics * titanium aluminides * creep Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  7. Zakladatelský význam díla Viktora Knappa pro právní komparatistiku v České republice

    Czech Academy of Sciences Publication Activity Database

    Blahož, Josef

    Plzeň : Aleš Čeněk, 2014 - (Gerloch, A.), s. 425-432 ISBN 978-80-7380-509-8 Institutional support: RVO:68378122 Keywords : eminent lawyer * comparative law * civil law Subject RIV: AG - Legal Sciences

  8. Oxidation of aniline with strong and weak oxidants

    Czech Academy of Sciences Publication Activity Database

    Sapurina, I. Yu.; Stejskal, Jaroslav

    2012-01-01

    Roč. 82, č. 2 (2012), s. 256-275. ISSN 1070-3632 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * oxidant Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.432, year: 2012

  9. Long-term follow-up of cognitive outcome after breech presentation at birth

    DEFF Research Database (Denmark)

    Sørensen, Henrik Toft; Steffensen, Flemming Hald; Olsen, Jørn;

    1999-01-01

    Boerge Prien IQ test. A total of 164 conscripts were born in breech presentation and 70 (42.7%) of these were delivered after Caesarean section. The mean Boerge Prien test score was 43.2 among men born in cephalic presentation and 39.9 among those born in breech presentation for a difference of 3.3 (95...

  10. 40 CFR 81.327 - Montana.

    Science.gov (United States)

    2010-07-01

    ... List of CFR Sections Affected which appears in the Finding Aids section of the printed volume and on... Northern boundary - horizontal universal transverse mercatur(UTM) 5,162,000 mN; eastern boundary - vertical UTM 432,500 mE; southern boundary - horizontal UTM 5,158,000 mN; western boundary - vertical UTM...

  11. The initial bearing capacities of subchondral bone replacements considerably contributing to chondrogenesis

    Czech Academy of Sciences Publication Activity Database

    Petrtýl, M.; Danešová, J.; Lísal, J.; Šenolt, L.; Hulejová, H.; Polanská, M.; Bastl, Zdeněk; Kruliš, Zdeněk; Černý, P.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 59-65. ISSN 1509-409X R&D Projects: GA ČR GA106/06/0761 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z40500505 Keywords : biomechanics * osteochondral defects * polymer replacement Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.432, year: 2010

  12. Leadership Style, Use of Power, and Conflict Management Style: Implications for Supervision and Training Programs.

    Science.gov (United States)

    Richmond, Virginia P.; And Others

    A study investigated the degree of association between supervisor and subordinate perceptions of the supervisor's leadership style, use of power, and conflict management style. Subjects were 87 supervisors and 432 subordinates from five service-oriented, publicly supported organizations. The supervisors completed measures of leadership style, use…

  13. Dependence of the length of the hydrogen bond on the covalent and cationic radii of hydrogen, and additivity of bonding distances

    Czech Academy of Sciences Publication Activity Database

    Heyrovská, Raji

    2006-01-01

    Roč. 432, č. 1-3 (2006), s. 348-351. ISSN 0009-2614 R&D Projects: GA MŠk(CZ) LC06035 Institutional research plan: CEZ:AV0Z50040507 Keywords : length of the hydrogen bond * ionic radius * Golden ratio Subject RIV: BO - Biophysics Impact factor: 2.462, year: 2006

  14. CYP1B1 genotype and risk of cardiovascular disease, pulmonary disease, and cancer in 50,000 individuals

    DEFF Research Database (Denmark)

    Kaur-Knudsen, D.; Nordestgaard, B.G.; Tybjaerg-Hansen, A.;

    2009-01-01

    OBJECTIVE: Cytochrome P450 (CYP) 1B1 enzymes metabolize tobacco-smoke polycyclic aromatic hydrocarbons and 17beta-estradiol. CYP1B1*3 (rs1056836 = Leu432Val = 4326C>G) and CYP1B1*4 (rs1800440 = Asn453Ser = 4390A>G) influence this metabolism. We, therefore, hypothesized that these two polymorphism...

  15. Abstrakta v českých a slovenských nářečích

    Czech Academy of Sciences Publication Activity Database

    Hlubinková, Zuzana

    2014-01-01

    Roč. 83, č. 4 (2014), s. 432-435. ISSN 0037-6736 R&D Projects: GA ČR GAP406/11/1786 Keywords : abstracts * nouns denoting actions * nouns denoting qualities * suffix * Czech dialects * Slovak dialects Subject RIV: AI - Linguistics

  16. Príprava Cu/FeS nanočastíc mechanochemickou redukciou sulfidu medi

    Czech Academy of Sciences Publication Activity Database

    Baláž, P.; Takacs, L.; Jiang, J.; Luxová, M.; Godočíková, E.; Bastl, Zdeněk; Briančin, J.

    2002-01-01

    Roč. 40, č. 4 (2002), s. 268-280. ISSN 0023-432X Institutional research plan: CEZ:AV0Z4040901 Keywords : mechanochemical reduction * Cu/FeS nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.493, year: 2002

  17. Corporal Punishment and Child Behavioural and Cognitive Outcomes through 5?Years of Age: Evidence from a Contemporary Urban Birth Cohort Study

    Science.gov (United States)

    MacKenzie, Michael J.; Nicklas, Eric; Waldfogel, Jane; Brooks-Gunn, Jeanne

    2012-01-01

    This study examined the prevalence and determinants of spanking of children at 3?years of age and the associations between spanking and externalizing behaviour and receptive verbal ability at age 5?years. Overall, we find maternal spanking rates of 55.2% and paternal rates of 43.2% at age 3?years. Mothers facing greater stress and those who…

  18. Výběr středního vzdělání v rodinách podle skupinových diskuzí

    Czech Academy of Sciences Publication Activity Database

    Vojtíšková, Kateřina

    2009-01-01

    Roč. 5, 019 (2009), s. 3-38. ISSN 1801-5999 R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : focus groups * family * secondary education Subject RIV: AM - Education http://publication.fsv.cuni.cz/eng/attachments/432_019%20-%20Vojtiskova.pdf

  19. Mutations in sodium channel {beta}-subunit SCN3B are associated with early-onset lone atrial fibrillation

    DEFF Research Database (Denmark)

    Olesen, Morten Salling; Jespersen, Thomas; Nielsen, Jonas Bille;

    2011-01-01

    -synonymous mutations were found in SCN3B (R6K, L10P, and M161T). Two mutations were novel (R6K and M161T). None of the mutations were present in the control group (n = 432 alleles), nor have any been previously reported in conjunction with AF. All SCN3B mutations affected residues that are evolutionarily conserved...

  20. Fusion energy from plasma block ignition

    Czech Academy of Sciences Publication Activity Database

    Hora, H.; Badziak, J.; Glowacz, S.; Jablonski, S.; Skladanowski, Z.; Osman, F.; Cang, Y.; Zhang, J.; Miley, G. H.; Peng, H.; He, X.; Zhang, W.; Rohlena, Karel; Ullschmied, Jiří; Jungwirth, Karel

    2005-01-01

    Roč. 23, - (2005), s. 423-432. ISSN 0263-0346 R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z10100523 Keywords : fusion energy * laser fusion * nonlinear force * plasma block ignition * ponderomotion * skin layer Subject RIV: BH - Optics, Masers, Laser s Impact factor: 2.590, year: 2005

  1. Appraising Gender Role Portrayals in TV Commercials.

    Science.gov (United States)

    Kolbe, Richard H.; Langefeld, Carl D.

    1993-01-01

    Examines gender role orientations of characters in prime time television advertisements through the Bem Sex-Role Inventory (BSRI) completed by 426 college students (43.2% females). Results confirm the appropriateness of the scale for self- and person-perception ratings. Uses of the BSRI in gender role research are discussed. (SLD)

  2. Analysis of Medication Errors of Health Care Providers on the Basis of Data from the Czech Toxicological Information Centre over an 11-Year Period (2000-2010)

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Navrátil, Tomáš; Pelclová, D.

    2012-01-01

    Roč. 110, č. 5 (2012), s. 427-432. ISSN 1742-7835 R&D Projects: GA AV ČR IAA400400806; GA ČR GAP206/11/1638 Institutional research plan: CEZ:AV0Z40400503 Keywords : ADVERSE DRUG EVENTS * PEDIATRIC INPATIENTS * ADMINISTRATION ERRORS Subject RIV: CG - Electrochemistry Impact factor: 2.124, year: 2012

  3. Nemocný, zraněný a sám. Ojedinělý mladolaténský kostrový hrob z Kolína

    Czech Academy of Sciences Publication Activity Database

    Valentová, J.; Šumberová, Radka; Brzobohatá, Hana; Likovský, Jakub

    Brno : Moravské zemské muzeum, 2014 - (Čižmářová, J.; Venclová, N.; Březinová, G.), s. 595-614 ISBN 978-80-7028-432-2 Institutional support: RVO:67985912 Keywords : Bohemia * La Tène * grave in settlement context * iron fibula * pathology * head injury Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Time-on-task impairment of psychomotor vigilance is affected by mild skin warming and changes with aging and insomnia

    NARCIS (Netherlands)

    Raymann, R.J.E.M.; Someren, E.J. van

    2007-01-01

    Study Objectives: To investigate the effect of mild manipulations of core and skin temperature on psychomotor vigilance (PVT) in young adults, elderly, and elderly insomniacs. Design: 432 PVTs were obtained during a 2-day semi-constant routine protocol, while differentially manipulating core and ski

  5. 77 FR 74798 - Awards for Information Relating To Detecting Underpayments of Tax or Violations of the Internal...

    Science.gov (United States)

    2012-12-18

    ... the Tax Relief and Health Care Act of 2006, Public Law 109-432 (120 Stat. 2922), enacted on December... Underpayments of Tax or Violations of the Internal Revenue Laws AGENCY: Internal Revenue Service (IRS), Treasury... provide guidance on submitting information regarding underpayments of tax or violations of the...

  6. Blood Pressure and Impedance Cardiography duríng Tilt Table Test

    Czech Academy of Sciences Publication Activity Database

    Jurák, Pavel; Halámek, Josef; Vondra, Vlastimil; Plachý, M.; Fráňa, P.; Leinveber, Pavel

    2009-01-01

    Roč. 36, - (2009), s. 429-432. ISSN 0276-6574 R&D Projects: GA AV ČR IAA200650801 Institutional research plan: CEZ:AV0Z20650511 Keywords : blood pressure * heart rate * thoracic impedance cardiography Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering http://cinc.mit.edu/archives/2009/pdf/0429.pdf

  7. Characteristic of monotonicity of Orlicz function spaces equipped with the Orlicz norm

    Czech Academy of Sciences Publication Activity Database

    Foralewski, P.; Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2013-01-01

    Roč. 53, č. 2 (2013), s. 421-432. ISSN 0373-8299 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : Orlicz space * Köthe space * characteristic of monotonicity Subject RIV: BA - General Mathematics

  8. The effect of cocaine sensitization on mouse immunoreactivity

    Czech Academy of Sciences Publication Activity Database

    Kubera, M.; Filip, M.; Basta-Kaim, A.; Nowak, E.; Siwanowicz, J.; Zajícová, Alena; Holáň, Vladimír; Maes, M.; Lasoń, W.

    2004-01-01

    Roč. 483, - (2004), s. 309-315. ISSN 0014-2999 R&D Projects: GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5052915 Keywords : cocaine sensitization, cytokine Subject RIV: EC - Immunology Impact factor: 2.432, year: 2004

  9. Gender in plants: sex chromosomes are emerging from the fog

    Czech Academy of Sciences Publication Activity Database

    Vyskot, Boris; Hobza, Roman

    2004-01-01

    Roč. 20, č. 9 (2004), s. 432-438. ISSN 0168-9525 R&D Projects: GA AV ČR(CZ) KSK5052113 Keywords : sex chromosomes * dioecious papaya * evolution Subject RIV: BO - Biophysics Impact factor: 14.643, year: 2004

  10. 77 FR 5492 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for...

    Science.gov (United States)

    2012-02-03

    ...: Jason Berthiaume, Fishery Management Specialist, phone (978) 281-9177. SUPPLEMENTARY INFORMATION: This notice is a revision to a previously published Federal Register notice (76 FR 65698). Complete project... quahogs utilizing a 170-inch (432-cm) hydraulic clam dredge for the vessel F/V SEAWATCHER I, and two...

  11. 76 FR 32392 - Notice of Allocation Availability (NOAA) Inviting Applications for the CY 2011 Allocation Round...

    Science.gov (United States)

    2011-06-06

    ... published by the CDFI Fund on how an entity may apply to become certified as a CDE (66 FR 65806, December 20... Applications for the CY 2011 Allocation Round of the New Markets Tax Credit Program Announcement Type: Initial.... L. 109-432), and section 733 of the Tax Relief, Unemployment Insurance Reauthorization and...

  12. Microstructure characterisation of Al65Cr28Fe7 quasicristalline approximant

    Czech Academy of Sciences Publication Activity Database

    Janovec, J.; Svoboda, Milan; Dolinšek, J.; Godec, M.; Buršík, Jiří; Dusza, J.

    2006-01-01

    Roč. 44, č. 6 (2006), s. 313-320. ISSN 0023-432X Institutional research plan: CEZ:AV0Z20410507 Keywords : quasicristalline approximant * substructure * transmission electron microscopy Subject RIV: JG - Metallurgy Impact factor: 1.138, year: 2006

  13. 78 FR 45604 - Funding Opportunity Title: Notice of Allocation Availability (NOAA) Inviting Applications for the...

    Science.gov (United States)

    2013-07-29

    ... Relief and Health Care Act of 2006 (Pub. L. 109-432), section 733 of the Tax Relief, Unemployment... active role in designing or implementing its investment criteria and/or decisions; and, if it is a... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE...

  14. Azole-Resistant Invasive Aspergillosis

    DEFF Research Database (Denmark)

    Stensvold, Christen Rune; Jørgensen, Lise Nistrup; Arendrup, Maiken Cavling

    2012-01-01

    gene coupled with point mutation (s) in CYP51A (TR34/L98H and TR46/Y121F/T289A). In the third a single target enzyme alteration (G432S) is found. These resistant “environmental” strains have been detected in many West-European countries as well as in the Asia- Pacifics. Noticeably, these two continents...

  15. Prevalence of hemoprotozoan diseases in cattle population of chittagong division, Bangladesh

    DEFF Research Database (Denmark)

    Alim, Md. Abdul; Das, Shubhagata; Roy, Krisna;

    2012-01-01

    A one year (2009-10) prevalence study on hemoprotozoan diseases was conducted in crossbred and indigenous cattle, Chittagong, Bangladesh. Blood samples were collected randomly from 216 crossbred and 432 indigenous cattle of four representative areas in three consecutive seasons. Samples were...

  16. Negative Intrusive Thoughts and Dissociation as Risk Factors for Self-Harm

    Science.gov (United States)

    Batey, Helen; May, Jon; Andrade, Jackie

    2010-01-01

    Relationships between self-harm and vulnerability factors were studied in a general population of 432 participants, of whom 30% reported some experience of self-harm. This group scored higher on dissociation and childhood trauma, had lower self-worth, and reported more negative intrusive thoughts. Among the non-harming group, 10% scored similarly…

  17. Prevalence and diversity of Arcobacter spp. isolated from the internal organs of spontaneous porcine abortions in Denmark

    DEFF Research Database (Denmark)

    On, Stephen L.W.; Jensen, Tim Kåre; Bille-Hansen, Vivi;

    2002-01-01

    pathogens (Brucella, Leptospira, PPV PRRSV), but Arcobacter spp, were recovered from 23/55 abortions. Co-infections with Streptococcus suis, Escherichia coli, and haemolytic streptococci were observed in 7/23 Arcobacter-positive fetuses, and in 4/32 Arcobacter-negative fetuses, Histopathological analyses...

  18. 75 FR 70625 - Annual Funding Notice for Defined Benefit Plans

    Science.gov (United States)

    2010-11-18

    ... regulation 26 CFR 1.432(a)-1(b)(7); 73 FR 14417, 14423 (March 18, 2008). c. Assets and Liabilities (Proposed... Policies; Asset Allocation (Proposed Sec. 2520.101-5(b)(5)) Section 101(f)(2)(B)(iv) of ERISA provides that... asset allocation of investments under the plan (expressed as percentages of total assets) as of the...

  19. On the error term in an asymptotic formula for the symmetric square L-function

    OpenAIRE

    Lau, YK

    2004-01-01

    Recently Wu proved that for all primes q, ∑ f L(1, sym 2 f) = π 4/432 q + O(q 27/28 log B q) where f runs over all normalized newforms of weight 2 and level q. Here we show that 27/28 can be replaced by 9/10.

  20. 76 FR 60047 - Agency Information Collection Activities; Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-09-28

    ... Rule. 76 FR 40731. No comments were received. Pursuant to the OMB regulations, 5 CFR part 1320, that... Utilized in Home Entertainment Products (``Amplifier Rule'' or ``Rule''), 16 CFR part 432 (OMB Control... performance characteristics of amplifiers in stereos and other home entertainment equipment. The Rule...

  1. Structures of a novel phosphoric triamide and its organotin(IV) complex

    Czech Academy of Sciences Publication Activity Database

    Shariatinia, Z.; Mirhosseini Mousavi, H.S.; Bereciartua, P.J.; Dušek, Michal

    2013-01-01

    Roč. 745, NOV (2013), s. 432-438. ISSN 0022-328X Grant ostatní: AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : organotin(IV) complex * phosphoric triamide * X-ray crystallography * hydrogen bond * nanoparticles * NMR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.302, year: 2013

  2. The development of a new class of inhibitors for betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Pícha, Jan; Vaněk, Václav; Buděšínský, Miloš; Mládková, Jana; Garrow, T. A.; Jiráček, Jiří

    2013-01-01

    Roč. 65, July (2013), s. 256-275. ISSN 0223-5234 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : BHMT * inhibitor * homocysteine * phosphonate * phosphinate * amino acid derivative * bioisostere * S-alkylated homocysteine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  3. Distinguishable Signature of UHP and Non-UHP Granitic Gneisses in the Sulu Terrane: Evidence from Mineral Inclusions in Zircons

    Institute of Scientific and Technical Information of China (English)

    LIU Fulai; XU Zhiqin; YANG Jingsui; ZHANG Zeming; S. MARUYAMA; J. G. LIOU; I.KATAYAMA; S. MASAGO

    2001-01-01

    @@ The pre-pilot drillhole CCSD-PP1 of the Chinese Continental Scientific Drilling Project, with a depth of 432.08 m, is located in the Donghai area in the southeastern Sulu terrane. The core samples are comprised mainly of paragneiss, granitic gneiss and ultramafic rock with minor intercalated layers of phengite-bearing kyanite quartzite and eclogite.

  4. Current status of Co-Re-based alloys being developed to supplement Ni-based superalloys for ultra-high temperature applications in gas turbines

    Czech Academy of Sciences Publication Activity Database

    Mukherji, D.; Strunz, Pavel; Gilles, R.; Karge, L.; Rösler, J.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 287-294. ISSN 0023-432X EU Projects: European Commission(XE) 283883 - NMI3-II Institutional support: RVO:61389005 Keywords : Co-base alloy * scanning electron microscopy (SEM) * neutron scattering Subject RIV: JG - Metallurgy Impact factor: 0.406, year: 2014

  5. Factors influencing creep resistance in discontinuously reinforced magnesium metal matrix composites

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Kvapilová, Marie; Svoboda, Milan

    2015-01-01

    Roč. 53, č. 4 (2015), s. 221-229. ISSN 0023-432X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : magnesium alloy s * composites * creep properties testing * structure * fibres * interfaces Subject RIV: JG - Metallurgy Impact factor: 0.406, year: 2014

  6. Facile synthesis of nitrophenyl 2-acetamido-2-deoxy-alpha-D-mannopyranosides from ManNAc-oxazoline

    Czech Academy of Sciences Publication Activity Database

    Křenek, Karel; Šimon, Petr; Weignerová, Lenka; Fliedrová, Barbora; Kuzma, Marek; Křen, Vladimír

    2012-01-01

    Roč. 8, MAR 2012 (2012), s. 428-432. ISSN 1860-5397 R&D Projects: GA ČR GAP207/10/0321; GA MŠk(CZ) 7E11011 Keywords : alpha-ManNAc * glycosylation * glycosidase Subject RIV: CC - Organic Chemistry Impact factor: 2.801, year: 2012

  7. Mechanické vlastnosti hybridních laminátů s uhlíkovými vlákny

    Czech Academy of Sciences Publication Activity Database

    Chlupová, Alice; Dymáček, P.

    2002-01-01

    Roč. 40, č. 3 (2002), s. 195-208. ISSN 0023-432X Institutional research plan: CEZ:AV0Z2041904 Keywords : composites * laminates * fatigue Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

  8. Anomalous high temperature creep behaviour of an Al-8.5Fe-1.3V-1.7Si (8009Al type) alloy reinforced with alumina short fibres

    Czech Academy of Sciences Publication Activity Database

    Čadek, Josef; Kuchařová, Květa

    2004-01-01

    Roč. 42, č. 1 (2004), s. 9-20. ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : High temperature creep- load transfer Subject RIV: JI - Composite Materials Impact factor: 1.056, year: 2004

  9. Creep Behaviour of an Aluminium Alloy Reinforced by Silicon Carbide Particulates

    Czech Academy of Sciences Publication Activity Database

    Pahutová, Marie; Šustek, Vladimír; Čadek, Josef

    1998-01-01

    Roč. 36, 3-S (1998), s. 57-61. ISSN 0023-432X. [International Colloquium on Material Structure and Micromechanics of Fracture (2.). Brno, 01.07.1998-03.07.1998] R&D Projects: GA AV ČR IAA2041607 Subject RIV: JG - Metallurgy Impact factor: 0.264, year: 1998

  10. The effect of carbon on high temperature deformation of Fe-40Al-xC (at.%) ternary alloys

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Ferdinand; Kratochvíl, P.; Vodičková, V.; Milička, Karel; Pešička, J.

    2008-01-01

    Roč. 46, č. 2 (2008), s. 97-103. ISSN 0023-432X R&D Projects: GA ČR GA106/05/0409 Institutional research plan: CEZ:AV0Z20410507 Keywords : iron aluminides * creep * high temperature deformation Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  11. Creep threshold of a Mg-4Al-1Ca alloy

    Czech Academy of Sciences Publication Activity Database

    Milička, Karel

    2008-01-01

    Roč. 46, č. 6 (2008), s. 323-329. ISSN 0023-432X R&D Projects: GA ČR GA106/06/1354 Institutional research plan: CEZ:AV0Z20410507 Keywords : magnesium alloys * creep * threshold behaviour * threshold stress concept * mechanisms of creep Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  12. The effect of carbon on the structure of Fe-40Al-xC (at.%)

    Czech Academy of Sciences Publication Activity Database

    Vodičková, V.; Kratochvíl, P.; Dobeš, Ferdinand

    2007-01-01

    Roč. 45, č. 3 (2007), s. 153-158. ISSN 0023-432X Institutional research plan: CEZ:AV0Z20410507 Keywords : iron aluminide (Fe-Al type) * phase composition Subject RIV: JG - Metallurgy Impact factor: 1.345, year: 2007

  13. 3,3´-(Ethane-1,2-diyl)bis(6-methyl-3.4-dihydro-2H-1,3-benzoxazine)

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Camacho, J.; Ríos-Motta, J.; Pojarová, Michaela; Dušek, Michal

    2011-01-01

    Roč. 67, Part 8 (2011), o2028-u432. ISSN 1600-5368 Grant ostatní: AVČR(CZ) Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : crystal structure * SHELX97 * benzoxazine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.347, year: 2011

  14. Constant structure creep experiments on aluminium

    Czech Academy of Sciences Publication Activity Database

    Milička, Karel

    2011-01-01

    Roč. 49, č. 5 (2011), s. 307-318. ISSN 0023-432X R&D Projects: GA AV ČR IAA2041203 Institutional research plan: CEZ:AV0Z20410507 Keywords : mechanical properties * high temperature deformation * creep * aluminium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.451, year: 2011

  15. A New "online" Method to Measure Increased Exhaled Isoprene in end-stage Renal Failure

    Czech Academy of Sciences Publication Activity Database

    Davies, S.; Španěl, Patrik; Smith, D.

    2001-01-01

    Roč. 16, - (2001), s. 836-839. ISSN 0931-0509 R&D Projects: GA ČR GA203/97/P130 Institutional research plan: CEZ:AV0Z4040901 Keywords : biocompatibility * haemodialysis * SIFT-MS Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.432, year: 2001

  16. Die exklusive Position Böhmens und Visualisierung der europäischen Nationen und Regionen in der Universitätsthese von Johann Friedrich von Waldstein (1661)

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Petr

    Praha: Casablanca, 2013 - (Bobková, L.; Fantysová-Matějková, J.; Hrachovec, P.; Zdichynec, J.), s. 432-444 ISBN 978-80-87292-25-9 Institutional support: RVO:67985955 Keywords : Concept of Europe * Intellectual History * Bohemia * Prague University * Early Modern Ages Subject RIV: AB - History

  17. Afløbsinstallationer - systemer og dimensionering

    DEFF Research Database (Denmark)

    Brandt, Erik; Faldager, Inge

    SBi-anvisning 255 beskriver afløbssystemer og retningslinjer for dimensionering af afløbssystemer i henhold til Bygningsreglementet og derigennem DS 432:2009. Anvisningen henvender sig til projekterende og udførende af afløbsinstallationer i nybyggeri eller eksisterende byggeri, eller som skal re...

