WorldWideScience

Sample records for alloy-ehi 397

  1. 49 CFR 397.211 - Preemption determination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Preemption determination. 397.211 Section 397.211... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.211 Preemption determination. (a) Upon... determination. (b) Notwithstanding that an application for a determination has not been filed under § 397.205...

  2. 49 CFR 397.13 - Smoking.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Smoking. 397.13 Section 397.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION...; DRIVING AND PARKING RULES General § 397.13 Smoking. No person may smoke or carry a lighted cigarette...

  3. 33 CFR 117.397 - Wabash River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.397 Section 117... OPERATION REGULATIONS Specific Requirements Illinois § 117.397 Wabash River. The draws of the bridges across the Wabash River need not be opened for the passage of vessels. Indiana ...

  4. 49 CFR 397.209 - Preemption processing.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.209 Preemption processing. (a) The... without prejudice if: (1) he or she determines that there is insufficient information upon which to base a...

  5. 49 CFR 397.217 - Waiver processing.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.217 Waiver processing. (a) The... application without prejudice if: (1) he or she determines that there is insufficient information upon which...

  6. 14 CFR 25.397 - Control system loads.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Control system loads. 25.397 Section 25.397... STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Control Surface and System Loads § 25.397 Control system...) and to be reacted at the attachment of the control system to the control surface horn. (b) Pilot...

  7. 14 CFR 23.397 - Limit control forces and -torques.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit control forces and -torques. 23.397 Section 23.397 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION.... Wheel 3 50 D in.-lbs 4 40 D in.-lbs.4 Elevator: Stick 167 lbs 100 lbs. Wheel (symmetrical) 200 lbs 100...

  8. 14 CFR 27.397 - Limit pilot forces and torques.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit pilot forces and torques. 27.397... System Loads § 27.397 Limit pilot forces and torques. (a) Except as provided in paragraph (b) of this section, the limit pilot forces are as follows: (1) For foot controls, 130 pounds. (2) For stick controls...

  9. 14 CFR 29.397 - Limit pilot forces and torques.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit pilot forces and torques. 29.397... System Loads § 29.397 Limit pilot forces and torques. (a) Except as provided in paragraph (b) of this section, the limit pilot forces are as follows: (1) For foot controls, 130 pounds. (2) For stick controls...

  10. 49 CFR 397.67 - Motor carrier responsibility for routing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Motor carrier responsibility for routing. 397.67 Section 397.67 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS...

  11. Phenotype-gene: 397 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 397 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1394i increased efficien...ar. Plant Cell 17(3):987-99. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15722464i increased efficien...cy in organ named whole plant during process named leaf rolling http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u822i AT1G16540

  12. 49 CFR 397.5 - Attendance and surveillance of motor vehicles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Attendance and surveillance of motor vehicles. 397.5 Section 397.5 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL... REGULATIONS TRANSPORTATION OF HAZARDOUS MATERIALS; DRIVING AND PARKING RULES General § 397.5 Attendance and...

  13. 27 CFR 19.397 - Spirits not originally intended for export.

    Science.gov (United States)

    2010-04-01

    ..., originally intended for domestic use may be exported with benefit of drawback or without payment of tax if... intended for export. 19.397 Section 19.397 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX....397 Spirits not originally intended for export. Spirits manufactured, produced, bottled in bottles...

  14. 49 CFR 40.397 - When does the Director make a PIE decision?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false When does the Director make a PIE decision? 40.397... a PIE decision? The Director makes his or her decision within 60 days of the date when the record of a PIE proceeding is complete (including any meeting with the Director and any additional fact...

  15. 14 CFR 135.397 - Small transport category airplane performance operating limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Small transport category airplane... PERSONS ON BOARD SUCH AIRCRAFT Airplane Performance Operating Limitations § 135.397 Small transport category airplane performance operating limitations. (a) No person may operate a reciprocating engine...

  16. [Study on cytogenetic changes with relation to FAB classification in 397 patients with acute leukemias].

    Science.gov (United States)

    Huo, Fei-Fei; Liu, Xin; Sun, Zi-Min; Zhu, Wei-Bo; Zheng, Chang-Cheng; Wang, Jian; Wu, Zhi-Wei

    2011-02-01

    The purpose of study was to investigate the cytogenetic abnormality of acute leukemias (AL), to analyze the relationship in the chromosomal abnormality and the AL FAB types, and to explore the impact of the chromosomal abnormalities on the prognostic factors of AL. The chromosome karyotypes of 397 patients with AL were analyzed by means of bone marrow short-term culture and G banding technique. The results showed that in 319 out of 397 patients, the chromosome karyotypes could be analyzed, and the chromosomal abnormality occurred in 175 patients (54.9%). In the patients with acute lymphocytic leukemia (ALL), acute myelogenous leukemia (AML) and acute mixed-lineage leukemia (AMLL), the chromosomal abnormality occurred respectively in 33 of 120 patients (27.5%), 129 of 252 patients (51.2%) and 13 of 25 patients (52.0%). Hyper-diploids, hypo-diploids and diploids occurred in 41 of 175 patients (23.4%), 22 of 175 patients (12.5%), and 112 of 175 patients (64.0%) respectively. In patients with AML the FAB type-associated chromosomal abnormality occurred in 69 of 129 patients (53.5%). It is concluded that chromosomal abnormalities exist in about 55% AL patients. Some special chromosomal abnormalities are cytogenetic characteristics of AL, and obviously correlated with AL FAB types, the combination of chromosomal detection with cytogenetics is useful for the diagnosis of AL, and the evaluation of therapeutic effects and prognosis.

  17. pFAK-Y397 overexpression as both a prognostic and a predictive biomarker for patients with metastatic osteosarcoma.

    Science.gov (United States)

    Thanapprapasr, Kamolrat; Nartthanarung, Adisak; Thanapprapasr, Duangmani; Jinawath, Artit

    2017-01-01

    Focal adhesion kinase (FAK) is important for tumor cell survival and metastasis in various cancers. However, its expression and prognostic value in patients with metastatic osteosarcoma remain unknown. We investigated the expression of FAK and its phosphorylated form (pFAK-Y397) in osteosarcoma tissues from 53 patients by immunohistochemistry and evaluated their correlations with clinicopathologic characteristics and outcomes. The prognostic values were assessed using Kaplan-Meier survival and Cox regression analyses. Total FAK and pFAK-Y397 were overexpressed in 48 (90.6%) and 33 (62.3%) cases, respectively. pFAK-Y397 overexpression was correlated with poor histologic response after neoadjuvant chemotherapy in patients with osteosarcoma regardless of the presence of metastasis or not. Kaplan-Meier curve showed that patients with metastatic osteosarcoma with pFAK-Y397 overexpression had significantly worse overall survival (OS) than those with non-overexpression (P = 0.044). Multivariate Cox regression analysis confirmed pFAK-Y397 overexpression as an independent prognostic predictor for OS and post metastases OS (PMOS) (P = 0.017, P = 0.006, respectively). Age at diagnosis was also an independent indicator for PMOS (P = 0.003). However, total FAK expression was not correlated with any clinicopathologic characteristics or OS in patients with metastatic osteosarcoma. In conclusion, our findings identified FAK as a common aberrant protein overexpression in various subtypes of osteosarcoma. pFAK-Y397 overexpression can be used as a prognostic biomarker predicting poor OS for patients with metastatic osteosarcoma, and the expression of pFAK-Y397 differentiated good and poor responders to neoadjuvant chemotherapy.

  18. Safety Evaluation Report related to the operation of WPPSS Nuclear Project No. 2 (Docket No. 50-397)

    International Nuclear Information System (INIS)

    1984-04-01

    This report, Supplement No. 5 to the Safety Evaluation Report (SSER 5) on the Washington Public Power Supply System application for a license to operate WNP-2 (Docket No. 50-397), located in Benton County, Washington, approximately 12 miles north of Richland, Washington, has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplements No. 1, 2, 3, and 4

  19. Genetic mapping of rust resistance genes in confection sunflower line HA-R6 and oilseed line RHA 397.

    Science.gov (United States)

    Gong, L; Gulya, T J; Markell, S G; Hulke, B S; Qi, L L

    2013-08-01

    Few widely effective resistance sources to sunflower rust, incited by Puccinia helianthi Schwein., have been identified in confection sunflower (Helianthus annuus L.). The USDA inbred line HA-R6 is one of the few confection sunflower lines resistant to rust. A previous allelism test indicated that rust resistance genes in HA-R6 and RHA 397, an oilseed-type restorer line, are either allelic or closely linked; however, neither have been characterized nor molecularly mapped. The objectives of this study are (1) to locate the rust resistance genes in HA-R6 and RHA 397 on a molecular map, (2) to develop closely linked molecular markers for rust resistance diagnostics, and (3) to determine the resistance spectrum of two lines when compared with other rust-resistant lines. Two populations of 140 F2:3 families each from the crosses of HA 89, as susceptible parent, with HA-R6 and RHA 397 were inoculated with race 336 of P. helianthi in the greenhouse. The resistance genes (R-genes) in HA-R6 and RHA 397 were molecularly mapped to the lower end of linkage group 13, which encompasses a large R-gene cluster, and were designated as R 13a and R 13b, respectively. In the initial maps, SSR (simple sequence repeat) and InDel (insertion and deletion) markers revealed 2.8 and 8.2 cM flanking regions for R 13a and R 13b, respectively, linked with a common marker set of four co-segregating markers, ORS191, ORS316, ORS581, and ZVG61, in the distal side and one marker ORS464 in the proximal side. To identify new markers closer to the genes, sunflower RGC (resistance gene candidate) markers linked to the downy mildew R-gene Pl 8 and located at the same region as R 13a and R 13b were selected to screen the two F2 populations. The RGC markers RGC15/16 and a newly developed marker SUN14 designed from a BAC contig anchored by RGC251 further narrowed down the region flanking R 13a and R 13b to 1.1 and 0.1 cM, respectively. Both R 13a and R 13b are highly effective against all rust races

  20. Histological regression in primary melanoma: not a predictor of sentinel lymph node metastasis in a cohort of 397 patients.

    Science.gov (United States)

    Socrier, Y; Lauwers-Cances, V; Lamant, L; Garrido, I; Lauwers, F; Lopez, R; Rochaix, P; Chevreau, C; Payoux, P; Viraben, R; Paul, C; Meyer, N

    2010-04-01

    Regression has been proposed as a potential marker of dissemination in thin melanomas. Previous studies have shown conflicting results. To determine if regression in melanoma is associated with an increased risk of sentinel lymph node (SLN) metastasis. A cohort analysis was conducted. Data on all patients were collected on a standardized case report form during 10 years. A total of 397 consecutive patients with melanoma who underwent a SLN biopsy were analysed. All cases of melanoma and SLN biopsies were examined by the same two pathologists. Differences between melanomas with and without SLN metastasis were compared using Fisher's exact test or the two-sample t-test and the chi(2) test. Multivariable logistic regression was used to adjust for possible confounding factors. We analysed 397 patients (411 melanomas) who underwent a SLN biopsy. The median Breslow index was 1.8 mm (interquartile range 1.1-3). Regression was observed in 23% (n = 94). SLN metastases were observed in 26% (n = 106). The frequency of SLN metastasis was 16% in melanomas with regression and 29% without regression (P = 0.012). The adjusted odds ratio (OR) for regressive melanoma was 0.9 [95% confidence interval (CI) 0.4-1.9; P = 0.777]. The risk of SLN metastasis was increased in melanoma cases with a Breslow index from 1.5 to or= 2.0 mm (adjusted OR 3.5; 95% CI 1.7-7.4; P = 0.001) and ulceration of the melanoma (adjusted OR 1.8; 95% CI 1.1-3.2; P = 0.03). Regression is not an independent predictor of the risk of SLN metastasis in melanoma.

  1. miR397/Laccase Gene Mediated Network Improves Tolerance to Fenoxaprop-P-ethyl in Beckmannia syzigachne and Oryza sativa

    Directory of Open Access Journals (Sweden)

    Lang Pan

    2017-05-01

    Full Text Available Herbicide resistance can be either target-site or non-target-site based. The molecular mechanisms underlying non-target-site resistance (NTSR are poorly understood, especially at the level of gene expression regulation. MicroRNAs (miRNAs represent key post-transcriptional regulators of eukaryotic gene expression and play important roles in stress responses. In this study, the miR397 gene from Beckmannia syzigachne (referred to as bsy-miR397 was functionally characterized to determine its role in regulating fenoxaprop-P-ethyl resistance. We showed that (1 bsy-miR397 transcript level is constitutively higher in resistant than in sensitive B. syzigachne plants, whereas bsy-Laccase expression and activity show the opposite trend, and (2 bsy-miR397 suppresses the expression of bsy-Laccase in tobacco, indicating that it negatively regulates bsy-Laccase at the transcriptional level. We found evidences that miR397/laccase regulation might be involved in fenoxaprop-P-ethyl NTSR. First, the rice transgenic line overexpressing OXmiR397 showed improved fenoxaprop-P-ethyl tolerance. Second, following activation of bsy-Laccase gene expression by CuSO4 treatment, fenoxaprop resistance in B. syzigachne tended to decrease. Therefore, we suggest that bsy-miR397 might play a role in fenoxaprop-P-ethyl NTSR in B. syzigachne by down-regulating laccase expression, potentially leading to the enhanced expression of three oxidases/peroxidases genes to introduce an active moiety into herbicide molecules in Phase-2 metabolism. Bsy-miR397, bsy-Laccase, and other regulatory components might form a regulatory network to detoxify fenoxaprop-P-ethyl in B. syzigachne, supported by the differential expression of transcription factors and oxidases/peroxidases in the rice transgenic line overexpressing OXmiR397. This implies how down-regulation of a gene (laccase can enhance NTSR. Our findings shed light on the daunting task of understanding and managing complex NTSR in weedy

  2. Constraining the Single-degenerate Channel of Type Ia Supernovae with Stable Iron-group Elements in SNR 3C 397

    Energy Technology Data Exchange (ETDEWEB)

    Dave, Pranav; Kashyap, Rahul; Fisher, Robert [Department of Physics, University of Massachusetts Dartmouth, 285 Old Westport Road, North Dartmouth, MA 02740 (United States); Timmes, Frank [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Townsley, Dean [Department of Physics and Astronomy, Box 870324, University of Alabama, Tuscaloosa, AL 35487 (United States); Byrohl, Chris [Institut für Astrophysik, Georg August Universität Göttingen, Friedrich-Hund-Platz 1, D-37077 Göttingen (Germany)

    2017-05-20

    Recent Suzaku X-ray spectra of supernova remnant (SNR) 3C 397 indicate enhanced stable iron group element abundances of Ni, Mn, Cr, and Fe. Seeking to address key questions about the progenitor and explosion mechanism of 3C 397, we compute nucleosynthetic yields from a suite of multidimensional hydrodynamics models in the near-Chandrasekhar-mass, single-degenerate paradigm for Type Ia supernovae (SNe Ia). Varying the progenitor white dwarf (WD) internal structure, composition, ignition, and explosion mechanism, we find that the best match to the observed iron peak elements of 3C 397 are dense (central density ≥6 × 10{sup 9} g cm{sup −3}), low-carbon WDs that undergo a weak, centrally ignited deflagration, followed by a subsequent detonation. The amount of {sup 56}Ni produced is consistent with a normal or bright normal SNe Ia. A pure deflagration of a centrally ignited, low central density (≃2 × 10{sup 9} g cm{sup −3}) progenitor WD, frequently considered in the literature, is also found to produce good agreement with 3C 397 nucleosynthetic yields, but leads to a subluminous SN Ia event, in conflict with X-ray line width data. Additionally, in contrast to prior work that suggested a large supersolar metallicity for the WD progenitor for SNR 3C 397, we find satisfactory agreement for solar- and subsolar-metallicity progenitors. We discuss a range of implications our results have for the single-degenerate channel.

  3. A CHANDRASEKHAR MASS PROGENITOR FOR THE TYPE Ia SUPERNOVA REMNANT 3C 397 FROM THE ENHANCED ABUNDANCES OF NICKEL AND MANGANESE

    International Nuclear Information System (INIS)

    Yamaguchi, Hiroya; Williams, Brian J.; Petre, Robert; Badenes, Carles; Foster, Adam R.; Brickhouse, Nancy S.; Bravo, Eduardo; Maeda, Keiichi; Nobukawa, Masayoshi; Koyama, Katsuji; Eriksen, Kristoffer A.

    2015-01-01

    Despite decades of intense efforts, many fundamental aspects of Type Ia supernovae (SNe Ia) remain elusive. One of the major open questions is whether the mass of an exploding white dwarf (WD) is close to the Chandrasekhar limit. Here, we report the detection of strong K-shell emission from stable Fe-peak elements in the Suzaku X-ray spectrum of the Type Ia supernova remnant (SNR) 3C 397. The high Ni/Fe and Mn/Fe mass ratios (0.11–0.24 and 0.018–0.033, respectively) in the hot plasma component that dominates the K-shell emission lines indicate a degree of neutronization in the supernova ejecta that can only be achieved by electron capture in the dense cores of exploding WDs with a near-Chandrasekhar mass. This suggests a single-degenerate origin for 3C 397, since Chandrasekhar mass progenitors are expected naturally if the WD accretes mass slowly from a companion. Together with other results supporting the double-degenerate scenario, our work adds to the mounting evidence that both progenitor channels make a significant contribution to the SN Ia rate in star-forming galaxies

  4. A CHANDRASEKHAR MASS PROGENITOR FOR THE TYPE Ia SUPERNOVA REMNANT 3C 397 FROM THE ENHANCED ABUNDANCES OF NICKEL AND MANGANESE

    Energy Technology Data Exchange (ETDEWEB)

    Yamaguchi, Hiroya; Williams, Brian J.; Petre, Robert [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Badenes, Carles [Department of Physics and Astronomy and Pittsburgh Particle Physics, Astrophysics and Cosmology Center (PITT PACC), University of Pittsburgh, 3941 O’Hara Street, Pittsburgh, PA 15260 (United States); Foster, Adam R.; Brickhouse, Nancy S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Bravo, Eduardo [E.T.S. Arquitectura del Vallès, Universitat Politècnica de Catalunya, Carrer Pere Serra 1-15, E-08173 Sant Cugat del Vallès (Spain); Maeda, Keiichi [Department of Astronomy, Kyoto University, Kitashirakawa-oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Nobukawa, Masayoshi; Koyama, Katsuji [Department of Physics, Kyoto University, Kitashirakawa-oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Eriksen, Kristoffer A., E-mail: hiroya.yamaguchi@nasa.gov [Theoretical Design Division, Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States)

    2015-03-10

    Despite decades of intense efforts, many fundamental aspects of Type Ia supernovae (SNe Ia) remain elusive. One of the major open questions is whether the mass of an exploding white dwarf (WD) is close to the Chandrasekhar limit. Here, we report the detection of strong K-shell emission from stable Fe-peak elements in the Suzaku X-ray spectrum of the Type Ia supernova remnant (SNR) 3C 397. The high Ni/Fe and Mn/Fe mass ratios (0.11–0.24 and 0.018–0.033, respectively) in the hot plasma component that dominates the K-shell emission lines indicate a degree of neutronization in the supernova ejecta that can only be achieved by electron capture in the dense cores of exploding WDs with a near-Chandrasekhar mass. This suggests a single-degenerate origin for 3C 397, since Chandrasekhar mass progenitors are expected naturally if the WD accretes mass slowly from a companion. Together with other results supporting the double-degenerate scenario, our work adds to the mounting evidence that both progenitor channels make a significant contribution to the SN Ia rate in star-forming galaxies.

  5. Fusion evaporation-residue cross sections for 28Si+40Ca at E(28Si)=309, 397, and 452 MeV

    International Nuclear Information System (INIS)

    Vineyard, M.F.; Bauer, J.S.; Crum, J.F.; Gosdin, C.H.; Trotter, R.S.; Kovar, D.G.; Beck, C.; Henderson, D.J.; Janssens, R.V.F.; Wilkins, B.D.; Maguire, C.F.; Mateja, J.F.; Prosser, F.W.; Stephans, G.S.F.

    1992-01-01

    Velocity distributions of mass-identified evaporation residues produced in the 28 Si+ 40 Ca reaction have been measured at bombarding energies of 309, 397, and 452 MeV using time-of-flight techniques. These distributions were used to identify evaporation residues and to separate the complete-fusion and incomplete-fusion components. Angular distributions and upper limits for the total evaporation-residue and complete-fusion evaporation-residue cross sections were extracted at all three bombarding energies. The complete-fusion evaporation-residue cross sections and the deduced critical angular momenta are compared with earlier measurements and the predictions of existing models. The ratios of the complete-fusion evaporation-residue cross section to the total evaporation-residue cross section, along with those measured for the 28 Si+ 12 C and 28 Si+ 28 Si systems at the same energies, support the entrance-channel mass-asymmetry dependence of the incomplete-fusion evaporation-residue process reported earlier

  6. Prevalence of ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms in Brazilian breast cancer-unaffected women

    Energy Technology Data Exchange (ETDEWEB)

    Giacomazzi, J.; Aguiar, E. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Palmero, E.I. [International Agency for Research on Cancer (IARC), Lyon (France); Schmidt, A.V. [Departamento de Estatística, UFRGS, Porto Alegre, RS (Brazil); Skonieski, G.; Filho, D.D. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Bock, H. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Saraiva-Pereira, M.L. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Bioquímica, UFRGS, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Ewald, I.P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Schuler-Faccini, L. [Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Camey, S.A. [Departamento de Estatística, Instituto de Matemática, UFRGS, Porto Alegre, RS (Brazil); Caleffi, M. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Giugliani, R. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Ashton-Prolla, P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (BR); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (BR); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (BR); Serviço de Genética Médica, HCPA, Porto Alegre, RS (BR); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (BR); Departamento de Genética, UFRGS, Porto Alegre, RS (BR)

    2012-05-18

    Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease.

  7. 49 CFR 397.71 - Federal standards.

    Science.gov (United States)

    2010-10-01

    ..., pickup and delivery, and (iii) Facilities for food, fuel, repairs, rest, and safe havens. (8... release. Special populations such as schools, hospitals, prisons, and senior citizen homes shall, among...; special populations in hospitals, schools, handicapped facilities, prisons and stadiums; water sources...

  8. 397-IJBCS-Article-Dr Gbassi Gildas

    African Journals Online (AJOL)

    Dr Gatsing

    Biodegradable composites from sugar beet pulp and poly(lactic acid). J. Agric. Food Chem., 55(6): 2349-2355. Lofgren C, Hermansson AM. 2007. Synergistic rheological behavior of mixed. HM/LM pectin gels. Food Hydrocolloids,. 21(3): 480–486. Lutz R, Aserin A, Wicker L, Garti N. 2009. Structure and physical properties of.

  9. BDML Metadata: 397 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Keller, P.J., Schmidt, A.D., Wittbrodt, J. and Stelzer, E.H.K. Philipp J. Keller, European Molecular Biology Lab...oratory, Cell Biology and Biophysics Unit, Stelzer Laboratory See details in

  10. China Report, Economic Affairs, No. 397

    Science.gov (United States)

    1983-11-10

    situation. Of course one of these is grain and cereals , or food in general, and another is energy, while in addition there is also communications and...our hopes for a vigorous economic development in the 1990’s be shattered ; even the normal economic order and proportionate relationship restored with...ideology was shattered , and a group of 500-ton- per-day sugar mills were constructed and expanded. Large sugar mills were also expanded. Thus, the scale

  11. Publications | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3961 - 3970 of 6381 ... This policy note explores labour market legislation and policies with reference to issues of minimum wages, contractual choice, and industrial relations in the Philippines. Wage and salary workers comprise about 52 percent of the Philippines'' employed work force, placing the rest of the 34.

  12. Publications | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3961 - 3970 of 6384 ... Social-economic impacts of HPAI outbreaks and control measures on small-scale and backyard poultry producers in Asia : final technical report (restricted ... Adding academic networks as an external KML map layer to the web version of the Africa Telecom Transmission Map (restricted access) ...

  13. US House of Representatives resolution 397

    Index Scriptorium Estoniae

    2008-01-01

    USA Kongressi Esindajatekoja Eesti teemaline resolutsioon, milles väljendatakse solidaarsust Eestiga ning mõistetakse hukka märatsejate vägivald Tallinnas ning rünnakud Eesti saatkonna vastu Moskvas

  14. Publications | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3961 - 3970 of 6381 ... Despite concerns over negative impacts, one of the anticipated benefits to wildlife viewing is increased visitor support for marine conservation. ... and local nongovernmental organizations has an inbuilt trigger for self-destruction because of poor sustainability and weak national ownership.

  15. Reference: 397 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available atricia et al. 2006 Jun. Proc. Natl. Acad. Sci. U.S.A. 103(26):10134-9. Phototropism, or plant growth in res...ly NONPHOTOTROPIC HYPOCOTYL 3 (NPH3) and root phototropism 2, both belonging to the same family of proteins,... have been previously identified as phototropin-interacting signal transducers involved in phototropism. PHY...n of this gene family during phototropism. Photobiological experiments show that ...the PKS proteins are critical for hypocotyl phototropism. Furthermore, PKS1 interacts with phot1 and NPH3 in

  16. 40 CFR 98.397 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... of density and carbon share for any petroleum product or natural gas liquid for which CO2 emissions... gas liquids, biomass, and feedstocks, reporters shall maintain metering, guaging, and other records... quantities of petroleum products, natural gas liquids, biomass, and feedstocks reported under this subpart...

  17. All projects related to | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-22

    Economic problems facing the West Bank and Gaza include high unemployment, low productivity, and an underperforming private sector. Start Date: January 22, 2012. End Date: July 22, 2014. Topic: ECONOMIC POLICY, ECONOMIC RESEARCH, PALESTINE, SMALL ENTERPRISES, EMPLOYMENT, PRODUCTIVITY.

  18. 397 Empirical Assessment of Agricultural Development in Manzini ...

    African Journals Online (AJOL)

    User

    the agricultural sector, by increasing the number of both small-scale and large farmers, adoption of incentives ..... western terminous of the city on the highway to Mbabane is KaKhoza. Township, a poor neighborhood .... from the other studies with those estimated in this study could be misleading. However, the own-price ...

  19. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 397

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...