  18. 77 FR 27814 - Model Safety Evaluation for Plant-Specific Adoption of Technical Specifications Task Force...

    Science.gov (United States)

    2012-05-11

    ... 4) end state rather than a cold shutdown (Mode 5) end state. The model SE will facilitate expedited... ISTS to permit, for some systems, entry into a hot shutdown (Mode 4) end state rather than a cold... Traveler TSTF-432, Revision 1, ``Change in Technical Specifications End States (WCAP-16294)'' Using...

  19. The significance of methionine, histidine and tryptophan in plant responses and adaptation to cadmium stress

    Czech Academy of Sciences Publication Activity Database

    Zemanová, V.; Pavlík, Milan; Pavlíková, D.; Tlustoš, P.

    2014-01-01

    Roč. 60, č. 9 (2014), s. 426-432. ISSN 1214-1178 Institutional support: RVO:61389030 Keywords : abiotic stress * amino acids * heavy metals Subject RIV: CE - Biochemistry Impact factor: 1.226, year: 2014 http://www.agriculturejournals.cz/publishedArticles/PSE/2014-60-9-426

  20. Compensation of Flicker Emitted by Wind Turbines

    Czech Academy of Sciences Publication Activity Database

    Chomát, Miroslav; Bendl, Jiří; Schreier, Luděk

    Sydney: The University of Newcastle Australia, 2004, s. 429-432. [Symposium IFAC (International Federation of Automatic Control) on Mechatronic Systems /3./. Sydney (AU), 06.09.2004-08.09.2004] R&D Projects: GA AV ČR IAA2057102 Keywords : wind turbines * flicker * induction generators Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  1. Dicty_cDB: Contig-U04690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available from Patent WO02070737. 44 5.8 1 ( AC004028 ) Homo sapiens PAC clone RP4-800B9 from 7, complete... 44 5.8 1 ( AC153098 ) Carol...lia perspicillata clone 432B2, WORKING DRAFT... 44 5.8 1 ( AC152359 ) Carol

  2. Endosomal sorting of VAMP3 is regulated by PI4K2A

    Czech Academy of Sciences Publication Activity Database

    Jovic, M.; Kean, M. J.; Dubánková, Anna; Bouřa, Evžen; Gingras, A. C.; Brill, J. A.; Balla, T.

    2014-01-01

    Roč. 127, č. 17 (2014), s. 3745-3756. ISSN 0021-9533 Institutional support: RVO:61388963 Keywords : PI4K2A * VAMP3 * PtdIns4P * vesicle fusion * sorting * SNARE Subject RIV: CE - Biochemistry Impact factor: 5.432, year: 2014

  3. Dietary fat intake and subsequent weight change in adults: results from the European Prospective Investigation into Cancer and Nutrition cohorts

    DEFF Research Database (Denmark)

    Forouhi, Nita G; Sharp, Stephen J; Du, Huaidong; van der A, Daphne L; Halkjaer, Jytte; Schulze, Matthias B; Tjønneland, Anne; Overvad, Kim; Jakobsen, Marianne Uhre; Boeing, Heiner; Buijsse, Brian; Palli, Domenico; Masala, Giovanna; Feskens, Edith J M; Sørensen, Thorkild I A; Wareham, Nicholas J

    2009-01-01

    weight divided by duration of follow-up). DESIGN: We analyzed data from 89,432 men and women from 6 cohorts of the EPIC (European Prospective Investigation into Cancer and Nutrition) study. Using country-specific food-frequency questionnaires, we examined the association between baseline fat intake...

  4. Vole impact on tree regeneration: insights into forest management

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Homolka, Miloslav; Tkadlec, Emil; Kamler, Jiří; Suchomel, J.; Purchart, L.; Krojerová, Jarmila; Barančeková, Miroslava; Turek, K.; Baňař, M.

    2011-01-01

    Roč. 432, - (2011), s. 101-102. ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. Berlin, 26.09.2011-30.09.2011] R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : environmental variables * forest regeneration * vole impact Subject RIV: EH - Ecology, Behaviour

  5. Structure and properties of a powder metallurgy Al-Zr-Ti alloy

    Czech Academy of Sciences Publication Activity Database

    Málek, P.; Janeček, M.; Bartuška, Pavel

    2002-01-01

    Roč. 40, č. 6 (2002), s. 371-388. ISSN 0023-432X Institutional research plan: CEZ:AV0Z1010914 Keywords : Al-1.25at. * (Zr+Ti) alloys * gas atomisation * chemical and phase composition * microstructure * microhardness * tensile tests Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.493, year: 2002

  6. Influence of cooling rate and cerium addition on rapidly solidified Al-TM alloys

    Czech Academy of Sciences Publication Activity Database

    Michalcová, A.; Vojtěch, D.; Schumacher, G.; Novák, P.; Klementová, Mariana; Šerák, J.; Mudrová, M.; Valdaufová, J.

    2010-01-01

    Roč. 48, č. 1 (2010), s. 1-7. ISSN 0023-432X Institutional research plan: CEZ:AV0Z40320502 Keywords : rapid solidification * Al-TM * microstructure * aluminium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2010

  7. Parenting Styles and Health-Related Behavior in Childhood and Early Adolescence: Results of a Longitudinal Study

    Science.gov (United States)

    Lohaus, Arnold; Vierhaus, Marc; Ball, Juliane

    2009-01-01

    This study addresses the development of health-related behavior during childhood and adolescence and the protective influence of an authoritative parenting style. The study is based on two samples followed from Grades 2 through 5 and from Grades 4 through 7. The first sample consisted of 432 second graders with a mean age of 7.9 years at the…

  8. Cyclic plastic response and fatigue life of duplex and superduplex stainless steel

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav

    43 2005, č. 4 (2005), s. 280-289. ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/02/0584 Institutional research plan: CEZ:AV0Z20410507 Keywords : duplex steel * fatigue life * cyclic plasticity Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  9. The Effects of Low Atmosphere Stunning and Deboning Time on Broiler Breast Meat Quality

    Science.gov (United States)

    A randomized complete block design with 3 replications (n = 432, 72 broilers per treatment) was used to evaluate the effects of electrical (ES) and vacuum stunning (VS) on broiler breast meat quality. Electrical stunning was performed by applying 11.5 V, <0.05 mA, AC to DC current for 3 s for each b...

  10. Nod2 is required for the regulation of commensal microbiota in the intestine

    Czech Academy of Sciences Publication Activity Database

    Petnicki-Ocwieja, T.; Hrnčíř, Tomáš; Liu, Y.-J.; Biswas, A.; Hudcovic, Tomáš; Tlaskalová, Helena; Kobayashi, K.

    2009-01-01

    Roč. 106, č. 37 (2009), s. 15813-15818. ISSN 0027-8424 R&D Projects: GA ČR GA303/06/0974 Institutional research plan: CEZ:AV0Z50200510 Keywords : commensal bacteria * crohn's disease * mouse Subject RIV: EC - Immunology Impact factor: 9.432, year: 2009

  11. Drug: D10404 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available glutamic acid [CPD:C01879]) (glycosylation site: H304, H'304) Peptide Crohn's disease, ulcerative coli...27-L'216, H'268-H'328, H'374-H'432, L23-L89, L136-L196, L'23-L'89, L'136-L'196) (modified residues: H1, H'1 Q=pyro

  12. Pornography, panopticism and the Criminal Justice and Immigration Act 2008

    OpenAIRE

    Petley, J

    2009-01-01

    This is the accepted version of the following article: Petley, J. (2009), Pornography, Panopticism and the Criminal Justice and Immigration Act 2008. Sociology Compass, 3: 417–432, which has been published in final form at http://onlinelibrary.wiley.com/doi/10.1111/j.1751- 9020.2009.00212.x/abstract.

  13. 5. Beethoven-Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik, 27.– 29. srpna 2012

    Czech Academy of Sciences Publication Activity Database

    Kolátorová, Petra

    2012-01-01

    Roč. 49, č. 4 (2012), s. 432-433. ISSN 0018-7003. [5. Beethoven -Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik,. Bonn, 27.08.2012-29.08.2012] Institutional support: RVO:68378076 Keywords : Beethoven * editorial work * music scores Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. Synchronous population fluctuations of forest and field voles: implications for population management

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Suchomel, J.; Purchart, L.; Heroldová, Marta; Čepelka, L.; Homolka, Miloslav

    2011-01-01

    Roč. 432, - (2011), s. 97-98. ISSN 1868-9892. [European Vertebrate Pest Management Conference /8./. Berlin, 26.09.2011-30.09.2011] R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bank vole * common vole * correlation of population fluctuations Subject RIV: EH - Ecology, Behaviour

  15. Adolescents' Cues and Signals: Sex and Assault.

    Science.gov (United States)

    Giarrusso, Roseann; And Others

    Acquaintance rape has been found to occur with disturbing frequency in an adolescents' social world. Unlike stranger rape, acquaintance rape, particularly dating rape, takes place in the context of normal social activity. In 1978, 432 adolescents, ages 14-18, were interviewed in the Los Angeles area: half male, and half female, and one-third drawn…

  16. Effects of feeding diets containing highly oxidized dried distillers grains with solubles (DDGS) with increasing vitamin E levels to wean-finish pigs on growth performance, carcass composition, and pork fat quality

    Science.gov (United States)

    Lipid peroxidation in animal feed has been shown to negatively impact growth performance and meat quality. A total of 432 weanling pigs were used to evaluate the effects of feeding highly oxidized DDGS with 3 levels of vitamin E on growth performance, carcass composition, and pork fat quality. The D...

  17. The splicing factor U1-70K interacts with the SMN complex and is required for nuclear gem integrity

    Czech Academy of Sciences Publication Activity Database

    Stejskalová, Eva; Staněk, David

    2014-01-01

    Roč. 127, č. 18 (2014), s. 3909-3915. ISSN 0021-9533 R&D Projects: GA ČR GAP302/11/1910 Institutional support: RVO:68378050 Keywords : nuclear gems * SMN * U1-70K Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  18. Closed-cell polymeric foam for hydrogen separation and storage

    Czech Academy of Sciences Publication Activity Database

    Pientka, Zbyněk; Pokorný, P.; Bélafi-Bakó, K.

    2007-01-01

    Roč. 304, 1-2 (2007), s. 82-87. ISSN 0376-7388 R&D Projects: GA ČR GA203/06/1207 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymeric foam * gas separation * hydrogen storage Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.432, year: 2007

  19. Experimental determination and computational interpretation of biophysical properties of lipid bilayers enriched by cholesteryl hemisuccinate

    Czech Academy of Sciences Publication Activity Database

    Kulig, W.; Jurkiewicz, Piotr; Olžyńska, Agnieszka; Tynkkynen, J.; Javanainen, M.; Manna, M.; Rog, T.; Hof, Martin; Vattulainen, I.; Jungwirth, Pavel

    2015-01-01

    Roč. 1848, č. 2 (2015), s. 422-432. ISSN 0005-2736 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : Time-dependent fluorescence shift * Molecular dynamics simulations * Cholesterol-mimicking detergents Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.836, year: 2014

  20. Laser Plasma Plume Kinetic Spectroscopy of the Nitrogen and Carbon Species

    Czech Academy of Sciences Publication Activity Database

    Zelinger, Zdeněk; Novotný, Michal; Bulíř, Jiří; Lančok, Ján; Kubát, Pavel; Jelínek, Miroslav

    2003-01-01

    Roč. 43, - (2003), s. 426-432. ISSN 0863-1042 R&D Projects: GA AV ČR IAA1010110 Institutional research plan: CEZ:AV0Z4040901 Keywords : laser ablation * laser plasma * emission spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.863, year: 2003

  1. Preparation of aluminium lakes by electrocoagulation

    Directory of Open Access Journals (Sweden)

    Prapai Pradabkham

    2008-07-01

    Full Text Available Aluminium lakes have been prepared by electrocoagulation employing aluminium as electrodes. The electrocoagulation is conducted in an aqueous alcoholic solution and is completed within one hour. The dye content in the lake ranges approximately between 4-32%.

  2. Prevalence of Autism Spectrum Disorders in Guanajuato, Mexico: The Leon Survey

    Science.gov (United States)

    Fombonne, Eric; Marcin, Carlos; Manero, Ana Cecilia; Bruno, Ruth; Diaz, Christian; Villalobos, Michele; Ramsay, Katrina; Nealy, Benjamin

    2016-01-01

    There are no epidemiological data on autism for Mexico. This study was conducted to generate a first estimate of ASD prevalence in Mexico. We surveyed children age eight in Leon (Guanajuato). The sample was stratified in two strata: (1) children having special education and medical records (SEMR; N = 432) and (2) children attending regular schools…

  3. Salivary Biomarker Levels and Diurnal Variation: Associations with Medications Prescribed to Control Children's Problem Behavior

    Science.gov (United States)

    Hibel, Leah C.; Granger, Douglas A.; Cicchetti, Dante; Rogosch, Fred

    2007-01-01

    This study examined associations between medications prescribed to control children's problem behaviors and levels of, and diurnal variation in, salivary cortisol (C), testosterone (T), and dehydroepiandrosterone (DHEA). Saliva was collected in the morning, midday, and afternoon from 432 children ages 6-13 years. Relative to a no-medication…

  4. Structure and pervaporation properties of poly(phenylene-iso-phthalamide) membranes modified by Fullerene C-60

    Czech Academy of Sciences Publication Activity Database

    Penkova, A. V.; Polotskaya, G. A.; Toikka, A. M.; Trchová, Miroslava; Šlouf, Miroslav; Urbanová, Martina; Brus, Jiří; Brožová, Libuše; Pientka, Zbyněk

    2009-01-01

    Roč. 294, 6-7 (2009), s. 432-440. ISSN 1438-7492 Institutional research plan: CEZ:AV0Z40500505 Keywords : fullerene * methanol/cyclohexane mixture * modification Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.742, year: 2009

  5. Runoff Responses to Forest Thinning at Plot and Catchment Scales in a Headwater Catchment Draining Japanese Cypress Forest

    Science.gov (United States)

    We examined the effect of forest thinning on runoff generation at plot and catchment scales in headwater basins draining a Japanese cypress (Chamaecyparis obtusa) forest. We removed 58.3% of the stems (corresponding to 43.2% of the basal area) in the treated headwater basin (catc...

  6. Oxidation of ST55, LH15 and Arema steels at high temperatures in ambient air

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jaroslav; Million, Bořivoj; Adamaszek, K.

    2004-01-01

    Roč. 42, č. 4 (2004), s. 242-250. ISSN 0023-432X Institutional research plan: CEZ:AV0Z2041904 Keywords : high temperatures * oxidation steels * ambient air Subject RIV: JG - Metallurgy Impact factor: 1.056, year: 2004

  7. Physical and chemical characterization of residual oil-fired power plant emissions

    Science.gov (United States)

    Although the toxicity of oil combustion emissions is a significant public health concern, few studies characterize the emissions from plant-scale utility boilers firing residual oil. This study remedies that deficiency by sampling and monitoring stack emissions from a 432 Giga Jo...

  8. Characterization of carbon nanofibers by SEM, TEM, ESCA and raman spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Tatarko, P.; Puchý, V.; Dusza, J.; Morgiel, J.; Bastl, Zdeněk; Mihály, J.

    2010-01-01

    Roč. 48, č. 6 (2010), s. 379-385. ISSN 0023-432X Institutional research plan: CEZ:AV0Z40400503 Keywords : carbon micro/nanofiber * cylindrical fiber * bambo-shaped fiber Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.471, year: 2010

  9. 10 CFR 35.433 - Decay of strontium-90 sources for ophthalmic treatments.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Decay of strontium-90 sources for ophthalmic treatments... Brachytherapy § 35.433 Decay of strontium-90 sources for ophthalmic treatments. (a) Only an authorized medical... times for ophthalmic treatments. The decay must be based on the activity determined under § 35.432....

  10. Recent progress in research on tungsten materials for nuclear fusion applications in Europe

    Czech Academy of Sciences Publication Activity Database

    Rieth, M.; Dudarev, S.L.; Gonzalez de Vicente, S.M.; Aktaa, J.; Ahlgren, T.; Antusch, S.; Armstrong, D.E.J.; Balden, M.; Baluc, N.; Barthe, M.-F.; Basuki, W.W.; Battabyal, M.; Becquart, C.S.; Blagoeva, N.; Boldyryeva, Hanna; Brinkmann, J.; Celino, M.; Ciupinski, L.; Correia, J.B.; De Backer, A.; Domain, C.; Gaganidze, E.; García-Rosales, C.; Gibson, J.; Gilbert, M.R.; Giusepponi, S.; Gludovatz, B.; Greuner, H.; Heinola, K.; Höschen, T.; Hoffmann, A.; Holstein, A.; Koch, F.; Krauss, W.; Li, H.; Lindig, S.; Linke, J.; Linsmeier, Ch.; López-Ruiz, P.; Maier, H.; Matějíček, Jiří; Mishra, T.P.; Muhammed, M.; Muñoz, A.; Muzyk, M.; Nordlund, K.; Nguyen-Manh, D.; Opschoor, J.; Ordás, N.; Palacios, Y.; Pintsuk, G.; Pippan, R.; Reiser, J.; Riesch, J.; Roberts, S. G.; Romaner, L.; Rosiński, M.; Sanchez, M.; Schulmeyer, W.; Traxler, H.; Ureña, G.; van der Laan, J.G.; Veleva, L.; Wahlberg, S.; Walter, M.; Weber, T.; Weitkamp, T.; Wurster, S.; Yar, M.A.; You, J.H.; Zivelonghi, A.

    2013-01-01

    Roč. 432, 1-3 (2013), s. 482-500. ISSN 0022-3115 Institutional support: RVO:61389021 Keywords : tungsten * joining * composites * graded materials * fusion materials Subject RIV: JF - Nuclear Energetics Impact factor: 2.016, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022311512004278

  11. Acid-base-driven matrix-assisted mass spectrometry for targeted metabolomics

    Czech Academy of Sciences Publication Activity Database

    Shroff, R.; Rulíšek, Lubomír; Doubský, J.; Svatoš, Aleš

    2009-01-01

    Roč. 106, č. 25 (2009), s. 10092-10096. ISSN 0027-8424 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : clinical diagnostic * matrix design * positive/negative ions * MALDI Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 9.432, year: 2009

  12. Chicagoland Single-Family Housing Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Spanier, J. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States); Scheu, R. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States); Brand, L. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States); Yang, J. [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States)

    2012-06-01

    In this report, the PARR team identifies housing characteristics and energy use for fifteen housing types in the Chicagoland (Cook County, Illinois) region and specifies measure packages that provide an optimum level of energy savings based on a BEopt analysis. The analysis is based on assessor data and actual energy consumption data on 432,605 houses representing approximately 30% of the population.

  13. Chicagoland Single-Family Housing Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Spanier, J.; Scheu, R.; Brand, L.; Yang, J.

    2012-06-01

    In this report, the PARR team identifies housing characteristics and energy use for fifteen housing types (groups) in the Chicagoland (Cook County, Illinois) region and specifies measure packages that provide an optimum level of energy savings based on a BEopt analysis. The analysis is based on assessor data and actual energy consumption data on 432,605 houses representing approximately 30% of the population.

  14. Toxicity studies for indigenous Bacillus thuringiensis isolates from Malang city, East Java on Aedes aegypti larvae

    Institute of Scientific and Technical Information of China (English)

    Zulfaidah Penata Gama; Nobukazu Nakagoshi; Suharjono; Faridah Setyowati

    2013-01-01

    Objective: To investigate the toxicity of indigenous Bacillus thuringiensis (B. thuringiensis) isolates from Malang City for controlling Aedes aegypti (Ae. aegypti) larvae. Methods: Soil samples were taken from Purwantoro and Sawojajar sub-districts. Bacterial isolation was performed using B. thuringiensis selective media. Phenotypic characteristics of the isolates were obtained with the simple matching method. The growth and prevalence of spores were determined by the Total Plate Count method, and toxicity tests were also performed on the third instar larval stage of Ae. aegypti. The percentage of larval mortality was analysed using probit regression. The LC50 was analysed by ANOVA, and the Tukey HSD interval was 95%. Results:Among the 33 selected bacterial isolates, six were obtained (PWR4-31, PWR4-32, SWJ4-2b, SWJ4-4b, SWJ-4k and SWJ5-1) that had a similar phenotype to reference B. thuringiensis. Based on the dendrogram, all of the bacterial isolates were 71%similar. Three isolates that had a higher prevalence of reference B. thuringiensis were PWR4-32, SWJ4-4b and SW5-1, of which the spore prevalence was 52.44%, 23.59%, 34.46%, respectively. These three indigenous isolates from Malang City successfully killed Ae. aegypti larvae. The PWR4-32 isolates were the most effective at killing the larvae. Conclusions:Six indigenous B. thuringiensis isolates among the 33 bacterial isolates found in the Sawojajar and Purwantoro sub-districts were toxic to the third instar larvae of Ae. aegypti. The PWR4-32 isolates were identical to the reference B. thuringiensis and had 88%phenotype similarity. The PWR4-32 isolates had the highest spore prevalence (52.44%), and the early stationary phase occurred at 36 h. The PWR4-32 isolates were the most effective at killing Ae. aegypti larvae (LC50-72 h=2.3í108 cells/mL).

  15. Powder metallurgy processing of high strength turbine disk alloys

    Science.gov (United States)

    Evans, D. J.

    1976-01-01

    Using vacuum-atomized AF2-1DA and Mar-M432 powders, full-scale gas turbine engine disks were fabricated by hot isostatically pressing (HIP) billets which were then isothermally forged using the Pratt & Whitney Aircraft GATORIZING forging process. While a sound forging was produced in the AF2-1DA, a container leak had occurred in the Mar-M432 billet during HIP. This resulted in billet cracking during forging. In-process control procedures were developed to identify such leaks. The AF2-1DA forging was heat treated and metallographic and mechanical property evaluation was performed. Mechanical properties exceeded those of Astroloy, one of the highest temperature capability turbine disk alloys presently used.

  16. Risk of leukemia in first degree relatives of patients with nonsyndromic cleft lip and palate

    Directory of Open Access Journals (Sweden)

    Eduardo GONÇALVES

    2014-01-01

    Full Text Available The aim of this study was to determine the frequency of leukemia in parents of patients with nonsyndromic cleft lip and/or cleft palate (NSCL/P. This case-control study evaluated first-degree family members of 358 patients with NSCL/P and 1,432 subjects without craniofacial alterations or syndromes. Statistical analysis was carried out using Fisher’s test. From the 358 subjects with NSCL/P, 3 first-degree parents had history of leukemia, while 2 out of 1,432 subjects from the unaffected group had a family history of leukemia. The frequency of positive family history of leukemia was not significantly increased in first-degree relatives of patients with NSCL/P.

  17. Acute Kidney Injury Classification in Neuro-ICU Patient Group

    Directory of Open Access Journals (Sweden)

    Canan Akıncı

    2012-12-01

    Full Text Available Objective: To investigate the role of acute kidney injury (AKI classification system for kidney injury outcome in neuro-Intensive care unit (ICU patients. Material and Method: Total 432 patients who admitted to ICU between 2005 and 2009 evaluated in this study. All patients’ AKI stage, Acute Physiology and Chronic Health Evaluation (APACHE-II, Sequential Organ Failure Assessment Score (SOFA, Glasgow Coma Score (GCS, Glasgow Outcome Score (GOS, mortality rate, length of ICU stay, need for intubation, and mechanical ventilation were recorded. Results: AKI was found in 24 of all 432 patents’ (5.5%. We found that, patients with AKI had higher APHACE-II score, SOFA score and mortality rates; longer ICU stay, duration of mechanical ventilation and intubation and lower GCS and GOS than without AKI group. Conclusion: Length of ICU stay and mortality rate were higher in AKI positive group.

  18. 不同类型浆纱机合理应用分析

    Institute of Scientific and Technical Information of China (English)

    梁浩祥; 朱瑞兵; 钱文明; 徐方东

    2004-01-01

    对祖克S432型、台湾大雅TAYA-500型和国产ASGA342型三种型号浆纱机的结构性能及上浆效果进行了对比分析,提出了三种不同浆纱机的适用范围,指出:S432型机适用于特细号高密品种的上浆,TAYA-500型机适用于细号中密品种的上浆,ASGA342型适用于中粗号中密度品种的上浆。

  19. 不同类型浆纱机合理应用分析%Reasonable Application and Analyses of Variant Type Sizing Machines

    Institute of Scientific and Technical Information of China (English)

    梁浩祥; 朱瑞兵; 钱文明; 徐方东

    2004-01-01

    对祖克S432型、台湾大雅TAYA-500型和国产ASGA342型三种型号浆纱机的结构性能及上浆效果进行了对比分析,提出了三种不同浆纱机的适用范围,指出:S432型机适用于特细号高密品种的上浆,TAYA-500型机适用于细号中密品种的上浆,ASGA342型机适用于中粗号中密度品种的上浆.