  20. Résultats de recherche | Page 397 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La ville de Rosario, en Argentine, s'était mise à la culture de jardins potagers pour traverser une crise économique. Aujourd'hui, elle fait figure de chef de file dans la promotion de ... ÉTUDE DE CAS — Vietnam : Les communes du Vietnam progressent grâce à l'information. Research in Action. Gender Trade and investment ...

  1. 49 CFR 397.101 - Requirements for motor carriers and drivers.

    Science.gov (United States)

    2010-10-01

    ... level of radiological risk; and (3) Tell the driver which route to take and that the motor vehicle... will access emergency assistance in each State to be entered. (e) No person may transport a package of highway route controlled quantity of Class 7 (radioactive) materials on a public highway unless: (1) The...

  2. 7 CFR 1755.397 - RUS performance specification for line concentrators.

    Science.gov (United States)

    2010-01-01

    ... be stored in electronic storage registers or a block of memory consisting of one or more traffic... and indicator type, and their rating designated by numerals or color code on fuse positions. (j... heating effects will be cumulative. See Figure 6 of this section, 60 Hz Current Surge Tests as follows...

  3. WPPSS Nuclear Project No. 2: Final environmental statement (DOCKET No. 50-397)

    International Nuclear Information System (INIS)

    1981-12-01

    The proposed action is the issuance of an operating license to the Washington Public Power Supply System (WPPSS) for the startup and operation of the Washington Nuclear Project Number 2 (WNP-2) located on the Columbia River in Benton County, about 19 km (12 mi) north of Richland, Washington. The facility will employ a boiling water reactor to produce 3323 megawatts thermal (MWt). A steam turbine-generator will use this heat to provide a nominal gross electrical output of 1150 megawatts (MWe). The exhaust steam will be condensed by cooled water from six circular mechanical-draft cooling towers with water taken from and returned to the Columbia River. The information in this statement represents the second assessment of the environmental impact associated with the WNP-2 pursuant to the guidelines of the National Environmental Policy Act of 1969 (NEPA) and 10 CRF Part 51 of the Commission's Regulations. After receiving an application to construct this plant, the staff carried out a review of impacts that would occur during its construction and operation. That evaluation was issued as a Final Environmental Statement (construction phase). The construction of Unit 2 about 86% complete. The staff estimated a fuel-loading date of September 1983. In March 1977, the applicant applied for an operating license for the unit and submitted the required safety and environmental reports in support of the application. 20 figs., 19 tabs

  4. Korean Waste Management Law, Presidential Decree Number 13480, and Prime Minister Order Number 397

    Science.gov (United States)

    1994-06-01

    stock or property: more than 300,000,000 won of captal stock in case of a corporation, more thart 600.000.000 won of estimated properties in case of...theWtrust- disp F meth•bed ir•-cy• W 1):t- eco ntheti aub t f sto raget Leather 40, Waste Paint & Lacquer 50, Other Waste Synthetic High Polymers 601

  5. 76 FR 397 - iShares Trust, et al.; Notice of Application

    Science.gov (United States)

    2011-01-04

    ... aggregations only (``Creation Units''); (b) secondary market transactions in Shares to occur at negotiated... redemption of Creation Units. DATES: Filing Dates: The application was filed on November 7, 2008 and amended... shares of other exchange traded funds (``ETFs'') and shares of money market mutual funds or other...

  6. 49 CFR 397.3 - State and local laws, ordinances, and regulations.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false State and local laws, ordinances, and regulations... laws, ordinances, and regulations. Every motor vehicle containing hazardous materials must be driven and parked in compliance with the laws, ordinances, and regulations of the jurisdiction in which it is...

  7. Community College Partnerships for Student and Career Success: Program Profile of "Carreras en Salud." Fact Sheet #C397

    Science.gov (United States)

    Henrici, Jane

    2012-01-01

    Postsecondary students with children often need an array of supports to succeed in their studies, which can require significant coordination among new and existing services (Conway, Blair, and Helmer 2012; Henrici n.d.; Miller, Gault, and Thorman 2011). Such supports might include financial aid, academic and career counseling, job placement…

  8. Leucocyte Telomere Length and Risk of Cardiovascular Disease in a Cohort of 1,397 Danish Men and Women

    DEFF Research Database (Denmark)

    Ellehoj, Hanne; Bendix, Laila; Osler, Merete

    2016-01-01

    OBJECTIVES: Short leucocyte telomere length (LTL) might be a risk factor for cardiovascular diseases (CVD). The present study examines the relation between LTL and incident fatal or non-fatal CVD, ischaemic heart disease (IHD) and stroke in a Danish cohort followed for 29 years. METHODS: In total...... rate ratio of 1.97 (95% CI 1.31-2.93) and 1.55 (95% CI 1.02-2.35), respectively, which was attenuated when confounding factors were adjusted for. For stroke, the pattern of associations was similar but less precisely estimated. CONCLUSIONS: In this study short, LTL was not associated with an increased...

  9. Screening of 397 chemicals and development of a quantitative structure-activity relationship model for androgen receptor antagonism

    DEFF Research Database (Denmark)

    Vinggaard, Annemarie; Niemelä, Jay Russell; Wedebye, Eva Bay

    2008-01-01

    , plastizicers, plastic additives, brominated flame retardants, and roast mutagens). In addition, the intention was to obtain an equal number of positive and negative chemicals. Among our own data for the training set, 45.7% exhibited inhibitory activity against the transcriptional activity induced...

  10. Bridge Busters: The 397th Bombardment Group (Medium) and the B-26 Marauder in World War II

    Science.gov (United States)

    2015-06-01

    instruction on combat procedures, tactics, navigation, communication, and gunnery. The group flew local training missions, known as “ doughnut missions,” to...minimum altitude attacks by fighters, if properly delivered, were the most effective and economical aerial countermeasures against ski sites; medium and...attacks against bridges, its proponents saw these attacks as less economical due to the difficulty of destroying bridges and the large number of bombs

  11. Le investigazioni difensive alla luce della L. 397/2000 / Les enquêtes défensives à la lumière de la loi n° 397/2000 / The defense investigations on the basis of Law n° 397/2000

    Directory of Open Access Journals (Sweden)

    Cennamo Alice

    2011-04-01

    Full Text Available In Italy, it has long been spoken of the need to allocate to the defense the tools reserved for the public prosecution.Only recently, the code of criminal procedures has introduced the same rules relating to defense investigations.Anyway, there are still gaps and these tools are not being used as we had hoped.On parle depuis longtemps, en Italie, de l’exigence de donner à la défense les mêmes moyens qu’à l’accusation, dans la procédure pénale.Ce n’est que récemment qu’on est parvenu à une égalité de traitement entre la défense et l’accusation, par la promulgation des normes sur les enquêtes défensives.Il reste, néanmoins, des lacunes, et ces règles ne sont pas appliquées comme on l’avait espéré.Da tempo si parla, in Italia, della necessità di munire la difesa dei medesimi strumenti dell’accusa, all’interno del procedimento penale.Solo recentemente, si è giunti ad un equo trattamento tra le parti antagoniste del processo, tramite l’introduzione, all’interno del codice di procedura penale vigente, della normativa in materia di investigazioni difensive.Ciononostante, permangono svariate lacune e l’applicazione della normativa non corrisponde a quanto sperato.

  12. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2, (Docket No. 50-397). Supplement No. 4

    International Nuclear Information System (INIS)

    1983-12-01

    Supplement No. 4 to the Safety Evaluation Report on the application filed by Washington Public Power Supply System for a license to operate the WPPSS Nuclear Project No. 2, located in Richland, Washington, has been prepared by the Division of Licensing, Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplement Nos. 1, 2 and 3

  13. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2. Docket No. 50-397, Washington Public Power Supply System

    International Nuclear Information System (INIS)

    1982-08-01

    Information is presented concerning site characteristics; design criteria for structures, systems, and components; engineered safety features; instrumentation and control; auxiliary systems; conduct of operations; and financial qualifications

  14. SU-F-T-397: Evaluating the Impact of Bladder Filling Status for the Organs at Risk Dose Distribution in Cervical Cancer Patients with Intensity Modulated Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, JY [Cancer Hospital of Shantou University Medical College, Shantou, Guangdong (China); Hong, DL [The First Affiliated Hospital of Shantou University Medical College, Shantou, Guangdong (China)

    2016-06-15

    Purpose: To investigate the impact of bladder filling status of the organs at risk (OARs) on dose distribution during intensity modulated radiotherapy (IMRT) for cervical cancer patients. Methods: Twelve cervical cancer patients treated with IMRT were selected for this study. The prescription dose was 45Gy/25 fractions with the 6 MV photon beam. All patients performed two CT scans, one with an empty bladder, the other one with bladder filled. For the registration of two CT scans, the fusion was automatically carried out upon the bony anatomy. The OARs (bladder, rectum, pelvic bone and small intestine) were delineated to planning CT to evaluate the dose distributions. These dose distributions were compared between empty bladder and bladder filling. Results: The bladder volume with empty bladder and bladder filling was 403.2±124.13cc and 101.4±87.5cc, respectively. There were no statistical differences between empty bladder and bladder filling in the mean value of pelvic bone V10Gy, V20Gy, V40Gy; rectum V40Gy and V45Gy. The bladder V40Gy and V45Gy were lower in the bladder filling group than in the empty bladder group (63.7%±5.8% vs 87.5%±7.8%, 45.1%±9.5% vs 62.4%±11.8%, respectively). The V45Gy for small intestine in the bladder filling group was significantly less than the empty bladder group (146.7cc±95.3cc vs 245.7cc±101.8cc). Conclusion: Our study finds that the bladder filling status did not have a significant impact on dose distribution in the rectum and pelvic bone. However, the changes of bladder filling have a large impact on bladder and small intestine doses. A full bladder is strongly recommended during treatment for cervical cancer patients.

  15. SU-F-T-397: Evaluating the Impact of Bladder Filling Status for the Organs at Risk Dose Distribution in Cervical Cancer Patients with Intensity Modulated Radiotherapy

    International Nuclear Information System (INIS)

    Zhang, JY; Hong, DL

    2016-01-01

    Purpose: To investigate the impact of bladder filling status of the organs at risk (OARs) on dose distribution during intensity modulated radiotherapy (IMRT) for cervical cancer patients. Methods: Twelve cervical cancer patients treated with IMRT were selected for this study. The prescription dose was 45Gy/25 fractions with the 6 MV photon beam. All patients performed two CT scans, one with an empty bladder, the other one with bladder filled. For the registration of two CT scans, the fusion was automatically carried out upon the bony anatomy. The OARs (bladder, rectum, pelvic bone and small intestine) were delineated to planning CT to evaluate the dose distributions. These dose distributions were compared between empty bladder and bladder filling. Results: The bladder volume with empty bladder and bladder filling was 403.2±124.13cc and 101.4±87.5cc, respectively. There were no statistical differences between empty bladder and bladder filling in the mean value of pelvic bone V10Gy, V20Gy, V40Gy; rectum V40Gy and V45Gy. The bladder V40Gy and V45Gy were lower in the bladder filling group than in the empty bladder group (63.7%±5.8% vs 87.5%±7.8%, 45.1%±9.5% vs 62.4%±11.8%, respectively). The V45Gy for small intestine in the bladder filling group was significantly less than the empty bladder group (146.7cc±95.3cc vs 245.7cc±101.8cc). Conclusion: Our study finds that the bladder filling status did not have a significant impact on dose distribution in the rectum and pelvic bone. However, the changes of bladder filling have a large impact on bladder and small intestine doses. A full bladder is strongly recommended during treatment for cervical cancer patients.

  16. Final Scientific Report DE-FGO3-97ER62460 Stomatal Responses to CO2: A Comparison of Woody and Herbaceous Species in Arid and Humid Climates

    Energy Technology Data Exchange (ETDEWEB)

    Koch, George W.

    2003-12-19

    OAK-B135 The project involved a study of a fundamental response of terrestrial vegetation to rising atmospheric carbon dioxide (CO2) concentration, namely, the change in leaf conductance to gas diffusion associated with a change in the aperture of the microscopic pores (stomata) on the surface of leaves.

  17. Klein Cecelia F. (ed.), Gender in Pre-hispanic America. A symposium at Dumbarton Oaks, 12 and 13 october 1996, Dumbarton Oaks Research Library and Collection, Washington, D.C., 2001, viii + 397 p.,

    OpenAIRE

    Arnauld, Marie-Charlotte

    2005-01-01

    Ce livre est un collectif d’articles issus d’un symposium tenu à Dumbarton Oaks les 12 et 13 octobre 1996. Dans l’introduction, Cecelia Klein explique que l’idée du symposium a d’abord rencontré une certaine réticence, due au fait que les gender studies étaient encore trop récentes dans le domaine mésoaméricain. Un symposium a bien été organisé par les historiennes de l’art Virginia E. Miller et Mary Ellen Miller, au Congrès des Américanistes de Bogotá en 1985, mais sans suite, si ce n’est la...

  18. Atuação dos fisioterapeutas dos núcleos de apoio à saúde da família entre idosos do município de Arapiraca-Al, Brasil - doi: 10.5020/18061230.2012.p397

    Directory of Open Access Journals (Sweden)

    Almir Vieira Dibai Filho

    2013-07-01

    Full Text Available Objetivo: Analisar a atuação dos fisioterapeutas nos Núcleos de Apoio à Saúde da Família (NASF com indivíduos senescentes residentes no município de Arapiraca-AL, Brasil. Metodos: Estudo caracterizado como descritivo e qualitativo. Os sujeitos da pesquisa foram oito fisioterapeutas realizando intervenções junto aos idosos nos NASF, de ambos os sexos, regularmente inscritos no Conselho Regional de Fisioterapia e Terapia Ocupacional 1 (CREFITO 1. Os dados foram obtidos no mês de outubro de 2010 com a aplicação de um questionário para caracterizar a amostra, sendo coletados dados pessoais e questões relacionadas à formação acadêmica e ao trabalho nos NASF. Além disso, realizou-se uma entrevista abordando opiniões dos fisioterapeutas referentes ao cuidado com o idoso na Estratégia Saúde da Família (ESF e nos NASF, à atuação dos fisioterapeutas dos NASF com idosos, e às dificuldades vivenciadas nesse trabalho. Foi realizada uma análise qualitativa por meio da técnica do discurso do sujeito coletivo. Resultados: Os profissionais incluídos no estudo consideraram regular e positivo o cuidado ao idoso na ESF e nos NASF, respectivamente. As intervenções deles nos NASF se baseiam em ações sustentadas na atenção primária à saúde e as dificuldades encontradas dizem respeito à equipe multidisciplinar e à falta de recursos e infraestrutura. Conclusão: Os fisioterapeutas dos NASF do município em estudo desenvolvem suas ações na população senescente, com ênfase em medidas educativas, preventivas e promotoras de saúde.

  19. ORF Alignment: NC_004347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QGAIYPLLTPENDE Sbjct: 1 ... STKQPIAIIGGGLASAHLMLSLAEREQSSILFCKDNDLGQGASGNRQGAIYPLLTPENDE 60 ... Query: 338 QSQDWPAEIAYAVDASEAN...KIAKIGIDKAGFYYPLGGWVCPFEYAKAAVDKASQLANVQC 397 ... QSQDWPAEIAYAVDASEANKIAKIGIDKAGFYYPLGGW...VCPFEYAKAAVDKASQLANVQC Sbjct: 121 QSQDWPAEIAYAVDASEANKIAKIGIDKAGFYYPLGGWVCPFEYAKA

  20. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available loti ... 1021] ... Length = 174 ... Query: 277 EMLGEKFHMDEAYLRELNPGVDFSIPGTTIKVVNPGPNKKGKVARIVADKAR...KQVLAYDE 336 ... EMLGEKFHMDEAYLRELNPGVDFSIPGTTIKVVNPGPNKKGKVARIVADKARKQV...LAYDE Sbjct: 1 ... EMLGEKFHMDEAYLRELNPGVDFSIPGTTIKVVNPGPNKKGKVARIVADKARKQVLAYDE 60 ... Query: 397 PVGTVWIALSKPTYG

  1. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available W 180 ... Query: 277 RLIEKIAELQDQKKLPLVGDVRDESAEDVRIVIEPKSKNVDPALMMESLFRLTELENKIP 336 ... RLIEKIAELQDQKK...LPLVGDVRDESAEDVRIVIEPKSKNVDPALMMESLFRLTELENKIP Sbjct: 241 RLIEKIAELQDQKKLPLVGDVRDESAEDVRIVIEPKSKNVDPALMMESLF...RLTELENKIP 300 ... Query: 397 DKVIKIIRTEDEPKPALMKAFKLTEVQAEAILNMRLRSLRKLEEMEIRTE 446... ... DKVIKIIRTEDEPKPALMKAFKLTEVQAEAILNMRLRSLRKLEEMEIRTE Sbjct: 361 DKVIKIIRTEDEPKPALMKAFKLTEVQAEAILNMRLRSLRKLEEMEIRTE 410

  2. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 119; Issue 4. Volume 119, Issue 4. August 2010, pages 397-560. pp 397-415. Towards understanding the unusual Indian monsoon in 2009 · P A Francis Sulochana Gadgil · More Details Abstract Fulltext PDF. The Indian summer monsoon season of 2009 ...

  3. Understanding the Plott-Wit-Yang paradox

    Czech Academy of Sciences Publication Activity Database

    Kálovcová, K.; Ortmann, Andreas

    -, č. 397 (2009), s. 1-15 ISSN 1211-3298 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : experimental betting markets * private information * information aggregation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp397.pdf

  4. Understanding the Plott-Wit-Yang paradox

    Czech Academy of Sciences Publication Activity Database

    Kálovcová, Katarína; Ortmann, A.

    -, č. 397 (2009), s. 1-15 ISSN 1211-3298 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : experimental betting markets * private information * information aggregation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp397.pdf

  5. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 36; Issue 3. Issue front cover thumbnail. Volume 36, Issue 3. August 2011, pages 397-553. Special Issue. pp 397-398. Editorial · J K Roy · More Details Fulltext PDF. pp 399-423 Articles. Forty years of the 93D puff of Drosophila melanogaster · Subhash C Lakhotia.

  6. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 1 (Adamsville, Alabama-Santa Clara, California).

    Science.gov (United States)

    1984-01-01

    204 29 175 TOTAL - VERNON 310 29 175 106 WILMER G M J MACHINE COMPANY 210 38 172 WINFIELD CLIFFORD INDUSTRIES INC 46 46 DECATUR AUTOMATIC SCREW MCH...AIR PARTS INC 397 397 PACIFIC CUSTOM INC 28 28 PARSON3 BRINCKERHOFF 463 463 PASCAL & L 223 223 PASTUSHIN AVIATION COMPANY 301 301 PEREIRA , WILLIAM L

  7. Modification of halogen specificity of a vanadium-dependent bromoperoxidase

    Science.gov (United States)

    Ohshiro, Takashi; Littlechild, Jennifer; Garcia-Rodriguez, Esther; Isupov, Michail N.; Iida, Yasuaki; Kobayashi, Takushi; Izumi, Yoshikazu

    2004-01-01

    The halide specificity of vanadium-dependent bromoperoxidase (BPO) from the marine algae, Corallina pilulifera, has been changed by a single amino acid substitution. The residue R397 has been substituted by the other 19 amino acids. The mutant enzymes R397W and R397F showed significant chloroperoxidase (CPO) activity as well as BPO activity. These mutant enzymes were purified and their properties were investigated. The maximal velocities of CPO activities of the R397W and R397F enzymes were 31.2 and 39.2 units/mg, and the Km values for Cl− were 780 mM and 670 mM, respectively. Unlike the native enzyme, both mutant enzymes were inhibited by NaN3. In the case of the R397W enzyme, the incorporation rate of vanadate into the active site was low, compared with the R397F and the wild-type enzyme. These results supported the existence of a specific halogen binding site within the catalytic cleft of vanadium haloperoxidases. PMID:15133166

  8. Exacerbation of Charcot-Marie-Tooth type 2E neuropathy following traumatic nerve injury.

    Science.gov (United States)

    Villalón, Eric; Dale, Jeffrey M; Jones, Maria; Shen, Hailian; Garcia, Michael L

    2015-11-19

    Charcot-Marie-Tooth disease (CMT) is the most commonly inherited peripheral neuropathy. CMT disease signs include distal limb neuropathy, abnormal gait, sensory defects, and deafness. We generated a novel line of CMT2E mice expressing hNF-L(E397K), which displayed muscle atrophy of the lower limbs without denervation, proximal reduction in large caliber axons, and decreased nerve conduction velocity. In this study, we challenged wild type, hNF-L and hNF-L(E397K) mice with crush injury to the sciatic nerve. We analyzed functional recovery by measuring toe spread and analyzed gait using the Catwalk system. hNF-L(E397K) mice demonstrated reduced recovery from nerve injury consistent with increased susceptibility to neuropathy observed in CMT patients. In addition, hNF-L(E397K) developed a permanent reduction in their ability to weight bear, increased mechanical allodynia, and premature gait shift in the injured limb, which led to increasingly disrupted interlimb coordination in hNF-L(E397K). Exacerbation of neuropathy after injury and identification of gait alterations in combination with previously described pathology suggests that hNF-L(E397K) mice recapitulate many of clinical signs associated with CMT2. Therefore, hNF-L(E397K) mice provide a model for determining the efficacy of novel therapies. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Vaccination studies in type 1 diabetes

    Czech Academy of Sciences Publication Activity Database

    Buschard, K.; Funda, David P.

    2002-01-01

    Roč. 360, - (2002), s. 488-489 ISSN 0140-6736 Institutional research plan: CEZ:AV0Z5020903 Keywords : vaccination * diabetes Subject RIV: EE - Microbiology, Virology Impact factor: 15.397, year: 2002

  10. EROS MSI IMAGES WITH GEOMETRY BACKPLANES

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains data products for 93,397 images obtained by the Multi-Spectral Imager (MSI) of the Near Earth Asteroid Rendezvous (NEAR) mission during the...

  11. "Our Song!" Nationalism in Folk Music Research and Revival in Socialist Czechoslovakia

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2015-01-01

    Roč. 56, č. 4 (2015), s. 397-405 ISSN 1788-6244 Institutional support: RVO:68378076 Keywords : Czechoslovakia * folk music * folk song collections * revival * politics * nationalism * communism Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Crossword. Articles in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 397-400 Crossword. Crossword · Shobhana Narasimhan · More Details Abstract Fulltext PDF ...

  13. Modulární laboratorní fluorová linka v ÚOCHB AV ČR

    Czech Academy of Sciences Publication Activity Database

    Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef

    2014-01-01

    Roč. 108, č. 4 (2014), s. 394-397 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  14. 30 CFR 77.403-1 - Mobile equipment; rollover protective structures (ROPS).

    Science.gov (United States)

    2010-07-01

    ... WORK AREAS OF UNDERGROUND COAL MINES Safeguards for Mechanical Equipment § 77.403-1 Mobile equipment... professional engineer that: (1) The ROPS complies with the Society of Automotive Engineers (SAE) Standard J 397...

  15. 75 FR 42449 - National Cancer Institute; Notice of Meeting

    Science.gov (United States)

    2010-07-21

    ... Research Programs and Updates of the Implementation of the Clinical Trials and Translational Research....395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93...

  16. Effect of soil moisture on root-associated fungal communities of Erica dominans in Drakensberg mountains in South Africa

    Czech Academy of Sciences Publication Activity Database

    Kohout, Petr; Tedersoo, L.

    2017-01-01

    Roč. 27, č. 4 (2017), s. 397-406 ISSN 0940-6360 Institutional support: RVO:67985939 Keywords : mycorrhiza * ecology * fungi Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.047, year: 2016

  17. The grandparent - grandchild relationship in childhood and adulthood: A matter of continuation?

    NARCIS (Netherlands)

    Geurts, T.; van Tilburg, T.G.; Poortman, A.R.

    2012-01-01

    This study examined whether grandparents perceive adult grandchildren as frequent and important contacts by analyzing network membership. It additionally examined whether this network membership is related to relationship intensity during childhood. Network membership was assessed in 1992 (397

  18. WT1 expression in peripheral leukocytes of patients with chronic myeloid leukemia serves for the prediction of Imatinib resistance

    Czech Academy of Sciences Publication Activity Database

    Otahalová, E.; Ullmannová-Benson, Veronika; Klamová, H.; Haškovec, C.

    2009-01-01

    Roč. 56, č. 5 (2009), s. 393-397 ISSN 0028-2685 Institutional research plan: CEZ:AV0Z50200510 Keywords : Imatinib * drug resistance * cml Subject RIV: EC - Immunology Impact factor: 1.192, year: 2009

  19. Disease: H00797 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available onadism in sibs: Martsolf's syndrome. ... JOURNAL ... J Med Genet 26:397-400 (1989) DOI...738902 (description) ... AUTHORS ... Harbord MG, Baraitser M, Wilson J ... TITLE ... Microcephaly, mental retardation, cataracts, and hypog

  20. 76 FR 50176 - Certain Orange Juice from Brazil: Final Results of Antidumping Duty Administrative Review...

    Science.gov (United States)

    2011-08-12

    ...., Florida Citrus Mutual and Citrus World Inc.), Cutrale, and Fischer S.A. Comercio, Industria, and...: Manufacturer/exporter Percent margin Coinbra-Frutesp (SA) * Fischer S.A. Comercio, Industria, and 3.97...

  1. Thermodynamic properties of solubility of 2-methyl-5-arylfuran-3-carboxylic acids in organic solvents

    Czech Academy of Sciences Publication Activity Database

    Sobechko, I.; Dibrivnyi, V.; Horak, Y.; Velychkivska, Nadiia; Kochubei, V.; Obushak, M.

    2017-01-01

    Roč. 11, č. 4 (2017), s. 397-404 ISSN 1996-4196 Institutional support: RVO:61389013 Keywords : enthalpy * entropy * Gibbs energy of solubility Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science

  2. Rozptýlení jako předpoklad soustředění: poznámky k pojetí recepce u Waltera Benjamina

    Czech Academy of Sciences Publication Activity Database

    Dvořák, Tomáš

    2003-01-01

    Roč. 15, č. 4 (2003), s. 67-84 ISSN 0862-397X Institutional research plan: CEZ:AV0Z9009908 Keywords : Walter Benjamin * distraction * concentration * media reception Subject RIV: AA - Philosophy ; Religion

  3. Jazyková komunikace a hodnotová atmosféra

    Czech Academy of Sciences Publication Activity Database

    Tondl, Ladislav

    2015-01-01

    Roč. 37, č. 4 (2015), s. 389-397 ISSN 1210-0250 Institutional support: RVO:67985955 Keywords : language * communication * value s * decision-making Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0260371

  4. New technologies for submillimeter laser ranging

    Czech Academy of Sciences Publication Activity Database

    Blažek, J.; Procházka, I.; Kodet, J.; Pánek, Petr

    -, 301-303 (2011), s. 397-401 ISSN 1662-8985 Institutional research plan: CEZ:AV0Z20670512 Keywords : time measurement * laser ranging Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  5. Mesozoic and Tertiary Anura of Laurasia

    Czech Academy of Sciences Publication Activity Database

    Roček, Zbyněk

    2013-01-01

    Roč. 93, č. 4 (2013), s. 397-439 ISSN 1867-1594 Institutional support: RVO:67985831 Keywords : Anura * Laurasia * taxonomic diagnoses * systematic review * stratigraphy * distribution Subject RIV: EG - Zoology

  6. Book Review: Africa and Europe in the Twenty-First Century ...

    African Journals Online (AJOL)

    Abstract. Title: Africa and Europe in the Twenty-First Century. Author: Osita C. Eze and Amadu Sesay. Publisher: Nigerian Institute of International Affairs, 2010, xvi + 397pp, Tables, Index. ISBN: 978-002-102-7 ...

  7. Expression of focal adhesion kinase in uveal melanoma and the effects of Hsp90 inhibition by 17-AAG.

    Science.gov (United States)

    Faingold, Dana; Filho, Vasco Bravo; Fernandes, Bruno; Jagan, Lisa; de Barros, Alexandre M; Orellana, Maria Eugenia; Antecka, Emilia; Burnier, Miguel N

    2014-11-01

    Focal adhesion kinase (FAK) is implicated in tumor progression and metastatic cascade, and has been shown to be overexpressed in a variety of human cancers. However, the role of FAK in human uveal melanoma (UM) is not well defined. The purpose of this study was to evaluate the expression of FAK in UM tumors and normal eyes, and to determine the effect of Hsp90 inhibition on FAK expression in UM cells. FAK expression was assessed in 39 UM specimens, FAK[pY397] expression was assessed in 51 UM specimens, and both FAK and FAK[pY397] expression were assessed in 20 normal eyes. The expression of FAK and FAK[pY397] was detected by Western blot in five UM cell lines after treatment with 10 μmol/L of 17-AAG. FAK was positive in 87.2% and FAK[pY397] in 90% of UM specimens. Low FAK expression was detected in non-tumor structures and in normal eyes. The cell lines with the most proliferative, invasive phenotype (92.1, SP6.5 and MKT-BR) displayed high expression of FAK[pY397], and the levels of FAK and FAK[pY397] were decreased in the presence of 17-AAG starting with 24 h of exposure. FAK and FAK[pY397] were overexpressed in human UM tumors compared to normal ocular tissue and high levels of FAK[pY397] were seen in the most aggressive UM cell lines. Hsp90 inhibition led to downregulation of FAK expression. We propose a role for FAK in the pathogenesis of UM. Future studies are needed to explore the use of Hsp90 inhibitors as a feasible approach for modulating FAK in UM. Copyright © 2014 Elsevier GmbH. All rights reserved.

  8. Impact of demographic factors on management competencies of the municipal sport

    Directory of Open Access Journals (Sweden)

    Tripolitsioti Alexandra

    2016-04-01

    Full Text Available The purpose of this study was to define the competencies required for the administration of the sports facilities, of the municipal sport organizations and to compare them with selected variables, such as age, educational level, type of degree and years of employment. In the study participated 401 sport’s facilities managers, of the Municipal sport organizations of the country. They answered in a questionnaire designed for the study purposes, which was sent to them postal. The Multivariate Analysis of Variance (MANOVA between age, educational level, type of degree and years of employment revealed that: a there were statistically significant differences between the different age groups for the facility management factor (F(3, 397= 4.947, p< 0.002 and governance factor (F(3, 397= 3.170, p< 0.024, b there were statistically significant differences between the PhD holders, the Master holders, the Higher Education graduates or any other title for the event management factor (F(3, 397= 3.073, p< 0.028 and first aid/crisis management factor (F(3, 397= 4.311, p< 0.005, c there were statistically significant differences between the different titles for the first aid- crisis management factor (F(3, 397= 10.264, p< 0.000 and governance factor (F(3, 397= 4.104, p< 0.007 and d there were statistically significant differences between the total years of employment for the first aid-crisis management factor (F(3, 397= 6.869, p< 0.000 and governance factor (F(3, 397= 3.779, p< 0.011. It is concluded that the competency factors of the Sport’s Facilities managers of the municipal sport organizations are affected by the age, the educational level, the type of degree and the years of employment.

  9. A role for focal adhesion kinase in facilitating the contractile responses of murine gastric fundus smooth muscles.

    Science.gov (United States)

    Xie, Yeming; Han, Koon Hee; Grainger, Nathan; Li, Wen; Corrigan, Robert D; Perrino, Brian A

    2018-03-12

    Smooth muscle contraction involves regulating myosin light chain phosphorylation and dephosphorylation by myosin light chain kinase and myosin light chain phosphatase. CPI-17 and MYPT1 are crucial for regulating gastrointestinal smooth muscle contraction by inhibiting myosin light chain phosphatase. Integrin signalling involves the dynamic recruitment of several proteins, including FAK, to focal adhesions. FAK tyrosine kinase activation is involved in cell adhesion to the extracellular matrix via integrin signalling. FAK participates in linking the force generated by myofilament activation to the extracellular matrix and throughout the smooth muscle tissue. Here, we show that cholinergic stimulation activates FAK in gastric fundus smooth muscles. Electrical field stimulation in the presence of L-NAME and MRS2500 contracted gastric fundus smooth muscle strips and increased FAK Y397 phosphorylation (pY397). Atropine blocked the contractions and prevented the increase in pY397. The FAK inhibitor PF-431396 inhibited the contractions and the increase in pY397. PF-431396 also inhibited the EFS-induced increase in CPI-17 T38 phosphorylation, and reduced MYPT1 T696 and T853, and myosin light chain S19 phosphorylation. Ca 2+ influx was unaffected by PF-431396. Nicardipine inhibited the contractions but had no effect on the increase in pY397. PDBu or calyculin A contracted gastric fundus smooth muscle strips Ca 2+ independently and increased pY397. Our findings suggest that FAK is activated by mechanical forces during contraction, and reveal a novel role of FAK in the regulation of CPI-17 phosphorylation. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  10. Big Five Personality Traits as the Predictor of Teachers' Organizational Psychological Capital

    Science.gov (United States)

    Bozgeyikli, Hasan

    2017-01-01

    The method of the research was defined as the descriptive survey model since it was aimed to test whether the personality traits of teachers are a significant predictor of their psychological capital levels in this study. 416 teachers (60.3% female, 39.7% male) who were teaching in the schools of Ministry of National Education in Istanbul and were…

  11. Common variants at the CHEK2 gene locus and risk of epithelial ovarian cancer

    DEFF Research Database (Denmark)

    Lawrenson, Kate; Iversen, Edwin S; Tyrer, Jonathan

    2015-01-01

    genes and EOC risk. We genotyped 2896 common variants at 143 gene loci in DNA samples from 15 397 patients with invasive EOC and controls. We found evidence of associations with EOC risk for variants at FANCA, EXO1, E2F4, E2F2, CREB5 and CHEK2 genes (P ≤ 0.001). The strongest risk association...

  12. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 397-405. Electromagnetic energy harvester for harvesting acoustic energy · FARID U KHAN IZHAR · More Details Abstract Fulltext PDF. This paper reports a suspended coil, electromagnetic acoustic energy harvester (AEH) for extracting acoustical energy. The developed AEH comprises Helmholtz resonator (HR), ...

  13. High performance p-type segmented leg of misfit-layered cobaltite and half-Heusler alloy

    DEFF Research Database (Denmark)

    Le, Thanh Hung; Van Nong, Ngo; Snyder, Gerald Jeffrey

    2015-01-01

    %, which is about 65% of that expected from the materials without parasitic losses. The long-term stability investigation for two weeks at the hot and cold side temperatures of 1153/397 K shows that the segmented leg has good durability as a result of stable and low electrical resistance contacts. 2015...

  14. Factors Influencing Pop Music Preferences of Young Persons.

    Science.gov (United States)

    Boyle, J. David; And Others

    1981-01-01

    Examined and compared self-reported reasons for pop music preferences of 397 students in grades five, seven, nine, eleven, and college. Results revealed that characteristics such as melody, mood, rhythm, and lyrics were the most important reasons for selection. Differences in response by age and background characteristics were noted. (Author/SJL)

  15. Transforming bases to bytes: Molecular computing with DNA

    Indian Academy of Sciences (India)

    Despite the popular image of silicon-based computers for computation, an embryonic field of mole- cular computation is emerging, where molecules in solution perform computational ..... [4] Mao C, Sun W, Shen Z and Seeman N C 1999. A nanomechanical device based on the B-Z transition of DNA; Nature 397 144–146.

  16. X-ray diffuse scattering in SrTiO.sub.3./sub. and model of atomic displacements

    Czech Academy of Sciences Publication Activity Database

    Kopecký, Miloš; Fábry, Jan; Kub, Jiří

    2012-01-01

    Roč. 45, č. 3 (2012), s. 393-397 ISSN 0021-8898 R&D Projects: GA AV ČR IAA100100915 Institutional research plan: CEZ:AV0Z10100520 Keywords : diffuse scattering * SrTiO 3 * perovskites * synchrotron radiation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.343, year: 2012

  17. Knowledge, perception and attitude of infertile women in Benin City ...

    African Journals Online (AJOL)

    With increasing utilization of Assisted Reproduction Technology (ART) in Nigeria, it is important to document views and feelings of the infertile couple to ART service in a public funded hospital. ... RESULT: More of the respondents(62.5%) knew of the female causes of infertility than those (39.7%) who knew male causes.

  18. The Role of Cysteine Residues in Catalysis of Phosphoenolpyruvate Carboxykinase from Mycobacterium tuberculosis.

    Directory of Open Access Journals (Sweden)

    Iva Machová

    Full Text Available Mycobacterium tuberculosis (MTb, the causative agent of tuberculosis, can persist in macrophages for decades, maintaining its basic metabolic activities. Phosphoenolpyruvate carboxykinase (Pck; EC 4.1.1.32 is a key player in central carbon metabolism regulation. In replicating MTb, Pck is associated with gluconeogenesis, but in non-replicating MTb, it also catalyzes the reverse anaplerotic reaction. Here, we explored the role of selected cysteine residues in function of MTb Pck under different redox conditions. Using mass spectrometry analysis we confirmed formation of S-S bridge between cysteines C391 and C397 localized in the C-terminal subdomain. Molecular dynamics simulations of C391-C397 bridged model indicated local conformation changes needed for formation of the disulfide. Further, we used circular dichroism and Raman spectroscopy to analyze the influence of C391 and C397 mutations on Pck secondary and tertiary structures, and on enzyme activity and specificity. We demonstrate the regulatory role of C391 and C397 that form the S-S bridge and in the reduced form stabilize Pck tertiary structure and conformation for gluconeogenic and anaplerotic reactions.

  19. 75 FR 14172 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-03-24

    ... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed Meetings... Emphasis Panel, Nucleic Acid Analysis for the Molecular Characterization of Cancer. Date: April 6, 2010... Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research Manpower; 93.399, Cancer Control...

  20. 75 FR 79010 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-12-17

    ... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed Meetings... Cancer Institute Special Emphasis Panel. Development of Devices for Point of Care Analysis of Circulating... Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research Manpower; 93.399, Cancer Control...

  1. Characterization and Pathogenesis of Aerosolized Eastern Equine Encephalitis in the Common Marmoset (Callithrix jacchus)

    Science.gov (United States)

    2016-08-10

    surgically implanted with a subcutaneous 144 Data Sciences International (DSI) (St. Paul , MN) radiotelemetry device (TA-F40) to monitor 145 body...Min, Z. 2014. Mosquito bites and eastern equine encephalitis. Q. J. Med. 107, 397–398. 597 doi:10.1093/qjmed/hct168. 598 Nathanson , N., Stolley

  2. Production of Non-Canonical Sentences in Agrammatic Aphasia: Limits in Representation or Rule Application?

    Science.gov (United States)

    Burchert, Frank; Meissner, Nadine; De Bleser, Ria

    2008-01-01

    The study reported here compares two linguistically informed hypotheses on agrammatic sentence production, the TPH [Friedmann, N., & Grodzinsky, Y. (1997). "Tense and agreement in agrammatic production: Pruning the syntactic tree." "Brain and Language," 56, 397-425.] and the DOP [Bastiaanse, R., & van Zonneveld, R. (2005). "Sentence production…

  3. The Nature of Developmental Dyslexia in a Transparent Orthography

    Science.gov (United States)

    Verhoeven, Ludo; Keuning, Jos

    2018-01-01

    The present study aimed to explore the nature of developmental dyslexia in a language considered to have a transparent orthography, namely, Dutch. We assessed the accuracy and efficiency of decoding words and pseudowords with four lengths as well as three types of phonological ability in 2,760 typical children and 397 peers with dyslexia across…

  4. 77 FR 71104 - Determination of Reasonable Rates and Terms for Noncommercial Broadcasting

    Science.gov (United States)

    2012-11-29

    ..., Composers and Publishers (``ASCAP''); SESAC, Inc.; Broadcast Music, Inc. (``BMI''); Educational Media... December 31, 2017. FOR FURTHER INFORMATION CONTACT: LaKeshia Keys, Program Specialist, by telephone at (202... entity'' is defined as a ``noncommercial educational broadcast station as defined in section 397 of title...

  5. Electronic Reverse Auctions in the Federal Government

    Science.gov (United States)

    2007-12-01

    FedBid uses is the English-Vickrey internet auction surrogate bidding solution. FedBid provides an “ Auto Re-Bid” mechanism for proxy bidding. This...Supplies $1,397,181 54 83—Textiles, Leather, Furs, Apparel and Shoe Findings, Tents and Flags $1,091,170 67 84—Clothing, Individual Equipment, and Insignia

  6. The Ethos of Post-Normal Science

    DEFF Research Database (Denmark)

    Kønig, Nicolas; Børsen, Tom; Emmeche, Claus

    2017-01-01

    The norms and values of Post-Normal Science (PNS) are instrumental in guiding science advice practices. In this article, we report work in progress to systematically investigate the norms and values of PNS through a structured review. Anarchive of 397 documents was collected, including documents...

  7. All projects related to | Page 139 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: AFRICA SOUTH OF SAHARA, HIV, Disease control, WOMEN'S HEALTH, YOUTH, Poverty alleviation, GENDER ANALYSIS, COMPARATIVE ANALYSIS. Region: Botswana, Swaziland. Program: Maternal and Child Health. Total Funding: CA$ 2,397,500.00. Using Community Land Rights to Build Local Governance ...

  8. 78 FR 41424 - Audits of States, Local Governments, and Non-Profit Organizations; OMB Circular A-133 Compliance...

    Science.gov (United States)

    2013-07-10

    ... be sent through http://www.regulations.gov --a Federal E-Government Web site that allows the public... OFFICE OF MANAGEMENT AND BUDGET Audits of States, Local Governments, and Non-Profit Organizations... Stabilization Fund) CFDA 84.397--State Fiscal Stabilization Fund (SFSF)--Government Services, Recovery Act CFDA...

  9. Piezoelectric PZT thin films on flexible copper-coated polymer films

    Czech Academy of Sciences Publication Activity Database

    Suchaneck, G.; Volkonskiy, O.; Gerlach, G.; Hubička, Zdeněk; Dejneka, Alexandr; Jastrabík, Lubomír; Kiselev, D.; Bdikin, I.; Kholkin, A.

    636/637, - (2010), s. 392-397 ISSN 0255-5476 R&D Projects: GA ČR GC202/09/J017; GA AV ČR KJB100100703 Institutional research plan: CEZ:AV0Z10100522 Keywords : plasma jet deposition * PZT * kapton® film substrate * piezoresponse force microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism

  10. Metal nano-film resistivity chemical sensor

    Czech Academy of Sciences Publication Activity Database

    Podešva, Pavel; Foret, František

    2016-01-01

    Roč. 37, č. 3 (2016), s. 392-397 ISSN 0173-0835 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : adsorption * chemiresistor * nano- film * thiol binding * thiol sensing Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.744, year: 2016

  11. Spontaneous recovery of an intensively used grassland after cessation of fertilizing

    Czech Academy of Sciences Publication Activity Database

    Královec, J.; Pocová, L.; Jonášová, Magda; Macek, Petr; Prach, Karel

    2009-01-01

    Roč. 12, č. 4 (2009), s. 391-397 ISSN 1402-2001 R&D Projects: GA AV ČR IAA600050702 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z60050516 Keywords : Long-term experiment * Nitrogen fertilization * Ordination * Restoration * Species richness Subject RIV: EF - Botanics Impact factor: 1.349, year: 2009

  12. Recovery of tubulin functions after freeze-dying in the presence of trehalose

    Czech Academy of Sciences Publication Activity Database

    Dráberová, Eduarda; Sulimenko, Vadym; Sulimenko, Tetyana; Böhm, K. J.; Dráber, Pavel

    2010-01-01

    Roč. 397, č. 1 (2010), s. 67-72 ISSN 0003-2697 R&D Projects: GA AV ČR KAN200520701; GA MŠk LC545 Institutional research plan: CEZ:AV0Z50520514 Keywords : Tubulin * Freeze-drying * Stability Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.236, year: 2010

  13. Self-adaptation in Software-intensive Cyber-physical Systems: From System Goals to Architecture Configurations

    Czech Academy of Sciences Publication Activity Database

    Gerostathopoulos, I.; Bureš, Tomáš; Hnětynka, P.; Keznikl, Jaroslav; Kit, M.; Plášil, F.; Plouzeau, N.

    2016-01-01

    Roč. 122, December (2016), s. 378-397 ISSN 0164-1212 Grant - others:GA MŠk(CZ) LD15051 Institutional support: RVO:67985807 Keywords : cyber–physical systems * self -adaptivity * dependability Subject RIV: JC - Computer Hardware ; Software Impact factor: 2.444, year: 2016

  14. Insight into the genetics of hypertension, a core component of the metabolic syndrome

    Czech Academy of Sciences Publication Activity Database

    Pravenec, Michal; Petretto, E.

    2008-01-01

    Roč. 11, - (2008), s. 393-397 ISSN 1363-1950 Grant - others:HHMI(US) 55005624; EURATOOLS(XE) LSHG-CT-2005-019015 Institutional research plan: CEZ:AV0Z50110509 Keywords : genetics * hypertension * genome-wide association studies Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.690, year: 2008

  15. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. KASINATH OJHA. Articles written in Journal of Chemical Sciences. Volume 129 Issue 3 March 2017 pp 397-404 Regular Article. Biomass derived graphene-like activated and non-activated porous carbon for advanced supercapacitors · KASINATH OJHA BHARAT KUMAR ...

  16. A Meta-Analytic Review of Moral Licensing

    NARCIS (Netherlands)

    Blanken, Irene; van de Ven, Niels; Zeelenberg, Marcel

    2015-01-01

    Moral licensing refers to the effect that when people initially behave in a moral way, they are later more likely to display behaviors that are immoral, unethical, or otherwise problematic. We provide a state-of-the-art overview of moral licensing by conducting a meta-analysis of 91 studies (7,397

  17. A meta-analytic review of moral licensing

    NARCIS (Netherlands)

    Blanken, I.; van de Ven, N.; Zeelenberg, M.

    2015-01-01

    Moral licensing refers to the effect that when people initially behave in a moral way, they are later more likely to display behaviors that are immoral, unethical, or otherwise problematic. We provide a state-of-the-art overview of moral licensing by conducting a meta-analysis of 91 studies (7,397

  18. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 313-317. On the Dimension of Chowla–Milnor Space · Tapas Chatterjee .... Isometric Coactions of Compact Quantum Groups on Compact Quantum Metric Spaces · Johan Quaegebeur Marie ... pp 385-397. On the Mean Curvature of Semi-Riemannian Graphs in Semi-Riemannian Warped Products · Zonglao Zhang.

  19. The Trace Fossil Chondrites in Uppermost Jurasic-Lower Cretaceous Deep Cavity Fills from the Western Carpathians, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Uchman, A.; Mikuláš, Radek; Houša, Václav

    2003-01-01

    Roč. 54, č. 3 (2003), s. 1-7 ISSN 1335-0552 R&D Projects: GA ČR GA205/00/0118 Institutional research plan: CEZ:AV0Z3013912 Keywords : jurassic * Cretaceous * trace fossils Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Mihaly Mezei. Articles written in Journal of Biosciences. Volume 37 Issue 3 July 2012 pp 379-397 Articles. The ABCs of molecular dynamics simulations on B-DNA, circa 2012 · David L Beveridge Thomas E Cheatham III Mihaly Mezei · More Details Abstract Fulltext PDF. This article ...

  1. Oribatid mites (Acari: Oribatida) in casts and burrows of an endemic earthworm .i.Dendrobaena mrazeki./i. and in litter of thermophilous oak forests

    Czech Academy of Sciences Publication Activity Database

    Starý, Josef; Pižl, Václav

    2007-01-01

    Roč. 26, č. 4 (2007), s. 390-397 ISSN 1335-342X R&D Projects: GA ČR GA206/03/0056 Institutional research plan: CEZ:AV0Z60660521 Keywords : soil oribatid mites * earthworms * casts and burrows Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

  2. Primary structure of the plant serpin BSZ7 having the capacity of chymotrypsin inhibition

    DEFF Research Database (Denmark)

    Rasmussen, Søren K; Klausen, Janne; Hejgaard, Jørn

    1996-01-01

    The primary structure of barley grain serpin BSZ7 was deduced from a cDNA encoding 397 amino-acid residues. More than 70% of the residues were confirmed by sequencing peptide fragments. The N-terminus was identified as an acetylated Ala by using mass spectrometry coupled with amino-acid analysis...

  3. Disease: H00223 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ics, epidemiology, and laboratory evaluation. ... JOURNAL ... Best Pract Res Clin Obstet Gynaecol 17:397-411 (2003) DOI:10.1016/S1521-6934(03)00010-5 ... ...:12787534 ... AUTHORS ... Buchanan GS, Rodgers GM, Ware Branch D ... TITLE ... The inherited thrombophilias: genet

  4. Assessment of undiscovered oil and gas resources of Libya and Tunisia, 2010

    Science.gov (United States)

    Whidden, Katherine J.; Lewan, Michael; Schenk, Christopher J.; Charpentier, Rondald R.; Cook, Troy A.; Klett, Timothy R.; Pitman, Janet K.

    2011-01-01

    Using a geology-based assessment methodology, the U.S. Geological Survey estimated means of 3.97 billion barrels of undiscovered oil, 38.5 trillion cubic feet of undiscovered natural gas, and 1.47 billion barrels of undiscovered natural gas liquids in two provinces of North Africa.

  5. Natural History of Chronic Kidney Disease Stages 2-4 | Yousi | Arab ...

    African Journals Online (AJOL)

    Results: Males constituted 57.7% of the study population, one third of patients were older than 65 years of age, 93% were white and 39.7% were diabetic. The study showed that 52.7% of patients had a progressive course of CKD. Gender, old age, ethnicity and diabetic status were not significantly different between ...

  6. Psychiatric Morbidity, Violent Crime, and Suicide among Children and Adolescents Exposed to Parental Death

    Science.gov (United States)

    Wilcox, Holly C.; Kuramoto, Satoko J.; Lichtenstein, Paul; Langstrom, Niklas; Brent, David A.; Runeson, Bo

    2010-01-01

    Objective: This retrospective cohort study examined the risk for suicide, psychiatric hospitalization, and violent criminal convictions among offspring of parents who died from suicide, accidents, and other causes. Method: Population-based data from multiple Swedish national registers were linked from 1969 to 2004. Participants were 44,397

  7. Developmental Trajectories in Adolescents and Adults With Autism: The Case of Daily Living Skills

    Science.gov (United States)

    Smith, Leann E.; Maenner, Matthew J.; Seltzer, Marsha Mailick

    2012-01-01

    Objective: This study aimed to investigate the longitudinal course of daily living skills in a large, community-based sample of adolescents and adults with autism spectrum disorders (ASD) over a 10-year period. Method: Adolescents and adults with ASD (n = 397) were drawn from an ongoing, longitudinal study of individuals with ASD and their…

  8. My Time with Sir Rudolf Peierls

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 5. My Time with Sir Rudolf Peierls. R K Bhaduri. Article-in-a-Box Volume 15 Issue 5 May 2010 pp 394-397. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/015/05/0394-0397. Author Affiliations.

  9. Independent particle model of spontaneous symmetry breaking in planar pi-electron systems

    Czech Academy of Sciences Publication Activity Database

    Thiamová, Gabriela; Paldus, J.

    2008-01-01

    Roč. 46, č. 3 (2008), s. 453-461 ISSN 1434-6060 Institutional research plan: CEZ:AV0Z10480505 Keywords : DENSITY-FUNCTIONAL THEORY * HARTREE - FOCK EQUATIONS * STABILITY CONDITIONS * MOLECULAR SYSTEMS Subject RIV: BE - Theoretical Physics Impact factor: 1.397, year: 2008

  10. 32 CFR 716.7 - Payment of the death gratuity.

    Science.gov (United States)

    2010-07-01

    ... certification and voucher for the death gratuity payment. The Comptroller General of the United States has... Certification and Voucher for Death Gratuity Payment, DD Form 397, in original and five copies, completing... 32 National Defense 5 2010-07-01 2010-07-01 false Payment of the death gratuity. 716.7 Section 716...

  11. Neonatal Sepsis: past, present and future; a review article | Tripathi ...

    African Journals Online (AJOL)

    Sepsis is the most common cause of neonatal mortality. As per National Neonatal Perinatal Database (NNPD) 2002-2003, the incidence of neonatal sepsis in India was 30 per 1000 live birth. It is 3% among intramural babies and 39.7% among extramural admissions. The early manifestations of neonatal sepsis are vague ...