  20. Dicty_cDB: SLB538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB538 (Link to dictyBase) - - - Contig-U16368-1 SLB538P (Link to Original site) SLB...538F 702 SLB538Z 214 SLB538P 916 - - Show SLB538 Library SL (Link to library) Clone ID SLB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB5-B/SLB538Q.Seq.d/ Representative seq. ID SLB...538P (Link to Original site) Representative DNA sequence >SLB538 (SLB538Q) /CSM/SL/SLB5-B/SLB5...nt alignments: (bits) Value SLB538 (SLB538Q) /CSM/SL/SLB5-B/SLB538Q.Seq.d/ 1332 0.0 SLA432 (SLA432Q) /CSM/SL

  1. Deriva de herbicidas e efeito de fungicida X herbicida em plantas jovens de pessegueiro Herbicide drift simulation and effect of fungicide X herbicide on peach tree seedlings

    OpenAIRE

    L.D. Tuffi Santos; A WAGNER JÚNIOR; J.O.C. Silva; L.D. Pimentel; C.E.M. Santos; C.H. Bruckner; F.A. Ferreira

    2006-01-01

    O objetivo deste trabalho foi avaliar os efeitos da deriva de glyphosate e triclopyr sobre plantas jovens de pessegueiro, bem como o comportamento destas quando submetidas à deriva de glyphosate com tratamento prévio de fungicida. No experimento 1, a simulação da deriva foi feita por aplicação de subdoses dos herbicidas glyphosate (43,2; 86,4; 172,8; e 345,8 g ha-1), triclopyr (14,4; 28,8; 57,6; e 115,2 g ha-1) e pela mistura de glyphosate + triclopyr (43,2 + 24,4; 86,4 + 28,8; e 172,8 + 57,6...

  2. Cytotoxicity assessment of antibiofouling compounds and by-products in marine bivalve cell cultures.

    Science.gov (United States)

    Domart-Coulon, I; Auzoux-Bordenave, S; Doumenc, D; Khalanski, M

    2000-06-01

    Short-term primary cell cultures were derived from adult marine bivalve tissues: the heart of oyster Crassostrea gigas and the gill of clam Ruditapes decussatus. These cultures were used as experimental in vitro models to assess the acute cytotoxicity of an organic molluscicide, Mexel-432, used in antibiofouling treatments in industrial cooling water systems. A microplate cell viability assay, based on the enzymatic reduction of tetrazolium dye (MTT) in living bivalve cells, was adapted to test the cytotoxicity of this compound: in both in vitro models, toxicity thresholds of Mexel-432 were compared to those determined in vivo with classic acute toxicity tests. The clam gill cell model was also used to assess the cytotoxicity of by-products of chlorination, a major strategy of biofouling control in the marine environment. The applications and limits of these new in vitro models for monitoring aquatic pollutants were discussed, in reference with the standardized Microtox test. PMID:10806375

  3. Simultaneous circulation of all four dengue serotypes in Manaus, State of Amazonas, Brazil in 2011

    Directory of Open Access Journals (Sweden)

    Michele de Souza Bastos

    2012-06-01

    Full Text Available INTRODUCTION: Manaus, the capital city of the state of Amazon with nearly 2 million inhabitants, is located in the middle of the Amazon rain forest and has suffered dengue outbreaks since 1998. METHODS: In this study, blood samples were investigated using reverse transcriptase-polymerase chain reaction (RT-PCR, aimed at identifying dengue virus serotypes. RESULTS: Acute phase sera from 432 patients were tested for the presence of dengue virus. Out of the 432 patients, 137 (31.3% were found to be positive. All the four dengue virus serotypes were observed. CONCLUSIONS: The simultaneous circulation of the four dengue serotypes is described for the first time in Manaus and in Brazil.

  4. Environmental studies for deep seabed mining

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, R.

    -eolonization of deep-sea environment and animal communities. A comparison of the sediment resuspended during these experiments, shows that these were mucll smaller in scale than a commercial mining system (Yamazaki and Sharma 2001 ). 432 Recent Advances..., 19(9). This observation shows that certain groups are more susceptible than others to adapt to the changed conditions on the seafloor. IOM·HIE A benthic impact experiment (IOM-BIE) was conducted by Interoceanmetal (10M) Joint Organisation, in CCEZ...

  5. Dicty_cDB: VSD529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ACCAAAATGGTATTGTGTAACACCT NATTGCNACTCAAATAGGAAAT Length of 3' end seq. 432 Connected seq. ID VSD529P Conne...ATATTCGATAATACCA TATCATGCAATCCTTCAGAACAATCGGAAACCAAAATGGTATTGTGTAACACCTNATTGC NACTCAAATAGGAAAT Length of connect...*iifklplptlki*nfpfkiqmnqklgfvkimkhsktfvismvkivkysii pyhailqnnrkpkwycvtpxcx...drial 4.0 %: vesicles of secretory system >> prediction for VSD529 is exc 5' end seq. ID VSD529F ...VS (Link to library) VSD529 (Link to dictyBase) - - - Contig-U06563-1 VSD529P (Link

  6. Residual stress determination by neutron diffraction in a car gear-shaft made of 20NiCrMo2 alloyed case hardening steel

    Czech Academy of Sciences Publication Activity Database

    Rogante, M.; Mazzanti, M.; Mikula, Pavol; Vrána, Miroslav

    2012-01-01

    Roč. 50, č. 4 (2012), s. 213-220. ISSN 0023-432X R&D Projects: GA ČR(CZ) GAP204/12/1360 Institutional support: RVO:61389005 Keywords : 20NiCrMo2 steel * gear -shaft * caser hardening * residual stress * neutron diffraction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.687, year: 2012

  7. Synthesis and biological evaluation of guanidino analogues of roscovitine

    Czech Academy of Sciences Publication Activity Database

    Dolečková, Iva; Česnek, Michal; Dračínský, Martin; Brynda, Jiří; Voller, J.; Janeba, Zlatko; Kryštof, Vladimír

    2013-01-01

    Roč. 62, April 2013 (2013), s. 443-452. ISSN 0223-5234 R&D Projects: GA MŠk 1M0508; GA ČR GAP305/12/0783 Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Keywords : 6-Guanidinopurine * Olomoucine * Roscovitine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  8. Únavové poškození v aluminium lithiových slitinách, Část II. Iniciace a šíření krátkých trhlin

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav; Man, Jiří; Obrtlík, Karel

    2001-01-01

    Roč. 39, č. 3 (2001), s. 179-189. ISSN 0023-432X R&D Projects: GA ČR GA106/95/1529; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium -lithium alloy * fatigue crack initiation * short crack growth Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.343, year: 2001

  9. K dokladům bojů na laténských oppidech

    Czech Academy of Sciences Publication Activity Database

    Salač, Vladimír

    Brno: Moravské zemské muzeum, 2014 - (Čižmářová, J.; Venclová, N.; Březinová, G.), s. 439-447 ISBN 978-80-7028-432-2 R&D Projects: GA ČR(CZ) GAP405/11/0603 Institutional support: RVO:67985912 Keywords : oppida * military actions * violence * weapons * human remains * destruction horizons Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. AcEST: BP917399 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D02 518 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D02. BP917399 - Show ... s = 20/43 (46%) Frame = -3 Query: 432 CYGY*DATQRGRLCSR KCCLGVLLNVHIMLESITDCEDLMRFV 304 C G D T CSR ... CC+ L N ... ++ E D + + ++ Sbjct: 384 CVGSRDKTVGNEYCSR VCCMAALKNSQMVKERYPDTDVTIHYI 426 >sp|A2RRX6|NPAT_XEN ...

  11. Dva zlaté předměty z kostrových hrobů z doby laténské ze severozápadních Čech. K možnosti existence předmincovních platidel v horizontu LT B2

    Czech Academy of Sciences Publication Activity Database

    Holodňák, P.; Militký, Jiří

    Brno : Moravské zemské muzeum, 2014 - (Čižmářová, J.; Venclová, N.; Březinová, G.), s. 563-580 ISBN 978-80-7028-432-2 R&D Projects: GA ČR GA13-24707S Institutional support: RVO:67985912 Keywords : Northwest Bohemia * Celts * skeleton graves * gold pendants * pre-coinage currency Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Evaluation of kinetic parameters of chitinases produced by Beauveria bassiana (Bals.) Vuill. /
    Avaliação de parâmetros cinéticos de quitinases produzidas por Beauveria bassiana (Bals.) Vuill.

    OpenAIRE

    Cristiane Mita; Vanessa Hitomi Sugahara; Jo I Wu; Pedro Manoel Oliveira Janeiro Neves; Dalva Tomoe Miyagui; Geni Varéa-Pereira; Danieli Cristina Sassá; Evelyn Kamogawa

    2008-01-01

    Entomopathogenic fungus Beauveria bassiana is currently used as a biocontrol agent for agricultural pests. The infection process involves extracellular enzymes such as proteases and chitinases that degrade the cuticle of the insects. The objective of this work was to evaluate kinetic parameters of pH, temperature, ionic concentration and time of reaction on chitinases activity. The fungus B. bassiana CG432 was cultivated on coffee berry borer Hypothenemus hampei (Ferrari) and the conidia grow...

  13. Differences in Extended-Spectrum Beta-Lactamase Producing Escherichia coli Virulence Factor Genes in the Baltic Sea Region

    OpenAIRE

    Jana Lillo; Kristiine Pai; Arta Balode; Mariia Makarova; Kristi Huik; Siiri Kõljalg; Marina Ivanova; Lidia Kaftyreva; Jolanta Miciuleviciene; Paul Naaber; Kristel Parv; Anastasia Pavelkovich; Tiiu Rööp; Karolin Toompere; Ludmila Suzhaeva

    2014-01-01

    The aim of this study was to compare the prevalence of different virulence factor (VF) genes in extended-spectrum beta-lactamase (ESBL) producing Escherichia coli strains isolated from the Baltic Sea region. A total of 432 strains of phenotypically ESBL positive E. coli were collected from 20 institutions located in Estonia, Latvia, Lithuania, and the region of St. Petersburg in Russia from January to May 2012 and analyzed for phylogenetic group and prevalence of 23 VF genes. The strains were...

  14. Simultaneous oxidation and decarburization of cast iron powder during plasma spraying

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Schneeweiss, Oldřich; Chráska, Tomáš; Dubský, Jiří; Písačka, Jan

    2009-01-01

    Roč. 47, č. 1 (2009), s. 19-24. ISSN 0023-432X R&D Projects: GA AV ČR IAA1041404 Institutional research plan: CEZ:AV0Z20430508; CEZ:AV0Z20410507 Keywords : cast iron powder * plasma spraying * oxidation * decarburization Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.345, year: 2007 http://kovmat.sav.sk/abstract.php?rr=47&cc=1&ss=19

  15. Microstructure stability and creep behaviour of advanced high chromium ferritic steels

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Kudrman, J.; Svoboda, Milan; Kloc, Luboš

    43 2005, č. 1 (2005), s. 20-33. ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/02/0608; GA AV ČR(CZ) IAA2041101; GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : 9-12%Cr steels * microstructure stability * creep behaviour * nonsteady creep loading Subject RIV: JG - Metallurgy Impact factor: 0.973, year: 2005

  16. Real-Time, Polyphase-FFT, 640-MHz Spectrum Analyzer

    Science.gov (United States)

    Zimmerman, George A.; Garyantes, Michael F.; Grimm, Michael J.; Charny, Bentsian; Brown, Randy D.; Wilck, Helmut C.

    1994-01-01

    Real-time polyphase-fast-Fourier-transform, polyphase-FFT, spectrum analyzer designed to aid in detection of multigigahertz radio signals in two 320-MHz-wide polarization channels. Spectrum analyzer divides total spectrum of 640 MHz into 33,554,432 frequency channels of about 20 Hz each. Size and cost of polyphase-coefficient memory substantially reduced and much of processing loss of windowed FFTs eliminated.

  17. Quantification of Gains and Risks of Static Thermal Rating Based on Typical Meteorological Year

    Czech Academy of Sciences Publication Activity Database

    Heckenbergerová, Jana; Musílek, P.; Filimonenkov, K.

    2013-01-01

    Roč. 44, č. 1 (2013), s. 227-235. ISSN 0142-0615 R&D Projects: GA MŠk LD12009 Grant ostatní: GA AV ČR(CZ) M100300904 Institutional support: RVO:67985807 Keywords : Overhead power transmission lines * Conductor ampacity * Probabilistic static thermal rating * Typical meteorological year * Risk tolerance * Energy throughput Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 3.432, year: 2012

  18. Analysis of water-soluble fraction of metals in atmospheric aerosols using aerosol counterflow two-jets unit and chemiluminescent detection

    Czech Academy of Sciences Publication Activity Database

    Vojtěšek, Martin; Mikuška, Pavel; Večeřa, Zbyněk; Křůmal, Kamil

    2012-01-01

    Roč. 92, č. 4 (2012), s. 432-449. ISSN 0306-7319 R&D Projects: GA MŽP SP/1A3/148/08; GA MŽP SP/1B7/189/07; GA MŽP SP/1A3/55/08 Institutional research plan: CEZ:AV0Z40310501 Keywords : atmospheric aerosols * metals * continuous aerosol collector Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.240, year: 2012

  19. Online or off-line victimisation and psychological well-being: a comparison of sexual-minority and heterosexual youth.

    OpenAIRE

    Priebe, Gisela; Svedin, Carl Göran

    2012-01-01

    The purpose of this study was to compare sexual-minority and heterosexual youths exposure to sexual abuse off-line, problematic sexual meetings off-line with person/s met online and online harassment with regard to prevalence, psychological well-being and support seeking. A nationally representative sample of 3,432 Swedish high school seniors completed an anonymous school-based survey about sexuality, health, sexual abuse and online-related sexual victimisation or harassment. Sexual-minority ...

  20. 49 CFR 173.336 - Nitrogen dioxide, liquefied, or dinitrogen tetroxide, liquefied.

    Science.gov (United States)

    2010-10-01

    ... (IBR, see § 171.7 of this subchapter). Each DOT specification cylinder must be cleaned according to the requirements of GSA Federal Specification RR-C-901D, paragraphs 3.3.1 and 3.3.2 (IBR, see § 171.7 of this... Specification RR-C-901D, paragraph 4.3.2 (IBR, see § 171.7 of this subchapter) and meet the standard...

  1. The Relationship Between Coat Color and Aggressive Behaviors in the Domestic Cat

    OpenAIRE

    Stelow, EA; Bain, MJ; Kass, PH

    2016-01-01

    © 2016 Taylor & Francis. The authors explored a possible relationship between coat color and aggressive behaviors in the domestic cat. This study used an Internet-based survey to collect information on coat color, affiliative behaviors toward cats/humans, agonistic behaviors toward cats/humans, other “problem” behaviors, and cat and guardian demographic data. A total of 1,432 cat guardians completed the online survey; after exclusions based on study protocol, data analysis included 1,274 comp...

  2. Cascades of convergent evolution: The corresponding evolutionary histories of euglenozoans and dinoflagellates

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; Leander, B. S.; Keeling, P. J.

    2009-01-01

    Roč. 106, č. 1 (2009), s. 9963-9970. ISSN 0027-8424 R&D Projects: GA ČR GA204/09/1667; GA MŠk LC07032; GA MŠk 2B06129 Institutional research plan: CEZ:AV0Z60220518 Keywords : comparative genomics * convergent evolution * dinoflagellates * Euglenozoa * mitochondria * molecular evolution * plastids * RNA editing * RNA editing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.432, year: 2009

  3. Predictors and Consequences of Aggressive–Withdrawn Problem Profiles in Early Grade School

    OpenAIRE

    Farmer, Alvin D.; Bierman, Karen L.

    2002-01-01

    Identified first-grade children who exhibited 4 different behavior problem profiles from an initial sample of 754: aggressive–withdrawn (n = 63, 8%) aggressive only (n = 165, 22%), withdrawn only (n = 94, 12%), and nonproblem (n = 432, 57%). Group comparisons revealed that children who became aggressive–withdrawn in first grade exhibited deficits in attention and social skills in kindergarten. Furthermore, these kindergarten deficits contributed to the emergence of their aggressive–withdrawn ...

  4. A temporal and spatial study of invertebrate communities associated with hard-bottom habitats in the South Atlantic Bight

    OpenAIRE

    Wenner, E. L.; Hinde, P.; Knott, D. M; Van Dolah, R. F.

    1984-01-01

    Species composition, biomass, density, and diversity of benthic invertebrates from six bard-bottom areas were evaluated. Seasonal collections using a dredge, trawl, and suction and grab samplers yielded 432, 525, and 845 taxa, respectively. Based on collections wltb the different gear types, species composition of invertebrates was found to change bathymetrically. Inner- and mlddle-shelf sites were more similar to each other in terms of invertebrate species composition than they were to outer...

  5. Polyhydroxylated Sapphyrins: Multisite Non-metallic Catalysts for Activated Phosphodiester Hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Král, V.; Lang, Kamil; Králová, Jarmila; Dvořák, Michal; Martásek, P.; Chin, A.O.; Andrievsky, A.; Lynch, V.; Sessler, J. L.

    2006-01-01

    Roč. 128, č. 2 (2006), s. 432-437. ISSN 0002-7863 R&D Projects: GA ČR GA301/04/1315; GA ČR(CZ) GA303/05/0336 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z50520514 Keywords : phosphoryl-transfer- reactions * metal-ions * alkaline-phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 7.696, year: 2006

  6. Association of Osteoarthritis With Serum Levels of the Environmental Contaminants Perfluorooctanoate and Perfluorooctane Sulfonate in a Large Appalachian Population

    OpenAIRE

    Innes, Kim E.; Ducatman, Alan M.; Luster, Michael I; Shankar, Anoop

    2011-01-01

    Perfluorooctanoate (PFOA) and perfluorooctane sulfonate (PFOS) are persistent environmental contaminants that affect metabolic regulation, inflammation, and other factors implicated in the pathogenesis of osteoarthritis (OA). However, the link between these compounds and OA remains unknown. In this study, the authors investigated the association of OA with PFOA and PFOS in a population of 49,432 adults from 6 PFOA-contaminated water districts in the mid-Ohio Valley (2005–2006). Participants c...

  7. Endophenotyping reveals differential phenotype-genotype correlations between myopia-associated polymorphisms and eye biometric parameters

    OpenAIRE

    Chen, Jian Huan; Chen, Haoyu; Huang, Shulan; Lin, Jianwei; Zheng, Yuqian; Xie, Mingliang; Lin, Wenjie; Pang, Chi Pui; ZHANG, MINGZHI

    2012-01-01

    Purpose To investigate the association with ocular biometric parameters in myopia-associated single nucleotide polymorphisms (SNPs) of the gap junction protein delta 2 (GJD2), insulin-like growth factor-1 (IGF1) and hepatocyte growth factor (HGF) genes in two geographically different Chinese cohorts. Methods In 814 unrelated Han Chinese individuals aged above 50 years including 362 inland residents and 432 island dwellers, comprehensive ophthalmic examinations were performed. Three SNPs, incl...

  8. Using Quantile Regressions to Examine the Capital Structure Decision of US Firms

    OpenAIRE

    Bala Arshanapalli; William Nelson

    2014-01-01

    The paper examines the capital structure decision of 3,432 US companies in the year 2006 and 2011. The paper employs quantile regression to explore the predictions of the trade-off and pecking order models. We find evidence of heterogeneity in the capital structure and the determinants of capital structure. We find the data more consistent with the trade-off theory than the pecking order theory in 2006 but find that only economic conditions matter in 2011.

  9. Asset prices and priceless assets

    OpenAIRE

    Penasse, J.N.G.

    2014-01-01

    The doctoral thesis studies several aspects of asset returns dynamics. The first three chapters focus on returns in the fine art market. The first chapter provides evidence for the existence of a slow-moving fad component in art prices that induces short-term return predictability. The article has been published in Economics Letters (Volume 122, Issue 3, pp. 432-434), and was written together with Christophe Spaenjers and Luc Renneboog. Chapter 2 investigates how fast is information incorpora...

  10. Risk of Preterm Delivery and Hypertensive Disorders of Pregnancy in Relation to Maternal Comorbid Mood and Migraine Disorders during Pregnancy

    OpenAIRE

    Cripe, Swee May; Frederick, Ihunnaya O; Qiu, Chunfang; Williams, Michelle A.

    2011-01-01

    We evaluated risks of preterm delivery and hypertensive disorders of pregnancy among pregnant women with mood and migraine disorders. We used data from a cohort study of 3,432 pregnant women. Maternal pre-gestational or early pregnancy (before 20 weeks gestational) mood disorder and pre-gestational migraine diagnoses were ascertained from in-person interview and medical record review. We fitted generalized linear models to derive risk ratios (RR) and 95% confidence intervals (CI) of preterm d...

  11. Antidepressant drugs: evaluation of price variation

    Directory of Open Access Journals (Sweden)

    Bhumika Jayantilal Patel

    2015-06-01

    Conclusion: Price variation was wide for antidepressant drugs. Generic drug prescribing can decrease the expenditure of patient on the drug. Prescribers should be provided updated knowledge of the cost of different drugs. Modifications in pharmaceutical policy are required, and prices of the drug should be controlled in effective way for all the drugs. [Int J Basic Clin Pharmacol 2015; 4(3.000: 432-437

  12. Proinsulin and age in general population

    OpenAIRE

    Ateia, S; E. Rusu; Cristescu, V; Enache, G; Cheța, DM; Radulian, G.

    2013-01-01

    Abstract Objective. The objective of this study was to assess the relationship between fasting proinsulin (PI) and age in general population and to determine whether there are differences regarding this association in obese and non-obese persons. Methods. A random population-based sample (n=656) of Romanians (26–80 years) living in Bucharest, Romania was studied; 432 persons had diabetes and they were not analyzed in this paper. Circulating levels of fasting plasma glucose (FPG), fasting plas...

  13. Determinants of exchange rate volatility: the case of the new EU members

    Czech Academy of Sciences Publication Activity Database

    Stančík, Juraj

    2007-01-01

    Roč. 57, 9-10 (2007), s. 414-432. ISSN 0015-1920 R&D Projects: GA MŠk LC542 Grant ostatní: GA ČR(CZ) GA402/06/1293 Institutional research plan: CEZ:AV0Z70850503 Keywords : exchange - rate volatility * TARCH model * EMU integration Subject RIV: AH - Economics Impact factor: 0.382, year: 2007 http://journal.fsv.cuni.cz/storage/1085_fau_9_10_2007_00000002.pdf

  14. Determinants of exchange rate volatility: the case of the new EU members

    Czech Academy of Sciences Publication Activity Database

    Stančík, Juraj

    2007-01-01

    Roč. 57, 9-10 (2007), s. 414-432. ISSN 0015-1920 R&D Projects: GA ČR GA402/06/1293; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : exchange - rate volatility * TARCH model * EMU integration Subject RIV: AH - Economics Impact factor: 0.382, year: 2007 http://journal.fsv.cuni.cz/storage/1085_fau_9_10_2007_00000002.pdf

  15. New collector for continuous sampling of atmospheric aerosols

    Czech Academy of Sciences Publication Activity Database

    Mikuška, Pavel; Večeřa, Zbyněk

    Oxford : Elsevier, 2004, S431-S432. [EAC 2004. European Aerosol Conference 2004. Budapest (HU), 06.09.2004-10.09.2004] R&D Projects: GA AV ČR IAA4031105; GA ČR GA526/03/1182; GA ČR GA525/04/0011 Institutional research plan: CEZ:AV0Z4031919 Keywords : aerosol instrumentation * aerosol particles * chemical composition Subject RIV: CB - Analytical Chemistry, Separation

  16. Chemical composition, molecular weight distribution, secondary structure and effect of NaCl on functional properties of walnut (Juglans regia L) protein isolates and concentrates

    OpenAIRE

    Mao, Xiao-Ying; Hua, Yu-Fei

    2012-01-01

    Chemical composition, molecular weight distribution, secondary structure and effect of sodium chloride concentration on functional properties of walnut protein isolates, concentrates and defatted walnut flour were study. Compared with walnut protein concentrates (75.6%) and defatted walnut flour (52.5%), walnut protein isolates contain a relatively high amount of protein (90.5%). The yield of walnut protein isolates and concentrates was 43.2% and 76.6%, respectively. In molecular weight distr...

  17. Impact of an therapeutic patient education of physical activity in subacute stroke patient

    OpenAIRE

    Kammoun, Benjamin

    2015-01-01

    In France, we estimate at 150,000 the number of cerebral vascular accident per year. With a cost of 8.3 billion euros, it has become a public health issue. The expenses are, among others, related to legacy, as 43.2% leave hospital being physically dependent.These effects will aftereffect will cause limitations, causing a vicious cycle of inactivity and deconditioning bringing. To fight against this deconditioning, it seems appropriate to follow the recommendations of learned societies in term...

  18. Domain Modeling: NP_115754.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_115754.2 chr8 Crystal structure of an 8 repeat consensus TPR superhelix (trigona...l crystal form) p2hyza_ chr8/NP_115754.2/NP_115754.2_apo_4-171.pdb p2fo7a_ chr8/NP_115754.2/NP_115754.2_holo_4-171.pdb psi-blast 381K,382F,383K,431S,432G,443H _CD 1 ...