  12. WEST AFRICAN JOURNAL OF MEDICINE

    African Journals Online (AJOL)

    user1

    swelling was associated with clinical features of heart failure. ... The heart failure and menstrual irregularities responded to l-thyroxine therapy. ..... M, et al. Pericardial effusion as a sign of acquired hypothyroidism in children with Down syndrome. Euro J Pediatr. 1993; 152: 397–8. 7. Said S, Droste H, Derks S, Fast J. Down.

  13. The Relationship between Age of Post-Graduate Adult Learning Students and Learning Style Preferences: A Case of Africa International University, Kenya

    Science.gov (United States)

    Ngala, Francisca Wavinya

    2017-01-01

    This paper sought to examine the relationship between age and learning preferences of post- graduate students at Africa International University (AIU). The study employed a descriptive survey design which used cross-sectional approach to data collection. The population of the study consisted of all the 397 post-graduate students at Africa…

  14. Parental background and other-regarding preferences in children

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Chytilová, J.; Pertold-Gebicka, B.

    2014-01-01

    Roč. 17, č. 1 (2014), s. 24-46 ISSN 1386-4157 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : other-regarding preferences * altruism * selfishness Subject RIV: AH - Economics Impact factor: 1.397, year: 2014

  15. a worldwide assessment of medical journal editors' practices and ...

    African Journals Online (AJOL)

    widely reported by medical journal editors throughout the world, although specific practices varied widely. Half of the responding editors reported having access to the Internet, making participation in a worldwide computer network of editors feasible. sAIr Med J1999; 89: 397-401. Project HOPE CenterJor Health Affairs, ...

  16. Empirická sociologie filmu v Československu do roku 1989

    Czech Academy of Sciences Publication Activity Database

    Čížek, Tomáš

    2010-01-01

    Roč. 23, č. 4 (2010), s. 91-105 ISSN 0862-397X R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : cultural consumption * cinema attendance * cultural capital Subject RIV: AL - Art, Architecture, Cultural Heritage

  17. CPAP Tips

    Medline Plus

    Full Text Available ... my first night using a CPAP machine - Duration: 9:28. Heidi Willbanks 397,785 views 9:28 How to solve nasal congestion when using ... How to Cure it by Natural Exercises - Duration: 9:14. MotivationCoach 313,727 views 9:14 Airing: ...

  18. South African Journal of Agricultural Extension - Vol 45, No 2 (2017)

    African Journals Online (AJOL)

    A bench mark survey for extension officers in three districts of Limpopo Province, South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E.M. Zwane, P.K. Chauke, C Igodan, R Agunga, 14-25. http://dx.doi.org/10.17159/2413-3221/2017/v45n2a397 ...

  19. Functional groups of fossil marattialeans: chemotaxonomic implications for Pennsylvanian tree ferns and pteridophylls

    Czech Academy of Sciences Publication Activity Database

    Pšenička, J.; Zodrow, E. L.; Mastalerz, M.; Bek, Jiří

    2005-01-01

    Roč. 61, 3-4 (2005), s. 259-280 ISSN 0166-5162 R&D Projects: GA AV ČR(CZ) IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : interdisciplinary approach * functional groups * FTIR Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.397, year: 2005

  20. Genetic diversity in rhizobial isolates determined by RAPDs

    African Journals Online (AJOL)

    STORAGESEVER

    2009-06-17

    Jun 17, 2009 ... Methylobacteria are capable of synthesizing auxins. Microbiol. 70: 392-397. Jaccard P (1912). The distribution of the flora in the alpine zone. New phytol. 11: 37-50. Jordan DK and Allen DN (1994). Genus II Rhizobium. In: Bergey's. Manual of Informative Bacteriology 18th Edn. The Williams and. Wilkins Co.

  1. Aged mice have increased inflammatory monocyte concentration ...

    Indian Academy of Sciences (India)

    Teissl, et al. 2000; Esch and Stefano 2002). Complications associated with chronic ..... E 2005 Influence of exercise training and age on CD14+ cell- surface expression of toll-like receptor 2 and 4. Brain Behav. Immun. 19 389–397. Sunderkötter C ...

  2. Seasonal diet pattern of non-native tubenose goby (Proterorhinus semilunaris) in the lowland reservoir (Mušov, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Adámek, Z.; Jurajda, Pavel; Prášek, Václav; Sukop, I.

    2010-01-01

    Roč. 397, 02 (2010), s. 1-12 ISSN 1961-9502 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : Gobiidae * food * lowland reservoir * rip-rap bank * the Dyje River Subject RIV: EG - Zoology Impact factor: 0.304, year: 2010

  3. Positive and Negative Affectivity as Mediator and Moderator of the Relationship between Optimism and Life Satisfaction in Turkish University Students

    Science.gov (United States)

    Kapikiran, Necla Acun

    2012-01-01

    The main purpose of this study is to examine the mediator and moderator role of positive and negative affectivity variables on the relationship between optimism and life satisfaction in university students. 397 university students, ranging in age from 18 to 27 (M = 20.98), attending different departments of the Faculty of Education, at Pamukkale…

  4. Wrinkle Creams: Your Guide to Younger Looking Skin

    Science.gov (United States)

    ... Choose products with built-in sunscreen. When selecting skin care products, choose those with a built-in SPF of ... 2011;38:397. How to select anti-aging skin care products. American Academy of Dermatology. http://www.aad.org/ ...

  5. Childhood Acute Glomerulonepbritis in Benin City

    African Journals Online (AJOL)

    2000-12-31

    Dec 31, 2000 ... Haematuria and proteinuria of varying degrees occurred in all the patients, while antecedent infections were noted in 49.2 percent. Complications included congestive cardiac failure (39.7 percent), urinary tract infection (20.6 percent), acute renal failure (12.7 percent), and hypertensive encephalopathy.

  6. Alexandria Bulletin

    African Journals Online (AJOL)

    hsa

    397. Bull. Alex. Fac. Med. 46 No.4, 2010. © 2010 Alexandria Faculty of Medicine. Adiponectin: A Differential Marker. Between Steatosis And Steatohepatitis. 1Hoda Aly Abd El Moety, 2Dalia Aly Maharem, 3Marwa El Gandour,. 4Amr Aly Abd El Moety. 1,3Chemical pathology, Medical Research Institute,2 Internal medicine, ...

  7. Modeling the active site of [FeFe]-hydrogenase: Electro-catalytic ...

    Indian Academy of Sciences (India)

    iron-free water for 10 min. The reference electrode was an Ag/AgCl and the auxiliary electrode was a platinum wire. The potentials, reported here, are ...... Cammack R 1999Nature 397 214; Nicolet Y, Lemon B. J, Fontecilla-Camps J C and Peters J W 2000 Trends. Biochem. Sci. 25 138; Darensbourg M Y, Lyon E J, Zhao.

  8. Understanding quantum scattering properties in terms of purely classical dynamics: Two-dimensional open chaotic billiards

    Czech Academy of Sciences Publication Activity Database

    Méndez-Bermúdez, J. A.; Luna-Acosta, G. A.; Šeba, Petr; Pichugin, K. N.

    2002-01-01

    Roč. 66, č. 4 (2002), 046207/1-046207/7 ISSN 1063-651X Grant - others:CONACyT(MX) 26163-E Institutional research plan: CEZ:AV0Z1010914 Keywords : quantum transport * resonance Subject RIV: BE - Theoretical Physics Impact factor: 2.397, year: 2002

  9. Classical versus quantum structure of the scattering probability matrix: Chaotic waveguides

    Czech Academy of Sciences Publication Activity Database

    Luna-Acosta, G. A.; Méndez-Bermúdez, J. A.; Šeba, Petr; Pichugin, K. N.

    2002-01-01

    Roč. 65, č. 4 (2002), 046605/1-046605/8 ISSN 1063-651X Grant - others:CONACYT(MX) 26163-E Institutional research plan: CEZ:AV0Z1010914 Keywords : scattering matrix * waveguids Subject RIV: BE - Theoretical Physics Impact factor: 2.397, year: 2002

  10. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 2. Issue front cover thumbnail. Volume 96, Issue 2. June 2017, pages 213-397. pp 213-218 RESEARCH ARTICLE. Isolation and characterization of microsatellite markers in Garcinia gummi-gutta by next-generation sequencing and cross-species amplification.

  11. Genetic diversity, phylogeographic structure and effect of selection ...

    Indian Academy of Sciences (India)

    Abdulhakeem B. Ajibike

    2017-12-11

    Dec 11, 2017 ... Abstract. In this study, the maternal genetic diversity, phylogenetic relationship and effect of natural selection on indigenous chickens from Nigeria were assessed. A total of 397-bp fragment of the mitochondrial DNA (mtDNA) D-loop region of 171 indigenous chickens from four populations of Nigeria and ...

  12. A Study of the Adequacy of College Students' Vocabulary for Reading the Daily Paper.

    Science.gov (United States)

    Greif, Ivo P.

    A study of the vocabulary adequacy of college students using words from a daily newspaper duplicated an earlier study using words from "Reader's Digest" which indicated a low level of adequacy. Two groups of 295 and 397 college juniors and seniors in teacher education courses indicated on a list of 80 words taken from a daily newspaper which ones…

  13. Design and implementation of participatory hygiene and sanitation ...

    African Journals Online (AJOL)

    EB

    Program and WHO, 1998; 1-7. 8. Katz NA, Chaves A, Pellegrino JA. Simple device for quantitative stool thick smears technique in Schistosmiasis mansoni. Revista do. Instituto de Medicina Tropical de Sao Paul, 1972; 14: 397-400. 9. Morton RF, Hebel JR, McCarter JR. A study guide to Epidemiology and Biostatistics (5thEd.) ...

  14. Child Abuse and Aggression among Seriously Emotionally Disturbed Children

    Science.gov (United States)

    Ford, Julian D.; Fraleigh, Lisa A.; Connor, Daniel F.

    2010-01-01

    Abused children may be at risk for problems with aggression. In a sample of 397 seriously emotionally disturbed children, reactive aggression was associated with documented history of physical abuse but not sexual abuse. Girls were equally likely to be classified as reactively aggressive regardless of physical abuse history, but boys with physical…

  15. Sex and Aggression: The Relationship between Gender and Abuse Experience in Youngsters Referred to Residential Treatment

    Science.gov (United States)

    Doerfler, Leonard A.; Toscano, Peter F., Jr.; Connor, Daniel F.

    2009-01-01

    We examined the relationship of gender and different forms of abuse experience on internalizing symptoms, externalizing symptoms, and IQ in a sample of 397 youngsters who were admitted to a residential treatment program. Three types of abuse experience were examined in this study: sexual abuse only, physical abuse only, and "both" sexual and…

  16. Cutaneous lupus erythematosus

    DEFF Research Database (Denmark)

    Biazar, Cyrus; Sigges, Johanna; Patsinakidis, Nikolaos

    2013-01-01

    ) patients with different subtypes of CLE, such as acute CLE (ACLE, 304 patients), subacute CLE (SCLE, 236 patients), chronic CLE (CCLE, 397 patients), and intermittent CLE (ICLE, 65 patients), from 13 European countries were collected and statistically analyzed by an SPSS database. The main outcome measures...

  17. Characterization of eight Bacillus thuringiensis isolates originated from fecal samples of Fuzhou Zoo and Fuzhou Panda Center

    Czech Academy of Sciences Publication Activity Database

    Wu, Ch.; Wu, L.; Zhang, L.; Gelbič, Ivan; Xu, L.; Guan, X.

    2014-01-01

    Roč. 17, č. 3 (2014), s. 395-397 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * faeces * microscophy Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.946, year: 2014 http://www.sciencedirect.com/science/article/pii/S122686151400034X

  18. Plio-Pleistocene basanitic and melilititic series of the Bohemian Massif: K-Ar ages, major/trace element and Sr–Nd isotopic data

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Ackerman, Lukáš; Balogh, K.; Hegner, E.; Jelínek, E.; Pécskay, Z.; Přichystal, A.; Upton, B. G. J.; Zimák, J.; Foltýnová, R.

    2013-01-01

    Roč. 73, č. 4 (2013), s. 429-450 ISSN 0009-2819 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Plio-Pleistocene * Basanite * Melilitite * K-Ar age * Magmatism * Sr–Nd isotopes Subject RIV: DD - Geochemistry Impact factor: 1.397, year: 2013

  19. Accumulation of soil organic carbon in relation to other soil characteristic during spontaneous succession in non reclaimed colliery spoil heaps after brown coal mining near Sokolov (the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Kalčík, Jiří

    2006-01-01

    Roč. 25, č. 4 (2006), s. 388-397 ISSN 1335-342X R&D Projects: GA AV ČR 1QS600660505 Institutional research plan: CEZ:AV0Z60660521 Keywords : carbon accumulation * succession * soil formation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

  20. Childhood Acute Glomerulonephritis in Benin City | Ibadin | Nigerian ...

    African Journals Online (AJOL)

    , oliguria (47.6 percent) and pulmonary oedema (39.7 percent). Others were headache (11.1 percent) and convulsion (4.8 percent). Haematuria and proteinuria of varying degrees occurred in all the patients, while antecedent infections were ...

  1. Metamorphosed carbonates of Krkonoše Mountains and Paleozoic evolution of Sudetic terranes (NE Bohemia, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Hladil, Jindřich; Patočka, František; Kachlík, V.; Melichar, R.; Hubačík, M.

    2003-01-01

    Roč. 54, č. 5 (2003), s. 281-297 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Institutional research plan: CEZ:AV0Z3013912 Keywords : Cambrium * carbonates * Krkonoše Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  2. Age- and Sex-Dependent Effects of Ethanol on Hippocampal Hemicholinum-3 Sensitive Choline Carriers during Postnatal Development of Rats

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Platilová, V.; Klaschka, Jan

    2003-01-01

    Roč. 28, 3/4 (2003), s. 397-405 ISSN 0364-3190 Institutional research plan: AV0Z1030915 Keywords : ethanol * high-affinity transport * hemicholinium-3 * postnatal development * hippocampus Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.511, year: 2003

  3. Isolation and characterization of a novel native Bacillus thuringiensis strain BRC-HZM2 capable of degrading chlorpyrifos

    Czech Academy of Sciences Publication Activity Database

    Wu, S.; Peng, Y.; Huang, Z.; Huang, Z.; Xu, L.; Gelbič, Ivan; Guan, X.; Zhang, L.; Zou, S.

    2015-01-01

    Roč. 55, č. 3 (2015), s. 389-397 ISSN 0233-111X Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * biopesticide * biodegradation Subject RIV: EE - Microbiology, Virology Impact factor: 1.585, year: 2015 http://onlinelibrary.wiley.com/doi/10.1002/jobm.201300501/epdf

  4. High human immunodeficiency virus incidence in a cohort of Rwandan female sex workers

    NARCIS (Netherlands)

    Braunstein, Sarah L.; Ingabire, Chantal M.; Kestelyn, Evelyne; Uwizera, Aline Umutoni; Mwamarangwe, Lambert; Ntirushwa, Justin; Nash, Denis; Veldhuijzen, Nienke J.; Nel, Annalene; Vyankandondera, Joseph; van de Wijgert, Janneke H. H. M.

    2011-01-01

    Measurement of human immunodeficiency virus(HIV) incidence among female sex workers in Rwanda is a key part of preparing for HIV prevention trials. HIV-negative, nonpregnant female sex workers (N =397) were tested for HIV-1, sexually transmitted infections, and pregnancy quarterly for 12 months, and

  5. Finite element modelling of elastic intraplate stresses due to ...

    Indian Academy of Sciences (India)

    deep seismic sounding data; Tectonophys. 202 375–397. Vlasov A N, Mnushkin M G and Yanovsky Yu G 2000. Object-oriented approach in programming of finite ele- ment method; In: Proc. 3rd. Int. Conf. on Advances of Computer Methods in Geotechnical and Geoenvi- ronmental Engineering (ed.) S A Yufin; pp. 367–372.

  6. Prevalence of biochemical and immunological abnormalities in ...

    African Journals Online (AJOL)

    Tile prevalence of biochemical and immunological abnormalities was studied in a group of 256 patients with rheumatoid arthritis (104 coloureds, 100 whites and 52 blacks). The most common biochemical abnormalities detected were a reduction in the serum creatinine value (43,4%), raised globulins (39,7%), raised serum ...

  7. Work Related Injuries and Associated Factors among Small Scale ...

    African Journals Online (AJOL)

    user

    Table 2: Occupational and behavioral characteristics of the respondents in small scale industries of Mizan-Aman town, Bench Maji zone, Southwest Ethiopia, 2016. Variable. Frequency (N=219). Percent (%). Consume alcohol. Yes. 87. 39.7. No. 132. 60.3. Smoke cigarettes. Yes. 58. 26.5. No. 161. 73.5. Sleeping disorder.

  8. SUBJECT INDEX

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Computing energy budget within a crop canopy from. Penmann's formulae. 179. Age. The Rajahmundry Traps, Andhra Pradesh: Evalu- ation of their petrogenesis relative to the Deccan. Traps. 397. Generation of Deccan Trap magmas. 409. Alkali basalts. Geochemistry and magnetostratigraphy of Deccan flows at Anjar ...

  9. Red luminescence from hydrothermally synthesized Eu-doped ZnO ...

    Indian Academy of Sciences (India)

    Photoluminescence studies show that these nanoparticles exhibit a sharp red luminescence due to the intra-4 transitions of Eu3+ ions at an excitation of 397 nm and 466 nm. Luminescence quenching is observed in the nanoparticles as the Eu-dopant concentration increases. Incorporation of Eu in the nanoparticles was ...

  10. Original Research

    African Journals Online (AJOL)

    Capuchin of propaganda Fide allowed Massaja to build another (Oromo) College in the Oromo country in 1868. As soon as he received the ... Viterbo an Italian scholar published Afaan Oromo grammar in Italian language under the title. Grammatica Della Lingua Oromonica in. Ermanno. The grammar consists of about 397.

  11. Worry as a Predictor of Nutrition Behaviors: Results from a Nationally Representative Survey

    Science.gov (United States)

    Ferrer, Rebecca A.; Bergman, Hannah E.; Klein, William M. P.

    2013-01-01

    Worry has been shown to predict a variety of health behaviors, such as cancer screening, yet there are few studies linking worry and nutrition. This study used nationally representative data from National Cancer Institute's Food Attitudes and Behavior Survey ("n" = 3,397) to examine the association between health-related worry and a variety of…

  12. ORIGINAL ARTICLES

    African Journals Online (AJOL)

    van Staden, BSc (Actuarial Science). January 2001, Vol. 91, o. 1 SAMJ medical aids spent 26% (R397 ... As a result, there has been a rapid growth in the number of ASCs, making them the preferred 'in-facility' (day ... The demands and expectations of the patient. These factors must be taken into account when cost is used.

  13. On the quantization of wave fields⋆

    Science.gov (United States)

    Rosenfeld, L.

    2017-04-01

    Originally published in German "Zur Quantelung der Wellenfelder" in Annalen der Physik 397, 113 (1930). Submitted for publication on March 18, 1930Translated by Donald Salisbury, Max-Planck-Institut für Wissenschaftsgeschichte, Berlin and Austin College, Sherman, TX, USA and Kurt Sundermeyer, Max-Planck-Institut für Wissenschaftsgeschichte, Berlin. DSalisbury@austincollege.edu

  14. Challenges in gluten-free diet in coeliac disease: Prague consensus

    Czech Academy of Sciences Publication Activity Database

    Samasca, G.; Lerner, U.; Girbovan, A.; Sur, G.; Lupan, I.; Makovický, Peter; Matthias, T.; Freeman, H.J.

    2017-01-01

    Roč. 47, č. 5 (2017), s. 394-397 ISSN 0014-2972 Institutional support: RVO:68378050 Keywords : Adult * biomarkers * childhood * diet ary adherence * gluten-free diet * transition Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Nutrition, Diet etics Impact factor: 2.714, year: 2016

  15. Case report

    African Journals Online (AJOL)

    abp

    4 févr. 2015 ... Noonan KJ, Levenda A, Snead J, Feinberg JR, Mih A. Evaluation of the forearm in untreated adult subjects with multiple hereditary osteochondromatosis. The Journal of bone and joint surgery American volume. 2002 Mar;84-A(3):397-. 403. PubMed | Google Scholar. 7. Caton J, Kohler R, Fournet-Fayard J, ...

  16. Comparative measurements of transpiration an canopy conductance in two mixed deciduous woodlands differing in structure and species composition

    DEFF Research Database (Denmark)

    Herbst, Mathias; Rosier, Paul T.W.; Morecroft, Michael D.

    2008-01-01

    a continuous hazel (Corylus avellana L.) understory. Wytham Woods, which had an LAI of 3.6, was dominated by ash (Fraxinus excelsior L.) and sycamore (Acer pseudoplatanus L.) and had only a sparse understory. Annual canopy transpiration was 367 mm for Grimsbury Wood and 397 mm for Wytham Woods. These values...

  17. Centra-to-limb variation of solar granulation in the infrared

    Czech Academy of Sciences Publication Activity Database

    Sanchez Cuberes, M.; Vazquez, M.; Bonet, J. A.; Sobotka, Michal

    Roč. 397, č. 3 ( 2003 ), s. 1075-1081 ISSN 0004-6361 R&D Projects: GA AV ČR IAA3003903; GA AV ČR KSK2043105 Institutional research plan: CEZ:AV0Z1003909 Keywords : Sun * granulation * photosphere Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.843, year: 2003

  18. Pýthagorův závoj

    Czech Academy of Sciences Publication Activity Database

    Dvořák, Tomáš

    2007-01-01

    Roč. 19, č. 13 (2007), s. 163-176 ISSN 0862-397X R&D Projects: GA ČR(CZ) GP403/06/P451 Institutional research plan: CEZ:AV0Z90090514 Keywords : hearing and listening of sounds * reproduced music * acousmatic listening Subject RIV: AA - Philosophy ; Religion

  19. Youth Alcohol Use and Dating Abuse Victimization and Perpetration: A Test of the Relationships at the Daily Level in a Sample of Pediatric Emergency Department Patients Who Use Alcohol

    Science.gov (United States)

    Rothman, Emily F.; Stuart, Gregory L.; Winter, Michael; Wang, Na; Bowen, Deborah J.; Bernstein, Judith; Vinci, Robert

    2012-01-01

    Objective: This study retrospectively examined the daily-level associations between youth alcohol use and dating abuse (DA) victimization and perpetration for a 6-month period. Method: Timeline Followback (TLFB) interview data were collected from 397 urban emergency department patients, ages 17 to 21 years. Patients were eligible if they reported…

  20. Transcriptional regulation of the operon encoding stress-responsive ECF sigma factor SigH and its anti-sigma factor RshA, and control of its regulatory network in Corynebacterium glutamicum

    Czech Academy of Sciences Publication Activity Database

    Busche, T.; Šilar, Radoslav; Pičmanová, Martina; Pátek, Miroslav; Kalinowski, J.

    2012-01-01

    Roč. 13, č. 445 (2012), s. 445-464 ISSN 1471-2164 R&D Projects: GA ČR GC204/09/J015 Institutional research plan: CEZ:AV0Z50200510 Keywords : Corynebacterium glutamicum * ECF sigma factor * Anti-sigma factor Subject RIV: EE - Microbiology, Virology Impact factor: 4.397, year: 2012

  1. Pamětní místa na komunismus v České republice. Dokumentace a interpretace

    Czech Academy of Sciences Publication Activity Database

    Tůma, Oldřich

    2015-01-01

    Roč. 22, 3/4 (2015), s. 366-397 ISSN 1210-7050 R&D Projects: GA MK(CZ) DF11P01OVV034 Keywords : Federal Assembly * velvet revolution 1989 * Czechoslovakia Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  2. Isolated peat bog habitats and their food connections: parasitoids (Hymenoptera: Ichneumonoidea) and their lepidopteran hosts

    Czech Academy of Sciences Publication Activity Database

    Lozan, Aurel; Spitzer, Karel; Jaroš, Josef

    2012-01-01

    Roč. 16, č. 3 (2012), s. 391-397 ISSN 1366-638X Institutional research plan: CEZ:AV0Z50070508 Keywords : Paleorefugia * relict peat bogs * specific Lepidoptera Subject RIV: EH - Ecology, Behaviour Impact factor: 1.801, year: 2012 http://www.springerlink.com/content/78u173hn60701033/

  3. Nevada Bouguer Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Bouguer anomaly grid for the state of Nevada. Number of columns is 282 and number of rows is 397. The order of the data is from the lower left to the...

  4. Oxygenation of saturated and unsaturated hydrocarbons with ...

    Indian Academy of Sciences (India)

    Unknown

    Oxygenation of saturated and unsaturated hydrocarbons with sodium periodate catalyzed by manganese(III) tetra-arylporphyrins, to study the axial ligation of imidazole. REZA TAYEBEE. Department of Chemistry, Sabzevar Teacher Training University, Sabzevar, Iran 397 e-mail: rtayebee@sttu.ac.ir. MS received 4 June ...

  5. Alterations in synaptic curvature in the dentate gyrus following induction of long-term potentiation, long-term depression, and treatment with the N-methyl-D-aspartate receptor antagonist CPP

    Czech Academy of Sciences Publication Activity Database

    Medvedev, N. I.; Popov, V. I.; Dallerac, G.; Davies, H.A.; Laroche, S.; Kraev, I. V.; Rodríguez Arellano, Jose Julio; Doyere, V.; Stewart, M.G.

    2010-01-01

    Roč. 171, č. 2 (2010), s. 390-397 ISSN 0306-4522 Institutional research plan: CEZ:AV0Z50390703 Keywords : D synaptic ultrastructure * hippocampus * long term potentiation and depression Subject RIV: FH - Neurology Impact factor: 3.215, year: 2010

  6. Differences in muscle pain and plasma creatine kinase activity after ...

    African Journals Online (AJOL)

    Objective. The aim of this study was to compare the acute changes in muscle pain and plasma creatine kinase (CK) activity following the 'up' and 'down' Comrades marathon. Design. This was a quasi-experimental design. Eleven male runners (39.7±9.3 years) completed the 'up' Comrades marathon, and 11 male runners ...

  7. Testicular volume of healthy term neonates: Determination of ...

    African Journals Online (AJOL)

    Subjects and Methods: This was a hospital.based, cross.sectional and descriptive study. Eight hundred and eleven apparently healthy term Igbo male neonates within the first 3 days of life were studied. The TV was measured with Prader Orchidometer (ZKL.135.H), ESP Model. Smoothed centiles (3.97th percentile values) ...

  8. Absorption spectra of ammonia near 1 mu m

    Czech Academy of Sciences Publication Activity Database

    Barton, E. J.; Polyansky, O. L.; Yurchenko, S. N.; Tennyson, J.; Civiš, Svatopluk; Ferus, Martin; Hargreaves, R.; Ovsyannikov, R. I.; Kyuberis, A. A.; Zobov, N. F.; Béguier, S.; Campargue, A.

    2017-01-01

    Roč. 203, DEC 2017 (2017), s. 392-397 ISSN 0022-4073 EU Projects: European Commission(XE) 267219 - EXOMOL Grant - others:RFBR(RU) 16-32-00244 Institutional support: RVO:61388955 Keywords : room temperature * ammonia * absorption intensities * FTIR spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.419, year: 2016

  9. Posttreatment plasma transforming growth factor beta 1 (TGF-beta1) level

    Czech Academy of Sciences Publication Activity Database

    Feltl, D.; Závadová, E.; Pála, M.; Hozák, Pavel

    2005-01-01

    Roč. 52, č. 5 (2005), s. 393-397 ISSN 0028-2685 R&D Projects: GA AV ČR(CZ) IAA5039202 Institutional research plan: CEZ:AV0Z50390512 Keywords : head and neck cancer * late morbidity Subject RIV: EE - Microbiology, Virology Impact factor: 0.731, year: 2005

  10. Architekt František Kalivoda a hraběnka Hélène de Mandrot. "Několik poznámek nejen k ose Brno – La Sarraz"

    Czech Academy of Sciences Publication Activity Database

    Chatrný, Jindřich

    2012-01-01

    Roč. 25, č. 0 (2012), s. 397-470 ISSN 0524-689X R&D Projects: GA AV ČR KJB800330601 Institutional research plan: CEZ:AV0Z80330511 Keywords : Hélène de Mandrot * František Kalivoda * correspondence * congresses CIAM * architecture * film * art Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. An Examination of High School Social Science Students' Levels Motivation towards Learning Geography

    Science.gov (United States)

    Yildirim, Tahsin

    2017-01-01

    This aim of this research was to examine the levels of motivation among high school social science students towards learning geography. The study group consisted of 397 students from different classes at Aksaray Ahmet Cevdet Pasa High School in the College of Social Science. The research was carried out with a scanning model, with data obtained…

  12. Coping Styles with Student Misbehavior as Mediators of Teachers' Classroom Management Strategies

    Science.gov (United States)

    Tran, Van Dat

    2016-01-01

    The purpose of the present study is to identify how teachers' use of various coping styles with student misbehavior, and the extent to which these relate to their classroom management techniques -- punishment, recognition and reward, hinting, discussion, and aggression. It examines data from 397 junior high school teachers in Vietnam. The results…

  13. 33 CFR 117.403 - Wabash River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.403 Section 117.403 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Indiana § 117.403 Wabash River. See § 117.397, Wabash River...

  14. Variation in chromosome numbers and nuclear DNA contents in genetic resources of Lactuca L. species (Asteraceae)

    Czech Academy of Sciences Publication Activity Database

    Doležalová, I.; Lebeda, A.; Janeček, J.; Čihalíková, Jarmila; Křístková, E.; Vránová, O.

    2002-01-01

    Roč. 49, č. 4 (2002), s. 385-397 ISSN 0925-9864 R&D Projects: GA AV ČR IAA6038204; GA AV ČR IBS5038104 Institutional research plan: CEZ:AV0Z5038910 Keywords : Asteraceae * Chromosome number * Flow cytometry Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.579, year: 2002

  15. Phase structure of symmetric tri-block-copolymers and their blends

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Josef; Steinhart, Miloš; Sikora, Antonín; Amenitsch, H.; Bernstorff, S.

    2005-01-01

    Roč. 13, č. 5 (2005), s. 35-40 ISSN 1230-3666 R&D Projects: GA ČR GA203/03/0611 Institutional research plan: CEZ:AV0Z40500505 Keywords : crystallization * block copolymers * blends Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.397, year: 2005

  16. 14 CFR 25.367 - Unsymmetrical loads due to engine failure.

    Science.gov (United States)

    2010-01-01

    ... system, considering the probable pilot corrective action on the flight controls: (1) At speeds between V... the engine compressor from the turbine or from loss of the turbine blades are considered to be... may be based on the control forces specified in § 25.397(b) except that lower forces may be assumed...

  17. Provenance of Wurmian loess and loess-like sediments of Moravia and Silesia (Czech Republic): a study of zircon typology and cathodoluminiscence

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Uher, P.

    2006-01-01

    Roč. 57, č. 5 (2006), s. 397-403 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Keywords : Pleistocene * Würmian * Czech Republic * Moravia * cathodoluminiscence * loess sediments * zircon typology * zircon Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.364, year: 2006 http://www.geologicacarpathica.sk/src/main.php

  18. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Devkanya Dutta. Articles written in Journal of Biosciences. Volume 25 Issue 4 December 2000 pp 397-404 Mini Review. Mechanism of store-operated calcium entry · Devkanya Dutta · More Details Abstract Fulltext PDF. Activation of receptors coupled to the phospholipase C/IP3 ...

  19. Interface affected polymer dynamics: NMR, SANS, and DLS study of the influence of shell-core interactions on the core chain mobility of poly(2-ethylhexyl acrylate)-block-poly(acrylic acid) micelles in water

    Czech Academy of Sciences Publication Activity Database

    Kříž, Jaroslav; Pleštil, Josef; Tuzar, Zdeněk; Pospíšil, Herman; Brus, Jiří; Jakeš, Jaromír; Masař, Bohumil; Vlček, Petr; Doskočilová, Danica

    1999-01-01

    Roč. 32, - (1999), s. 397-410 ISSN 0024-9297 R&D Projects: GA ČR GA203/95/1319; GA ČR GA203/96/1388; GA AV ČR KSK2050602 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.534, year: 1999

  20. 14 CFR 29.395 - Control system.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Control system. 29.395 Section 29.395... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Strength Requirements Control Surface and System Loads § 29.395 Control system. (a) The reaction to the loads prescribed in § 29.397 must be provided by— (1) The control...

  1. Immediate placement of implants in periapical infected sites: a prospective randomized study in 50 patients

    NARCIS (Netherlands)

    Lindeboom, Jérôme A. H.; Tjiook, Yang; Kroon, Frans H. M.

    2006-01-01

    OBJECTIVE: To determine clinical success when implants are placed in chronic periapical infected sites. STUDY DESIGN: Fifty patients (25 females, 25 males, mean age 39.7 +/- 14.5 years) were included in this prospective controlled study. After randomization, 25 Frialit-2 Synchro implants were

  2. Morphology and SSU rDNA-based Phylogeny of a New Strain of Saccamoeba sp (Saccamoeba Frenzel, 1892, Amoebozoa)

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Kostka, Martin; Pecková, Hana

    2008-01-01

    Roč. 47, č. 4 (2008), s. 397-405 ISSN 0065-1583 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Amoebozoa * Saccamoeba sp. * Phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.013, year: 2008

  3. Time-lapse micro-tomography analysis of the deformation response of a gellan-gum-based scaffold

    Czech Academy of Sciences Publication Activity Database

    Kytýř, Daniel; Fenclová, Nela; Zlámal, Petr; Kumpová, Ivana; Fíla, Tomáš; Koudelka_ml., Petr; Gantar, A.; Novak, S.

    2017-01-01

    Roč. 51, č. 3 (2017), s. 397-402 ISSN 1580-2949 Institutional support: RVO:68378297 Keywords : bone scaffold * gellan gum * time-lapse micro CT * digital volume correlation Subject RIV: JJ - Other Materials OBOR OECD: Materials engineering Impact factor: 0.436, year: 2016 http://mit.imt.si/Revija/izvodi/mit173/kytyr.pdf

  4. Actinorhodopsin genes discovered in diverse freshwater habitats and among cultivated freshwater .i.Actinobacteria./i

    Czech Academy of Sciences Publication Activity Database

    Sharma, A. K.; Sommerfeld, K.; Bullerjahn, G. S.; Matteson, A. R.; Wilhelm, S. W.; Jezbera, Jan; Brandt, U.; Doolittle, W.F.; Hahn, M.W.

    2009-01-01

    Roč. 3, č. 6 (2009), s. 726-737 ISSN 1751-7362 Institutional research plan: CEZ:AV0Z60170517 Keywords : rhodopsins * actinorhodopsin * freshwater * Actinobacteria * Superior * Erie Subject RIV: EE - Microbiology, Virology Impact factor: 6.397, year: 2009

  5. Data of evolutionary structure change: 1QRZC-2FODA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1QRZC-2FODA 1QRZ 2FOD C A FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTR--...ine> PHE CA 397 2FOD A 2FODA...> A 2FODA HGVTSFVSRLG...yChain> 2FOD A 2FODA HCVDR---ELTF...pdbChain>A 2FODA GCQGD-SGGPL

  6. 21 CFR 209.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Federal Food, Drug, and Cosmetic Act (sections 201-907 (21 U.S.C. 301-397)). Authorized dispenser means an... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Definitions. 209.2 Section 209.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL...

  7. Výborné divadlo jako hezký film aneb Archeologie filmových Hrátek s čertem

    Czech Academy of Sciences Publication Activity Database

    Merenus, Aleš

    2016-01-01

    Roč. 28, č. 2 (2016), s. 77-103 ISSN 0862-397X Institutional support: RVO:68378068 Keywords : Czech drama * Drda, Jan * Mach, Josef * Brdečka, Jiří * film adaptation * Hrátky s čertem (Playing with the Devil) * fairy tales Subject RIV: AJ - Letters, Mass-media, Audiovision

  8. Isopycnic focusing: myth or reality?

    Czech Academy of Sciences Publication Activity Database

    Janča, J.; Špírková, Milena; Stejskal, Jaroslav

    2003-01-01

    Roč. 77, č. 1 (2003), s. 95-104 ISSN 0036-0244 R&D Projects: GA AV ČR KSK4050111 Keywords : density * density gradient * isopycnic focusing Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.397, year: 2003

  9. 76 FR 66090 - Facility Operating License Amendment From Virginia Electric and Power Company, Surry Power...

    Science.gov (United States)

    2011-10-25

    ... process, thermal expansion mismatch between the tube and tubesheet, and from the differential pressure... staff at 1- 800-397-4209, 301-415-4737, or by e-mail to [email protected] . The application for... attachment to the application, dated July 28, 2011, contains SUNSI and, accordingly, this portion is being...

  10. Assessment of the relationship between geologic origin of soil, rhizobacterial community composition and soil receptivity to tobacco black root rot in Savoie region (France)

    Czech Academy of Sciences Publication Activity Database

    Almario, J.; Kyselková, Martina; Kopecký, J.; Ságová-Marečková, M.; Muller, D.; Grundmann, G.L.; Moënne-Loccoz, Y.

    2013-01-01

    Roč. 371, 1/2 (2013), s. 397-408 ISSN 0032-079X Grant - others:MŚMT(CZ) ME09077 Institutional support: RVO:60077344 Keywords : suppressive soils * Thielaviopsis basicola * black root rot Subject RIV: EE - Microbiology, Virology Impact factor: 3.235, year: 2013

  11. 76 FR 20034 - Calvin Ramsey, M.D.; Revocation of Registration

    Science.gov (United States)

    2011-04-11

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration [Docket No. 10-25] Calvin Ramsey, M.D.; Revocation of Registration On December 18, 2009, the Deputy Assistant Administrator, Office of Diversion... constitutional right to appointed counsel in a proceeding under 21 U.S.C. 824(a). See Goldberg v. Kelly, 397 U.S...

  12. Český filmový divák. Sociologická charakterizace na základě kvantitativních šetření

    Czech Academy of Sciences Publication Activity Database

    Vávra, Martin; Špaček, Ondřej; Čížek, Tomáš

    2010-01-01

    Roč. 23, č. 4 (2010), s. 107-125 ISSN 0862-397X R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : cultural consumption * cinema attendance * cultural capital Subject RIV: AO - Sociology, Demography

  13. Motor proficiency profile of Grade 1 learners in the North West ...

    African Journals Online (AJOL)

    This study aimed to establish a comprehensive profile of the motor proficiency of Grade 1 learners in the North West Province of South Africa, taking into account gender and racial differences and strengths and weaknesses. A stratified randomised sample of 816 Grade 1 learners (419 boys, 397 girls, mean age 6.84 years ...

  14. 77 FR 55848 - National Cancer Institute; Notice of Meeting

    Science.gov (United States)

    2012-09-11

    ... Clinical Trials and Strategic Planning Subcommittee. Date: September 24, 2012. Time: 5 p.m. to 6 p.m... Trials Strategic Planning Subcommittee. Dial in number: 1-866-652-9542 and Passcode: 4596704. Place... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397...

  15. Metal nano-film resistivity chemical sensor

    Czech Academy of Sciences Publication Activity Database

    Podešva, Pavel; Foret, František

    2016-01-01

    Roč. 37, č. 3 (2016), s. 392-397 ISSN 0173-0835 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : adsorption * chemiresistor * nano-film * thiol binding * thiol sensing Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.744, year: 2016

  16. Kasinath Ojha

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. KASINATH OJHA. Articles written in Journal of Chemical Sciences. Volume 129 Issue 3 March 2017 pp 397-404 Regular Article. Biomass derived graphene-like activated and non-activated porous carbon for advanced supercapacitors · KASINATH OJHA BHARAT KUMAR ...

  17. An Attachment Perspective on Anger among Adolescents

    Science.gov (United States)

    Konishi, Chiaki; Hymel, Shelley

    2014-01-01

    Extending John Bowlby's hypothesis that dysfunctional anger is a predictable outcome of insecure attachments to parents, this study investigated the relationship between current parent-adolescent attachment and both the experience and expression of anger. Participants included 776 students (379 boys and 397 girls) in grades 8-12. As predicted by…

  18. Chromosome identification for the carnivorous plant Genlisea margaretae

    Czech Academy of Sciences Publication Activity Database

    Tran, T.D.; Šimková, Hana; Schmidt, R.; Doležel, Jaroslav; Schubert, I.; Fuchs, J.

    2017-01-01

    Roč. 126, č. 3 (2017), s. 389-397 ISSN 0009-5915 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACs * Genlisea * Karyotyping * Multicolor fluorescence in situ hybridization (mcFISH) * Reprobing Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.414, year: 2016

  19. Coping with spinal cord injury: Tenacious goal pursuit and flexible goal adjustment.

    NARCIS (Netherlands)

    van Lankveld, Wim; van Diemen, Tijn; van Nes, Ilse J. W.

    2011-01-01

    Objective: To investigate the correlation of higher-order coping strategies of tenacious goal pursuit and flexible goal adjustment with adjustment after rehabilitation in spinal cordinjury. Design: Cross-sectional correlational study.Subjects/patients: All 397 eligible patients entered for spinal

  20. The Training Needs of Michigan Automobile Suppliers: Initial Report.

    Science.gov (United States)

    Jacobs, James

    In June 1985, a survey was sent by the Industrial Technology Institute to 397 Michigan automobile supplier firms concerning their industrial training in modern manufacturing technologies. The purposes of this survey were to investigate the training needs of Michigan automobile suppliers, with particular emphasis on how they met their training…

  1. Urinary endogenous sex hormone levels and the risk of postmenopausal breast cancer

    NARCIS (Netherlands)

    Onland-Moret, N.C.; Kaaks, R.; Noord, P.A.H. van; Rinaldi, S.; Key, T.; Grobbee, D.E.; Peeters, P.H.M.

    2003-01-01

    To assess the relation between urinary endogenous sex steroid levels and the risk of postmenopausal breast cancer, a nested case–cohort study was conducted within a large cohort (the DOM cohort) in the Netherlands (n¼9 349). Until the end of follow-up (1 January 1996), 397 postmenopausal breast

  2. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 4. Issue front cover thumbnail Issue back cover thumbnail. Volume 13, Issue 4. April 2008 ... K R Y Simha Dhruv C Hoysall · More Details Fulltext PDF. pp 394-397 Think It Over. Solution to How Many Birds are Unwatched · Soubhik Chakraborty.

  3. Comparison of LiDAR- and photointerpretation-based estimates of canopy cover

    Science.gov (United States)

    Demetrios Gatziolis

    2012-01-01

    An evaluation of the agreement between photointerpretation- and LiDARbased estimates of canopy cover was performed using 397 90 x 90 m reference areas in Oregon. It was determined that at low canopy cover levels LiDAR estimates tend to exceed those from photointerpretation and that this tendency reverses at high canopy cover levels. Characteristics of the airborne...

  4. Why Girl Students Achieve English Presentation Learning Significantly Better in Shanghai University of Engineering Science (SUES)

    Science.gov (United States)

    Zhu, Wen; Liu, Zhixin

    2017-01-01

    In non literature major dominated university, it is obviously noted that girl students' English (as the second language) presentation scores often higher than boy students in the same teaching environment and evaluation system. A 397 samples' survey has been studied from the aspects of after school activities and sleep schedule to discuss if any…

  5. 75 FR 51846 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-08-23

    ..., Leased Workers From Aerotek. 74,170 Con-way Enterprise Portland, OR May 28, 2009. Services, Accounting.... 74,397 Progress Software Bedford, MA July 12, 2009. Corporation, Off-Site Workers Reporting to Bedford, Massachusetts from Arizona, etc. 74,398 Progress Software El Segundo, CA......... July 12, 2009...

  6. 40 CFR 721.9079 - Dihydro quinacridone derivative (generic).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Dihydro quinacridone derivative... Specific Chemical Substances § 721.9079 Dihydro quinacridone derivative (generic). (a) Chemical substance... dihydro quinacridone derivative (PMN P-01-397) is subject to reporting under this section for the...

  7. Hydrobiont animals in floodplain soil: Are they positively or negatively affected by flooding?

    Czech Academy of Sciences Publication Activity Database

    Devetter, Miloslav; Schöll, K.

    2014-01-01

    Roč. 69, February (2014), s. 393-397 ISSN 0038-0717 Grant - others:Deutsche Bundesstiftung Umwelt(DE) AZ 24050 Institutional support: RVO:60077344 Keywords : Rotifers * Bdelloids * floodplain * limnoterrestrial communities * species response * variance partitioning Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  8. Histopathological aspects of liver under variable food restriction: Has the intense one-week food restriction a protective effect on non-alcoholic-fatty-liver-disease (NAFLD) development?

    Czech Academy of Sciences Publication Activity Database

    Makovický, P.; Tůmová, E.; Volek, Z.; Makovický, P.; Vodičková, Ludmila; Slyšková, Jana; Svoboda, Miroslav; Rejhová, Alexandra; Vodička, Pavel; Samasca, G.; Králová, A.; Nagy, M.; Mydlarova-Blascakova, M.; Poracova, J.

    2014-01-01

    Roč. 210, č. 12 (2014), s. 855-862 ISSN 0344-0338 R&D Projects: GA MZd(CZ) NT14329 Grant - others:GA MZE(CZ) 0002701404 Institutional support: RVO:68378041 Keywords : fasting * liver * starvation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.397, year: 2014

  9. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 397-400 Research Commentary. Inexorable spread: inexorable death? The fate of neo-XY chromosomes of grasshoppers · Claudio J. Bidau Dardo A. Martí Elio R. Castillo · More Details Fulltext PDF. pp 401-408 Research Article. Domain combination of the vertebrate-like TLR gene family: implications for their origin and ...

  10. Prevalence of paratuberculosis in the dairy goat and dairy sheep industries in Ontario, Canada

    DEFF Research Database (Denmark)

    Bauman, Cathy A.; Jones-Bitton, Andria; Menzies, Paula

    2016-01-01

    A cross-sectional study was undertaken (October 2010 to August 2011) to estimate the prevalence of paratuberculosis in the small ruminant dairy industries in Ontario, Canada. Blood and feces were sampled from 580 goats and 397 sheep (lactating and 2 y of age or older) that were randomly selected...

  11. Catalytic effects of poly(methyl methacrylate)-supported β-diketone ...

    Indian Academy of Sciences (India)

    Metal salt solutions were prepared in doubly distilled water. Functional group capacities and metal intake capacities were determined by standard volumetric methods. Electronic spectra were recorded on a Varian Cary 2390 UV-VIS-NIR spectrophotometer and infrared spectra on a Perkin–Elmer 397 spectrophotometer.

  12. Rhizosphere effect of colonizer plant species on the development of soil microbial community during primary succession on postmining sites

    Czech Academy of Sciences Publication Activity Database

    Elhottová, Dana; Krištůfek, Václav; Malý, S.; Frouz, Jan

    2009-01-01

    Roč. 40, 1-6 (2009), s. 758-770 ISSN 0010-3624 R&D Projects: GA MŠk LC06066; GA ČR GA526/03/1259 Institutional research plan: CEZ:AV0Z60660521 Keywords : colonizer plant * colliery spoil substrate * rhizosphere effect Subject RIV: EH - Ecology, Behaviour Impact factor: 0.397, year: 2009

  13. Conflict between parents and adolescents : Variation by family constitution

    NARCIS (Netherlands)

    Honess, T.M; Charman, E.A; Zani, B; Cicognani, E; Xerri, M.L; Jackson, A.E.; Bosma, H.A.

    Conflicts between parents and adolescents were explored from the viewpoint of 13- and 15-year-old children (N = 397). There was support for Steinberg's (1989) distancing hypothesis: older children reported more aggression, more frustration and lower intimacy outcomes. There was also support for the

  14. Changes in Microtubular Alignment in Lactuca spp. (Asteraceae) Epidermal Cells during Early Stages of Infection by Bremia lactucae (Peronosporaceae)

    Czech Academy of Sciences Publication Activity Database

    Sedlářová, M.; Binarová, Pavla; Lebeda, A.

    2001-01-01

    Roč. 41, č. 1 (2001), s. 21-34 ISSN 0079-2047 R&D Projects: GA AV ČR IAA5020803; GA MŠk ME 397 Institutional research plan: CEZ:AV0Z5038910 Keywords : Bremia lactucae * Peronosporaceae * resistance Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.275, year: 2001

  15. Four-switch three-phase space-vector PWM AC-DC converter

    Czech Academy of Sciences Publication Activity Database

    Klíma, J.; Škramlík, Jiří; Valouch, Viktor

    2008-01-01

    Roč. 95, č. 4 (2008), s. 383-397 ISSN 0020-7217 Institutional research plan: CEZ:AV0Z20570509 Keywords : AC-DC converter * space-vector pulsewidth modulation * rectifier Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.567, year: 2008

  16. The effect of the first dynode`s geometry on the detection efficiency of a 119EM electron multiplier used as a highly charged ion detector

    Czech Academy of Sciences Publication Activity Database

    Krása, Josef; Pfeifer, Miroslav; Stöckli, M. P.; Lehnert, U.; Fry, D.

    1999-01-01

    Roč. 152, - (1999), s. 397-402 ISSN 0168-583X R&D Projects: GA AV ČR IAA1010819; GA ČR GA202/97/0918 Institutional research plan: CEZ:AV0Z1010921 Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.118, year: 1999

  17. Mollusc trace fossils Ptychoplasma Fenton and Fenton, 1937 and Oravaichnium Plička and Uhrová, 1990: Their type material and ichnospecies

    Czech Academy of Sciences Publication Activity Database

    Uchman, A.; Mikuláš, Radek; Rindsberg, A. K.

    2011-01-01

    Roč. 44, č. 4 (2011), s. 387-397 ISSN 0016-6995 R&D Projects: GA ČR GA205/05/0917 Institutional research plan: CEZ:AV0Z30130516 Keywords : locomotion trace fossils * Bivalves * flysch * Carboniferous * Cretaceous * Paleogene Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.010, year: 2011

  18. Particulate composite on the basis of HA and TCP microparticles and nanoparticles as a possible biomaterial for spine therapy

    Czech Academy of Sciences Publication Activity Database

    Rýglová, Šárka; Sucharda, Zbyněk; Černý, Martin; Suchý, Tomáš; Šupová, Monika; Žaloudková, Margit

    2010-01-01

    Roč. 54, č. 4 (2010), s. 386-397 ISSN 0862-5468 R&D Projects: GA MPO FT-TA3/131 Institutional research plan: CEZ:AV0Z30460519 Keywords : particulate composite * preparation * hydroxyapatite Subject RIV: JI - Composite Materials Impact factor: 0.297, year: 2010

  19. Transferases and transporters mediate the detoxification and capacity to tolerate trinitrotoluene in Arabidopsis

    Czech Academy of Sciences Publication Activity Database

    Landa, Přemysl; Štorchová, Helena; Hodek, J.; Vaňková, Radomíra; Podlipná, Radka; Maršík, Petr; Ovesná, J.; Vaněk, Tomáš

    2010-01-01

    Roč. 10, č. 4 (2010), s. 547-559 ISSN 1438-793X R&D Projects: GA MŠk 2B06187; GA MŠk 2B08058 Institutional research plan: CEZ:AV0Z50380511 Keywords : Microarrays * Arabidopsis thaliana * TNT Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.397, year: 2010

  20. Alcohol and Drug Use in Young Apprentices: Effect of Social Control in the Family.

    Science.gov (United States)

    Burcu, Esra

    2003-01-01

    Examined the social control used by families of young apprentices in Turkey in relation to deviant behaviors, such as alcohol and drug use. Data for 397 apprentices show that those who use alcohol are most frequently exposed to stringent controls and oral and physical violence, and those who use drugs frequently were exposed to battering by their…

  1. Molecular epidemiology studies of carcinogenic environmental pollutants. Effects of polycyclic aromatic hydrocarbons (PAHs) in environmental pollution on exogenous and oxidative DNA damage

    Czech Academy of Sciences Publication Activity Database

    Farmer, P. B.; Singh, R.; Kaur, B.; Šrám, Radim; Binková, Blanka; Kalina, I.; Popov, T. A.; Garte, S.; Taioli, E.; Gabelova, A.; Cebulska-Wasilewska, A.