  19. Laser photogrammetry improves size and demographic estimates for whale sharks

    OpenAIRE

    Christoph A. Rohner; Richardson, Anthony J.; Prebble, Clare E. M.; Marshall, Andrea D.; Michael B Bennett; Scarla J Weeks; Geremy Cliff; Wintner, Sabine P.; Simon J Pierce

    2015-01-01

    Whale sharks Rhincodon typus are globally threatened, but a lack of biological and demographic information hampers an accurate assessment of their vulnerability to further decline or capacity to recover. We used laser photogrammetry at two aggregation sites to obtain more accurate size estimates of free-swimming whale sharks compared to visual estimates, allowing improved estimates of biological parameters. Individual whale sharks ranged from 432–917 cm total length (TL) (mean ± SD = 673 ± 11...

  20. Juvenile Psychopathic Personality Traits are Associated with Poor Reading Achievement

    OpenAIRE

    Vaughn, Michael G.; DeLisi, Matt; Kevin M. Beaver; Wexler, Jade; Barth, Amy; Fletcher, Jack

    2011-01-01

    The current study sought to further the understanding of the linkage between maladaptive behavior and cognitive problems by examining the relations between psychopathic personality traits and reading comprehension performance. Data were derived from a study of 432 predominately African-American and Hispanic middle-school students. Dependent variables consisted of three measures of reading comprehension. Psychopathy measures included the Inventory of Callous-Unemotional traits (ICU—teacher rat...

  1. Networks for the weak topology of Banach and Fréchet spaces

    Czech Academy of Sciences Publication Activity Database

    Gabriyelyan, S.; Kąkol, Jerzy; Kubiś, Wieslaw; Marciszewski, W.

    2015-01-01

    Roč. 432, č. 2 (2015), s. 1183-1199. ISSN 0022-247X R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : Fréchet space * space of continuous functions * locally convex space Subject RIV: BA - General Mathematics Impact factor: 1.120, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022247X15006836

  2. Merovingian glass beads from Holubice in Moravia: a chemical and technological view

    Czech Academy of Sciences Publication Activity Database

    Venclová, Natalie; Hulínský, V.; Jonášová, Šárka

    Brno : Moravské zemské muzeum, 2014 - (Čižmářová, J.; Venclová, N.; Březinová, G.), s. 815-826 ISBN 978-80-7028-432-2 R&D Projects: GA ČR(CZ) GA14-25396S Institutional support: RVO:67985912 ; RVO:67985831 Keywords : glass * Migration period * chemical analysis Subject RIV: AC - Archeology, Anthropology, Ethnology; CB - Analytical Chemistry, Separation (GLU-S)

  3. Synthesis and in vitro biological evaluation of 2,6,9-trisubstituted purines targeting multiple cyclin-dependent kinases

    Czech Academy of Sciences Publication Activity Database

    Zatloukal, M.; Jorda, Radek; Gucký, T.; Řezníčková, Eva; Voller, Jiří; Pospíšil, T.; Malínková, V.; Adamcová, H.; Kryštof, Vladimír; Strnad, Miroslav

    2013-01-01

    Roč. 61, SI (2013), s. 61-72. ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : Cyclin-dependent kinase * Inhibitor * Roscovitine Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.432, year: 2013

  4. Hypertension in Mexican adults: results from the National Health and Nutrition Survey 2006 Hipertensión en adultos mexicanos: resultados de la Encuesta Nacional de Nutrición y Salud 2006

    OpenAIRE

    Simón Barquera; Ismael Campos-Nonato; Lucía Hernández-Barrera; Salvador Villalpando; César Rodríguez-Gilabert; Ramón Durazo-Arvizú; Aguilar-Salinas, Carlos A

    2010-01-01

    OBJECTIVE: To describe the prevalence of hypertension among Mexican adults, and to compare to that observed among Mexican-Americans living in the US. MATERIAL AND METHOD: The primary data source came from adults (>20 years) sampled (n=33366) in the Mexican National Health and Nutrition Survey 2006 (ENSANUT 2006). Hypertension was defined when systolic blood pressure was >140 and/or diastolic was >90 or patients previously diagnosed. RESULTS: A total of 43.2% of participants were classified as...

  5. Association of lifestyle habits and academic achievement in Norwegian adolescents: a cross-sectional study

    OpenAIRE

    Stea, Tonje H; Torstveit, Monica K.

    2014-01-01

    Background: While healthy lifestyle habits are generally assumed to be important for high academic achievement, there has been little research on this topic among adolescents. The aim of this study was therefore to examine the associations between several lifestyle habits and academic achievement in adolescent girls and boys. Methods: The study included 2,432 Norwegian adolescents, 15–17 years old. A self-report questionnaire was used to assess dietary-, physical activity-, smokin...

  6. Risk Factors for Sexually Transmitted Disease Among Rural-to-Urban Migrants in China: Implications for HIV/Sexually Transmitted Disease Prevention

    OpenAIRE

    Liu, Hongjie; Li, Xiaoming; Stanton, Bonita; Liu, Hui; LIANG, GUOJUN; Chen, Xinguang (Jim); Yang, Hongmei; Hong, Yan

    2005-01-01

    The objective of the study was to identify risk factors associated with sexually transmitted diseases (STDs) among rural-to-urban migrants in Beijing in 2002. Migrants with STDs consisted of 432 migrants who sought STD care in two public STD clinics. Migrants without STDs included 892 migrants recruited from 10 occupational clusters. Multiple logistic regression was used for data analysis. Compared to migrants without STDs, migrants with STDs were more likely to report having engaged in comme...

  7. Difuze a termodynamika fosforu, uhlíku, chromu a niklu ve svarech ocelí

    Czech Academy of Sciences Publication Activity Database

    Million, Bořivoj; Stránský, K.; Michalička, Petr; Rek, A.

    2001-01-01

    Roč. 39, č. 3 (2001), s. 161-178. ISSN 0023-432X R&D Projects: GA ČR GA106/98/1367; GA AV ČR IBS2041105 Institutional research plan: CEZ:AV0Z2041904 Keywords : weld joints of steel * P, C, Cr and Ni redistribution * diffusion Subject RIV: JG - Metallurgy Impact factor: 0.343, year: 2001

  8. Spectral analysis of coniferous foliage and possible links to soil chemistry: Are spectral chlorophyll indices related to forest floor dissolved organic C and N?

    Czech Academy of Sciences Publication Activity Database

    Albrechtová, Jana; Seidl, Z.; Aitkenhead-Peterson, J. A.; Lhotáková, Z.; Rock, B. N.; Alexander, J.E.; Malenovský, Zbyněk; McDowell, W. H.

    2008-01-01

    Roč. 404, 2-3 (2008), s. 424-432. ISSN 0048-9697 R&D Projects: GA MŠk(CZ) ME 658 Grant ostatní: NSF(US) DEB108385 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60870520 Keywords : chlorophyll indexes * reflectance * DON and DOC Subject RIV: EF - Botanics Impact factor: 2.579, year: 2008

  9. Sergeia podlipaevi gen. nov., sp. nov. (Trypanosomatidae, Kinetoplastida), a parasite of biting midges (Ceratopogonidae, Diptera)

    Czech Academy of Sciences Publication Activity Database

    Svobodová, M.; Zídková, L.; Čepička, I.; Oborník, Miroslav; Lukeš, Julius; Votýpka, Jan

    2007-01-01

    Roč. 57, č. 2 (2007), s. 423-432. ISSN 1466-5026 R&D Projects: GA MŠk(CZ) LC06009; GA MŠk 2B06129 Institutional research plan: CEZ:AV0Z60220518 Keywords : Culicoides * Trypanosoma * trypanosomatids * transmission * biting midges * 18S SSU * GAPDH Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.384, year: 2007

  10. Alternative Fundamental Measure Theory for Additive Hard Spheres Mixtures

    Czech Academy of Sciences Publication Activity Database

    Malijevský, Alexandr

    2006-01-01

    Roč. 125, č. 19 (2006), s. 194519-1. ISSN 0021-9606 R&D Projects: GA ČR(CZ) GP203/06/P432; GA ČR(CZ) GA203/05/0725; GA MŠk(CZ) LC512 Institutional research plan: CEZ:AV0Z40720504 Keywords : density-functional theory * white bear version * free-energy model Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.166, year: 2006

  11. A comprehensive model of the quiet-time, near-Earth magnetic field: phase 3

    DEFF Research Database (Denmark)

    Sabaka, T.J.; Olsen, Nils; Langel, R.A.

    2002-01-01

    The near-Earth magnetic field is caused by sources in the Earth's core, ionosphere, magnetosphere, lithosphere and from coupling currents between the ionosphere and the magnetosphere, and between hemispheres. Traditionally, the main field (low degree internal field) and magnetospheric field have ...... explicit parametrization and estimation of the lithospheric field. The result is a model that describes well the 591 432 data with 16 594 parameters, implying a data-to-parameter ratio of 36, which is larger than several popular field models....

  12. Vliv kolísání teploty na průběh nitrifikace kalové vody

    OpenAIRE

    Mikulová, Blanka

    2013-01-01

    Summary The method of semi-continuous nitrification reactor operation in SBR regime is suitable for realization of shortcut nitrification. The process stability depends on many factors, while temperature is one of the most important. The way, how sudden temperature changes affect nitrification process and ratio of its final products was evaluated experimentally. The lab nitrification reactor with working volume of 0.75 l was operated in SBR regime for 432 days under stable, relatively low ...

  13. Aggregated n-of-1 trials of central nervous system stimulants versus placebo for paediatric traumatic brain injury – a pilot study

    OpenAIRE

    Nikles, Catherine J; McKinlay, Lynne; Mitchell, Geoffrey K; Carmont, Sue-Ann S; Senior, Hugh E; Waugh, Mary-Clare A; Epps, Adrienne; Schluter, Philip J; Lloyd, Owen T

    2014-01-01

    Background In 2006 there were 432,700 people in Australia who had acquired brain injury (ABI) with some limitation of activities; 90% of these were traumatic brain injuries (TBIs) and nearly a third sustained injury below age 15 years. One to four years post injury, 20% to 46% of children with traumatic brain injury (TBI) have clinically significant disorders of attention. There is controversy as to whether central nervous system (CNS) stimulants can be an effective method of treating these. ...

  14. Student work and nursing student's performance during study: Študentsko delo in uspešnost študentov zdravstvene nege v času študija:

    OpenAIRE

    Kadivec, Saša; Kalender Smajlović, Sedina; Skela-Savič, Brigita

    2014-01-01

    Introduction: According to different studies, student work has both positive and negative effects on the academic performance of nursing students. The purpose of the study was to examine the effect of student work based on a sample of Slovenian nursing students. Methods: The method of non-experimental quantitative research with a sampling survey was used. 432 nursing students participated. The reliability of the questionnaire was determined by internal consistency analysis (from 0.608 to 0.75...

  15. Back analysis of reinforced soil slopes

    Czech Academy of Sciences Publication Activity Database

    Procházka, P.; Trčková, Jiřina

    Southampton : WIT Press, 2012 - (Mammoli, A.; Brebbia, C.), s. 423-432 ISBN 978-1-84564-602-8. ISSN 1743-3533. [Computational methods and experiments in material characterisation /3./. Material Characterisation 2007. Bologna (IT), 13.06.2007-15.06.2007] R&D Projects: GA AV ČR IAA2119402 Institutional research plan: CEZ:AV0Z30460519 Keywords : back analysis * numerical and experimental modelling * slopes Subject RIV: JM - Building Engineering

  16. Zirconology of pegmatites of the Ilmeny Mountains

    Science.gov (United States)

    Krasnobaev, A. A.; Valizer, P. M.; Anfilogov, V. N.; Nemov, A. B.; Busharina, S. V.

    2014-08-01

    Zircons extracted from the nepheline and feldspar crystals of miaskitic and feldspar pegmatites, respectively, are analyzed with the SHRIMP method for the first time. The early (Silurian) zircons coincide in age (432 Ma), composition, and mineralogical peculiarities with early zircons from miaskites. It is concluded that the pegmatite melt is a derivative of the miaskite melt. Permian (240-260 Ma) metamorphic zircons are widespread in pegmatites and miaskites. Zircons from these rocks are characterized by genetic commonality.

  17. AcEST: DK959319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_F20 672 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_F20. 5' end seq ... TTSNSITLLTSQIAFMYMADKFFSYKM 175 Query: 516 CILCGIPQVTL AGTVQDWEEIDARINRLETGGYGKVCSEWASMLKKISSQFI 671 + CGI ... IPG 184 Query: 444 THDDTIVASVALMASMKKYFEHRFCILCGIPQVTL AGTVQ 563 I + ALM ++ RF L GIP +TLAG V+ Sbjct: 185 V ... 156 Query: 432 FSTTTHDDTIVASVALMASMKKYFEHRFCILCGIPQVTL AGTVQDWEEIDARINRLETGG 611 FSTTT DTI+ASV +M+SMKKYF++ ... RFC+ CGIP VTL ... G +DWEEI RI +L+ Sbjct: 157 FSTTTTTDTIIASVIMMSSMKKY ...

  18. 色度学理论

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    O432.3 2002053231用阴极射线管显示器研究影响色差知觉的因素=Studyof the parametric effects in colour-difference evaluationusing CRT displays[刊,中]/崔桂华,李为,范秋梅(北京理工大学光电工程系,颜色科学与工程国家重

  19. Somatic mitochondrial mutation in gastric cancer.

    OpenAIRE

    Burgart, L.J.; J. Zheng; Shu, Q; Strickler, J. G.; Shibata, D.

    1995-01-01

    Likely hot spots for mutations are mitochondrial sequences as there is less repair and more damage by carcinogens compared with nuclear sequences. A somatic 50-bp mitochondrial D-loop deletion was detected in four gastric adenocarcinomas. The deletion included the CSB2 region and was flanked by 9-bp direct repeats. The deletion was more frequent in adenocarcinomas arising from the gastroesophageal junction (4/32, 12.5%) compared with more distal tumors (0/45). Topographical analysis revealed ...

  20. High-spin states in the sup 9 sup 7 Tc nucleus

    CERN Document Server

    Bucurescu, D; Cata-Danil, I; Ivascu, M; Marginean, N; Rusu, C; Stroe, L; Ur, C A; Gadea, A

    2003-01-01

    High-spin states in the sup 9 sup 7 Tc nucleus have been studied by in-beam gamma-ray spectroscopy with the reaction sup 8 sup 2 Se( sup 1 sup 9 F,4n gamma) at 68 MeV incident energy. Excited states have been observed up to about 8 MeV excitation and spin 43/2 Planck constant. The observed level scheme is compared with results of shell model calculations. (orig.)

  1. The effect of novel [3-fluoro-(2-phosphonoethoxy)propyl]purines on the inhibition of Plasmodium falciparum, Plasmodium vivax and human hypoxanthine-guanine-(xanthine) phosphoribosyltransferases

    Czech Academy of Sciences Publication Activity Database

    Baszczyňski, Ondřej; Hocková, Dana; Janeba, Zlatko; Holý, Antonín; Jansa, Petr; Dračínský, Martin; Keough, D. T.; Guddat, L. W.

    2013-01-01

    Roč. 67, Sep (2013), s. 81-89. ISSN 0223-5234 R&D Projects: GA MV VG20102015046; GA ČR GAP207/11/0108 Grant ostatní: National Health and Madical Research Council(AU) 1030353; National Health and Medical Research Council(AU) 569703 Institutional support: RVO:61388963 Keywords : Malaria * nucleoside phosphonates * fluorine * purines * FPMP Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.432, year: 2013

  2. Permanent Genetic Resources added to Molecular Ecology Resources Database 1 April 2012 – 31 May 2012

    Czech Academy of Sciences Publication Activity Database

    Mendel, Jan; Papoušek, Ivo; Marešová, Eva; Vetešník, Lukáš; Halačka, Karel; Nowak, M.; Čížková, Dagmar

    2012-01-01

    Roč. 12, č. 5 (2012), s. 972-974. ISSN 1755-098X R&D Projects: GA ČR GP206/09/P608 Institutional support: RVO:68081766 Keywords : Romanogobio * gudgeon * microsatellites * hybrid Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.432, year: 2012 http:// tomato .biol.trinity.edu/manuscripts/12-5/mer-12-0021.pdf

  3. PetroChina and Sinopec Raises Oil Ex-refinery Prices

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ Sinopec and PetroChina have raised ex-refinery prices for gasoline and diesel to boost sagging margins as it faces soaring crude prices. The Chinese refiners increased 90-octane gasoline price by 100 yuan (US$12) a ton to about 3,580 yuan (US$432) a ton, and that of diesel by 40 yuan (US$4.80) a ton to 3,602 yuan (US$435),effective September 17.

  4. Synergy between pathogen release and resource availability in plant invasion

    Czech Academy of Sciences Publication Activity Database

    Blumenthal, D.; Mitchell, C. E.; Pyšek, Petr; Jarošík, Vojtěch

    2009-01-01

    Roč. 106, č. 19 (2009), s. 7899-7904. ISSN 0027-8424 R&D Projects: GA MŠk LC06073 Grant ostatní: Evropská komise(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * enemy release * resource availability Subject RIV: EG - Zoology Impact factor: 9.432, year: 2009

  5. Timing and preservation mechanism of deglacial pteropod spike from the Andaman Sea, northeastern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sijinkumar, A.V.; Nath, B.N.; Gupta, M.V.S.; Rao, B.R.

    (2); 2015; 432-444 Timing and preservation mechanism of deglacial pteropod spike from the Andaman Sea, north-eastern Indian Ocean Sijinkumar, A. V., Nath, B. N., Guptha, M. V. S., Ahmad, S. M., Rao, B. R. The aragonite compensation depth (ACD.... Guptha, Bandaru Ramalingeswara Rao, Geological Oceanography Division, CSIR-National Institute of Oceanography, Dona Paula, Goa-403 004, India; Syed Masood Ahmad, CSIR-National Geophysical Research Institute, Uppal Road, Hyderabad 500 007, India...

  6. Plasma spraying of Fe-Cr-Al alloy powder

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Leitner, J.; Kolman, Blahoslav Jan; Písačka, Jan; Schneeweiss, Oldřich

    2008-01-01

    Roč. 46, č. 1 (2008), s. 17-25. ISSN 0023-432X R&D Projects: GA AV ČR IAA1041404 Institutional research plan: CEZ:AV0Z20430508; CEZ:AV0Z20410507 Keywords : Fe-Cr-Al alloy powder * plasma spraying * oxidation * vaporization * composition changes Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.345, year: 2007

  7. Isothermal oxidation of metallic coatings deposited by a water-stabilized plasma gun

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Nop, P.; Kopřiva, P.; Kolman, Blahoslav Jan; Dubský, Jiří

    2006-01-01

    Roč. 44, č. 1 (2006), s. 41-48. ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/03/0710 Institutional research plan: CEZ:AV0Z20430508 Keywords : plasma spraying * metallic coatings * oxidation tests * oxidation kinetics * oxide structure * element distribution Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.138, year: 2006

  8. Únavové poškození v aluminium lithiových slitinách Část I. Cyklická plastická odezva a únavová životnost

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav; Kruml, Tomáš; Očenášek, V.

    2001-01-01

    Roč. 39, č. 2 (2001), s. 132-147. ISSN 0023-432X R&D Projects: GA ČR GA106/95/1529; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : aluminium -lithium alloy * cyclic plasticity * fatigue life Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.343, year: 2001

  9. Térence Billeter, L’Empereur jaune, Paris, Les Indes savantes, 2007, 549 pp.

    OpenAIRE

    Billioud, Sébastien

    2008-01-01

    In this book on Huangdi, the Yellow Emperor, the mythical patron figure of Chinese civilization, Térence Billeter presents a meticulously documented study on the Chinese authorities’ use of traditional culture today. His main thesis is that the Beijing regime is in this way seeking to “build an alternative model of modernity to counter the dominant Western one” (p. 432). This nationalist ideology seeks above all to impart a renewed legitimacy to the authorities in rallying their new social ba...

  10. Pathogenicity in Verticillium on strawberry plants

    OpenAIRE

    Schubert, P.; J. Golldack; Schwärzel, H.; Lentzsch, P.

    2008-01-01

    In the most common strawberry cv. ’Elsanta’, Verticillium infection can lead to rapid wilt and even death of plants. It is known, that a dead plant can be located directly beside vital ones. In a survey of 8 fields in Brandenburg, Mecklenburg- Vorpommern, Sachsen-Anhalt and Sachsen, 432 genotypes of Verticillium dahliae Kleb. were isolated from wilted and even vital plants from 8 fields and classified by PCR-fingerprints. For strawberries, the genotypes can be classified as apa...

  11. Structure changes in two chosen metallic materials exposed to molten LiF-NaF eutectic mixture – model of corrosion behaviour

    Czech Academy of Sciences Publication Activity Database

    Král, Lubomír; Čermák, Jiří; Matal, O.; Šimo, T.; Nesvadba, L.; Jílek, M.

    2009-01-01

    Roč. 47, č. 2 (2009), s. 63-73. ISSN 0023-432X R&D Projects: GA MPO 2A-1TP1/067 Institutional research plan: CEZ:AV0Z20410507 Keywords : steels and nickel alloys * corrosion * diffusion Subject RIV: JF - Nuclear Energetics Impact factor: 1.345, year: 2007 http://www.kovmat.sav.sk/abstract.php?rr=47&cc=2&ss=63

  12. Evaluation of two approaches to genotyping major histocompatibility complex class I in a passerine—CE-SSCP and 454 pyrosequencing

    Czech Academy of Sciences Publication Activity Database

    Promerová, Marta; Babik, W.; Bryja, Josef; Albrecht, Tomáš; Stuglik, M.; Radwan, J.

    2012-01-01

    Roč. 12, č. 2 (2012), s. 285-292. ISSN 1755-098X R&D Projects: GA AV ČR IAA600930608; GA ČR GA206/06/0851; GA ČR GAP505/10/1871 Institutional research plan: CEZ:AV0Z60930519 Keywords : avian * Carpodacus erythrinus * major histocompatibility complex * next-generation sequencing * scarlet rosefinch Subject RIV: EG - Zoology Impact factor: 7.432, year: 2012

  13. Information-disturbance tradeoff in sending direction information via antiparallel quantum spin

    International Nuclear Information System (INIS)

    When sending unknown direction information, antiparallel spins contain more direction information than parallel spins (Gisin and Popescu 1999 Phys. Rev. Lett. 83 432). In this paper, the optimal information-disturbance tradeoff bound for antiparallel spins is derived. The quantum measurements which attain the optimal tradeoff bound are obtained. This result can be of practical relevance for posing some general limits on Eve's eavesdropping process. Finally, we also present a comparison between the bound for antiparallel spins and the bound for parallel spins.

  14. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... NEOMED) 15,234 views 5:39 Perinatal Palliative Care - The Zimmer Family Story - Duration: 13:34. UnityPoint Health - Meriter 50,432 views 13:34 A Certain Kind Of Death - Documentary - Duration: 1:09:38. havoctrend 4,213,979 views ... Principles of Pediatric Palliative Care - Duration: 1:05:13. Karen Fauman 1,257 ...

  15. Workplace and HIV-related sexual behaviours and perceptions among female migrant workers

    OpenAIRE

    Yang, H; Li, X; Stanton, B.; Fang, X.; Lin, D.; Mao, R; H. Liu; Chen, X; SEVERSON, R.

    2005-01-01

    Data from 1,543 female migrants working in eight occupational clusters in Beijing and Nanjing, China were analysed to examine the association of workplace with HIV-related behaviours and perceptions. For sexually experienced women (n = 666, 43.2%), those working in entertainment establishments or personal service (e.g., nightclubs, dancing halls, barbershops, beauty salons, massage parlours, etc.) engaged in risky sexual practices twice as frequently as those working in non-entertainment esta...

  16. Prevalence and Characteristics of Pregnant Syphilis among Women Attending Antenatal Clinics in Shenzhen (China) in 2003

    Institute of Scientific and Technical Information of China (English)

    Yang Fan(杨帆); Zhou Hua(周华); Hong Fuchang(洪福昌); Luo Bin(罗斌); Cai Yumao(蔡于茂); Wen Lizhang(文立章); Zhang Chunlai(张春来)

    2004-01-01

    Abstract Background: The Nnewly reported cases of congenital syphilis have been increaseding substantially over the past few years. To control the epidemic, a municipal program aimed at preventing mother-to-child transmission of syphilis was introduced in July, 2001,which was designed aimed to screen all pregnant women for syphilis at their first visit to antenatal clinics or at admission to hospitals in Shenzhen.Objectives: The aim of the study is tTo determine the prevalence of syphilis among women attending antenatal clinics and other medical institutions in Shenzhen and identifies its patterns of infection.Methods: Upon giving informed consent, w Women who attended antenatal care centers in Shenzhen from January to December 2003 were included in this study subject to obtaining informed consent. A blood sample was harvested for syphilis screened for syphilising by using rapid plasma reagent test (RPR) and confirmed by TPHA for those who were RPR positive. The women with pregnant syphilispositive serology were systematically interviewed to obtain. During the interview, their demographic detailsinformation, patterns of risk behaviors and other data. Data were collected andwere analyzed retrospectively.Results: Among Of 118,235 pregnant women surveyed,555 pregnant women were confirmed to have syphilis (prevalence of 4.69%), with a incidence of 4.69‰. 123women were excluded from the analysis because of incomplete medical records. Of 432 infected subjects with complete medical records, the average age was 26.8, with a range of 19 to 41. 7.41% (32/432) of them suffered from primary syphilis, 3.24% (14/432) were ofhad secondary syphilis, and 89.35%(386/432) had latent syphilis. Without any conspicuous clinical signs and symptoms. Conclusions: The prevalence of syphilis among the pregnant women in our series was high an most of them were asymptomatic. Screening for syphilis among pregnant women in Shenzhen is of importantce for the prevention of mother

  17. The relationship between DRM and misinformation false memories

    OpenAIRE

    Zhu, B; Chen, C.; Loftus, EF; Lin, C.; Dong, Q.