    2003-01-01

    Roč. 544, 2-3 (2003), s. 397-402 ISSN 1383-5742 Institutional research plan: CEZ:AV0Z5039906 Keywords : molecular epidemiology Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 5.783, year: 2003

  2. Determinants of management outcome in open tibia fractures in ile-ife

    African Journals Online (AJOL)

    The majority of the cases were Gustilo and Anderson type II 32 (36.0%) cases and type I 22(24.7%) cases. There was Correlation between the presence of wound infection and (i) Gustilo and Anderson grading (F -.352, P .001); (ii) Injury to Debridement time in hours (F -.304, P .004); (iii) Osteomyelitis (F .397, P .001); (iv) ...

  3. Mutuality as an Aspect of Family Functioning in Predicting Eating Disorder Symptoms in College Women

    Science.gov (United States)

    Sanftner, Jennifer L.; Cameron, Rebecca P.; Tantillo, Mary; Heigel, Caron P.; Martin, David Myron; Sippel-Silowash, Julie Ann; Taggart, Jane M.

    2006-01-01

    We examined mutuality, an aspect of Relational Cultural Theory, in an ethnically diverse sample of 397 college women from Midwestern and Western universities. We hypothesized that mutuality would predict scores on an eating disorder scale after controlling for traditional family variables, such as expressed emotion. As predicted, mutuality, as…

  4. 76 FR 16431 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2011-03-23

    ... Committee: National Cancer Institute Special Emphasis Panel; SPORE in Lymphoma, Breast, Ovarian... and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed Meeting...

  5. Equine herpesvirus 1 and/or 4 in working equids: seroprevalence ...

    African Journals Online (AJOL)

    A cross-sectional study was conducted in selected districts of North Shewa Zone of Amhara Region with the objectives of estimating the seroprevalence of equine herpesvirus 1 and/or 4 and to identify possible risk factors for the occurrence of the disease. A total 397 working equids sera were examined for the presence of ...

  6. Anion recognition by calix[4]arene-based p-nitrophenyl amides

    Czech Academy of Sciences Publication Activity Database

    Flídrová, K.; Tkadlecová, M.; Lang, Kamil; Lhoták, P.

    2012-01-01

    Roč. 53, č. 6 (2012), s. 678-680 ISSN 0040-4039 R&D Projects: GA ČR GA203/09/0691 Institutional research plan: CEZ:AV0Z40320502 Keywords : calixarenes * anion recognition * receptor * complexation * UV/Vis titration Subject RIV: CA - Inorganic Chemistry Impact factor: 2.397, year: 2012

  7. Corn starch: properties and processing. January 1972-December 1987 (citations from the Food Science and Technology Abstracts data base). Report for January 1972-December 1987

    International Nuclear Information System (INIS)

    1987-12-01

    This bibliography contains citations concerning corn starch processing. The physical and chemical properties, and nutritive value of corn starch and corn starch products are considered. Studies of gamma-irradiated corn starch are included. (This updated bibliography contains 397 citations, 123 of which are new entries to the previous edition.)

  8. Yield performance of four beetroot ( Beta vulgaris l.) varieties ...

    African Journals Online (AJOL)

    varieties compared with the local variety under open field conditions in Seychelles. ... with root yield being 39.7 % and 33.1 % higher than the popular variety 'Detroit' in both years respectively. Hence the variety 'Crosby' was recommended as a potential replacement for 'Detroit'. Agro-Science Vol. 7 (2) 2008: pp. 139-142 ...

  9. Aquatic Environment 2000

    DEFF Research Database (Denmark)

    Svendsen, L. M.; Bijl, L. van der; Boutrup, S.

    The report summarizes the results of the Danish Aquatic Monitoring and Assessment Programme 1998-2003. Danish Environmental Protection Agency 2000: NOVA-2003. Programbeskrivelse for det nationale program for overvågning af vandmiljøet 1998-2003. 397 pp. - Redegørelse fra Miljøstyrelsen nr. 1 (in...

  10. The "Presodium" Hydrogen Evolution at the Dropping Mercury Electrode Catalysed by Simple Cysteine Peptides

    Czech Academy of Sciences Publication Activity Database

    Mader, P.; Veselá, V.; Dorčák, V.; Heyrovský, Michael

    2001-01-01

    Roč. 66, č. 3 (2001), s. 397-410 ISSN 0010-0765 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901 Keywords : cysteine peptides * polarography * hydrogen catalysis Subject RIV: CG - Electrochemistry Impact factor: 0.778, year: 2001

  11. AcEST: DK951242 [AcEST

    Lifescience Database Archive (English)

    Full Text Available umbagini... 398 e-110 sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 397 e-110 sp|P25819|CATA2...FSHHP 180 Query: 628 ESMHMFSWLFDDVGIPLNYRH 690 ES+HMFS+LFDD+G+P +YRH Sbjct: 181 ESLHMFSFLFDDLGVPQDYRH 201 >sp|O24339|CATA_SOLAP

  12. AcEST: DK950143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 398 e-110 sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 397 e-110 sp|P25819|CATA2_ARATH C...0 Query: 619 ESMHMFSWLFDDVGIPLNYRH 681 ES+HMFS+LFDD+G+P +YRH Sbjct: 181 ESLHMFSFLFDDLGVPQDYRH 201 >sp|O24339|CATA_SOLAP

  13. Physical mapping, expression analysis and polymorphism survey of ...

    Indian Academy of Sciences (India)

    Madhsudhan

    AC133216-10. RRGA11-180 do. TTCTTGAAGGAGGAGGAAGG. GAGTTATGGAGCGAGCAAGC. 60. 397. 3. AC133216-11. RRGA11-181 do. GTCCAGGGTGTACGAGATCC. GCATGAGAGGATGCAAGTAGC. 64. 535. 4. AC133216-13. RRGA11-182 do. CGATCACTGACCATGTTTGG. CCTTCTGCAGTCGATTCTCC. 60. 461.

  14. Obstetric performance of elderly primi gravida in Jos University ...

    African Journals Online (AJOL)

    During the study period, 411 primigravidae delivered in the labour ward unit of Jos University Teaching Hospital. Out of these, 397 (96.6%) were aged ≤ 34 years while only 14 (3.4%) were aged ≥ 35 years. The commonest obstetric complication was failure to progress in labour (FTP),18(4.4%). Three hundred and thirteen ...

  15. Symptom burden and its association with change in glucose metabolism status over a 7-year period: the Hoorn Study.

    NARCIS (Netherlands)

    van der Pols-Vijlbrief, R.; Dekker, J.M.; Stehouwer, C.D.A.; de Boer, M.R.; Nijpels, G.; Snoek, F.J.; Adriaanse, M.C.

    2014-01-01

    Aims: To study symptom burden among older people and its associations with change in glucose metabolism status over a 7-year period. Methods: We conducted a prospective population-based cohort study among 397 older people. We used the revised Diabetes Symptom Checklist to assess symptom burden.

  16. Do Children Who Bully Their Peers Also Play Violent Video Games? A Canadian National Study

    Science.gov (United States)

    Dittrick, Crystal J.; Beran, Tanya N.; Mishna, Faye; Hetherington, Ross; Shariff, Shaheen

    2013-01-01

    The study examined whether children who bully others are likely to prefer playing video games that are rated high in maturity and violence. A stratified random sample of Canadian children ages 10 to 17 years from the provinces of Canada was obtained. Parents (n = 397) and their children (n = 492) completed an online survey of children's bullying…

  17. 75 FR 59099 - Cable Television Act of 1992

    Science.gov (United States)

    2010-09-27

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 76 [MM Docket No. 92-266, FCC 95-397] Cable Television Act of 1992 AGENCY: Federal Communications Commission. ACTION: Final rule; announcement of effective date. SUMMARY: This document announces the effective date of rules published in the Federal...

  18. 78 FR 11988 - Cable Television Act of 1992

    Science.gov (United States)

    2013-02-21

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 76 [MM Docket No. 92-266, FCC 95-397] Cable Television Act of 1992 AGENCY: Federal Communications Commission. ACTION: Final rule; announcement of effective date. SUMMARY: This document announces the effective date of rules published in the Federal...

  19. Direct Monte Carlo Simulation Methods for Nonreacting and Reacting Systems at Fixed Total Internal Energy or Enthalpy

    Czech Academy of Sciences Publication Activity Database

    Smith, W.; Lísal, Martin

    2002-01-01

    Roč. 66, č. 1 (2002), s. 011104-1 - 011104-1 ISSN 1063-651X R&D Projects: GA ČR GA203/02/0805 Grant - others:NSERC(CA) OGP1041 Keywords : MC * simulation * reaction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.397, year: 2002

  20. Control of flowering time and spike development in cereals: the earliness per se Eps-1 region in wheat, rice, and Brachypodium

    Czech Academy of Sciences Publication Activity Database

    Faricelli, M. E.; Valárik, Miroslav; Dubcovsky, J.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 293-306 ISSN 1438-793X Institutional research plan: CEZ:AV0Z50380511 Keywords : Comparative genomics * Earliness per se * Flowering Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.397, year: 2010

  1. ASPERGILLUS NIGER ASPERGILLUS NIGER

    African Journals Online (AJOL)

    User

    CITRIC ACID PRODUCTION FROM DILUTE ACID HYDROLYSED CORN STARCH USING ASPERGILLUS NIGER. , N. A. Amenaghawon ..... “The effect of the sugar source on citric acid production by. Aspergillusniger”. Applied. Microbiology and Biotechnology, Vol. 19, Number 6,. 1984, pp. 393-397. [25]. Xu, D.B., Madrid ...

  2. Temperature structure function in the Bolgiano regime of thermal convection

    Czech Academy of Sciences Publication Activity Database

    Skrbek, Ladislav; Niemela, J. J.; Sreenivasan, K. R.; Donnelly, J.

    2002-01-01

    Roč. 66, č. 3 (2002), 036303/1-036303/6 ISSN 1063-651X Institutional research plan: CEZ:AV0Z1010914 Keywords : thermal convection * temperature fluctuations * Bolgiano regime Subject RIV: BK - Fluid Dynamics Impact factor: 2.397, year: 2002

  3. An Overview of Pakistani Women in Education, Science and Research

    Indian Academy of Sciences (India)

    ranjeetha

    2013-09-24

    Sep 24, 2013 ... Education has been of central significance to the development of human society. ▫ Humane and ethical thing to provide everyone easy access to education without ... Middle Stage 3.179 million (43%)2.397 million (37%) 114,645 (34%). 220,339 (66%) ... and technology in all aspects of life. ▫ The presence ...

  4. Untitled

    Indian Academy of Sciences (India)

    Control 34:377-397. Puterman M. 1994 Markov decision processes (New York: John Wiley). Rachev S, Ruschendorf L 1995 Probability metrics and recursive algorithms. Adv. Appl. Probab. 27: 770-799. Ripley B 1987 Stochastic simulation (New York: John Wiley). Robbins H, Monro 1951 A stochastic approximation method.

  5. Dislocation interaction with a .SIGMA.=3 grain boundary by .I.in-situ./I. TEM

    Czech Academy of Sciences Publication Activity Database

    Vystavěl, Tomáš; Jacques, A.; Gemperle, Antonín; Gemperlová, Juliana; George, A.

    294-296, - (1999), s. 397-400 ISSN 0255-5476. [Intergranular and Interphase Boundaries in Materials(iib`98). Praha, 06.07.1998-09.07.1998] R&D Projects: GA AV ČR IAA1010702; GA ČR GA202/98/1281 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.981, year: 1999

  6. Connectivity between the Algerian population of Greater Flamingo ...

    African Journals Online (AJOL)

    In this paper, we document the wintering and breeding of European flamingos in Algeria and provide the first post-fledging dispersal data for flamingos born in Algeria. At breeding colonies in Algeria, most ringed birds (99.4% of 835 birds) originated from north-western Mediterranean colonies (397 individuals born in ...

  7. Dicty_cDB: Contig-U05483-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 397 ) CBHN10812.rev CBHN Metridium senile tentacle Metr... 34 3.7 3 ( AC021180 ) Homo sapiens BAC clone RP11...8 ( FC840398 ) CBHN10812.fwd CBHN Metridium senile tentacle Metr... 34 3.9 3 ( AC224554 ) Bos taurus clone C

  8. Bovine Mastitis in Selected Districts of Borena Zone, Southern Ethiopia

    African Journals Online (AJOL)

    A cross-sectional study was conducted on 397 lactating Boran cows in pastoral areas of Borana Zone, Ethiopia to determine the prevalence of mastitis, major causes and associated risk factors of mastitis using California mastitis test and bacteriology. The study showed an overall prevalence of 70.8%; out of which 12.4% ...

  9. Quietly Does It: Questioning assumptions about class, sustainability and consumption

    Czech Academy of Sciences Publication Activity Database

    Smith, J.; Kostelecký, Tomáš; Jehlička, P.

    2015-01-01

    Roč. 67, č. 10 (2015), s. 223-232 ISSN 0016-7185 Institutional support: RVO:68378025 Keywords : Sustainability * Ethical consumption * Class Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.397, year: 2015 http://dx.doi.org/10.1016/j.geoforum.2015.03.017

  10. Prevalence and detection of cytomegalovirus by polymerase chain ...

    African Journals Online (AJOL)

    A total of 327 women were screened, amongst them, 7 (2.14%) were cytomegalovirus (CMV) DNA positive by polymerase chain reaction (PCR). Antibodies against toxoplasma were also detected in 106 (32.41%) women, while 54 (16.51%) were anti CMV positive. Eleven (3.36%) and thirteen (3.97%) women were anti HSV ...

  11. A Cross-Cultural Analysis of Interpersonal Needs.

    Science.gov (United States)

    Cambra, Ronald E.; Klopf, Donald W.

    The Fundamental Interpersonal Relations Orientation--Behavior (FIRO-B) was administered to 504 Japanese, 219 Australian, 73 Korean, and 397 United States college students to assess interpersonal needs in the four cultures. The FIRO-B provides ratings for inclusion, control, and affection needs on an "expressed" dimension to indicate the…

  12. Hirschsprung's disease presenting in the neonatal period in Jos ...

    African Journals Online (AJOL)

    Results: From January 1996 – December 2004, 78 children were managed for Hirschsprung's disease in our unit. Thirty-one (39.7%) were aged 30 days or below. ... presented with enterocolitis while in five there was delayed passage of meconium and recurrent constipation. Barium enema was done in 25 and rectal biopsy ...

  13. Renal I-131-hippurate clearance overestimates true renal blood flow in the instrumented conscious dog

    NARCIS (Netherlands)

    Visscher, CA; DeZeeuw, D; Navis, G; VanZanten, AK; DeJong, PE; Huisman, RM

    We evaluated renal I-131-hippurate clearance (ERPF(hip)) as a measure of renal blood flow (RBF) in chronically instrumented conscious dogs. When adjusted for renal hippurate extraction (E(hip), 0.77 +/- 0.01) and hematocrit (Hct, 39.7 +/- 1%), calculated RBF(hip) (656 +/- 37 ml/min) markedly

  14. Multi-component titanium–copper–cobalt- and niobium nanostructured oxides as catalysts for ethyl acetate oxidation

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Henych, Jiří; Ivanova, R.; Kovacheva, D.; Štengl, Václav

    2015-01-01

    Roč. 116, č. 2 (2015), s. 397-408 ISSN 1878-5190 Institutional support: RVO:61388980 Keywords : Copper and cobalt oxides * Effect of support * Ethyl acetate combustion * Multicomponent oxides * Titania doped with niobium Subject RIV: CA - Inorganic Chemistry Impact factor: 1.265, year: 2015

  15. 77 FR 40385 - Withdrawal of Regulatory Guide 7.3; Procedures for Picking Up and Receiving Packages of...

    Science.gov (United States)

    2012-07-09

    ... Picking Up and Receiving Packages of Radioactive Material AGENCY: Nuclear Regulatory Commission. ACTION.... Nuclear Regulatory Commission (NRC or Commission) is withdrawing RG 7.3, ``Procedures for Picking Up and... Public Document Room (PDR) reference staff at 1-800-397-4209, or 301-415-4737, or by email at PDR...

  16. 77 FR 36017 - Regulatory Guide 7.3, Procedures for Picking Up and Receiving Packages of Radioactive Material

    Science.gov (United States)

    2012-06-15

    ... NUCLEAR REGULATORY COMMISSION [NRC-2012-0139] Regulatory Guide 7.3, Procedures for Picking Up and... Guide (RG) 7.3, ``Procedures for Picking Up and Receiving Packages of Radioactive Material.'' The guide..., please contact the NRC's Public Document Room (PDR) reference staff at 1-800-397-4209, or 301-415-4737...

  17. 75 FR 71368 - Erik Erb; Notice of Receipt of Petition for Rulemaking

    Science.gov (United States)

    2010-11-23

    ... and Adjudications Staff. E-mail comments to: [email protected] . If you do not receive a... accessing the documents located in ADAMS, then contact the NRC's PDR reference staff at 800-397-4209, or 301... overtime must now ``pick up the slack,'' sometimes to the point of being forced to work overtime. The...

  18. The EUV Spectrum of Sunspot Plumes Observed by SUMER on ...

    Indian Academy of Sciences (India)

    tribpo

    J. Astrophys. Astr. (2000) 21, .397-401. The EUV Spectrum of Sunspot Plumes Observed by SUMER on. SOHO. W. Curdt,. 1. B. N. Dwivedi. 2. & U. Feldman. 3. 1. Max-Planck-Institut für Aeronomie, D-37191, Katlenburg-Lindau, Germany. 2. Department of Applied Physics, Banaras Hindu University, Varanasi-221005, India.

  19. The effect of conditioning with NaCl, KCl and HCl on the ...

    African Journals Online (AJOL)

    2009-11-20

    Nov 20, 2009 ... Natural Zeolites, Brockport, New York. 397-403. CORUH S (2008) Treatment of copper industry waste and production of sintered glass-ceramic. Waste Manage. Res. 24 234-241. CULFAZ M and YAGIZ M (2004) Ion exchange properties of natural clinoptilolite: lead-sodium and cadmium-sodium equilibria.

  20. Habitat use of the endangered butterfly Euphydryas maturna and forestry in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Freese, A.; Beneš, Jiří; Bolz, R.; Čížek, Oldřich; Dolek, M.; Geyer, A.; Gros, P.; Konvička, Martin; Liegl, A.; Stettmer, C.

    2006-01-01

    Roč. 9, č. 4 (2006), s. 388-397 ISSN 1367-9430 R&D Projects: GA ČR GA526/04/0417 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterfly conservation * coppicing * forest pasture Subject RIV: EH - Ecology, Behaviour Impact factor: 1.926, year: 2006

  1. Targeted Zinc Delivery: A Novel Treatment for Prostate Cancer

    Science.gov (United States)

    2010-06-01

    metabolism and homeostasis: the application of tracer techniques to human zinc physiology. Biometals 2001, 14(3-4):397-412. 23. Dahm P, Yeung LL...human prostate epithelial cell line. Biometals 21(4):405–16, 2008. JETO-091217-CK.indd 9 5/14/2010 11:56:40 AM

  2. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. David L Beveridge. Articles written in Journal of Biosciences. Volume 37 Issue 3 July 2012 pp 379-397 Articles. The ABCs of molecular dynamics simulations on B-DNA, circa 2012 · David L Beveridge Thomas E Cheatham III Mihaly Mezei · More Details Abstract Fulltext PDF.

  3. Beahaviour of the lowest excited triplet state of a divalent lead ion. From an isolated impurity to an exciton

    Czech Academy of Sciences Publication Activity Database

    Polák, Karel; Nikl, Martin; Mihóková, Eva; Nitsch, Karel

    94-95, - (2001), s. 397-401 ISSN 0022-2313 Institutional research plan: CEZ:AV0Z1010914 Keywords : Pb 2+ ions * lead chloride compounds * emission lifetimes Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.279, year: 2001

  4. The EUV Spectrum of Sunspot Plumes Observed by SUMER on SOHO

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 21; Issue 3-4. The EUV Spectrum of Sunspot Plumes Observed by SUMER on SOHO. W. Curdt B. N. Dwivedi U. Feldman. Session X – Cycle Variation in the Quiet Corona & Coronal Holes Volume 21 Issue 3-4 September-December 2000 pp 397-401 ...

  5. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. B. N. Dwivedi. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 397-401 Session X – Cycle Variation in the Quiet Corona & Coronal Holes. The EUV Spectrum of Sunspot Plumes ...

  6. Open Veterinary Journal: Submissions

    African Journals Online (AJOL)

    Impacts of the zebra mussel (Dreissena polymorpha) on water quality and fish spawning reefs of Western Lake Erie. In Zebra mussels: biology, impacts and control, Eds., Nalepa, T. and D. Schloesser. Ann Arbor, MI: Lewis Publishers, pp: 381-397. Conference Proceedings: Stock, A. 2004. Signal Transduction in Bacteria.

  7. Tropical Journal of Pharmaceutical Research - Vol 14, No 3 (2015)

    African Journals Online (AJOL)

    siRNAs Targeting Viral Protein 5: The Major Capsid Protein of Herpes Simplex Virus-1 Affects its Propagation and Cytoskeleton · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K Ma, F Jin, Q Wang, Z Ren, K Zheng, Y Wang, 391-397.

  8. Bulletin of the Chemical Society of Ethiopia - Vol 31, No 3 (2017)

    African Journals Online (AJOL)

    Removal of imidacloprid using activated carbon produced from ricinodendron heudelotii shells · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K. Y. Urbain, E. K. Fodjo, D. Ardjouma, B. Y. Serge, E. S. Aimé, G. B. Irié Marc, T. Albert, 397-409.

  9. The role of Her2 and other oncogenes of the PI3K/AKT pathway in mitochondria

    Czech Academy of Sciences Publication Activity Database

    Rohlenová, Kateřina; Neužil, Jiří; Rohlena, Jakub

    2016-01-01

    Roč. 397, č. 7 (2016), s. 607-615 ISSN 1431-6730 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : alpha-tocopheryl succinate * mitochondria * oxidase subunit-ii * protein-kinase b Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.273, year: 2016

  10. 75 FR 5092 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-02-01

    ... . Name of Committee: National Cancer Institute Special Emphasis Panel, Quantitative Cell-Based Imaging....396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research Manpower; 93.399... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  11. 76 FR 52960 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2011-08-24

    ... Emphasis Panel, Mechanisms of Cell Signaling in Cancer. Date: October 13-14, 2011. Time: 3 to 5 p.m. Agenda..., Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  12. Synonymical notes on Apogenia cupreoviridis and A. nigroolivacea (Coleoptera: Scarabaeoidea: Melolonthidae: Diplotaxini)

    Czech Academy of Sciences Publication Activity Database

    Bezděk, Aleš

    2008-01-01

    Roč. 58, č. 1 (2008), s. 71-77 ISSN 0003-4541 R&D Projects: GA AV ČR 1QS500070505 Institutional research plan: CEZ:AV0Z50070508 Keywords : taxonomy * type designation * new synonymy Subject RIV: EG - Zoology Impact factor: 0.397, year: 2008

  13. 76 FR 52699 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses Involving No...

    Science.gov (United States)

    2011-08-23

    ... 3.9.4 (Containment Building Penetrations); and TS 3.9.7 (Crane Travel--Fuel Handling Building... West Summit Hill Drive, 6A West Tower, Knoxville, Tennessee 37902. NRC Branch Chief: Douglas A... lifting device or crane, or an operator error--that could cause an FHA. Since these systems are designed...

  14. On White’s Expansion of Lukasiewicz Logic

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    2010-01-01

    Roč. 20, č. 2 (2010), s. 389-397 ISSN 0955-792X R&D Projects: GA ČR GEICC/08/E018 Institutional research plan: CEZ:AV0Z10300504 Keywords : Lukasiewicz fuzzy logic * Cantor-Lukasiewicz set theory * full comprehension Subject RIV: BA - General Mathematics Impact factor: 0.586, year: 2010

  15. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal

    2015-01-01

    Roč. 267, 15 September (2015), s. 397-408 ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sum s * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015 http://www.sciencedirect.com/science/article/pii/S0096300315002155

  16. Tailoring approach for obtaining molecular orbitals of large systems

    Indian Academy of Sciences (India)

    ) Limaye A C and Gadre SR 1994 J. Chem. Phys. 100 1303. 30. Muscat J, Wander A and Harrison N M 2001 Chem. Phys. Lett. 342 397. 31. The package MeTA Studio available at: http://code. google.com/p/metastudio/ See: Ganesh V2009 J.

  17. Is positron annihilation in polyamide 6 affected by morphology?

    Czech Academy of Sciences Publication Activity Database

    Debowska, M.; Piglowski, J.; Slusarczyk, C.; Schmidt, Pavel; Rudzinska-Girulska, J.; Suzuki, T.; Yu, R.; Binias, W.

    2005-01-01

    Roč. 132, SI (2005), s. 64-68 ISSN 1230-3666. [International Conference on X-Ray Investigation of Polymer Structure /6./. Bielsko-Biala, 08.12.2004-11.12.2004] Institutional research plan: CEZ:AV0Z40500505 Keywords : polyamide 6 * crystalline regions * positron annihilation Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.397, year: 2005

  18. Organisational Learning Approaches to School Leadership and Management: Teachers' Values and Perceptions of Practice

    Science.gov (United States)

    Pedder, David; MacBeath, John

    2008-01-01

    In this article, we report results of a survey of 1,397 teachers in 26 primary and 17 secondary schools in England as part of the Learning How to Learn project. We consider how school self-evaluation can be understood within an organisational learning frame. Factor analysis of teachers' responses helped us identify 4 dimensions of organisational…

  19. Quality of life of healthy subjects and patients with arthritis and ...

    African Journals Online (AJOL)

    quality of life perception among healthy subjects. METHODS ... social and economic (SE; 8 items), psychological and spiritual .... 8.92 (SD=3.97); moderately dissatisfied category. In between these two extreme are diabetes mellitus patients who belong to slightly satisfied category with a mean overall QOL score of 18.92 ...

  20. MICROWAVE-ASSISTED SYNTHESIS OF SOME NITRO ...

    African Journals Online (AJOL)

    Chem. Life Sci. 2014, 347, 387-397. 32. Menteşe, E. Efficient microwave assisted synthesis of some new benzimidazoles containing the mebendazole nucleus. J. Chem. Res. 2013, 37, 168-170. 33. Menteşe, E.; Yılmaz, F.; Mutlu, F.; Kahveci, B. Synthesis of new coumarin containing benzimidazole derivatives. J. Chem. Res.

  1. Perceived Disgust and Personal Experiences are Associated with Acceptance of Dissections in Schools

    Science.gov (United States)

    Fancovicova, Jana; Prokop, Pavol; Leskova, Andrea

    2013-01-01

    Animal dissections are essential parts of anatomy/zoology courses, but their effectiveness is influenced by student attitudes and emotions. Here we examined attitudes toward dissections in 397 prospective biology teachers enrolling two Slovak universities. Perceived disgust of dissections negatively correlated with other attitudes toward…

  2. INJURY EXPERIENCE IN TANZANIA- NEED FOR INTERVENTION

    African Journals Online (AJOL)

    2013-05-01

    May 1, 2013 ... Design: A Cross - Sectional hospital based study. Setting: Data were collected .... Study Design: This was a cross-sectional study of patients who .... 2582 (44.5). Employed. 11 (9.4). 490 (8.4). Total. 117 (100). 5809 (100). Transport to hospital. Ambulance. 48 (39.7). 2457 (42.2). Bicycle/Motorcycle. 10 (8.3).

  3. 75 FR 5353 - Energy Northwest; Notice of Receipt and Availability of Application for Renewal of Columbia...

    Science.gov (United States)

    2010-02-02

    ... NUCLEAR REGULATORY COMMISSION [NRC-2010-0029; Docket No. 50-397] Energy Northwest; Notice of Receipt and Availability of Application for Renewal of Columbia Generating Station Facility Operating... Commission) has received an application, dated January 19, 2010, from Energy Northwest (EN), filed pursuant...

  4. 77 FR 31895 - Energy Northwest, Columbia Generating Station; Record of Decision and Issuance of Renewed...

    Science.gov (United States)

    2012-05-30

    ... 11576). For further details with respect to this action, see: (1) Energy Northwest's license renewal... NUCLEAR REGULATORY COMMISSION [Docket No. 50-397; NRC-2010-0029] Energy Northwest, Columbia... 20-Year Period AGENCY: Nuclear Regulatory Commission. ACTION: License renewal application; issuance...

  5. Evaluation of micronutrients level and antinociceptive property of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-02-01

    Feb 1, 2010 ... inflammatory activity of extracts in rats. Ethnopharmacology, 93: 397-. 402. Simjee SU, Jawed H, Quadri J, Saeed SA (2007). Quantitative gait analysis as a method to assess mechanical hyperalgesia modulated by disease-modifying antirheumatoid drugs in the adjuvant-induced arthritic rat. Arth. Res. Ther.

  6. Soil formation and mineralogy of a Rhodic Luvisol - insights from magnetic and geochemical studies

    Czech Academy of Sciences Publication Activity Database

    Jordanova, N.; Jordanova, D.; Liu, Q.-Z.; Hu, P.; Petrov, P.; Petrovský, Eduard

    2013-01-01

    Roč. 110, Part C - November (2013), s. 397-413 ISSN 0921-8181 Institutional support: RVO:67985530 Keywords : red soil * magnetism * hematite * pedogenesis * REE * Sahara dust Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.707, year: 2013

  7. The field high-amplitude SX Phe variable BL Cam: results from a multisite photometric campaign. II. Evidence of a binary - possibly triple - system

    Czech Academy of Sciences Publication Activity Database

    Fauvaud, S.; Sareyan, J.P.; Ribas, I.; Rodriguez, E.; Lampens, P.; Klingenberg, G.; Farrell, J.A.; Fumagalli, F.; Simonetti, J.H.; Wolf, M.; Santacana, G.; Zhou, A.; Michel, R.; Fox-Machado, L.; Alvarez, M.; Nava-Vega, A.; Lopez-Gonzalez, M.J.; Casanova, V.M.; Aceituno, F.J.; Scheggia, I.; Rives, J.-J.; Hintz, E.G.; Van Cauteren, P.; Helvaci, M.; Yesilyaprak, C.; Graham, K.A.; Král, L.; Kocián, R.; Kučáková, Hana; Fauvaud, M.; Granslo, B.H.; Michelet, J.; Nicholson, M.P.; Vugnon, J.-M.; Kotková, Lenka; Truparova, K.; Ulusoy, G.; Yasarsoy, B.; Avdibegovic, A.; Blazek, M.; Kliner, J.; Zasche, P.; Bartosikova, S.; Vilasek, M.; Trondal, O.; Van Den Abbeel, F.; Behrend, R.; Wuecher, H.

    2010-01-01

    Roč. 515, June (2010), A39/1-A39/7 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : variables stars * BL Camelopardalis * oscillations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

  8. SAMJ

    African Journals Online (AJOL)

    Edited by A Nava, L Rossi and G Thiene. Pp. xix +. 493. NLG397/US$228. Amsterdam: Elsevier Science. 1997. ISBN. 0-444-82447-2. Epilepsy and other Neurological Disorders in Coeliac Disease. Edited by G Gobbi, F Andermann, S Naccarato and G Banchini. Pp. xiv + 378. Illustrated. £65. London: John Libbey & Co. Ltd.

  9. 76 FR 15008 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-03-18

    ... products (``SFP'') to customers, requires that such broker-dealers provide certain notifications to...% of these customers may engage in SFP transactions (35,242,468 accounts x 8% = 2,819,397). Further... customer that plans to effect SFP transactions with a disclosure document containing certain information,\\3...

  10. The Student Perception of University Support and Structure Scale: Development and Validation

    Science.gov (United States)

    Wintre, Maxine G.; Gates, Shawn K. E.; Pancer, W. Mark; Pratt, Michael S.; Polivy, Janet; Birnie-Lefcovitch, S.; Adams, Gerald

    2009-01-01

    A new scale, the Student Perception of University Support and Structure Scale (SPUSS), was developed for research on the transition to university. The scale was based on concepts derived from Baumrind's (1971) theory of parenting styles. Data were obtained from two separate cohorts of freshmen (n=759 and 397) attending six Canadian universities of…

  11. CONSUMO DE ALCOHOL Y FACTORES DE RIESGO EN ESTUDIANTES DE DOS UNIVERSIDADES COLOMBIANAS. (ALCOHOL CONSUMPTION AND RISK FACTORS IN STUDENTS OF TWO COLOMBIAN UNIVERSITIES

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Cano Bedoya

    2012-06-01

    Full Text Available El objetivo fue identificar factores de riesgo del consumo de alcohol en estudiantes universitarios colombianos. Participaron 397 mujeres y 312 hombres, estudiantes de dos universidades privadas y católicas de la ciudad de Medellín (Colombia. Los resultados identificaron como factores de riesgo las dificultades para decir “no” a la gente (p=0.012 y el consumo de sustancias psicoactivas por miembros de la familia (p=0.022.Abstract:The objective of the current research was to identify the risk factors associated to alcohol consumption of Colombian University students. 397 women and 312 men, students from two private and Catholic universities in the city of Medellín (Colombia took part in it. The results identified as risk factors the difficulties to say 'no' to the people (p=0.012 and the consumption of psychoactive substances by members of the family (p=0.022.

  12. Brilliant Green Dye Elimination from Water Using Psidium guajava Leaves and Solanum tuberosum Peels as Adsorbents in Environmentally Benign Way

    Directory of Open Access Journals (Sweden)

    Rabia Rehman

    2015-01-01

    Full Text Available The aim of this study is to check the feasibility of Psidium guajava (Guava leaves and peels of Solanum tuberosum (Potato as biosorbents in removal of Brilliant Green (BG in batch mode. Surface analysis of biosorbents was done by FT-IR and quantitatively analyzed by Boehm titration. The removal of dye was confirmed by UV-VIS spectroscopy. Isothermal modeling was studied by using Langmuir, Freundlich, and Temkin isotherms. Various isothermal parameters for adsorption of Brilliant Green such as qm=1.075 mg/g, 1.173 mg/g ΔG°=-3.397, and −2.397 KJ/mol were noted for Solanum tuberosum peels (PP and Psidium guajava leaves (GL, respectively. Similarly pH, moisture content, and various metals were quantitatively analyzed. Results showed that leaves of Psidium guajava were more effective for removal of Brilliant Green.

  13. Phosphotyrosine enrichment identifies focal adhesion kinase and other tyrosine kinases for targeting in canine hemangiosarcoma.

    Science.gov (United States)

    Marley, K; Maier, C S; Helfand, S C

    2012-09-01

    Canine hemangiosarcoma (HSA) is an endothelial cell malignancy driven, in part, by activating mutations in receptor and non-receptor tyrosine kinases. Proteomics, Western blots and a tyrosine kinase inhibitor were used to elucidate activating mechanisms in HSA cell lines. Phosphotyrosine peptides from focal adhesion kinase (FAK) STAT3, Lyn, Fyn and other signal transduction kinases were identified by mass spectrometry. FAK was constitutively activated at tyrosine 397, the autophosphorylation site, and this was reversible with high concentrations of a FAK inhibitor. FAK inhibitor-14 suppressed migration and phosphorylation of FAK tyrosine 397 and tyrosines 576/577 and was cytotoxic to HSA cells suggesting FAK signalling may be an important contributor to canine HSA survival. © 2012 Blackwell Publishing Ltd.

  14. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 66; Issue 6 ... 2.397 Å. SrS is found to have the lowest electron density at the mid-bond (0.003 e/Å3) at 2.118 Å from the origin leaving it more ionic than the other two sulphides studied in this work. ... Department of Physics, The Madura College, Madurai 625 011, India ...

  15. Exercise and Osteoporosis: A Dose-Response Meta-Analysis

    Science.gov (United States)

    2011-05-01

    osteoporosis related fractures, in both civilian and non-civilian adults. Body For the first year of this project our Statement of Work...lysine-lactose treatment in menopausal osteoporosis ]. Minerva Medica 1994 June;85(6):327-32. Ref ID: 397 18 (100) Bemben DA, Fetters NL, Bemben...the potential menopause - related health benefits of soy and soy products. Health SA Gesondheid 2008 June;13(2):25-37. Ref ID: 746 (131) Bouxsein

  16. Evaluation of Mechanisms of Alteration and Humification of PAHs for Water Quality Management

    OpenAIRE

    Sims, Ronald C.; Abbott, Carolyn K.

    1992-01-01

    Introduction: Creosote-pentachlorophenol (PCP) is a mixture commonly used as a wood preservative in the U.S. (1). A 1988 survey (2) indicated that 1,397 wood preserving waste contaminated sites exist in the United States consisting of 555 active wood treatment plants and 842 inactive plants. Stinson (3) indentifed 58 wood preserving sites on the National Priorities List, of which 51 have PCP and/or creosote or po...

  17. On Tight Separation for Blum Measures Applied to Turing Machine Buffer Complexity

    Czech Academy of Sciences Publication Activity Database

    Šíma, Jiří; Žák, Stanislav

    2017-01-01

    Roč. 152, č. 4 (2017), s. 397-409 ISSN 0169-2968 R&D Projects: GA ČR GBP202/12/G061; GA ČR GAP202/10/1333 Institutional support: RVO:67985807 Keywords : Turing machine * hierarchy * buffer complexity * diagonalization Subject RIV: IN - Informatics, Computer Science OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.687, year: 2016

  18. Research

    African Journals Online (AJOL)

    abp

    29 déc. 2015 ... Bergmann JF, Cohen AT, Tapson VF, Kakkar AK, Goldhaber SZ,. Behar M. Risque de maladie thromboembolique veineuse et pratique de préventions hospitalières en médecine interne : résultas obtenus en France de l'étude internationale ENDORSE. Rev Med Interne. 2008;29(3): S397. PubMed |Google.

  19. Dislocation glide velocity in creep of Mg alloys derived from dip tests

    Czech Academy of Sciences Publication Activity Database

    Eisenlohr, P.; Blum, W.; Milička, Karel

    510-511, Sp. Iss. (2009), s. 393-397 ISSN 0921-5093. [Creep 2008. Bayreuth, 04.05.2008-09.05.2008] R&D Projects: GA ČR GA106/06/1354 Institutional research plan: CEZ:AV0Z20410507 Keywords : Dislocation glide velocity * Temperature dependence * Solute drag * Forest cutting * Prismatic glide Subject RIV: JG - Metallurgy Impact factor: 1.901, year: 2009

  20. Selection of reference genes for real-time polymerase chain reaction analysis in tissues from Bombus terrestris and Bombus lucorum of different ages

    Czech Academy of Sciences Publication Activity Database

    Horňáková, Darina; Matoušková, Petra; Kindl, Jiří; Valterová, Irena; Pichová, Iva

    2010-01-01

    Roč. 397, č. 1 (2010), s. 118-120 ISSN 0003-2697 R&D Projects: GA ČR GA203/09/1446; GA MŠk(CZ) LC531; GA MŠk 2B06007 Institutional research plan: CEZ:AV0Z40550506 Keywords : real-time PCR * reference genes * Bombus * bumblebees Subject RIV: CE - Biochemistry Impact factor: 3.236, year: 2010

  1. Alpha-Tocopheryl succinate causes mitochondrial permeabilization by preferential formation of Bak channels

    Czech Academy of Sciences Publication Activity Database

    Procházka, L.; Dong, L.F.; Vališ, Karel; Freeman, R.; Ralph, S.J.; Turánek, J.; Neužil, Jiří

    2010-01-01

    Roč. 15, č. 7 (2010), s. 782-794 ISSN 1360-8185 R&D Projects: GA AV ČR(CZ) KAN200520703; GA AV ČR(CZ) IAA500520702; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Vitamin E succinate * apoptosis * Noxa-Bak Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.397, year: 2010

  2. Defining an Approach for Future Close Air Support Capability

    Science.gov (United States)

    2017-01-01

    information from warfighters, and includes the results of an assessment using state-of-the-art machine learning methods for coding to extract information on...smallwarsjournal.com/ blog /journal/docs-temp/397-jackson.pdf 25 Jacques, David R., and Dennis D. Strouble, A-10 Thunderbolt II (Warthog) Systems...29, 2014. As of October 15, 2015: http://www.nationaldefensemagazine.org/ blog /lists/posts/post.aspx?ID=1570 “US Air Force to Build 56 Additional A

  3. Coexisting Miocene Alkaline Volcanic Series Associated with the Cheb-Domažlice Graben (W Bohemia): Geochemical Characteristics

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Štěpánková, Jana; Lloyd, F. E.; Balogh, K.

    2003-01-01

    Roč. 54, č. 1 (2003), s. 53-64 ISSN 1335-0552 R&D Projects: GA ČR GA205/99/0907 Grant - others:Hungarian Academy of Sciences Foundation(HU) T 014961 Institutional research plan: CEZ:AV0Z3013912 Keywords : W Bohemia * Miocene volkanism * geochemistry Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  4. Insomnia Phenotypes Based on Objective Sleep Duration in Adolescents: Depression Risk and Differential Behavioral Profiles

    OpenAIRE

    Fernandez-Mendoza, Julio; Calhoun, Susan L.; Vgontzas, Alexandros N.; Li, Yun; Gaines, Jordan; Liao, Duanping; Bixler, Edward O.

    2016-01-01

    Based on previous studies on the role of objective sleep duration in predicting morbidity in individuals with insomnia, we examined the role of objective sleep duration in differentiating behavioral profiles in adolescents with insomnia symptoms. Adolescents from the Penn State Child Cohort (n = 397, ages 12–23, 54.7% male) underwent a nine-hour polysomnography (PSG), clinical history, physical examination and psychometric testing, including the Child or Adult Behavior Checklist and Pediatric...

  5. Importance of mental performance in parental choice of food for children aged 4 – 10 years: a study in four European countries

    OpenAIRE

    Gage, Heather; Egan, B; Williams, Peter; Brands, B; Györei, E; López-Robles, J-C; Campoy, C; Decsi, T; Koletzko, B; Raats, Monique

    2016-01-01

    Objective: Typically, attention focuses on how nutrition affects physical health. The present study investigated the importance that parents attach to the impact of diet on mental performance when choosing food for their child. Design: Questionnaire. Setting: Four European countries. Subjects: Parents of children aged 4–10 years (n 1574): England (n 397), Germany (n 389), Hungary (n 398) and Spain (n 390). Results: Most parents (80–85 %) considered the effect of food on four elements of menta...

  6. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    We have made observations of the associated HI absorption of a high redshift radio galaxy 0902+34 at = 3.395 with the Giant Meterwave Radio Telescope in the 323+1 MHz band. We find a narrow absorption line with a flux density of 11.5 mJy at a redshift of 3.397 consistent with that observed by Uson et al. (1991) ...

  7. Charge exchange signatures in x-ray line emission accompanying plasma-wall interaction

    Czech Academy of Sciences Publication Activity Database

    Renner, Oldřich; Dalimier, E.; Liska, R.; Oks, E.; Šmíd, Michal

    2012-01-01

    Roč. 397, č. 1 (2012), s. 1-6 ISSN 1742-6588 R&D Projects: GA ČR GAP205/10/0814; GA ČR GAP208/10/2302; GA AV ČR IAAX00100903 Institutional research plan: CEZ:AV0Z10100523 Keywords : laser-produced plasma * particle jets generation * plasma-wall interaction * x-ray spectroscopy * charge exchange Subject RIV: BL - Plasma and Gas Discharge Physics

  8. Vortex-Transport Element Simulation of a Confined Mixing Layer

    Science.gov (United States)

    1988-11-01

    Vol. 125, pp. 397-410. Browand, F. E., and Ho, C.-M. (1983) Journal de Mecanique theorique et Aunliauee Numero Special, pp. 99-120. Chorin, A. J...layers was initiated by Givi and Jou (1988) using a hybrid pseudo-spectral second order finite difference scheme. In all cases, the Reynolds number was...confinement. Therefore, they can provide accurate simulations for high Reynolds number, spatially growing flows. Moreover, vortex methods optimize the

  9. The Relationship between Academic Optimism Levels of Schools and Their Levels of Openness to Change

    OpenAIRE

    Çağlar ÇAĞLAR

    2014-01-01

    The sample of this survey study consisted of 605 teachers (208 female and 397 male). It aims to determine the relationship between academic optimism levels of schools and their levels of openness to change and to detect whether those differ on selected variables such as gender, subject matter taught, teaching experience, and school type, number of teachers and students in school, and type of school graduated. Data were collected through the “Personal Information Form”, “Academic Optimism Scal...

  10. lung function of zimbabwea farm workers exposed to flue curing and ...

    African Journals Online (AJOL)

    Outcame measures. Lung function indices. Results. Forced vital capacity (FVq, forced expiratory volume in 1 second (FEV,) and peak expiratory flow rate (pEFR) of the TfWs were 3.28 ± 051 litres, 2.68 ± 0.74 litres and 6.41 ±. 2.08litres/second, respectively. These figures were significantly lower than 3.97 ± 0.83 litres, 3.09 ...

  11. Brief Report: Checklist for Autism Spectrum Disorder--Most Discriminating Items for Diagnosing Autism

    Science.gov (United States)

    Mayes, Susan D.

    2018-01-01

    The smallest subset of items from the 30-item Checklist for Autism Spectrum Disorder (CASD) that differentiated 607 referred children (3-17 years) with and without autism with 100% accuracy was identified. This 6-item subset (CASD-Short Form) was cross-validated on an independent sample of 397 referred children (1-18 years) with and without autism…

  12. Vitellogenesis in two spathebothriidean cestodes

    Czech Academy of Sciences Publication Activity Database

    Bruňanská, Magdaléna; Poddubnaya, L. G.; dezfuli, B. S.

    2005-01-01

    Roč. 96, č. 6 (2005), s. 390-397 ISSN 0932-0113 R&D Projects: GA ČR GA206/03/1317 Grant - others:Russian Foundation of Fundamental Research(RU) 05-04-48250; Grantová agentura SR(SK) VEGA2/4177/04 Institutional research plan: CEZ:AV0Z60220518 Keywords : ultrastructure * vitellogenesis * Cestoda Subject RIV: EA - Cell Biology Impact factor: 1.226, year: 2005

  13. Determination of insoluble avian eggshell matrix proteins

    Czech Academy of Sciences Publication Activity Database

    Mikšík, Ivan; Sedláková, Pavla; Lacinová, Kateřina; Pataridis, Statis; Eckhardt, Adam

    2010-01-01

    Roč. 397, č. 1 (2010), s. 205-214 ISSN 1618-2642 R&D Projects: GA MŠk(CZ) 1M0510; GA ČR(CZ) GA203/09/0675; GA ČR(CZ) GA203/08/1428 Institutional research plan: CEZ:AV0Z50110509 Keywords : eggshell proteins * insoluble proteins * matrix proteins Subject RIV: CE - Biochemistry Impact factor: 3.841, year: 2010

  14. The power of negative thinking: corruption, perception and willingness to bribe in Ukraine

    Czech Academy of Sciences Publication Activity Database

    Čábelková, I.; Hanousek, Jan

    2004-01-01

    Roč. 36, č. 4 (2004), s. 383-397 ISSN 0003-6846 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : corruption, perception and willingness to bribe * Ukraine Subject RIV: AH - Economics Impact factor: 0.211, year: 2004 http://search.ebscohost.com/login.aspx?direct=true&db=bth&AN=12453997&site=ehost-live

  15. Comparative analysis of dose rates in bricks determined by neutron activation analysis, alpha counting and X-ray fluorescence analysis for the thermoluminescence fine grain dating method

    Czech Academy of Sciences Publication Activity Database

    Bártová, H.; Kučera, Jan; Musílek, L.; Trojek, T.

    2014-01-01

    Roč. 104, NOV (2014), s. 393-397 ISSN 0969-806X. [1st International Conference on Dosimetry and its Applications (ICDA). Prague, 23.6.2013-28.6.2013] R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : Alpha coutning * neutron activation analysis * X-ray fluorescence * thermoluminescence dating * dose rate Subject RIV: CB - Analytical Chemistry , Separation Impact factor: 1.380, year: 2014

  16. Mollusca of the Magellan Region. A checklist of the species and their distribution

    Directory of Open Access Journals (Sweden)

    Katrin Linse

    1999-12-01

    Full Text Available The Molluscan species collected during the Victor Hensen Joint Magellan Campaign 1994 served as the basis for this species list. The list was then completed by literature data on the distribution of molluscs around the Falkland Islands, the other Scotia Arc Islands, Antarctica and the Kerguelen Islands. 397 Magellan species are known: 10 species of Aplacophora, 250 species of Gastropoda, 6 species of Scaphopoda and 131 species of Bivalvia. Polyplacophora and Cephalopoda are not included because both taxa need revision.

  17. Download this PDF file

    African Journals Online (AJOL)

    USER

    Cattle within the rage of. 3.5 – 4 years 3(9.7%) were significantly (P<0.05) infected than other age groups. Breed specific prevalence was highest 1(6.7%) in Sokoto gudali and lowest 1(3.1%) in white Fulani. This study concluded that CBPP is endemic and its prevalence is on the increase in the study area. Key words:.

  18. Alpha (alpha-) and beta (beta-carboranyl-C-deoxyribosides: Syntheses, structures and biological evaluation

    Czech Academy of Sciences Publication Activity Database

    Šnajdr, I.; Janoušek, Zbyněk; Takagaki, M.; Císařová, I.; Hosmane, N. S.; Kotora, Martin

    2014-01-01

    Roč. 83, Aug 18 (2014), s. 389-397 ISSN 0223-5234 R&D Projects: GA MŠk 1M0508 Grant - others:GA MŠk(CZ) LC06070; GA ČR(CZ) GA13-15915S Program:LC Institutional support: RVO:61388963 Keywords : alkynes * carboranes * boron neutron capture therapy * antitumor agents * drug research Subject RIV: CC - Organic Chemistry Impact factor: 3.447, year: 2014

  19. A simple rank-based Markov chain with self-organized criticality

    Czech Academy of Sciences Publication Activity Database

    Swart, Jan M.

    2017-01-01

    Roč. 23, č. 1 (2017), s. 87-102 ISSN 1024-2953 R&D Projects: GA ČR GAP201/12/2613; GA ČR(CZ) GA15-08819S Institutional support: RVO:67985556 Keywords : self-reinforcement * self-organized criticality * canyon Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.397, year: 2016 http://library.utia.cas.cz/separaty/2017/SI/swart-0476009.pdf

  20. Le VIH chez le malade neurologique aux CHU de Lome ...

    African Journals Online (AJOL)

    Etude prospective à propos de 397 malades hospitalisés du 1er Janvier au 31 Décembre 2015. Objectifs: Evaluer l'évolution de la séroprévalence hospitalière et les manifestations cliniques neurologiques de l'infection à VIH. Méthodologie: Notre étude s'est déroulée du 1er Janvier au 31 Décembre 2015 dans les services ...

  1. Characterization, molecular cloning and localization of calreticulin in Eisenia fetida earthworms

    Czech Academy of Sciences Publication Activity Database

    Šilerová, Marcela; Kauschke, E.; Kohlerová, Petra; Josková, Radka; Tučková, Ludmila; Bilej, Martin

    2007-01-01

    Roč. 397, - (2007), s. 169-177 ISSN 0378-1119 R&D Projects: GA ČR GD310/03/H147; GA AV ČR IAA5020208; GA MŠk 2B06155 Institutional research plan: CEZ:AV0Z50200510 Keywords : earthworms * annelids * invertebrates Subject RIV: EE - Microbiology, Virology Impact factor: 2.871, year: 2007

  2. Crystallization and crystallographic analysis of the Rhodococcus rhodochrous NCIMB 13064 DhaA mutant DhaA31 and its complex with 1,2,3-trichloropropane

    Czech Academy of Sciences Publication Activity Database

    Lahoda, M.; Chaloupková, R.; Stsiapanava, A.; Damborský, J.; Kutá-Smatanová, Ivana

    2011-01-01

    Roč. 67, Part 3 (2011), s. 397-400 ISSN 1744-3091 R&D Projects: GA MŠk(CZ) LC06010; GA MŠk(CZ) ED1.1.00/02.0073 Institutional research plan: CEZ:AV0Z60870520 Keywords : haloalkane dehalogenases * DhaA * Rhodococcus rhodochrous Subject RIV: CE - Biochemistry Impact factor: 0.506, year: 2011

  3. Evidence of long-term change in zonal wind in the tropical lower mesosphere: Observations and model simulations

    Czech Academy of Sciences Publication Activity Database

    Ratnam, M. V.; Kumar, G. K.; Rao, N. V.; Murthy, B. V. K.; Laštovička, Jan; Qian, L.