    2013-01-01

    This research investigated the relationship between false memories induced by two different paradigms (misinformation and Deese-Roediger-McDermott [DRM]). The misinformation effect refers to the phenomenon that a person's recollection of a witnessed event can be altered after exposure to misleading information about the event. DRM false memory represents the intrusion of words that are semantically related but not actually presented in the study session. Subjects (N = 432) completed both misi...

  18. Investigating non-Fritzsch like texture specific quark mass matrices

    OpenAIRE

    Mahajan, Neelu; Verma, Rohit; Gupta, Manmohan

    2009-01-01

    A detailed investigation of all possible textures of Fritzsch-like and non-Fritzsch like, 144 for texture 6 zero and 432 for texture 5 zero mass matrices, have been carried out to ascertain their compatibility with the existing quark mixing data. It seems that all the texture 6 zero possibilities are completely ruled out whereas in the case of texture 5 zero mass matrices the only viable possibility looks to be that of Fritzsch-like.

  19. AcEST: BP918060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_B08 474 Adiantum capillus-veneris mRNA. clone: YMU001_000109_B08. BP918060 CL1202C ... QLLFGIEKGTELLDVVRPAGSPLVDNWDCLK 431 Query: 172 AMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVC 306 MV+ FE H ... VLLYGPGKGSSVLQSVRAPGSSLVDDWTCLK 433 Query: 172 AMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVCD 309 +MV+ FE ... KILFGISRGPEVLNKVRSAGQPLVDDWNCLK 432 Query: 172 AMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVC 306 V+AFE ... HC ... G L+ YG+KHMR+FANICNAG+ + +ME S C Sbjct: 433 NQVRAFE RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQAC 477 >sp|O243 ...

  20. AcEST: BP916351 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_F12 527 Adiantum capillus-veneris mRNA. clone: YMU001_000086_F12. BP916351 CL1202C ... QLLFGIEKGTELLDVVRPAGSPLVDNWDCL 430 Query: 234 KAMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVC 371 K MV+ FE ... KILFGISRGPEVLNKVRSAGQPLVDDWNCL 431 Query: 234 KAMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVC 371 K V+AFE ... HCG L+ YG+KHMR+FANICNAG+ + +ME S C Sbjct: 432 KNQVRAFE RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQAC 477 Score = ... KLLFGIEKGPEILNTVRPAGQPLVDDWGCL 431 Query: 234 KAMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVCD 374 K++V+ F ...

  1. Acute Kidney Injury Classification in Neuro-ICU Patient Group

    OpenAIRE

    Canan Akıncı; Nahit Çakar

    2012-01-01

    Objective: To investigate the role of acute kidney injury (AKI) classification system for kidney injury outcome in neuro-Intensive care unit (ICU) patients. Material and Method: Total 432 patients who admitted to ICU between 2005 and 2009 evaluated in this study. All patients’ AKI stage, Acute Physiology and Chronic Health Evaluation (APACHE-II), Sequential Organ Failure Assessment Score (SOFA), Glasgow Coma Score (GCS), Glasgow Outcome Score (GOS), mortality rate, length of ICU stay, need...

  2. Association between dyslipidemia and anthropometric indicators in adolescents Asociación entre la dislipemia y los indicadores antropometricos en adolescentes

    OpenAIRE

    S. C. Vieira Cunha Lima; C. Oliveira Lyra; L. Galvão Bacurau Pinheiro; P. R. Medeiros de Azevedo; R. F. Arrais; L. F. Campos Pedrosa

    2011-01-01

    The dyslipidemia associated with excess weight is a risk profile global call for cardiovascular disease (CVD). The aim of this study was to investigate the association between dyslipidemias and other risk factors for cardiovascular diseases (CVD) in adolescents, considering sexual maturation. A cross-sectional study was carried out with 432 adolescents from public schools, aged 10-19 years. The correlations between the variables from the lipid profile and the Body Mass Index (BMI), waist circ...

  3. Energy use in the U.S. steel industry: An historical perspective and future opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Stubbles, John [Steel Industry Consultant, Mason, OH (United States)

    2000-09-01

    Renowned industry expert Dr. John Stubbles has projected the energy savings that the U.S. steel industry could reasonably expect to achieve in the report, Energy Use in the U.S. Steel Industry: Historical Perspective and Future Opportunities (PDF 432 KB). The report examines the potential impacts of state-of-the-art technologies and operating practices, as well as structural changes in the industry itself.

  4. Knockdown of proteins involved in iron metabolism limits tick reproduction and development

    Czech Academy of Sciences Publication Activity Database

    Hajdušek, O.; Sojka, Daniel; Kopáček, Petr; Burešová, Veronika; Franta, Zdeněk; Šauman, Ivo; Winzerling, J.; Grubhoffer, L.

    2009-01-01

    Roč. 106, č. 4 (2009), s. 1033-1038. ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC06009; GA MŠk LC07032; GA AV ČR IAA600220603 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50070508 Keywords : tick ferritin * iron metabolism * RNA interference Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.432, year: 2009

  5. Effect of grain refinement by ECAP on creep of pure Cu

    Czech Academy of Sciences Publication Activity Database

    Blum, W.; Dvořák, Jiří; Král, Petr; Eisenlohr, P.; Sklenička, Václav

    2014-01-01

    Roč. 590, JAN (2014), s. 423-432. ISSN 0921-5093 R&D Projects: GA ČR(CZ) GAP108/11/2260; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Cu * ECAP * Static recrystallization * Creep * Ductility * High-angle boundaries Subject RIV: JJ - Other Materials Impact factor: 2.567, year: 2014

  6. Financování studia a vývoj v nerovnostech v přístupu k vysokoškolskému vzdělání v České republice a Nizozemsku

    Czech Academy of Sciences Publication Activity Database

    Matějů, P.; Konečný, Tomáš; Weidnerová, S.; Vossensteyn, H.

    2009-01-01

    Roč. 45, č. 5 (2009), s. 993-1031. ISSN 0038-0288 Institutional research plan: CEZ:MSM0021620846 Keywords : higher education * accessibility * inequality Subject RIV: AH - Economics Impact factor: 0.562, year: 2009 http://sreview.soc.cas.cz/uploads/a3cfbb693e42ea4491bb18005af05b432e1189d8_MatejuetalSC2009-5.pdf

  7. Influence of surrounding atmosphere on crystallization of as-quenched Fe-Ni-Zr ribbon

    Czech Academy of Sciences Publication Activity Database

    Roupcová, Pavla; Schneeweiss, Oldřich; Bezdička, Petr; Petrovič, P.

    2006-01-01

    Roč. 44, č. 3 (2006), s. 127-132. ISSN 0023-432X R&D Projects: GA MŠk 1M0512 Institutional research plan: CEZ:AV0Z20410507; CEZ:AV0Z40320502 Keywords : as-quenched material * kinetics of crystallization * Mossbauer spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

  8. The long range distributed fiber raman photon temperature sensor

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    A 31 km long range distributed optical fiber Raman photon temperature sensor (DOFRPTS) system have been developed based on temperature effect of the amplified spontaneous Raman scattering in fiber, and using fiber laser as a pumped source. The results show that temperature measuring uncertainty is ±2 ℃, temperature resolution is 0.1 ℃, measurement time is 432 s, spatial resolution is less than 4 m.

  9. Usage of complementary medicine across Switzerland. Results of the Swiss Health Survey 2007

    OpenAIRE

    Klein, Sabine; Frei-Erb, Martin; Wolf, Ursula

    2012-01-01

    QUESTIONS UNDER STUDY: This study investigated the use among the Swiss adult population and regional dissemination of various methods of complementary medicine (CM) provided by physicians or therapists in Switzerland. METHODS: Data of the Swiss Health Survey 2007 were used, which comprised a telephone interview followed by a written questionnaire (18,760 and 14,432 respondents, respectively) and included questions about people's state of health, health insurance and usage of health servic...

  10. Cyclic plasticity, cyclic creep and fatigue life of duplex stainless steel in cyclic loading with positive mean stress

    Czech Academy of Sciences Publication Activity Database

    Polák, Jaroslav; Petrenec, Martin; Man, Jiří

    2011-01-01

    Roč. 49, č. 5 (2011), s. 347-354. ISSN 0023-432X R&D Projects: GA AV ČR IAA100480704; GA ČR GA101/07/1500 Institutional research plan: CEZ:AV0Z20410507 Keywords : cyclic plasticity * cyclic creep * duplex steel Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.451, year: 2011

  11. Cytokinins modulate auxin-induced organogenesis in plants via regulation of the auxin efflux

    Czech Academy of Sciences Publication Activity Database

    Pernisová, M.; Klíma, Petr; Horák, J.; Válková, M.; Malbeck, Jiří; Souček, Přemysl; Reichman, P.; Hoyerová, Klára; Dubová, J.; Friml, J.; Zažímalová, Eva; Hejátko, J.

    2009-01-01

    Roč. 106, č. 9 (2009), s. 3609-3614. ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC06034; GA ČR(CZ) GD204/08/H054 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z50040702 Keywords : PIN expression * two-component signalling * root meristem Subject RIV: ED - Physiology Impact factor: 9.432, year: 2009

  12. Dental caries and dental fluorosis in 7-12-year-old schoolchildren in Catalão, Goiás, Brazil Cárie e fluorose dentária em escolares de 7 a 12 anos de idade em Catalão, Goiás, Brasil

    OpenAIRE

    Priscila Ariede Petinuci Bardal; Kelly Polido Kaneshiro Olympio; Marília Afonso Rabelo Buzalaf; José Roberto Magalhães Bastos

    2005-01-01

    INTRODUCTION: Over the last two decades, the prevalence of dental caries in children has decreased and the prevalence of dental fluorosis has increased. Knowledge on the epidemiologic conditions of a population is fundamental for the planning of health programs. OBJECTIVES: To determine the prevalence of dental caries and dental fluorosis among schoolchildren, in Catalão, Goiás, Brazil. METHODS: A random sample of 432 schoolchildren aged 7-12-years old was obtained. WHO (1997) criteria for de...

  13. An organometallic route to long helicenes

    Czech Academy of Sciences Publication Activity Database

    Sehnal, Petr; Stará, Irena G.; Šaman, David; Tichý, Miloš; Míšek, Jiří; Cvačka, Josef; Rulíšek, Lubomír; Chocholoušová, Jana; Vacek, Jaroslav; Goryl, G.; Szymonski, M.; Císařová, I.; Starý, Ivo

    2009-01-01

    Roč. 106, č. 32 (2009), s. 13169-13174. ISSN 0027-8424 R&D Projects: GA ČR GA203/06/1792; GA MŠk LC512 Grant ostatní: FP6(XE) 015847 Institutional research plan: CEZ:AV0Z40550506 Keywords : nonracemic compounds * STM imaging * helicene Subject RIV: CC - Organic Chemistry Impact factor: 9.432, year: 2009

  14. Sequencing wheat chromosome arm 7BS delimits the 7BS/4AL translocation and reveals homoeologous gene conservation

    Czech Academy of Sciences Publication Activity Database

    Berkman, P.J.; Skarshewski, A.; Manoli, S.; Lorenc, M. T.; Stiller, J.; Smits, L.; Lai, K.; Cambell, E.; Kubaláková, Marie; Šimková, Hana; Batley, J.; Doležel, Jaroslav; Hernandez, P.; Edwards, D.

    2012-01-01

    Roč. 124, č. 3 (2012), s. 423-432. ISSN 0040-5752 R&D Projects: GA MŠk(CZ) LC06004 Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : POLYPLOID WHEAT * BIN MAP * BRACHYPODIUM-DISTACHYON Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.658, year: 2012

  15. Fraenkel's pupariation factor identified at last

    Czech Academy of Sciences Publication Activity Database

    Verleyen, P.; Clynen, E.; Huybrechts, J.; Van Lommel, A.; Vanden Bosch, L.; De Loof, A.; Žďárek, Jan; Schoofs, L.

    2004-01-01

    Roč. 273, - (2004), s. 38-47. ISSN 0012-1606 R&D Projects: GA ČR GA522/01/0501 Grant ostatní: FWO(BE) G.0187.00; FWO(BE) G.0175.02; FWO(BE) G.0146.03 Institutional research plan: CEZ:AV0Z4055905 Keywords : Neobellieria bullata * pupariation factor * pyrokinin Subject RIV: CC - Organic Chemistry Impact factor: 5.432, year: 2004

  16. Modulation of flagellum attachment zone protein FLAM3 and regulation of the cell shape in Trypanosoma brucei life cycle transitions

    Czech Academy of Sciences Publication Activity Database

    Sunter, J.C.; Benz, C.; Andre, L.; Whipple, S.; McKean, P.G.; Gull, K.; Ginger, M. L.; Lukeš, Julius

    2015-01-01

    Roč. 128, č. 16 (2015), s. 3117-3130. ISSN 0021-9533 R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA MŠk LH12104 EU Projects: European Commission(XE) 316304 Institutional support: RVO:60077344 Keywords : Trypanosomes * Morphogenesis * Flagellum attachment zone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  17. Bora and Aurora-A continue to activate Plk1 in mitosis

    Czech Academy of Sciences Publication Activity Database

    Bruinsma, W.; Macůrek, Libor; Freire, R.; Lindqvist, A.; Medema, R.H.

    2014-01-01

    Roč. 127, č. 4 (2014), s. 801-811. ISSN 0021-9533 R&D Projects: GA ČR GA13-18392S Grant ostatní: Ministerio de Economía y Competitividad(ES) SAF2010-22357; CONSOLIDER-Ingenio(NL) CDS2007-0015 Keywords : Aurora-A * Bora * Mitosis * Plk1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  18. Relations Among Student Attention Behaviors, Teacher Practices, and Beginning Word Reading Skill

    OpenAIRE

    Sáez, Leilani; Folsom, Jessica Sidler; Al Otaiba, Stephanie; Schatschneider, Christopher

    2011-01-01

    The role of student attention for predicting kindergarten word reading was investigated among 432 students. Using SWAN behavior rating scores, we conducted an exploratory factor analysis, which yielded three distinct factors that reflected selective attention. In this study, we focused on the role of one of these factors, which we labeled attention-memory behaviors, for predicting reading performance. Teacher ratings of attention predicted word reading above and beyond the contribution of pho...

  19. Pinning it Down: Drawing as Capture

    OpenAIRE

    Mojsiewicz, Kristin; Lewis, Chara; Pettican, Anneke

    2011-01-01

    Title of Output: Pinning it Down: Drawing as CaptureAuthor(s): Brass ArtName of conference/ publication proceedings: Technologies of DrawingOpening date/ closing date: 26/08/11Location: University of Huddersfield, UKVenue or Publisher: University of Huddersfield & the European Sculpture NetworkURL: http://www.sculpture-network.org/index.php?id=432Other Details: 4 invited speakers: Prof Deanna Petherbridge, Brass Art, Prof David Dernie, Teresa Carneiro

  20. Investigation of Strouhal numbers of iced cable models of cable-supported bridges with respect to angle of wind attack

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Tatara, M.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Marušić, A.

    2015-01-01

    Roč. 112, 2-B (2015), s. 417-432. ISSN 1897-628X R&D Projects: GA MŠk(CZ) LO1219; GA MPO(CZ) FR-TI3/654 Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JN - Civil Engineering http://suw.biblos.pk.edu.pl/resources/i5/i6/i6/i8/i4/r56684/GorskiP_InvestigationsStrouhal.pdf

  1. Status and performance of the CDF Run II silicon detector

    Energy Technology Data Exchange (ETDEWEB)

    Maki, Tuula; /Helsinki Inst. of Phys.

    2006-10-01

    The CDF silicon detector is one of the largest silicon detectors in operation. It has a total of 722,432 electronic channels, and it covers a sensor surface area of 6 m{sup 2}. The detector has been operating reliably for five years, and it has recorded 1.5 fb{sup -1} of data. This article discusses experiences of operating such a large, complex system as well as the longevity of the detector.

  2. Validation of the Ottawa ankle rules in children.

    OpenAIRE

    Libetta, C; Burke, D; Brennan, P; Yassa, J

    1999-01-01

    OBJECTIVE: To assess whether the Ottawa ankle rules can be used to accurately predict which children with ankle and midfoot injuries need radiography. METHODS: Prospective study with historical control group of all children aged 1-15 years presenting to Sheffield Children's Hospital accident and emergency department with blunt ankle and/or midfoot injuries during two five month periods before and after implementation of the Ottawa ankle rules. RESULTS: In the study group 432 out of 761 (56.76...

  3. Influence of yttrium content on the Ce.sub.Lu1./sub. and Ce.sub.Lu2./sub. luminescence characteristics in (Lu.sub.1-x./sub.Y.sub.x./sub.).sub.2./sub.SiO.sub.5./sub.: Ce single crystal

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Ren, G.; Horodysky, P.; Pazzi, G.P.; Kučerková, Romana

    2011-01-01

    Roč. 34, č. 2 (2011), s. 428-432. ISSN 0925-3467 R&D Projects: GA MŠk(CZ) ME10084; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * excited state ionization * temperature dependence * L(Y)SO: Ce Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.023, year: 2011

  4. Innate Immune Activity Conditions the Effect of Regulatory Variants upon Monocyte Gene Expression

    OpenAIRE

    Fairfax, B. P.; Humburg, P.; Makino, S.; Naranbhai, V; Wong, D.; Lau, E; Jostins, L; Plant, K.; Andrews, R; McGee, C.; Knight, J.C.

    2014-01-01

    To systematically investigate the impact of immune stimulation upon regulatory variant activity, we exposed primary monocytes from 432 healthy Europeans to interferon-γ (IFN-γ) or differing durations of lipopolysaccharide and mapped expression quantitative trait loci (eQTLs). More than half of cis-eQTLs identified, involving hundreds of genes and associated pathways, are detected specifically in stimulated monocytes. Induced innate immune activity reveals multiple master regulatory trans-eQTL...

  5. Acceptance of HIV testing among women attending antenatal care in south-western Uganda: risk factors and reasons for test refusal

    OpenAIRE

    Dahl, Viktor; Mellhammar, Lisa; Bajunirwe, Francis; Björkman, Per

    2008-01-01

    Abstract A problem commonly encountered in programs for prevention of mother-to-child-transmission (PMTCT) of HIV in sub-Saharan Africa is low rates of HIV test acceptance among pregnant women. In this study, we examined risk factors and reasons for HIV test refusal among 432 women attending three antenatal care clinics offering PMTCT in urban and semi-urban parts of the Mbarara district, Uganda. Structured interviews were performed following pre-test counselling. Three-hundre...

  6. Individual, Family, and Culture Level Contributions to Child Physical Abuse and Neglect: A Longitudinal Study in Nine Countries

    OpenAIRE

    Lansford, Jennifer E.; Godwin, Jennifer; Uribe Tirado, Liliana Maria; Zelli, Arnaldo; Al-Hassan, Suha M.; Bacchini, Dario; Bombi, Anna Silvia; Bornstein, Marc H.; Chang, Lei; Deater-Deckard, Kirby; Di Giunta, Laura; Dodge, Kenneth A.; Malone, Patrick S.; Oburu, Paul; Pastorelli, Concetta

    2015-01-01

    This study advances understanding of predictors of child abuse and neglect at multiple levels of influence. Mothers, fathers, and children (N = 1,432 families, M age of children = 8.29 years) were interviewed annually in three waves in 13 cultural groups in nine countries (China, Colombia, Italy, Jordan, Kenya, Philippines, Sweden, Thailand, and the United States). Multilevel models were estimated to examine predictors of (a) within-family differences across the three time points, (b) between...

  7. Aphid parasitoids (Hymenoptera, Braconidae, Aphidiinae) and their associations related to biological control in Brazil

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Sampaio, M. V.; Bueno, V. H. P.

    2007-01-01

    Roč. 51, č. 1 (2007), s. 107-118. ISSN 0085-5626 R&D Projects: GA AV ČR IBS5007102 Grant ostatní: FAO programmers(BR) TCP/BRA/8908 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphid * host range * insect-plant interactions Subject RIV: EH - Ecology, Behaviour Impact factor: 0.432, year: 2007

  8. AcEST: DK953903 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e-40 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L...RSLDWDRDRFDIEFGLQNGTTYNSYLIQADKVALVDSSHEK 67 Query: 444 FRDLYLAALKEQIDPSTIQYIVANHTEP...DHSGLIPDLLEIAPNVTVVGSKICIQFL 611 FR LYL L+ IDP I Y++ +HTEPDHSGL+ D+L++ P +TVV +K+ +QFL Sbjct: 68 FRQLYLDLLQGLIDPQRIDYLIVSHTEP...D Sbjct: 4 LTEKTEKRLTIQTADIAQDTTAIRSLDWERDRFDIEFGLQNGTTYNSFLIRGEQIALVDT 63 Query: 432 SHEKFRDLYLAALKEQIDPSTIQYIVANHTEP...DHSGLIPDLLEIAPNVTVVGSKICIQFL 611 SHEKFR LY L I+P+ I Y++ +HTEPDHSGL+ DLL

  9. AcEST: DK950335 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0008_G04 645 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_G04. 5' end seq ... 7 LSSEFLLPEDPKTKIPPAPGPTPLLPFPTPV-KVHGLEPCTP-SPFPT-MAP PPSLLPE- 432 Query: 518 AQTSTSASLPIGLSPSHP 571 ++ S ... tr_hit_id Q9ATY4 Definition tr|Q9ATY4|Q9ATY4_MAIZE MAP ... kinase phosphatase (Fragment) OS=Zea mays Align le ...

  10. Spatial decisions and cognitive strategies of monkeys and humans based on abstract spatial stimuli in rotation test

    Czech Academy of Sciences Publication Activity Database

    Nekovářová, Tereza; Nedvídek, Jan; Klement, Daniel; Bureš, Jan

    2009-01-01

    Roč. 136, č. 36 (2009), s. 15478-15482. ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517; GA ČR(CZ) GA309/09/0286; GA AV ČR KJB500110704 Institutional research plan: CEZ:AV0Z50110509 Keywords : spatial cognition * geometry of space * mental rotations Subject RIV: FH - Neurology Impact factor: 9.432, year: 2009

  11. [原著]Elder Abuse and Staff Awareness in Long-term Care Insurance Facilities in Okinawa

    OpenAIRE

    Kuniyoshi, Midori; Maeshiro, Chikako; Koja, Yasuko; Yokota, Takao; Departments of Coommunity Health Nursingschool of Health Sciences, Faculty of Medicine, University of the Ryukyus; Adult and Gerontotgical Nursing and Coommunity Health Nursingschool of Health Sciences, Faculty of Medicine, University of the Ryukyus

    2007-01-01

    Staff awareness of abusive actions to the elderly in long-term care insurance facilities was surveyed. A total of 702 responses (response rate, 65.6%) were obtained and then divided into abuse-experienced (n=432) and non-experienced group (n=270). Twentyseven abusive actions categorized by the Study Group for Treating the Elderly were evaluated by staff. Results were as follows:1) Men were more likely to commit abuse than women(p

  12. Extended Latanoprost Release from Commercial Contact Lenses: In Vitro Studies Using Corneal Models

    OpenAIRE

    Mohammadi, Saman; Jones, Lyndon; Gorbet, Maud

    2014-01-01

    In this study, we compared, for the first time, the release of a 432 kDa prostaglandin analogue drug, Latanoprost, from commercially available contact lenses using in vitro models with corneal epithelial cells. Conventional polyHEMA-based and silicone hydrogel soft contact lenses were soaked in drug solution ( solution in phosphate buffered saline). The drug release from the contact lens material and its diffusion through three in vitro models was studied. The three in vitro models consisted ...

  13. [Specific molecular markers of the rust resistance gene M4 in flax].

    Science.gov (United States)

    Bo, Tian-Yue; Ye, Hua-Zhi; Wang, Shi-Quan; Yang, Jian-Chun; Li, Xiao-Bing; Zhai, Wen-Xue

    2002-10-01

    Flax (Linum usitatissimum L.) is an important fiber and oil-producing crop. Flax rust, caused by Melampsora lini Ehrenb. Lev., occurs worldwide and can cause severe losses in seed yield and fiber quality. In order to identify molecular markers linked to the flax rust resistant gene M4, RAPD analysis of NM4, a near-isogenic line containing the M4 gene, and the recurrent parent Bison was carried out with 540 decamer primers. The primer OPA18 could stably amplify a specific fragment, OPA18(432), in the NM4 line. The OPA18(432) marker was testified to be closely linked to the M4 gene with a genetic distance of 2.1 cM through the analysis of the F2 mapping population derived from a cross of Bison x NM4. Based on the sequence of OPA18(432), the specific PCR primers were designed, and a SCAR marker for the M4 gene was produced. Amplification of different resistant materials proved that the maker is specific for the M4 gene. This marker has been used successfully in marker-assisted selection in the flax breeding program. PMID:12561479

  14. Rapeseed population arrangement defined by adaptability and stability parameters

    Directory of Open Access Journals (Sweden)

    Cleusa A. M. B. Krüger

    2016-01-01

    Full Text Available ABSTRACT The objective of this study was to identify the plant arrangement that allows greater grain yield with adaptability and stability of rapeseed hybrids. The experiments were conducted in randomized block design with four replicates and the 12 treatments consisted of combination of inter-row spacings (0.20, 0.40, and 0.60 m and plant densities (20, 40, 60 and 80 plants m-2. The hybrids Hyola 432 (early cycle and Hyola 61 (medium cycle were cultivated in three growing seasons (2008, 2009 and 2010. Grain yield was evaluated based on the parameters adaptability and stability according to the models of Wricke and Eberhart & Russell. The plant arrangement for obtaining higher grain yield depends on the cultivated genotype. Higher grain yield was obtained in the arrangements of 0.20 m x 60 and 0.40 m x 60 plants m-2 for Hyola 432, and in 0.20 m x 60 plants m-2 for Hyola 61, in the three years of evaluation. In the inter-row spacing of 0.40 m and densities of 40 and 60 plants m-2, Hyola 432 shows high yield, adaptability to wide environments and stability. For Hyola 61, high productivity with overall adaptability was obtained in the inter-row spacing of 0.40 m, with 60 plants m-2.

  15. Protective effects of adrenochrome monoaminoguanidine methanesulfonate (AMM) and cytochrome C (CCC) on natural killer cells in the peripheral blood of cancer patients during radiotherapy

    International Nuclear Information System (INIS)

    The purpose of this study was to examine radioprotective effects of adrenochrome monoaminoguanidine methanesulfonate (AMM) and cytochrome C (CCC) on lymphocyte subset during radiotherapy (RT). Sixty five patients received irradiation of 50 Gy or more to the chest field of 100 cm2 or larger. The patients were classified into four groups: those treated with RT alone (Group I, n=15), combined RT and OK-432 (Group II, n=15), combined RT and AMMM + CCC (Group III, n=17), and combined RT and AMM + CCC + OK-432 (Group IV, n=18). Lymphocytes decreased by 64% after RT in Group I and by 50% in Group III. AMM and CCC prevented a decrease in the absolute number of potent natural killer cells and activated T cells, with statistically significant differences. In Group III, the absolute number of activated T cells tended to increase even after RT. Cytotoxic T cells decreased by only 11% after RT in Group III, as compared with 58% in Group I. As found in Groups II and IV, the combination of OK-432 did not have so protective effects on lymphocytes associated with RT as AMM + CCC combined with RT in Groups III. In view of the selective protection for potent natural killer cells and activated T cells, AMM + CCC seemed to serve as biological response modifiers, as well as radioprotective agents. (N.K.)

  16. Physical, Chemicals and Flavors of Some Varieties of Arabica Coffee

    Directory of Open Access Journals (Sweden)

    Yusianto .

    2014-08-01

    Full Text Available Export of Arabica coffee was 28,100 tons/year or 8.28% total export of Indonesian coffee, most of them are specialty coffee. Beside their origin, variety and determine the of physical, chemical and flavors characters. The promising clones or varieties i.e. BP 416A, BP 418A, BP 430A, BP 431A, BP 432A, BP 507A, BP 508A, BP 509A, BP 511A, BP 513A, BP 516A, BP 517A and BP 518A still not be determined their quality This research was conducted to analyze their physicals, chemicals and flavors during 2 periods of harvesting (2004 and 2005, using AS 1, S 795 and USDA 762 as the control. Mature coffee berry was harvested, sorted manually, and depulped, cleaned manually and then fermented in plastic sacks during 36 hours. The fermented parchment was washed, and then sun dried, dehulled to get green coffee. Observations wre conducted on green coffee yield, husk content, color of green coffee, distribution of size, bulk density of green and roasted coffee, roasting characters, color of roasted beans, and pH, acidity and flavors. The results showed (a The lowest content of husk was BP 432A and the highest was USDA 762. The control varieties of AS 1, S 795 and USDA 762, showed husk content >15%, while those potential varieties were < 15% except BP 416A. (b Beans size >6,5 mm and more than 80% were BP 416A, BP 430A, BP 432A, BP 509A, P 88 and S 795. Green coffee of BP 430A, BP 432A and BP 509A were uniform, but S 795 was not uniform. AS 1 and BP 416A and P 88 was one group; S 795 was one group with BP 542A; BP 509 was a group with BP 432A; but BP4 30A and USDA 762 were the other groups. (c Green coffee of USDA 762 was the palest color, but BP 542A was the darkest color. AS 1 and S 795 were a group with all potential varieties, except BP 542A. (d Roasted coffee of USDA 762 was the palest color and AS 1 was the darkest. In this case, AS 1 was a group with BP 430A, BP 509A and P 88, while S 795 was a group with BP 416A and BP 432A, but USDA 762 and BP 542A were

  17. Deriva de herbicidas e efeito de fungicida X herbicida em plantas jovens de pessegueiro Herbicide drift simulation and effect of fungicide X herbicide on peach tree seedlings

    Directory of Open Access Journals (Sweden)

    L.D. Tuffi Santos

    2006-09-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos da deriva de glyphosate e triclopyr sobre plantas jovens de pessegueiro, bem como o comportamento destas quando submetidas à deriva de glyphosate com tratamento prévio de fungicida. No experimento 1, a simulação da deriva foi feita por aplicação de subdoses dos herbicidas glyphosate (43,2; 86,4; 172,8; e 345,8 g ha-1, triclopyr (14,4; 28,8; 57,6; e 115,2 g ha-1 e pela mistura de glyphosate + triclopyr (43,2 + 24,4; 86,4 + 28,8; e 172,8 + 57,6 g ha-1, constituindo os tratamentos. O experimento 2 foi num fatorial 2 x 6 [fungicida (presença e ausência de aplicação x subdoses de glyphosate (0; 43,2; 86,4; 129,6; 172,8; e 345,6 g ha-1]. No experimento 1, plantas tratadas com glyphosate e triclopyr nas doses de 345,6 e 57,6 g e.a. ha-1, respectivamente, apresentaram maiores percentuais de intoxicação, não havendo efeito da deriva destes herbicidas no desenvolvimento inicial. No experimento 2, as doses de glyphosate influenciaram o desenvolvimento inicial das plantas, com efeitos proporcionais ao aumento das doses. O fungicida não influenciou o desenvolvimento inicial, mas a porcentagem de intoxicação foi maior em plantas tratadas, indicando possível efeito sinérgico entre os defensivos testados.The aim of this work was to evaluate the effects of glyphosate and triclopyr drift on the initial growth of peach tree seedlings, as well as the behavior of these seedlings when submitted to glyphosate drift with fungicidal treatment. In Experiment 1, simulation drift was performed by applying glyphosate (43.2; 86.4; 172.8 and 345.8 g ha-1 , triclopyr (14.4; 28.8; 57.6 and 115.2 g ha-1 and the mixture glyphosate + triclopyr (43.2 + 24.4; 86.4 + 28.8 and 172.8 + 57.6 g ha-1, as the treatments. Experiment 2 was arranged in a 2 x 6 factorial scheme [fungicide (with and without of application x reduced rates of glyphosate (0; 43.2; 86.4; 129.6; 172.8 and 345.6 g ha-1]. In Experiment 1, peach

  18. Chemical genetics reveals a specific requirement for Cdk2 activity in the DNA damage response and identifies Nbs1 as a Cdk2 substrate in human cells.

    Directory of Open Access Journals (Sweden)

    Lara Wohlbold

    2012-08-01

    Full Text Available The cyclin-dependent kinases (CDKs that promote cell-cycle progression are targets for negative regulation by signals from damaged or unreplicated DNA, but also play active roles in response to DNA lesions. The requirement for activity in the face of DNA damage implies that there are mechanisms to insulate certain CDKs from checkpoint inhibition. It remains difficult, however, to assign precise functions to specific CDKs in protecting genomic integrity. In mammals, Cdk2 is active throughout S and G2 phases, but Cdk2 protein is dispensable for survival, owing to compensation by other CDKs. That plasticity obscured a requirement for Cdk2 activity in proliferation of human cells, which we uncovered by replacement of wild-type Cdk2 with a mutant version sensitized to inhibition by bulky adenine analogs. Here we show that transient, selective inhibition of analog-sensitive (AS Cdk2 after exposure to ionizing radiation (IR enhances cell-killing. In extracts supplemented with an ATP analog used preferentially by AS kinases, Cdk2(as phosphorylated the Nijmegen Breakage Syndrome gene product Nbs1-a component of the conserved Mre11-Rad50-Nbs1 complex required for normal DNA damage repair and checkpoint signaling-dependent on a consensus CDK recognition site at Ser432. In vivo, selective inhibition of Cdk2 delayed and diminished Nbs1-Ser432 phosphorylation during S phase, and mutation of Ser432 to Ala or Asp increased IR-sensitivity. Therefore, by chemical genetics, we uncovered both a non-redundant requirement for Cdk2 activity in response to DNA damage and a specific target of Cdk2 within the DNA repair machinery.

  19. Effect of suppression of arabinoxylan synthetic genes in wheat endosperm on chain length of arabinoxylan and extract viscosity.

    Science.gov (United States)

    Freeman, Jackie; Lovegrove, Alison; Wilkinson, Mark David; Saulnier, Luc; Shewry, Peter Robert; Mitchell, Rowan Andrew Craig

    2016-01-01

    Arabinoxylan (AX) is the dominant component within wheat (Triticum aestivum L.) endosperm cell walls, accounting for 70% of the polysaccharide. The viscosity of aqueous extracts from wheat grain is a key trait influencing the processing for various end uses, and this is largely determined by the properties of endosperm AX. We have previously shown dramatic effects on endosperm AX in transgenic wheat by down-regulating either TaGT43_2 or TaGT47_2 genes (orthologues to IRX9 and IRX10 in Arabidopsis, respectively) implicated in AX chain extension and the TaXAT1 gene responsible for monosubstitution by 3-linked arabinose. Here, we use these transgenic lines to investigate the relationship between amounts of AX in soluble and insoluble fractions, the chain-length distribution of these measured by intrinsic viscosity and the overall effect on extract viscosity. In transgenic lines expressing either the TaGT43_2 or TaGT47_2 RNAi transgenes, the intrinsic viscosities of water-extractable (WE-AX) and of a water-insoluble alkaline-extracted fraction (AE-AX) were decreased by between 10% and 50% compared to control lines. In TaXAT1 RNAi lines, there was a 15% decrease in intrinsic viscosity of WE-AX but no consistent effect on that of AE-AX. All transgenic lines showed decreases in extract viscosity with larger effects in TaGT43_2 and TaGT47_2 RNAi lines (by up to sixfold) than in TaXAT1 RNAi lines (by twofold). These effects were explained by the decreases in amount and chain length of WE-AX, with decreases in amount having the greater influence. Extract viscosity from wheat grain can therefore be greatly decreased by suppression of single gene targets. PMID:25819752

  20. Genome-scale metabolic analysis of Clostridium thermocellum for bioethanol production

    Directory of Open Access Journals (Sweden)

    Brooks J Paul

    2010-03-01

    Full Text Available Abstract Background Microorganisms possess diverse metabolic capabilities that can potentially be leveraged for efficient production of biofuels. Clostridium thermocellum (ATCC 27405 is a thermophilic anaerobe that is both cellulolytic and ethanologenic, meaning that it can directly use the plant sugar, cellulose, and biochemically convert it to ethanol. A major challenge in using microorganisms for chemical production is the need to modify the organism to increase production efficiency. The process of properly engineering an organism is typically arduous. Results Here we present a genome-scale model of C. thermocellum metabolism, iSR432, for the purpose of establishing a computational tool to study the metabolic network of C. thermocellum and facilitate efforts to engineer C. thermocellum for biofuel production. The model consists of 577 reactions involving 525 intracellular metabolites, 432 genes, and a proteomic-based representation of a cellulosome. The process of constructing this metabolic model led to suggested annotation refinements for 27 genes and identification of areas of metabolism requiring further study. The accuracy of the iSR432 model was tested using experimental growth and by-product secretion data for growth on cellobiose and fructose. Analysis using this model captures the relationship between the reduction-oxidation state of the cell and ethanol secretion and allowed for prediction of gene deletions and environmental conditions that would increase ethanol production. Conclusions By incorporating genomic sequence data, network topology, and experimental measurements of enzyme activities and metabolite fluxes, we have generated a model that is reasonably accurate at predicting the cellular phenotype of C. thermocellum and establish a strong foundation for rational strain design. In addition, we are able to draw some important conclusions regarding the underlying metabolic mechanisms for observed behaviors of C. thermocellum

  1. Nutrition habits in 24-hour mountain bike racers.

    Science.gov (United States)

    Chlíbková, Daniela; Knechtle, Beat; Rosemann, Thomas; Tomášková, Ivana; Chadim, Vlastimil; Shortall, Marcus

    2014-01-01

    We investigated seventy-four ultra-mountain bikers (MTBers) competing in the solo category in the first descriptive field study to detail nutrition habits and the most common food before during and after the 24 hour race using questionnaires. During the race, bananas (86.5%), energy bars (50.0%), apples (43.2%) and cheese (43.2%) were the most commonly consumed food, followed by bread (44.6%), rice (33.8%) and bananas (33.8%) after the race. Average fluid intake was 0.5 ± 0.2 l/h. The main beverage was isotonic sports drink (82.4%) during and pure water (66.2%) after the race. The most preferred four supplements in the four weeks before, the day before, during and after the race were vitamin C (35.1%), magnesium (44.6%), magnesium (43.2%) and branched-chain amino acids (24.3%), respectively. Total frequency of food intake (30.6 ± 10.5 times/24 hrs) was associated with fluid intake (r = 0.43, P = 0.04) and both were highest at the beginning of the race and lower during the night hours and the last race segment in a subgroup of twenty-three ultra-MTBers. Supplement intake frequency (6.8 ± 8.4 times/24 hrs) was highest during the night hours and lower at the beginning and end of the race. Elevated food and fluid intake among participants tracked across all race segments (P < 0.001). In conclusion, the nutrition strategy employed by ultra-MTBers was similar to those demonstrated in previous studies of ultra-cyclists with some exceptions among selected individuals. PMID:25674455

  2. Cytochrome 450 1B1 (CYP1B1 polymorphisms associated with response to docetaxel in Castration-Resistant Prostate Cancer (CRPC patients

    Directory of Open Access Journals (Sweden)

    Price Douglas K

    2010-09-01

    Full Text Available Abstract Background The selection of patients according to key genetic characteristics may help to tailor chemotherapy and optimize the treatment in Castration-Resistant Prostate Cancer (CRPC patients. Functional polymorphisms within the cytochrome P450 1B1 (CYP1B1 gene have been associated with alterations in enzymatic expression and activity and may change sensitivity to the widely used docetaxel regimen. Methods CYP1B1 genotyping was performed on blood samples of 60 CRPC patients treated with docetaxel, using TaqMan probes-based assays. Association between CYP1B1-142C>G (leading to the 48ArgGly transition, 4326C>G (432LeuVal, and 4390A>G (453AsnSer polymorphisms and treatment response, progression-free-survival (PFS and overall-survival (OS was estimated using Pearson χ2 test, Kaplan-Meier curves and Log-rank test. Results Patients carrying the CYP1B1-432ValVal genotype experienced a significantly lower response-rate (P = 0.014, shorter progression-free-survival (P = 0.032 and overall-survival (P Conclusions CYP1B1-4326C>G (432LeuVal polymorphism emerged as possible predictive marker of response and clinical outcome to docetaxel in CRPC patients and may represent a potential new tool for treatment optimization. Larger prospective trials are warranted to validate these findings, which might be applied to the future practice of CRPC treatment.

  3. Intergrating cavity absorption meter measurements of dissolved substances and suspended particles in ocean water

    Science.gov (United States)

    Pope, Robin M.; Weidemann, Alan D.; Fry, Edward S.

    2000-01-01

    We have developed a new device to measure the separate contributions to the spectral absorption coefficient due to a pure liquid, due to the particles suspended in it, and due to the substances dissolved in it. This device, the Integrating Cavity Absorption Meter (ICAM), is essentially independent of scattering effects in the sample. In April 1993, a prototype of the ICAM was field tested on board the research vessel USNS Bartlett. A major part of the cruise track included criss-crossing the area where the Mississippi flows into the Gulf of Mexico at various ranges from the mouth of the river; thus samples were collected from areas of blue, green, and brown/black water. We evaluated 35 seawater samples collected with 5-l Niskin bottles from 22 locations to determine absorption spectra (380-700 nm) of suspended particles and dissolved substances (gelbstoff). Results validate the ICAM as a viable tool for marine optical absorption research. Gelbstoff absorption at 432.5 nm ranged from 0.024 to 0.603 m -1. Over the spectral region 380→560 nm, gelbstoff absorption by each of the samples could be accurately fit to a decaying exponential. The particle absorption spectra are generally characteristic of those of phytoplankton and exhibit a local maximum at 430-440 nm. Absorption values at 432.5 nm ranged from ˜zero to ˜1.0 m -1. Some samples with moderate particulate absorption, however, did not show the characteristic local maximum of phytoplankton in the blue and instead resembled the characteristic decaying exponential of detritus with a shape similar to that observed in the gelbstoff. The ratio of gelbstoff to particulate absorption at 432.5 nm ranged from 0.46 to 152.

  4. Genome wide expression profiling of p53 regulated miRNAs in neuroblastoma.

    Science.gov (United States)

    Rihani, Ali; Van Goethem, Alan; Ongenaert, Maté; De Brouwer, Sara; Volders, Pieter-Jan; Agarwal, Saurabh; De Preter, Katleen; Mestdagh, Pieter; Shohet, Jason; Speleman, Frank; Vandesompele, Jo; Van Maerken, Tom

    2015-01-01

    Restoration of the antitumor activity of p53 could offer a promising approach for the treatment of neuroblastoma. MicroRNAs (miRNAs) are important mediators of p53 activity, but their role in the p53 response has not yet been comprehensively addressed in neuroblastoma. Therefore, we set out to characterize alterations in miRNA expression that are induced by p53 activation in neuroblastoma cells. Genome-wide miRNA expression analysis showed that miR-34a-5p, miR-182-5p, miR-203a, miR-222-3p, and miR-432-5p are upregulated following nutlin-3 treatment in a p53 dependent manner. The function of miR-182-5p, miR-203a, miR-222-3p, and miR-432-5p was analyzed by ectopic overexpression of miRNA mimics. We observed that these p53-regulated miRNAs inhibit the proliferation of neuroblastoma cells to varying degrees, with the most profound growth inhibition recorded for miR-182-5p. Overexpression of miR-182-5p promoted apoptosis in some neuroblastoma cell lines and induced neuronal differentiation of NGP cells. Using Chromatin Immunoprecipitation-qPCR (ChIP-qPCR), we did not observe direct binding of p53 to MIR182, MIR203, MIR222, and MIR432 in neuroblastoma cells. Taken together, our findings yield new insights in the network of p53-regulated miRNAs in neuroblastoma. PMID:25762502

  5. Phase diagram of the ternary Zr-Ti-Sn system

    International Nuclear Information System (INIS)

    It is well known that Ti stabilizes the high temperature cubic phase of Zr and that Sn stabilizes the low temperature hexagonal phase of Zr. The effect of Sn on the Zr-Ti diagram has been studied in the present paper. Using high purity metals, nine different alloys have been prepared, with 4-32 at % Ti, 0.7-2.2 at % Sn and Zr till 100%. Resistivity and optical and SEM metallography techniques have been employed. Effect of some impurities have been analyzed. The results are discussed and different isothermic sections of the ternary Zr-Ti-Sn diagram are presented. (Author)

  6. Detection of low-frequency organized structures in night-time air flow within a spruce canopy on the upwind and downwind sides of a mountain ridge

    Czech Academy of Sciences Publication Activity Database

    Potužníková, Kateřina; Sedlák, Pavel; Koucká Knížová, Petra

    2015-01-01

    Roč. 16, č. 4 (2015), s. 432-437. ISSN 1530-261X R&D Projects: GA ČR(CZ) GP205/05/P564; GA ČR(CZ) GA15-24688S; GA AV ČR(CZ) IAA300420803 Institutional support: RVO:68378289 Keywords : nocturnal boundary layer * turbulence * organized structures * complex terrain * forest canopy * wavelet transform Subject RIV: DG - Athmosphere Science s, Meteorology Impact factor: 1.521, year: 2014 http://onlinelibrary.wiley.com/doi/10.1002/asl.578/epdf

  7. AcEST: DK954185 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0019_M10 432 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_M10. 5' end seq ... RC5|Q6DRC5_DANRE D13S106E-like (Chromosome 13 open reading ... 34 3.2 tr|A8WFQ9|A8WFQ9_DANRE Chromosome 13 ope ... n reading ... frame 22-like ... 34 3.2 tr|B6PRG1|B6PRG1_BRAFL Pu ...

  8. When Adolescents with High Self-Concept Lose their Engagement in School

    OpenAIRE

    Veiga, Feliciano; García, Fernando; Reeve, Johnmarshall; Wentzel, Kathryn; García, Óscar

    2015-01-01

    La motivación escolar y el autoconcepto son dos constructos claves del ajuste académico. Para entender cómo la motivación escolar cambia durante la adolescencia, se analizó la motivación académica de adolescentes tempranos y medios (cognitiva, afectiva, conductual e implicación personal) y su autoconcepto. La muestra fue de 685 adolescentes, 296 hombres (43,2%) y 389 mujeres de 11 a 17 años. Los adolescentes tempranos con alto autoconcepto siempre indicaron mayor motivación cognit...

  9. Corporal punishment and child behavioral and cognitive outcomes through 5 years-of-age: Evidence from a contemporary urban birth cohort study

    OpenAIRE

    MacKenzie, Michael J.; Nicklas, Eric; Waldfogel, Jane; Brooks-Gunn, Jeanne

    2012-01-01

    This study examined the prevalence and determinants of spanking of children at 3 years-of-age, and the associations between spanking and externalizing behavior and receptive verbal ability at age 5. Overall, we find maternal spanking rates of 55.2% and paternal rates of 43.2% at age 3. Mothers facing greater stress and those who spanked earlier are more likely to spank at age 3, whereas those who report a supportive partner during pregnancy and those who were not U.S. born were less likely to...

  10. Evaluation of a milk-ELISA test for brucellosis through repeated sampling on an infected herd

    International Nuclear Information System (INIS)

    The aim was to evaluate the ability of a milk-ELISA test (M-EIA) to detect infected animals, in comparison with the Rose Bengal plate test (RBPT), the complement fixation test (CFT) and the milk ring test (MRT), and to estimate the probability of M-EIA and MRT detecting infected animals in three subsequent samplings and testings in relation to directives 64/432/EEC and 91/499/EEC regarding the application of MRT and M-EIA, respectively, and stating that in countries free from Brucella during the last four years serological tests may be substituted by three M-EIAs or three MRTs

  11. Dicty_cDB: Contig-U11471-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -55 CP000115_1889( CP000115 |pid:none) Nitrobacter winogradskyi Nb-255... 219 3e-... = 1811 Score = 2480 bits (1251), Expect = 0.0 Identities = 1287/1287 (100%) Strand = Plus / Plus Query: 432...692 ataaaaccattaatttttaatgataat 1718 Score = 803 bits (405), Expect = 0.0 Identities = 408/408 (100%) Strand... 361 attcaaatttagttgaaattactgaatcaaaaaatgatacatcagatt 408 Score = 83.8 bits (42), Expect = 6e-16 Identities = 42/42 (100%) Stra...tttt 1791 Score = 30.2 bits (15), Expect = 7.9 Identities = 15/15 (100%) Strand = Plus / Plus Query: 1 ctgttggcctact

  12. AcEST: BP911824 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_F02 597 Adiantum capillus-veneris mRNA. clone: YMU001_000009_F02. BP911824 CL3433C ... KSSMTSPAHSCRVTH*AKARSLYPSTIPRVTNYTQASSPGTLSL 488 +SP S G ... +K RS + SCRV + SL P+ I + + PGT Sbjct: 797 VSPANS ... GRT-SLPPTFIRAQPTFVKVEVPGTFVG 855 Query: 489 PKPILFYPSG ... 518 P + PSG ... Sbjct: 856 PPSM---PSG ... 862 >sp|Q9UKN1|M ... GFSLFGTPS 178 Query: 432 TIPRVTNYTQASSPGTLSLPKPILFYPSG ... 518 + P T + + T S P P LF SG Sbjct: 179 SAPSATTTSSL ...

  13. Recovery of Americium-241 from lightning rod by the method of chemical treatment

    International Nuclear Information System (INIS)

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 (241Am), fewer and Radium 226 (226Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241Am technique was used electrodeposition. (author)

  14. The Existence of Water Container as Risk Factor the Transmission of DHF in Palu, Central Sulawesi

    OpenAIRE

    Junus Widjaja

    2011-01-01

    During the period of three years (2003-2005) the number of dengue cases in Palu continues to increase, the number of cases in 2003 with 173 people with death ot 10 people (CFR 5.78%), in 2004 the number ofcasesfound among 210 people died (CFR 4.32%) and 2005 the number of cases found 627 people with 12 deaths (CFR2.21%). Objectives know the type, material and location conteiner as risk factors for the occurence of dengue in the city of Palu. The presence of mosquito breeding sites by species ...

  15. Biokatalizatorių įtaka akrilamido formavimuisi ruginės duonos gaminiuose bei kvietinių miltų technologinių savybių pagerinimo galimybės RS 190 modifikuotomis mielėmis, taikant pastaruosius pusruginės duonos gamybai

    OpenAIRE

    Krunglevičiūtė, Vita

    2013-01-01

    Darbo tikslas buvo įvertinti biokatalizatorių įtaką akrilamido formavimuisi ruginės duonos gaminiuose bei RS 190 modifikuotų mielių įtaką kvietinių miltų 550 C tipo technologinių savybių pagerinimui, pritaikant juos pusruginės duonos gamybai. Nustatyta, kad L. delbruecki intensyviau mažina terpės pH (3,35) nei P. acidilactici (4,32), tačiau, žaliavos apcukrinimui naudojant gliukoamilolitinius fermentus, fermentacijos procesą galima suintensyvinti. Žaliavos apcukrinimas fermentais įtakoja ...

  16. Energy and Water Conservation Assessment of the Radiochemical Processing Laboratory (RPL) at Pacific Northwest National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Stephanie R.; Koehler, Theresa M.; Boyd, Brian K.

    2014-05-31

    This report summarizes the results of an energy and water conservation assessment of the Radiochemical Processing Laboratory (RPL) at Pacific Northwest National Laboratory (PNNL). The assessment was performed in October 2013 by engineers from the PNNL Building Performance Team with the support of the dedicated RPL staff and several Facilities and Operations (F&O) department engineers. The assessment was completed for the Facilities and Operations (F&O) department at PNNL in support of the requirements within Section 432 of the Energy Independence and Security Act (EISA) of 2007.

  17. ADS specific accelerator developments: Status in Europe

    International Nuclear Information System (INIS)

    The EUROpean research programme for the TRANSmutation of high level radioactive waste in accelerator driven systems (EUROTRANS) is funded by the European Commission within the 6th Framework Programme, and involves 31 partners (research agencies and nuclear industries) with the contribution of 16 universities [4.32]. EUROTRANS is a 4-year programme (2005–2009) extending previous activities (PDS-XADS, Preliminary Design Study for an eXperimental Accelerator Driven System) and paving the road towards the construction, during the next EC framework programmes, of an eXperimental facility demonstrating the technical feasibility of Transmutation in an Accelerator Driven System (XT-ADS)

  18. Bond orientational order in the blue phases of chiral liquid crystals

    OpenAIRE

    Longa, Lech; Trebin, Hans-Rainer

    1993-01-01

    It is proposed to describe blue phases by two order parameters: the standard alignment tensor field Q αβ(r) and a bond orientational tensor order parameter of octahedral point group symmetry scrO(432). The yet mysterious blue fog then emerges as a liquid of purely cubic bond orientational order. In the transition from the cubic blue phases to the blue fog the cubic space group symmetry is being reduced to its octahedral factor group. Because of the new order parameter the scrO 5(scr...

  19. Comparing the harmful effects of nontuberculous mycobacteria and Gram negative bacteria on lung function in patients with cystic fibrosis

    DEFF Research Database (Denmark)

    Qvist, Tavs; Taylor-Robinson, David; Waldmann, Elisabeth; Olesen, Hanne Vebert; Hansen, Christine Rønne; Mathiesen, Inger Hee; Høiby, Niels; Katzenstein, Terese L; Smyth, Rosalind L; Diggle, Peter J; Pressler, Tania

    2015-01-01

    BACKGROUND: To better understand the relative effects of infection with nontuberculous mycobacteria and Gram negative bacteria on lung function decline in cystic fibrosis, we assessed the impact of each infection in a Danish setting. METHODS: Longitudinal registry study of 432 patients with cystic...... slower decline, similar in magnitude to the pre-infection slope. CONCLUSIONS: In a national population we have demonstrated the impact on lung function of each chronic CF pathogen. M. abscessus complex was associated with the worst impact on lung function. Eradication of M. abscessus complex may...

  20. Low power RF field tuning of a four-vane type RFQ stabilized with PISLs

    International Nuclear Information System (INIS)

    A 432 MHz four-vane type radio-frequency quadrupole (RFQ) linac stabilized with π-mode stabilizing loops (PISLs) is under construction as a preinjector linac for the Japanese Hadron Project (JHP). It was designed to accelerate a 20-mA H- beam from 50 keV to 3 MeV with a 3% duty factor. We obtained the uniform distribution within ±1% both longitudinally and azimuthally by adjusting the positions of dummy tuning plungers. The sizes of stab tuners and the standard positions of movable tuners were thus determined to reproduce the obtained field distribution. (author)

  1. Wind energy barometer - EurObserv'ER - February 2016

    International Nuclear Information System (INIS)

    The spectacular rise of China's wind power market that resulted in connecting at least 30.5 GW, catapulted the global installation level to 62.7 GW in 2015- a 22% more than in 2014. The US and German markets also performed very well, the former because its tax credit mechanism remained in force and the latter because many of its offshore wind farms in the North Sea were connected to the grid. Global wind turbine capacity has increased by 17% and now stands at 432.6 GW

  2. Testing of five methods for the control of zebra mussels in cooling circuits of power plants located on the Moselle river

    International Nuclear Information System (INIS)

    Bioassays have been conducted on site at the Cattenom nuclear power plant located on the Moselle River (in northeast France) to control mussels in auxiliary plant circuits. During the course of a two-year program, five methods were tested: - thermal treatment (33 deg to 40 deg C), - high dosage chlorination (> 50 ppm), - low dosage chlorine dioxide, - potassium salt (KCI > 100 ppm), - one organic compound (Mexel 432). This note presents a comparison of the treatments shown to be most effective, on the basis of technical feasibility, cost and environmental acceptability. (author). 8 figs., 10 refs., 3 tabs

  3. Kerugian Ekonomis Akibat Serangan Rayap Pada Bangunan Rumah Masyarakat Di Dua Kecamatan (Medan Denai Dan Medan Labuhan)

    OpenAIRE

    Siregar, Ameilia Zuliyanti; Batubara, Ridwanti

    2010-01-01

    The house is able to attack by some termites. Because some termites fed part of the house. Therefore, some termites caused great economic loss in Medan Denai and Medan Labuhan county. This has lead us to investigate the possibility several termites to attack them. We used Multi Stage Sampling. Actually, the economic loss occurred in two county were Rp 22.432.950. Economic loss caused grown and dry wood termites were Rp 12.532.650 and Rp 9.900.300, respectively. We found a lot of termites...

  4. Partial Characterization of Immunoglobulin Cμ Gene of Water Buffalo (Bubalus bubalis) Predicts Distinct Structural Features of C1q-Binding Site in Cμ3 Domain

    OpenAIRE

    Kaushik, Azad K.; Surinder S. Saini; Maiti, N. K.

    2013-01-01

    Partial characterization of immunoglobulin Cµ gene of water buffalo (Bubalus bubalis) revealed high amino acid sequence identity with Cµ of cattle (94.28%) and sheep (91.71%). Four amino acid replacements (Met-301, Val-310, Asn-331, and Thr-432) in Cµ2, Cµ3, and Cµ4 of buffalo IgM are distinct, however. Unlike cattle, a codon deletion (GTG encoding valine at position 507 in cattle) and an insertion (GGC encoding glycine at position 532) occur in buffalo Cµ4. Three N-linked glycosylation (Asn-...

  5. A survey assessing modes of maintaining denture hygiene among elderly patients

    OpenAIRE

    Saha, Ashishtaru; Dutta, Sudipto; Varghese, Rana K; Kharsan, Vinay; Agrawal, Anil

    2014-01-01

    Objective: To determine the denture hygiene habits in complete denture wearers. Materials and Methods: In this study, a self-administered structured questionnaire was developed to know the attitude of the patients from the Department of Prosthodontics regarding denture hygiene. The study sample consisted of totally 500 subjects, which included 284 (56.8%) males and 216 (43.2%) females. Data were analyzed using SPSS version 15.0 with Chi-square (χ2) test at P < 0.05. Results: Nearly half of th...

  6. Possible three-nucleon force effects in D-P scattering at low energies

    CERN Document Server

    Brune, C R; Karwowski, H J; Ludwig, E J; Veal, K D; Wood, M H; Kievsky, A; Rosati, S; Viviani, M

    1998-01-01

    We present measurements of the analyzing powers Ay and iT11 for proton-deuteron scattering at Ecm=432 keV. Calculations using a realistic nucleon-nucleon potential (Argonne V18) are found to underpredict both analyzing powers by 40. The inclusion of the Urbana three-nucleon interaction does not significantly modify the calculated analyzing powers. Due to its short range, it is difficult for this three-nucleon interaction to affect Ay and iT11 at this low energy. The origin of the discrepancy remains an open question.

  7. Long QT interval in Turner syndrome – a high prevalence of LQTS gene mutations

    DEFF Research Database (Denmark)

    Trolle, Christian; Mortensen, Kristian Havmand; Pedersen, Lisbeth Nørum;

    Objective: QT interval prolongation of unknown aetiology is common in Turner syndrome (TS). This study set out to explore the presence of known pathogenic long QT (LQT) mutations in TS and to examine the corrected QT interval (QTc) over time and relate the findings to the TS phenotype. Methods......QTc). The prevalence of mutations in genes related to Long QT syndrome (LQTS) was determined in females with TS and a QTc >432.0 milliseconds (ms). Echocardiographic assessment of aortic valve morphology, 24-hour blood pressures and blood samples were done. Results: The mean hQTc in females with TS (414...

  8. Thermochemical study of gaseous oxy salts. Communication 8. Beryllium molybdate and tungstates

    International Nuclear Information System (INIS)

    Gaseous phase reactions involving beryllium molybdate and tungstates were studied by the method of high-temperature mass-spectroscopy. Standard formation enthalpies of BeMoO3, BeWO3, BeWO4 and Be2WO4 were determined, being equal to -432.4 ± 3.1, -424.1 ± 3.7, -794.9 ± 5.2, -973.4 ± 6.7 kJ/mol respectively. Atomization enthalpy of the salts at 298 K amounts to 2162 ± 5, 2347 ± 5, 2967 ± 7, 3470 ± 8 kJ/mol

  9. Determination of 236Np(n,f) and 238Pu(n,f) cross-sections using surrogate reactions

    International Nuclear Information System (INIS)

    Cross sectional data for 236Np(n,f) reaction is not available for neutron energies beyond 4.32 MeV. In this work, we have determined the cross-section of the above reaction for the neutron energy range En=10-18 MeV using ‘Hybrid Surrogate Ratio’ method via 235U(6Li, α)237Np and 235U(6Li,d)239Pu reactions. The cross-sections for 238Pu(n,f) reaction available in literature have been used as a reference for the above surrogate method

  10. Low power RF field tuning of a four-vane type RFQ for the JHP

    International Nuclear Information System (INIS)

    A 432 MHz four-vane type radio-frequency quadrupole (RFQ) linac stabilized with π-mode stabilizing loops (PISLs) is under construction as a preinjector linac for the Japanese Hadron Project (JHP). It was designed to accelerate a 20-mA H- beam from 50 keV to 3 MeV with a 3 % duty factor. In the RFQ, we obtained the uniform distribution within ±1 % both longitudinally and azimuthally by adjusting the positions of dummy tuning plungers. The size of stab tuners and the standard positions of movable tuners were thus determined to reproduce the obtained field distribution. (author)

  11. Cardiovascular fitness is associated with cognition in young adulthood

    OpenAIRE

    Åberg, Maria A. I.; Pedersen, Nancy L.; Torén, Kjell; Svartengren, Magnus; Bäckstrand, Björn; Johnsson, Tommy; Cooper-Kuhn, Christiana M.; Åberg, N. David; Nilsson, Michael; Kuhn, H. Georg

    2009-01-01

    During early adulthood, a phase in which the central nervous system displays considerable plasticity and in which important cognitive traits are shaped, the effects of exercise on cognition remain poorly understood. We performed a cohort study of all Swedish men born in 1950 through 1976 who were enlisted for military service at age 18 (N = 1,221,727). Of these, 268,496 were full-sibling pairs, 3,147 twin pairs, and 1,432 monozygotic twin pairs. Physical fitness and intelligence performance d...

  12. The comparison of critical thinking and problem solving disposition of athletes according to gender and sport type

    OpenAIRE

    Hakan Kolayiş; İhsan Sarı; Nurullah Çelik

    2014-01-01

    The terms “critical thinking and problem solving” are crucial for cognitive processes of athletes. It could also be said that these two concepts are likely to affect athletic performance of individuals. Therefore, the aim of this research is to investigate critical thinking and problem solving disposition of athletes. For this purpose 432 athletes (Xage: 20.53±3.85; Xsportexperience: 9.47±4.22) who comprise of 261 males (60.4%) and 171 females (39.6%) participated to the research. Problem Sol...

  13. Validity of self-reported vaccination status among French healthcare students.

    Science.gov (United States)

    Loulergue, P; Pulcini, C; Massin, S; Bernhard, M; Fonteneau, L; Levy-Brühl, D; Guthmann, J-P; Launay, O

    2014-12-01

    Data on validity of self-reported vaccinations are scarce. This study, performed on healthcare students in Paris (France), aimed to evaluate this validity for occupational vaccinations. The validity of self-reported vaccination status was compared with written information. A total of 432 students were enrolled. Sensitivity rates for BCG, hepatitis B and measles were over 74%. For diphtheria-tetanus-polio and pertussis, sensitivity was below 50%. Specificity was between 70 and 95% for dTP-pertussis, and below 35% for all others. Overall, the validity of self-reported information was low, meaning that checking medical records remains the preferable strategy for assessing immunization status. PMID:25040583

  14. Total Synthesis of the Ammosamides

    Science.gov (United States)

    Hughes, Chambers C.; Fenical, William

    2010-01-01

    The ammosamides A-C are chlorinated pyrrolo[4,3,2-de]quinoline metabolites isolated from the marine-derived Streptomyces strain CNR-698. The natural products, which possess a dense array of heteroatoms, were synthesized in 17–19 steps from 4-chloroisatin. That the five nitrogen atoms were introduced at the appropriate time and in a suitable oxidation state was key to the success of the total synthesis. Compared to synthetic deschloro ammosamide B, natural ammosamide B is much less susceptible to oxidative degradation. PMID:20131899

  15. Common variants of the vitamin D binding protein gene and adverse health outcomes

    OpenAIRE

    Malik, Suneil; Fu, Lei; Juras, David James; Karmali, Mohamed; Wong, Betty Y. L.; Gozdzik, Agnes; Cole, David E.C.

    2013-01-01

    The vitamin D binding protein (DBP) is the major plasma carrier for vitamin D and its metabolites, but it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Two missense variants of the DBP gene – rs7041 encoding Asp432Glu and rs4588 encoding Thr436Lys – change the amino acid sequence and alter the protein function. They are common enough to generate population-wide constitutive differences in vitamin D status, based on assay of the serum metabolite, 25-...

  16. Enhancement of the superconducting critical temperature in Nb/Py/Nb trilayers

    Energy Technology Data Exchange (ETDEWEB)

    Ilyina, E.A., E-mail: i.katerina@sa.infn.it [CNR-SPIN Salerno, Dipartimento di Fisica ' E.R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy); Hernandez, J.M.; Garcia-Santiago, A. [Departament de Fisica Fonamental, Facultat de Fisica, Universitat de Barcelona, Avinguda Diagonal 645, ES-08028 Barcelona (Spain); Institut de Nanociencia i Nanotecnologia IN2UB, Universitat de Barcelona, c. Marti i Franques 1, ES-08028 Barcelona (Spain); Cirillo, C.; Attanasio, C. [CNR-SPIN Salerno, Dipartimento di Fisica ' E.R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy)

    2012-09-15

    Superconducting critical temperature, T{sub c}, have been measured in a series of Nb/Py/Nb (here Py = Ni{sub 80}Fe{sub 20}) trilayers having constant Py thickness, d{sub Py} = 432 nm, and variable Nb thickness, d{sub Nb}, in the range 20-30 nm. We have observed that, for d{sub Nb} between 23 and 27 nm, resistive transitions shift towards higher temperature if stripe domains are present in the Py layer. We relate those observations to the non-homogeneous magnetization in the Py layer due to the presence of stripe domain structures.

  17. The Class Distrbution and Stracture of Isfahan City and Its Effects

    Directory of Open Access Journals (Sweden)

    Mojtaba Shahnoshi

    2010-01-01

    Full Text Available AbstractFor studying of the distribution of social class structure of Isfahan and its social effects, this research hasbeen done.The determined household sample is432 based on the latest Isfahan census.The tools of gathering data is a questionnaire with closed and semi closed questions.The results indicated that the districts of Isfahan have different class structure, and the marriage relations areaffected by socio- economic status of house holds.Other hypothesis indicated there is no meaningful relation between socio-economic and geographic structurein the Isfahan districts.

  18. Mercury-induced genotoxicity in marine diatom (Chaetoceros tenuissimus)

    Digital Repository Service at National Institute of Oceanography (India)

    Sarker, S.; Desai, S.R.; Verlecar, X.N.; Sarker, M.S.; Sarkar, A.

    . tenuissimus cells. Grover et al. (2001) observed similar repair of DNA damage in rat peripheral blood leucocytes at an HgCl2 level of 43.2 ng g −1 after a 48-h exposure period. It was previously shown that, when phytoplankton was exposed to heavy metals... correlation between the metal concentration in water and plankton growth (Senthilnathan and Balasubramanian 1999). Interestingly, an inhibition was observed in cell population and chlorophyll a (chl a) concen- tration in Dunaliella minuta when exposed...

  19. Tetrakis[tris(2,2′-bi-1H-benzimidazolenickel(II] bis(phosphate sulfate

    Directory of Open Access Journals (Sweden)

    Chun-Sheng Ling

    2008-11-01

    Full Text Available The title compound, [Ni(C14H10N43]4(PO42(SO4, consists of [Ni(C14H10N43]2+ complex cations (.3. symmetry and disordered anions ({overline 4} symmetry with occupancy factors of two-thirds for PO43− and one-third for SO42−. The Ni2+ centre is chelated by three bidentate 2,2′-bi-1H-benzimidazole molecules in a distorted octahedral coordination. N—H...O hydrogen bonds consolidate the building units into a framework structure.

  20. Assessment of the effect of parallel temperature gradients in the JET SOL on Te measured by divertor target Langmuir probes

    Czech Academy of Sciences Publication Activity Database

    Ďuran, Ivan; Ješko, Karol; Fuchs, Vladimír; Groth, M.; Guillemaut, C.; Gunn, J. P.; Horáček, Jan; Pitts, R.A.; Tskhakaya, D.

    2015-01-01

    Roč. 463, August (2015), s. 432-435. ISSN 0022-3115. [PLASMA-SURFACE INTERACTIONS 21: International Conference on Plasma-Surface Interactions in Controlled Fusion Devices. Kanazawa, 26.05.2014-30.05.2014] R&D Projects: GA ČR GAP205/10/2055 Institutional support: RVO:61389021 Keywords : Langmuir probes * SOL Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.865, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022311515000665

  1. Preparation of Egg White Liquid Hydrolysate (ELH) and Its Radical-Scavenging Activity

    OpenAIRE

    Noh, Dong Ouk; Suh, Hyung Joo

    2015-01-01

    In the present study, an optimum protease was selected to hydrolyze the egg white liquid protein for the antioxidant peptides. Alcalase treatment yielded the highest amount of α-amino groups (15.27 mg/mL), while the control (no enzymatic hydrolysis) showed the lowest amount of α-amino groups (1.53 mg/mL). Alcalase also gave the highest degree of hydrolysis (DH) value (43.2%) and was more efficient for egg white liquid hydrolysis than the other enzymes. The Alcalase hydrolysate had the highest...

  2. Prix des actifs et actifs sans prix

    OpenAIRE

    Pénasse, Julien

    2014-01-01

    Cette thèse étudie plusieurs aspects de la dynamique du rendement des actifs. Les trois premiers chapitres ont pour objet la formation des prix sur le marché de l'art. Le premier chapitre établit que les prix peuvent s'écarter temporairement, et de manière partiellement prévisible, de la valeur fondamentale. Cet article a été publié dans Economics Letters (Volume 122, Issue 3, pp. 432-434) et a été écrit avec Christophe Spaenjers et Luc Renneboog. Le chapitre 2 étudie la vitesse de transmissi...

  3. Laterally substituted naphthalene-2,7-diol-based bent-shaped liquid crystals

    Czech Academy of Sciences Publication Activity Database

    Kozmík, V.; Kuchař, M.; Svoboda, J.; Novotná, Vladimíra; Glogarová, Milada; Baumeister, U.; Diele, S.; Pelzl, G.

    2005-01-01

    Roč. 32, č. 9 (2005), s. 1151-1160. ISSN 0267-8292 R&D Projects: GA ČR(CZ) GA202/02/0840; GA ČR(CZ) GA202/05/0431; GA MŠk(CZ) 1P04OCD14.60 Grant ostatní: EU(XE) COST D14 WG 00015 Institutional research plan: CEZ:AV0Z1010914 Keywords : naphthalene - based liquid crystals * x-ray Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.432, year: 2005

  4. Prokaryote phylogeny meets taxonomy: An exhaustive comparison of composition vector trees with systematic bacteriology

    Institute of Scientific and Technical Information of China (English)

    GAO; Lei; QI; Ji; SUN; JianDong; HAO; BaiLin

    2007-01-01

    We perform an exhaustive, taxon by taxon, comparison of the branchings in the composition vector trees (CVTrees) inferred from 432 prokaryotic genomes available on 31 December 2006, with the bacteriologists' taxonomy-primarily the latest online Outline of the Bergey's Manual of Systematic Bacteriology. The CVTree phylogeny agrees very well with the Bergey's taxonomy in majority of fine branchings and overall structures. At the same time most of the differences between the trees and the Manual have been known to biologists to some extent and may hint at taxonomic revisions. Instead of demonstrating the overwhelming agreement this paper puts emphasis on the biological implications of the differences.

  5. Sirenomelia: a case report with literature review

    Directory of Open Access Journals (Sweden)

    Latika Sahu

    2013-06-01

    Full Text Available We are presenting a case of Sirenomelia (Mermaid Syndrome, which is an extreme example of the caudal regression syndrome. It invariably presents with lower limb fusion, sacral and pelvic bony anomalies, absent external genitalia, imperforate anus, and renal agenesis or dysgenesis. There are approximately 300 cases reported in the literature, 15% of which are associated with twinning, most often monozygotic. The syndrome of caudal regression is thought to be the result of injury to the caudal mesoderm early in gestation. The case encountered was a stillborn baby. [Int J Reprod Contracept Obstet Gynecol 2013; 2(3.000: 430-432

  6. Gambaran Faktor- Faktor yang Mempengaruhi Pertolongan Persalinan pada Masyarakat Suku Melayu di Kecamatan Medang Deras Kabupaten Batu Bara Tahun 2015

    OpenAIRE

    Rizki, Ahmad Fahri

    2016-01-01

    High Maternal Mortality Rate (MMR) as well as the slow decline in these figures show that the MCH service must be urgently improved both in terms of the range and quality of their services, including service coverage during puerperium and good childbirth service. From 2013 Basic Health Reasearch, birth of the last child's birth mother from last five years shows that 56.8% give birth in health facilities and 43.2% still give birth at home / other. Malay tribe is one of the tribe...

  7. AcEST: BP911684 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ein glmU OS=Clostridium no... 30 7.5 sp|Q057Q1|RLMN_BUCCC Ribosomal RNA large subunit methyltransfera... 29 9.8 sp|Q8R4S2|AHR_MUSS...QEPLLQVPEKPSQKEL-EAMALGTPAEAIEITAPEGAFA 842 Query: 323 DLDQASSKASFLQRLCDGLRFDPKKAKEVHEEIYRQKLQQCLSDGVLSE... +P+S K+ Sbjct: 518 TITVNVSKQGRCRDLIQALTNACSLKQSEELKLAEIRNNFIHRLFEDPLIPLSSIKDDDH 577 Query: 423 --ILKLS...K-SRNILFLKL 467 KLSK S N L+L Sbjct: 578 LAAYKLSKSSENTTLLRL 595 TrEMBL (release 39.9) L...I ++ K + A + G D A ++ S Sbjct: 374 GELSDDNVAALLRLRVMLCIPQQTVDTAHAEICGTIFEKVVRDAISSGVDGYDAETRKS- 432 Query: 2

  8. Optical properties of Yb{sup 3+} ions in SiO{sub 2}-Al{sub 2}O{sub 3}-CaF{sub 2} glasses

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Qiang; Tang Bin; Cheng Jimeng; Qiao Yanbo; Zhou Qinling; Chen Qingxi; Chen Danping [Key Laboratory of Material Science and Technology for High Power Lasers, Shanghai Institute of Optics and Fine MechanicsChinese Academy of Sciences, Shanghai 201800 (China); Ding Jie [Sino-America Cancer Res Institute, Guangdong Medical College, Dongguan 523808 (China); Qiu Jianrong, E-mail: qiangzhang_china@126.co, E-mail: dpchen2008@yahoo.com.c [State Key Laboratory of Silicon Materials, Zhejiang University, Hangzhou 310027 (China)

    2009-12-07

    The absorption and emission properties of Yb{sup 3+} doped oxy-fluoride-silicate glasses prepared by the melt-quenching method have been investigated. Yb{sup 3+} ions in the oxy-fluoride-silicate glasses show large absorption and emission cross-section and the fluorescence lifetimes are longer than 1.3 ms. The minimum pumping intensity, minimum fraction of excited ions, saturation pumping intensity, minimum pulse duration and peak power are also analysed to characterize the samples. The minimum pulse duration and peak power are 79 fs and 0.432 PW cm{sup -2}, which indicates the potential application in high power and ultrashort pulse lasers.

  9. Optical properties of Yb3+ ions in SiO2-Al2O3-CaF2 glasses

    International Nuclear Information System (INIS)

    The absorption and emission properties of Yb3+ doped oxy-fluoride-silicate glasses prepared by the melt-quenching method have been investigated. Yb3+ ions in the oxy-fluoride-silicate glasses show large absorption and emission cross-section and the fluorescence lifetimes are longer than 1.3 ms. The minimum pumping intensity, minimum fraction of excited ions, saturation pumping intensity, minimum pulse duration and peak power are also analysed to characterize the samples. The minimum pulse duration and peak power are 79 fs and 0.432 PW cm-2, which indicates the potential application in high power and ultrashort pulse lasers.

  10. Genome-wide association study of CNVs in 16,000 cases of eight common diseases and 3,000 shared controls

    OpenAIRE

    Craddock, Nick; Hurles, Matthew E.; Cardin, Niall; Pearson, Richard D.; Plagnol, Vincent; Robson, Samuel; Vukcevic, Damjan; Barnes, Chris; Conrad, Donald F.; Giannoulatou, Eleni; Holmes, Chris; Marchini, Jonathan L.; Stirrups, Kathy; Martin D Tobin; Wain, Louise V.

    2010-01-01

    Copy number variants (CNVs) account for a major proportion of human genetic polymorphism and have been predicted to have an important role in genetic susceptibility to common disease. To address this we undertook a large, direct genome-wide study of association between CNVs and eight common human diseases. Using a purpose-designed array we typed 19,000 individuals into distinct copy-number classes at 3,432 polymorphic CNVs, including an estimated 50% of all common CNVs larger than 500 base pa...

  11. Effect of L-Glutamine Supplementation on Electromyographic Activity of the Quadriceps Muscle Injured By Eccentric Exercise

    OpenAIRE

    Farhad Rahmani Nia; Esmail Farzaneh; Arsalan Damirchi; Ali Shamsi Majlan

    2013-01-01

      Objective(s): The purpose of the present study was to examine the effects of L-glutamine on electromyographic (EMG) activity of the quadriceps muscle injured by eccentric exercise (EE).   Materials and Methods: Seventeen healthy men (age: 22.35±2.27 yr; body mass: 69.91±9.78 kg; height: 177.08±4.32 cm) were randomly and double-blind study with subjects assigned to either an L-glutamine supplementation (n=9) or placebo (n=8) group. The subjects in two groups were asked to take three times du...

  12. The evaluation of the thermal behaviour of an underground repository of the spent nuclear fuel

    Czech Academy of Sciences Publication Activity Database

    Kohut, Roman; Starý, Jiří; Kolcun, Alexej

    Berlin : Springer-Verlag Berlin Heidelberg, 2008 - (Lirkov, I.; Margenov, S.; Waśniewski, J.), s. 425-432 ISBN 978-3-540-78825-6. ISSN 0302-9743. [Large-Scale Scientific Computing, International Conference, LSSC 2007 /6./. Sozopol (BG), 05.09.2007-09.06.2007] R&D Projects: GA AV ČR 1ET400300415 Institutional research plan: CEZ:AV0Z30860518 Keywords : elastoplastic problem s * FEM method * additive Schwarz method Subject RIV: IN - Informatics, Computer Science www.springer.com/lncs

  13. Knowledge and needs about various aspects related to adolescent health in school going Adolescents

    OpenAIRE

    Vaibhavkumar B. Ramanuj; Bala, D. V.

    2010-01-01

    Adolescents have their specific problems and needs. This cross-sectional study was conducted among 187 students of class X-XI. About 51 (43.2%) boys and 43 (62.3%) girls were aware about the components of the Female Reproductive System. Only 1 (0.8%) boy and 1 (1.4%) girl were aware about the components of the Male Reproductive System. Total 89.8% adolescents were aware that HIV/AIDS is a STD. Nearly 50% of the respondents thought that they were given adequ...

  14. Physical and Flavor Quality of Some Potential Varieties of Arabica Coffee in Several Interval Storage Periods

    OpenAIRE

    Yusianto .; Retno Hulupi; Sulistyowati .; Surip Mawardi; Cahya Ismayadi

    2006-01-01

    Coffee storage was an active process, where the quality and flavor was depend on the origin, humidity, temperature, period, and ware house condition. The objective of this research was to know quality and flavor of some Arabica coffee varieties in interval of storage periods. The examined coffee varieties were BP 416 A, BP 430 A, BP 432 A, BP 509 A, BP 542 A, P 88, AS 1, S 795, and USDA-762. The treatments were recent harvest, one and two years stored green coffee. The green coffee were wet p...

  15. Transcranial bright light treatment via the ear canals in seasonal affective disorder: a randomized, double-blind dose-response study

    OpenAIRE

    Jurvelin, Heidi; Takala, Timo; Nissilä, Juuso; Timonen, Markku; Rüger, Melanie; Jokelainen, Jari; Räsänen, Pirkko

    2014-01-01

    Background Bright light treatment is effective for seasonal affective disorder (SAD), although the mechanisms of action are still unknown. We investigated whether transcranial bright light via the ear canals has an antidepressant effect in the treatment of SAD. Methods During the four-week study period, 89 patients (67 females; 22 males, aged 22-65, mean ± SD age: 43.2 ± 10.9 years) suffering from SAD were randomized to receive a 12-min daily dose of photic energy of one of three intensities ...

  16. AcEST: BP916147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_F11 432 Adiantum capillus-veneris mRNA. clone: YMU001_000083_F11. BP916147 - Show ... VDLFCRSGHLKDAHEFINQMPIKPNTVIWR 348 Query: 250 TMLASCRN LGNVEFGTEVFQHVMCLE 173 T+L +C GNVE G EV + + L+ Sbjc ... IDLFSRSGRLEEAMRFINGMPFPPDAIGWTT 545 Query: 247 MLASCRN LGNVEFG 206 +L++CRN ... GN+E G Sbjct: 546 LLSACRN KGNLEI ... VDMLTRAGLLSRAKEFIQEMPIKPDALVWRT 866 Query: 247 MLASCRN LGNVEFGTEVFQHVMCLESRST*LFCLCS 140 +L++C N+E G H++ L ... VDLLGRAGLLEDAHNLMKNMPFEPDAAIWG 582 Query: 250 TMLASCRN LGNVEFGTEVFQHVMCLESRST*LFCLCSLVSNL*RSSAQ 107 T+L + ...

  17. Mechanism and function of drosophila capa GPCR: a desiccation stress-responsive receptor with functional homology to human neuromedinU receptor

    OpenAIRE

    Selim Terhzaz; Pablo Cabrero; Robben, Joris H.; Radford, Jonathan C.; Hudson, Brian D.; Graeme Milligan; Dow, Julian A. T.; Shireen-A Davies

    2012-01-01

    The capa peptide receptor, capaR (CG14575), is a G-protein coupled receptor (GPCR) for the D. melanogaster capa neuropeptides, Drm-capa-1 and -2 (capa-1 and -2). To date, the capa peptide family constitutes the only known nitridergic peptides in insects, so the mechanisms and physiological function of ligand-receptor signalling of this peptide family are of interest. Capa peptide induces calcium signaling via capaR with EC(5)(0) values for capa-1 = 3.06 nM and capa-2 = 4.32 nM. capaR undergoe...

  18. Abundance of cetaceans in the oceanic northern Gulf of Mexico from 2003 and 2004 ship surveys

    OpenAIRE

    Mullin, Keith D.

    2007-01-01

    The Gulf of Mexico (GMx) is a subtropical marginal sea of the western North Atlantic Ocean with a diverse cetacean community. Ship-based, line-transect abundance surveys were conducted in oceanic waters (>200 m deep) of the northern GMx within U.S. waters (380,432 square km) during summer 2003 and spring 2004. Data from these surveys were pooled and minimum abundance estimates were based on 10,933 km of effort and 433 sightings of at least 17 species.The most commonly sighted species (number ...

  19. International Space Station (ISS) Configuration Post STS-120 Mission

    Science.gov (United States)

    2007-01-01

    Back dropped by the blackness of space and Earth's horizon is the International Space Station (ISS) as seen from Space Shuttle Discovery as the two spacecraft begin their relative separation. The latest configuration of the ISS includes the Italian-built U.S. Node 2, named Harmony, and the P6 truss segment installed over 11 days of cooperative work onboard the shuttle and station by the STS-120 and Expedition 16 crews. Undocking of the two spacecraft occurred at 4:32 a.m. (CST) on Nov. 5, 2007.

  20. Response of Navicula rhynchocephala (Bacillariophyceae) to nutrient enrichment in an andean stream (Colombia)

    International Nuclear Information System (INIS)

    To evaluate the effect of ammonium (NH 4+) and phosphates (PO432-) addition on the structure of the diatom community in the Tota stream (Boyaca, Colombia), diatom density was quantified on artificial substrates in two reaches (control and impact) with similar environmental conditions, along the Tota stream. Using a nutrient controlled enrichment in the impact reach, concentrations of ammonium and phosphates were increased to twice those in the control reach. Navicula rhynchocephala decreased its densities significantly, suggesting that is species that responds negatively to nutrient enrichment.

  1. CHOICE FEEDING AND AMINO ACID REQUIREMENTS FOR BROILERS

    OpenAIRE

    B. Indarsih; R.A.E.Pym

    2011-01-01

    The study was conducted as a completely randomized design, with a factorial arrangement to determine the response of commercial broilers to choice feeding and limiting amino acids on growth and carcass performance. A total of 432 male birds were weighed at one-d-old and randomly distributed to 48 wire-floored brooder cage each 1.0 m2. There were 2 sexes and 4 dietary treatments with 6 replicates each of 9 birds. Birds were given one of three dietary regimens with dietary change every 7 days. ...

  2. Intoxicação de eucalipto submetido à deriva simulada de diferentes herbicidas Intoxication of eucalyptus submitted to different herbicide drift

    OpenAIRE

    L.D. Tuffi Santos; L.R. Ferreira; F.A. Ferreira; W.M. Duarte; R.A.S. Tiburcio; A.F.L. Machado

    2006-01-01

    Além do glyphosate, amplamente usado, outros herbicidas, como o triclopyr e o carfentrazone-ethyl, apresentam potencial de uso na eucaliptocultura. Entretanto, a nãoseletividade destes herbicidas ao eucalipto pode levar à intoxicação da cultura, caso haja contato das folhas com a calda aplicada. Objetivou-se avaliar os efeitos da deriva de alguns herbicidas em plantas de Eucalyptus urophylla, simulada por meio de subdoses: 0, 43,2, 86,4 e 172,8 g ha-1 de glyphosate; 14,4, 28,8 e 57,6 g ha-1 d...

  3. Prevalence of Peste-des-petits-ruminant virus antibodies in cattle, buffaloes, sheep and goats in India

    OpenAIRE

    V. Balamurugan; Krishnamoorthy, P.; Raju, D. S. N.; Rajak, K. K.; Bhanuprakash, V.; Pandey, A. B.; Gajendragad, M. R.; Prabhudas, K.; Rahman, H

    2013-01-01

    The present study describes the prevalence of Peste-des-petits-ruminant virus (PPRV) antibodies in cattle, buffaloes, sheep and goats carried out during the period 2011 using the serum samples randomly collected from different villages of five states of India. A total of 1,498 serum samples [n = 605 (cattle); n = 432 (buffaloes); n = 173 (sheep); n = 288 (goats)] were collected from 52 districts in five states (Andhra Pradesh, Gujarat, Jammu and Kashmir, Maharashtra and Rajasthan) of India an...

  4. 4-(4-Chlorophenyl)-8-methyl-2-oxo-1,2,3,4,4a,5,6,7-octahydroquinoline-3-carbonitrile

    OpenAIRE

    Khadija O. Badahdah; Faidallah, Hassan M.; Al-Youbi, Abdulrahman O.; Asiri, Abdullah M.; Seik Weng Ng

    2011-01-01

    The six-membered N-heterocyclic ring of title compound, C17H17ClN2O, is fused with a methyl-substituted cyclohexene ring. The nitrogen-bearing ring has an envelope conformation with the benzene ring-bearing C atom lying 0.432 (6) Å out of the plane defined by the other five atoms (r.m.s. deviation 0.011 Å); its benzene substituent is aligned at 84.7 (1)° to the latter plane. The cyclohexene ring adopts a half-chair conformatio...

  5. 新开业酒店成功的15个步骤

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    在Trip Advisor上简单搜索就能出现数不胜数的酒店,其中伦敦1060家,巴黎1844家,纽约432家,米兰434家。搜索结果列表中都是大家以前看到或听到过的酒店。那么在日益拥挤的酒店市场你怎样保证新开业的酒店可以崭露头角呢?

  6. Effects of irrigation strategies and soils on field grown potatoes

    DEFF Research Database (Denmark)

    Ahmadi, Seyed Hamid; Andersen, Mathias Neumann; Plauborg, Finn;

    2010-01-01

    Yield and water productivity of potatoes grown in 4.32 m2 lysimeters were measured in coarse sand, loamy sand, and sandy loam and imposed to full (FI), deficit (DI), and partial root-zone drying (PRD) irrigation strategies. PRD and DI as water-saving irrigation treatments received 65% of FI after...... tuber bulking and lasted for 6 weeks until final harvest. Analysis across the soil textures showed that fresh yields were not significant between the irrigation treatments. However, the same analysis across the irrigation treatments revealed that the effect of soil texture was significant on the fresh...

  7. Cloning, characterization, and expression in Escherichia coli of a gene encoding Listeria seeligeri catalase, a bacterial enzyme highly homologous to mammalian catalases

    OpenAIRE

    Haas, Albert; Brehm, Klaus; Kreft, Jürgen; Goebel, Werner

    2011-01-01

    A gene coding for catalase (hydrogen-peroxide:hydrogen-peroxide oxidoreductase; EC 1.11.1.6) of the gram-positive bacterium Listeria seeligeri was cloned from a plasmid library of EcoRI-digested chromosomal DNA, with Escherichia coli DH5 alpha as a host. The recombinant catalase was expressed in E. coli to an enzymatic activity approximately 50 times that of the combined E. coli catalases. The nucleotide sequence was determined, and the deduced amino acid sequence revealed 43.2% amino acid se...

  8. Paxillin-dependent regulation of IGF2 and H19 gene cluster expression

    Czech Academy of Sciences Publication Activity Database

    Marášek, Pavel; Dzijak, Rastislav; Studenyak, Irina; Fišerová, Jindřiška; Uličná, Lívia; Novák, Petr; Hozák, Pavel

    2015-01-01

    Roč. 128, č. 16 (2015), s. 3106-3116. ISSN 0021-9533 R&D Projects: GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk EE2.3.30.0050; GA MŠk LO1509 Institutional support: RVO:68378050 ; RVO:61388971 Keywords : Paxillin * Cohesin * Imprinting * IGF2 * H19 * Enhancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.432, year: 2014

  9. Efeitos de diferentes formulações comerciais de glyphosate sobre estirpes de Bradyrhizobium Effects of different glyphosate commercial formulations on Bradyrhizobium strains

    OpenAIRE

    J.B. Santos; Jacques, R.J.S.; S.O. Procópio; M.C.M. Kasuya; A.A. Silva; E.A. Santos

    2004-01-01

    O objetivo deste trabalho foi avaliar efeitos de formulações comerciais de glyphosate sobre estirpes de Bradyrhizobium, em condições de laboratório. As formulações foram aplicadas na concentração de 43,2 µg L-1 do equivalente ácido. As bactérias foram inoculadas em meio de cultura à base de manitol e extrato de levedura (YM). O efeito do herbicida no crescimento das estirpes de Bradyrhizobium foi avaliado mediante leitura da densidade ótica em espectrofotômetro. Avaliou-se o crescimento das e...

  10. Changing Cause of Death Profile in Morocco: The Impact of Child-survival Programmes

    OpenAIRE

    Garenne, Michel; Darkaoui, Nada; Braikat, Mhamed; Azelmat, Mustapha

    2007-01-01

    This study was carried out to evaluate the trends in cause-specific mortality and the impact of child-survival programmes in Morocco. Two national surveys on causes and circumstances of child deaths were conducted in Morocco in 1988 and 1998 (ECCD-1 and ECCD-2 respectively). These surveys were based on a representative sample of deaths of children aged less than five years (432 and 866 respectively). Causes of death were assessed by verbal autopsy and were validated on a subsample of 94 cases...

  11. EXAMİNATİON OF PRİMARY SCHOOL LEVEL CHİLDEREN AND YOUTH SETUP OF BASKETBALL MOTOR DEVELOPMENT

    OpenAIRE

    Şinasi; Hikmet; Olcay

    2015-01-01

    Purpose of this work is to examine the motor development of primary school level children and the youth setup of basketball teams. 71 male students and 68 female students whose age average is 8.8(Ss±1.49) have participated in this research. 40 of those who participated in research are calculated to be doing sports and their length is 4.32(Ss±5.61). In this work Bruininks-Oseretsky Motor Sufficiency Test is used as a tool to gain information. In this test 8 small and 14 skill tests exist for b...

  12. Situação do registro de medicamentos fitoterápicos no Brasil

    OpenAIRE

    Ana C.B. Carvalho; Evelin E. Balbino; Artur Maciel; João P. S. Perfeito

    2008-01-01

    Fitoterápico é uma classe de medicamento largamente utilizada no país e constitui um mercado em potencial expansão. Este artigo busca traçar um panorama sobre os medicamentos fitoterápicos registrados no país e as espécies vegetais que lhe deram origem, enfocando o papel regulador da Anvisa. Realizou-se uma pesquisa nas seguintes bases de dados: Visalegis e site da Anvisa para verificar os medicamentos fitoterápicos registrados na Anvisa, obtendo-se os seguintes dados: há 432 fitoterápicos si...

  13. EROSIVE POTENTIAL OF TRAVELING BUBBLE CAVITATION IN A WATER PUMP – CFD & EXPERIMENT

    Czech Academy of Sciences Publication Activity Database

    Zima, Patrik; Sedlář, M.; Müller, M.

    Liberec : Technical University of Liberec, 2009 - (Vít, T.; Dančová, P.; Dvořák, V.), s. 432-442 ISBN 978-80-7372-538-9. [International Conference Experimental Fluid Mechanics 2009. Liberec (CZ), 25.11.2009-27.11.2009] R&D Projects: GA ČR(CZ) GA101/07/1612 Institutional research plan: CEZ:AV0Z20760514 Keywords : traveling bubble cavitation * erosive potential * water pump Subject RIV: BK - Fluid Dynamics

  14. AcEST: DK959937 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_A16 644 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_A16. 5' end seq ... MQE-DQSWKVAATKLAFADQMRLKFDRSRSDAKVVAPHEKNIKQAKGRSKGRAE ... 432 R+ P MQ ++ + A +L+ A Q + +DA P IK + + + E Sbjc ... QSWKVAATKLAFADQMRLKFDRSRSDAKVVAPHEKNIKQAKG-----RSKGRAE D 435 E + S ++ A + A +MRLK R + + +A +K +K AK R K RA ... SSEEIKALEKRHAAKMRLKEQRRKEQEENIAK-KKAVKDAKKQRKLERRKARAE E 413 Query: 436 MLKGEGFNQKFSDG------DLRYGDLGQKL 51 ... Frame = +1 Query: 346 DRSRSDAKVVAPH---EKNIKQAKGRSKGRAE DMLKGEGFNQKFSDGDLRYGDLGQKLGA 516 D ++ ++K V P + + + ...

  15. Effects of L-NAME on morphometric parameters of stomach parietal cells in pregnant rats

    Directory of Open Access Journals (Sweden)

    Seyed Mohammad Hossein Noori Mugahi

    2014-05-01

    Results: Results of this study after analysis showed the significant changes in parietal cells count (mean 61.3±4.32 and its diameters (mean 16.12±1.18 µm in L-NAME group in comparison to control and the sham groups in pregnant rats (P≤0.05. Conclusion: Results of this study showed L-NAME with effects on NO synthesis can reduce the count of parietal cells and increase its diameter in pregnant rats and has destructive effects on structure of stomach parietal cells in pregnancy rats.

  16. trans-Dichloridobis[tris(4-methoxyphenylphosphane]palladium(II toluene solvate

    Directory of Open Access Journals (Sweden)

    Alfred Muller

    2010-11-01

    Full Text Available In the title compound, trans-[PdCl2{P(4-MeOC6H43}2]·C7H8, the Pd(II atom lies on a center of symmetry, resulting in a distorted trans-square planar geometry. The Pd—P and Pd—Cl bond lengths are 2.3409 (4 and 2.2981 (4 Å, respectively. An intramolecular C—H...Cl hydrogen bond occurs. In the crystal, weak C—H...O interactions are observed between the aromatic rings of adjacent molecules. The toluene solvate molecule is equally disordered over two sets of sites.

  17. Agro-economic performance of Comum tannia cultivated with plant spacing and different seed-rhizome masse

    OpenAIRE

    Rosimeire Pereira Gassi; Néstor Antonio Heredia Zárate; Maria do Carmo Vieira; Elissandra Pacito Torales

    2014-01-01

    The study aimed to evaluate the increase in plant height and agro-economic productivity of Comum tannia cultivated using two different row spacing (0.10 and 0.15 m) and four seed-rhizome masses (5.52 g; 3.76 g, 2.17 g, and 1.44 g, mean of 480 rhizomes). The plants were cultivated in a 2 × 4-factorial scheme, completely randomized block design, with three replications. The maximum height of the plants reached 43.2 cm at 179 days after planting with a seed-rhizome mass of 5.52 g and 0.15-m spac...

  18. Metalochelatační liposomy s vázanými deriváty muramyl dipeptidu jako vakcinační nosič rekombinantních antigenů stimulující TH1 typ imunitní odpovědi

    Czech Academy of Sciences Publication Activity Database

    Křupka, M.; Mašek, J.; Bartheldyová, E.; Koudelka, Š.; Ledvina, Miroslav; Turánek, J.; Raška, M.

    2012-01-01

    Roč. 106, č. 5 (2012), s. 432-433. ISSN 0009-2770. [Mezioborové setkání mladých biologů, biochemiků a chemiků /12./. 29.05.2012-01.06.2012, Počátky] R&D Projects: GA ČR(CZ) GAP304/10/1951; GA AV ČR KAN200100801 Institutional research plan: CEZ:AV0Z40550506 Keywords : liposomes * metallochelation * recombinant antigens * muramyl glycopeptides Subject RIV: CC - Organic Chemistry

  19. Photometric Observations and Lightcurve Analysis of Asteroids 129 Antigone, 174 Phaedra, 232 Russia, 291 Alice, and 343 Ostara

    Science.gov (United States)

    Ruthroff, John C.

    2009-07-01

    From 2008 November through 2009 March photometric data were obtained and analyzed for five asteroids. Synodic periods were found for four of the asteroids while only a lower limit could be established for the fifth: 129 Antigone, P = 4.96 ± 0.01 h; 174 Phaedra, P = 5.75 ± 0.01 h; 232 Russia, P = 21.91 ± 0.01 h; 291 Alice, P = 4.32 ± 0.01 h; and 343 Ostara, P > 6 h.

  20. Análise espacial da transmissão de dengue em cidade de porte médio do interior paulista Spatial analysis of dengue transmission in a medium-sized city in Brazil

    OpenAIRE

    Adriano Mondini; Francisco Chiaravalloti Neto; Manuela Gallo Y Sanches; José Carlos Cacau Lopes

    2005-01-01

    OBJETIVO: Analisar espacialmente a transmissão de dengue entre setembro de 1990 e agosto de 2002 em cidade de porte médio do interior paulista. MÉTODOS: Utilizaram-se casos autóctones confirmados laboratorialmente e dados populacionais de São José do Rio Preto, obtidos da Fundação Instituto Brasileiro de Geografia e Estatística e da Prefeitura Municipal. Os casos foram geocodificados a partir do eixo de logradouros e agrupados segundo os 432 setores censitários do município, resultando em map...