    2013-01-01

    Roč. 40, č. 2 (2013), s. 397-401 ISSN 0094-8276 R&D Projects: GA ČR GAP209/10/1792 Institutional support: RVO:68378289 Keywords : mesosphere * zonal wind * long-term trends * TIME-GCM * climate change Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 4.456, year: 2013 http://onlinelibrary.wiley.com/doi/10.1002/grl.50158/abstract

  4. 435-IJBCS-Article-Prof E D Fiogbe

    African Journals Online (AJOL)

    User

    industries et services publics. 397 000 m3 soit 217 tonnes de DBO5. Réalisé à partir des données de Soclo (1999) et Roche International (2000). Photos 3 & 4: Les latrines flottantes à côté du 2ème pont côté marché Dantokpa (Photo 3) et au quartier Agbato (Photo 4) (Badahoui, 21 février 2008). Les valeurs de température ...

  5. Research

    African Journals Online (AJOL)

    raoul

    16 janv. 2011 ... Les femmes au foyer (24%) et les sujets non scolarisés (62,8%) représentaient les couches sociales les plus touchées. Les forages ont été la source de boisson de 39,7% des patients 72 heures avant le début de la maladie. Tous les patients ont présenté une diarrhée aqueuse. Vibrio cholerae, sérotype ...

  6. Changes in Extracellular Striatal Acetylcholine and Brain Seizure Activity Following Acute Exposure to Nerve Against in Freely Moving Guinea Pigs

    Science.gov (United States)

    2010-01-01

    effects of pesticides . In: Klaassen CD, editor. Casarett and Doull’s toxicology: The basic science of poisons. 6th ed. New York: McGraw-Hill. pp 763...orga- nophosphorus or carbamate pesticide -a treatment protocol for junior doctors. Crit Care 8: R391-R397 . Eddleston M, Singh S, Buckley N. 20.o4b...Organophosphorus poisoning (acute). Clin Evid 12:1941-1953. Ellman GL, Courtney KD, Andres V; Featherstone RM. 1961. A new and rapid colorimetric

  7. Spectral Analysis and Computation of Effective Diffusivities for Steady Random Flows

    Science.gov (United States)

    2016-04-28

    Isichenko and J. Kalda. Statistical topography II. 2D transport of passive scalar. J. Nonlinear Sci., 4:375–397, 1991. [24] J. D. Jackson. Classical ... Electrodynamics . John Wiley and Sons, Inc., New York, 1999. [25] J. P. Keener. Principles of Applied Mathematics: Transformation and Approximation. Ad...US), 1988. [49] I. Stakgold. Boundary Value Problems of Mathematical Physics. Classics in Applied Mathe- matics. SIAM, 2000. 2-volume set. [50] T.-J

  8. Generations in Analysis of Costumer Behaviors: A Study On Social Media Using

    OpenAIRE

    Sarıtaş, Emel; Barutçu, Süleyman

    2016-01-01

    In this study, generation concept is analyzed and social media was investigated by level of use varies according to generation in terms of marketing management and consumer behavior. The face to face survey conducted on 397 people from different generation. According to results; X-Y-Z generation that important tool grouping customer behavior, don’t show great difference for the purpose of social media, especially disappear difference “start communication, share the content, entertainment”. Ho...

  9. Children and youth perceive smoking messages in an unbranded advertisement from a NIKE marketing campaign: a cluster randomised controlled trial

    OpenAIRE

    Daniel Mark; Auger Nathalie; Knäuper Bärbel; Raynault Marie-France; Pless Barry

    2011-01-01

    Abstract Background How youth perceive marketing messages in sports is poorly understood. We evaluated whether youth perceive that the imagery of a specific sports marketing advertisement contained smoking-related messages. Methods Twenty grade 7 to 11 classes (397 students) from two high schools in Montréal, Canada were recruited to participate in a cluster randomised single-blind controlled trial. Classes were randomly allocated to either a NIKE advertisement containing the phrase 'LIGHT IT...

  10. Disturbing impact of outdoor cattle husbandry on community of arbuscular mycorrhizal fungi in upland pasture soil

    Czech Academy of Sciences Publication Activity Database

    Jirout, Jiří; Tříska, Jan; Růžičková, Kamila; Elhottová, Dana

    2009-01-01

    Roč. 40, 1-6 (2009), s. 736-745 ISSN 0010-3624 R&D Projects: GA MŠk LC06066; GA AV ČR IAA600660605 Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z60870520 Keywords : arbuscular mycorrhizal fungi * cattle husbandry * pasture soil Subject RIV: EH - Ecology, Behaviour Impact factor: 0.397, year: 2009

  11. Geochemical discrimination of metasedimentary sequences in the Krkonoše-Jizera Terrane (West Sudetes, Bohemian Massif): paleotectonic and stratigraphic constraints

    Czech Academy of Sciences Publication Activity Database

    Winchester, J. A.; Patočka, František; Kachlík, V.; Melzer, M.; Nawakowski, C.; Crowley, Q. G.; Floyd, P. A.

    2003-01-01

    Roč. 54, č. 5 (2003), s. 267-280 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Grant - others:CZ-XE(XE) PACE TMR Network ERBFMRXCT97-0136 Institutional research plan: CEZ:AV0Z3013912 Keywords : geochemistry * metasediments * tectonic setting Subject RIV: DD - Geochemistry Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  12. Supersymmetric quantum mechanics living on topologically non-trivial Riemann surfaces

    Czech Academy of Sciences Publication Activity Database

    Znojil, Miloslav; Jakubský, Vít

    2009-01-01

    Roč. 73, č. 2 (2009), s. 397-404 ISSN 0304-4289. [8th Conference on Non-Hermitian Hamiltonians in Quantum Physics. Mumbai , 13.01.2009-16.01.2009] R&D Projects: GA MŠk LC06002; GA ČR GA202/07/1307 Institutional research plan: CEZ:AV0Z10480505 Keywords : Supersymmetry * Schrodinger equation * complexified coordinates Subject RIV: BE - Theoretical Physics Impact factor: 0.349, year: 2009

  13. Exploitation of Unintentional Information Leakage from Integrated Circuits

    Science.gov (United States)

    2011-12-01

    approaches to counteract power-analysis attacks. In Michael J. Wiener , editor, CRYPTO, volume 1666 of Lecture Notes in Computer Science, pages 398–412...Differential power analysis. In Michael J. Wiener , editor, CRYPTO, volume 1666 of Lecture Notes in Computer Science, pages 388–397. Springer, 1999...11967668_16. OMPR05. Elisabeth Oswald, Stefan Mangard, Norbert Pramstaller, and Vincent Rijmen. A side-channel analysis resistant description of the AES s

  14. Ahmed Zafar Scarcity of real discrete eigenvalues in non-analytic ...

    Indian Academy of Sciences (India)

    Boya Luis J. Note on the natural system of units 961. Büyükkasap E see Sögüt Ö. 711. Caliceti E. Reality and non-reality of the spectrum of PT -symmetric operators: ... Jakubskı Vıt see Znojil Miloslav. 397. Javidan Kurosh see Pakzad Hamid Reza. 913. Jyothi S see Kurian M J. 1111. Kalluraya Balakrishna see Naseema K.

  15. Rend Lake, Illinois (Operation and Maintenance).

    Science.gov (United States)

    1976-12-01

    Lippia lanc6Tahta Foxtail, Bristly Setaria Faberfi Foxtail, Green Setaria viridis Foxtail, Yellow Setaria lutescens Galingale C Verus strigosus Garlic...altissima Redtop Agrostis alba Reed Phracjmites coinunis Reedgrass, Wood Cinna arundinacea 397 Ribgrass Plantago lanceolata Richweed Pie uia Rock-Cress Arbis...terweed Elodea canadensisWitch-Grass Pa-nicum capillare Yam Dioscorea villosaYarrow, common Chillea miifoiumYerba-de-Tago Eclipta alba 399 APPENDIX B-3

  16. Differentiated Ratings of Perceived Exertion during Physical Exercise

    Science.gov (United States)

    1982-01-01

    MEDICINE AND SCIENCE IN SPORTS AND EXERCISE VOl 14, No 5. Pp 397-405. 1982 -1982 Differentiated ratings of perceived exertion during physical...Subjects are asked to indicate a Aeciied e pblicfim1mw.196 y - . ; MEDICINE AND SCIENCE IN SPORTS AND EXERCISE local muscular rating pertaining to...suggests that the interrela-11 1 1 Jl MEDICINE AND SCIENCE IN SPORTS AND

  17. Weight Perceptions and Perceived Risk for Diabetes and Heart Disease Among Overweight and Obese Women, Suffolk County, New York, 2008

    OpenAIRE

    Darlow, Susan; Goodman, Melody S.; Stafford, Jewel D.; Lachance, Christina R.; Kaphingst, Kimberly A.

    2012-01-01

    Introduction Many Americans fail to accurately identify themselves as overweight and underestimate their risk for obesity-related diseases. The purpose of this study was to investigate associations between weight perceptions and perceived risk for diabetes and heart disease among overweight or obese women. Methods We examined survey responses from 397 overweight or obese female health center patients on disease risk perceptions and weight perceptions. We derived odds ratios (ORs) and 95% conf...

  18. Graphite structure and magnetic parameters of flake graphite cast iron

    Czech Academy of Sciences Publication Activity Database

    Vértesy, G.; Uchimoto, T.; Takagi, T.; Tomáš, Ivan; Kage, H.

    2017-01-01

    Roč. 442, Nov (2017), s. 397-402 ISSN 0304-8853 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:68378271 Keywords : magnetic NDE * magnetic adaptive testing * cast iron * graphite structure * pearlite content Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  19. Effect of the particle size and surface area of tungstated zirconia on the WOx nuclearity and n-heptane isomerization over Pt/WO3–ZrO2

    Czech Academy of Sciences Publication Activity Database

    Kaucký, Dalibor; Wichterlová, Blanka; Dědeček, Jiří; Sobalík, Zdeněk; Jakubec, Ivo

    2011-01-01

    Roč. 397, 1-2 (2011), s. 82-93 ISSN 0926-860X R&D Projects: GA AV ČR KAN100400702 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z40400503 Keywords : n-heptane isomeration * Pt/WO3-ZrO2 * nano ZrO2 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.903, year: 2011

  20. and Suzuki coupling reactions

    Indian Academy of Sciences (India)

    99 397; (d) Cerchiaro G, Micke G A, Tavares. M F M and Ferreira A M D C 2004 J. Mol. Cat. 221. 29; (e) Ferrari M B, Pelizzi C, Pelosi G and Rodriguez-. Arguelles M C 2002 Polyhedron 21 2593; (f) Sridhar. S K, Pandeya S N, Stables J P and Ramesh A 2002 Eur. J. Pharm. Sci. 16 129; (g) Sridhar S K, Saravanan M and.

  1. Fertility of a spontaneous hexaploid male Siberian sturgeon, Acipenser baerii

    Czech Academy of Sciences Publication Activity Database

    Havelka, M.; Hulák, M.; Ráb, Petr; Rábová, Marie; Lieckfeldt, D.; Ludwig, A.; Rodina, M.; Gela, D.; Pšenička, M.; Bytyutskyy, D.; Flajšhans, M.

    2014-01-01

    Roč. 15, č. 5 (2014) ISSN 1471-2156 Grant - others:GA MŠk(CZ) EE2.3.30.0049; GA MŠk(CZ) ED2.1.00/01.0024; GA ČR(CZ) GA523/08/0824 Program:GA Institutional support: RVO:67985904 Keywords : Acipenseridae * polyploidy determination * sperm quality Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2014

  2. How to interpret Methylation Sensitive Amplified Polymorphism (MSAP) profiles?

    Czech Academy of Sciences Publication Activity Database

    Fulneček, Jaroslav; Kovařík, Aleš

    2014-01-01

    Roč. 15, JAN 2014 (2014) ISSN 1471-2156 R&D Projects: GA ČR(CZ) GBP501/12/G090; GA ČR(CZ) GA13-10057S; GA ČR(CZ) GA206/09/1751 Institutional support: RVO:68081707 Keywords : MSAP * DNA methylation * Methylcytosine Subject RIV: BO - Biophysics Impact factor: 2.397, year: 2014

  3. An orphaned clone of Potamogeton ×schreberi in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kaplan, Zdeněk; Fehrer, Judith

    2009-01-01

    Roč. 81, č. 4 (2009), s. 387-397 ISSN 0032-7786 R&D Projects: GA ČR GA206/09/0291; GA ČR GA206/07/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : Potamogeton * hybridization * taxonomy Subject RIV: EF - Botanics Impact factor: 2.638, year: 2009 http://www.preslia.cz/P094Kaplan.pdf

  4. Membrane ion transport in erythrocytes of salt hypertensive Dahl rats and their F2 hybrids: the importance of cholesterol

    Czech Academy of Sciences Publication Activity Database

    Vokurková, Martina; Dobešová, Zdenka; Kuneš, Jaroslav; Zicha, Josef

    2003-01-01

    Roč. 26, č. 5 (2003), s. 397-404 ISSN 0916-9636 R&D Projects: GA ČR GA305/00/1638; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : ion transport * salt hypertension * plasma lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 2.013, year: 2003

  5. Reliability of the 6-min walk test after total knee arthroplasty

    DEFF Research Database (Denmark)

    Jakobsen, Thomas Linding; Kehlet, Henrik; Bandholm, Thomas

    2013-01-01

    reliability, intra-class correlation coefficient (ICC(2,1)), standard error of measurement (SEM), and smallest real difference (SRD) were calculated. RESULTS: The patients walked on average 14.1 m longer at the second (397.2 m) compared to the first (383.1 m) test trial. The ICC(2,1), SEM, and SRD were 0...

  6. Neuroregulators and Stress, 1979 - 1986.

    Science.gov (United States)

    1986-01-01

    the aggresive behavior of septal rats. Phatmccl. Niochm. Bth"a. 1:397-40D, 1976. Eichelman, B., Orenberg. E., Seagraves, E. and Barchas. 3. Influence...Investigator intracranial reward. With such a wide range of influence on physiological and behavioral functions it is not surprising that epinephrin* neurons in... Behavioral con- trol decreases fear arousal over and above any benefits derived from predict- ability of the occurrences of threats. Autonomic

  7. A viable mouse model for Netherton syndrome based on mosaic inactivation of the Spink5 gene

    Czech Academy of Sciences Publication Activity Database

    Kašpárek, Petr; Ileninová, Zuzana; Hanečková, Radka; Kanchev, Ivan; Jeníčková, Irena; Sedláček, Radislav

    2016-01-01

    Roč. 397, č. 12 (2016), s. 1287-1292 ISSN 1431-6730 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk(CZ) LQ1604; GA MŠk(CZ) LM2011032; GA MŠk(CZ) LO1509 Institutional support: RVO:68378050 Keywords : mosaicism * mouse model * netherton syndrome * skin * SPINK5 * TALEN Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.273, year: 2016

  8. Hypertension and anxiety in young Nigerian Adults: A study of an ...

    African Journals Online (AJOL)

    Appropriate statistical tools were used to analyze the data generated. A total of 1.5% (1.6% for males and 1.4% for females, P = 0.561) had high degree of anxiety. Hypertension was found in 2.4% (4% for males and 0.1% for female, P = 0.043) of the population while prehypertension was found in 39.7% (53.2% for males ...

  9. Production, purification and oxidative folding of the mouse recombinant prion protein

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, A.; Bednárová, Lucie; Holada, K.

    2007-01-01

    Roč. 52, č. 4 (2007), s. 391-397 ISSN 0015-5632 R&D Projects: GA ČR GD310/05/H533 Grant - others:GA ČR(CZ) GA310/04/0419 Institutional research plan: CEZ:AV0Z40550506 Keywords : recombinant prion protein * production * purification * folding Subject RIV: CE - Biochemistry Impact factor: 0.989, year: 2007 http://www.biomed.cas.cz/mbu/folia/

  10. Chromosomes in the flow to simplify genome analysis

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jaroslav; Vrána, Jan; Šafář, Jan; Bartoš, Jan; Kubaláková, Marie; Šimková, Hana

    2012-01-01

    Roč. 12, č. 3 (2012), s. 397-416 ISSN 1438-793X R&D Projects: GA ČR GAP501/10/1740; GA ČR GAP501/10/1778 Institutional research plan: CEZ:AV0Z50380511 Keywords : Chromosome sorting * Chromosome-specific BAC libraries * Chromosome sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.292, year: 2012

  11. Determination of butoxyacetic acid (biomarker of ethylene glycol monobutyl ether exposure) in human urine candidate reference material

    Czech Academy of Sciences Publication Activity Database

    Sperlingova, I.; Dabrowská, L.; Stránský, V.; Duskova, S.; Kučera, Jan; Tvrdíková, M.; Tichý, M.

    2010-01-01

    Roč. 397, č. 2 (2010), s. 433-438 ISSN 1618-2642. [12th International Symposium on Biological and Environmental Reference Materials Keble Coll. Oxford, 07.07.2009-10.07.2009] Institutional research plan: CEZ:AV0Z10480505 Keywords : Candidate reference material * Ethylene glycol monobutyl ether * Metabolite Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.841, year: 2010

  12. On mean reward variance in semi-Markov processes

    Czech Academy of Sciences Publication Activity Database

    Sladký, Karel

    2005-01-01

    Roč. 62, č. 3 (2005), s. 387-397 ISSN 1432-2994 R&D Projects: GA ČR(CZ) GA402/05/0115; GA ČR(CZ) GA402/04/1294 Institutional research plan: CEZ:AV0Z10750506 Keywords : Markov and semi-Markov processes with rewards * variance of cumulative reward * asymptotic behaviour Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.259, year: 2005

  13. The posterior medial cortex is involved in visual but not in verbal memory encoding processing: an intracerebral recording study

    Czech Academy of Sciences Publication Activity Database

    Štillová, K.; Jurák, Pavel; Chládek, Jan; Halámek, Josef; Telecká, S.; Rektor, I.

    2013-01-01

    Roč. 120, č. 3 (2013), s. 391-397 ISSN 0300-9564 R&D Projects: GA ČR GAP103/11/0933; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : Event-related potential (ERP) * Memory * Posterior medial cortex (PMC) – SEEG Subject RIV: BD - Theory of Information Impact factor: 2.871, year: 2013

  14. Lipoxygenase inhibiting and antioxidant iridoids from Buddleja crispa.

    Science.gov (United States)

    Ahmad, Ijaz; Chen, Shilin; Peng, Yong; Chen, Sibao; Xu, Lijia

    2008-02-01

    Phytochemical investigations on the ethyl acetate-soluble fraction of the whole plant of Buddleja crispa led to the isolation of the iridoids 1-7. Compound 2 displayed significant inhibitory potential against enzyme lipoxygenase in a concentration-dependant fashion with IC(50) value of 39.7 +/- 0.02microM, along with DPPH radical scavenging activity with IC(50) value 0.638 mM.

  15. 76 FR 56242 - Energy Northwest; Establishment of Atomic Safety and Licensing Board

    Science.gov (United States)

    2011-09-12

    ... NUCLEAR REGULATORY COMMISSION [Docket No. 50-397-LR; ASLBP No. 11-912-03-LR-BD01] Energy Northwest; Establishment of Atomic Safety and Licensing Board Pursuant to delegation by the Commission dated December 29, 1972, published in the Federal Register, 37 FR 28,710 (1972), and the Commission's regulations, see, e.g., 10 CFR 2.104, 2.105, 2.300,...

  16. Boundary Influences on HAB Phytoplankton Ecology in a Stratification-Enhanced Upwelling Shadow

    Science.gov (United States)

    2014-05-13

    Laczka, 0„ 2006. Trace metal effects on the production of biotoxins by microalgae . Afr. J. Mar. Sci. 28, 393-397. Rienecker, E.R., Ryan, J.P., Marin...2005a, 2011). One hypothesis for a causal link between sediments and toxicity involves the influences of trace metals on DA production , which...observed relationship between resuspended sediments and toxicity is regulation of DA production by trace metals transported with the bottom bound- ary

  17. New cyclic aminals derived from rac-trans-1,2-diaminocyclohexane: synthesis and crystal structure of racemic 1,8,10,12-tetraazatetracyclo[8.3.1.1..sup.8,12./sup.O.sup.2,7./sup.] pentadecane and a route to its enantiomerically pure (R,R) and (S,S) isomers

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Quiroga, D.; Jiménez-Cruz, L.; Fejfarová, Karla; Dušek, Michal

    2012-01-01

    Roč. 53, č. 3 (2012), s. 345-348 ISSN 0040-4039 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : crystal structure * X-ray diffraction * Jana2006 * chiral cyclic aminals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.397, year: 2012

  18. Seasonal and spatial dynamics of gas ebullition in a temperate water-storage reservoir

    Czech Academy of Sciences Publication Activity Database

    Tušer, Michal; Picek, T.; Sajdlová, Zuzana; Jůza, Tomáš; Muška, Milan; Frouzová, Jaroslava

    2017-01-01

    Roč. 53, č. 10 (2017), s. 8266-8276 ISSN 0043-1397 R&D Projects: GA ČR GAP504/12/1186; GA MŠk(CZ) LM2015075; GA MŠk(CZ) EF16_013/0001782 Institutional support: RVO:60077344 Keywords : ebullitive flux * hydroacoustics * methane * river impoundment * season Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Marine biology, freshwater biology, limnology Impact factor: 4.397, year: 2016

  19. High Cycle Fatigue Damage Mechanisms of MAR-M 247 Superalloy at High Temperatures

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Horník, Vít; Hutař, Pavel; Hrbáček, K.; Kunz, Ludvík

    2016-01-01

    Roč. 69, č. 2 (2016), s. 393-397 ISSN 0972-2815 R&D Projects: GA TA ČR(CZ) TA04011525; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : High cycle fatigue * S-N curves * Fractography * High temperature * EBSD analysis Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.533, year: 2016

  20. Nigeria Evidence-based Health System Initiative (NEHSI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Agent(e) responsable du CRDI. Mhatre, Sharmila. Financement total. CAD$ 17,397,789. Pays. Nigéria, Sud du Sahara, États-Unis d'Amérique, Canada, Suède, Afrique du Sud. Chargé(e) de projet. Martin Meremikwu. Chargé(e) de projet. Iwara Arikpo. Institution. University of Calabar. Pays d' institution. Nigeria. Chargé(e) ...

  1. Operator ordering and causality

    OpenAIRE

    Plimak, L. I.; Stenholm, S. T.

    2011-01-01

    It is shown that causality violations [M. de Haan, Physica 132A, 375, 397 (1985)], emerging when the conventional definition of the time-normal operator ordering [P.L.Kelley and W.H.Kleiner, Phys.Rev. 136, A316 (1964)] is taken outside the rotating wave approximation, disappear when the amended definition [L.P. and S.S., Annals of Physics, 323, 1989 (2008)] of this ordering is used.

  2. A longitudinal study of migration and health: Empirical evidence from Thailand and its implications

    OpenAIRE

    Chamchan, Chalermpol; Chan, Win Kit; Punpuing, Sureeporn

    2014-01-01

    Using longitudinal data and analysis from 2005 to 2009, this study aims to examine the complex relationship between rural-urban migration and health in Thailand. Measured by Physical and Mental Component Summary Scales from the Short Form (SF-36) Health Survey, the physical and mental health of respondents was assessed and tracked over this five-year period with regard to migration status and relevant socio-demographic characteristics. A total of 2,397 individuals of prime migration age (betw...

  3. The cellular fate of cortical progenitors is not maintained in neurosphere cultures

    Czech Academy of Sciences Publication Activity Database

    Machoň, Ondřej; Backman, M.; Krauss, S.; Kozmik, Zbyněk

    2005-01-01

    Roč. 30, č. 3 (2005), s. 388-397 ISSN 1044-7431 R&D Projects: GA ČR GA204/04/1358; GA MŠk 1M0520 Institutional research plan: CEZ:AV0Z50520514 Keywords : cortical progenitors * neurospheres * fibroblast growth factor FGF Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.641, year: 2005

  4. original articles

    African Journals Online (AJOL)

    Kirsten, Muhammad A Dhansay, Mieke Faber, Paul J van. Jaarsveld, A J Spinnler Benade. The effect of two ..... 4.84 (0.86). 3.97 (0.72). 4.65 (0.84). TIR. 0.10 (0.05). 0.11 (0.06). 0.04 (0.03). 0.08 (0.04). Statistical significance between day 3 and day 9 within each group: 'P 6).

  5. Synthesis of a new chiral cyclic aminal derived from rac-1,2-propanediamine

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Pacheco, D.J.; Ríos-Motta, J.; Fejfarová, Karla; Dušek, Michal

    2012-01-01

    Roč. 53, č. 45 (2012), s. 6132-6135 ISSN 0040-4039 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : aminal cage * axial chirality * imidazolidine-bridged bis(phenols) * Mannich condensation * 1,2-propanediamine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.397, year: 2012

  6. Effects of Methamphetamine on Vigilance and Tracking during Extended Wakefulness.

    Science.gov (United States)

    1993-09-01

    Effects of modafinil on the nocturnal activity and behavioural sleep of rhesus monkeys (Maccaca mulatta). Medical Science Research, 18, 397-399...vigilance and tracking performance in a 13.5-h sustained-performance session during a night of sleep loss. At 0116 hours, seven subjects were... sleep loss. DTIO QUAI.TY INSPECTE-tD 5 .I IC I Of ...................................................... i .’I ; )I ACKNOWLEDGEMENTS In particular, we

  7. Elastic and inelastic scattering of 11 MeV protons on 64Zn, 66Zn, 68Zn isotopes

    International Nuclear Information System (INIS)

    Beurtey, R.; Catillon, P.; Chaminade, R.; Faraggi, H.; Papineau, A.; Thirion, J.

    1960-01-01

    The elastic and inelastic scattering of 11 MeV protons on separated isotopes of zinc (64, 66, 68) is presented. The curves of elastic scattering exhibit differences which will be compared with theoretical curves in a later article. Inelastic spectra with good resolution are studied and the curves corresponding to the first excited state obtained. Theoretical computations are in progress. Reprint of a paper published in Nuclear Physics, 13, p. 397-406, 1959

  8. Solving the Principal - Agent Problem in Iraq: Economic Incentives Create a New Model for Security

    Science.gov (United States)

    2007-12-01

    93(1), 397-405. Retrieved March 8, 2007 from JSTOR . 109 International Monetary Fund (IMF). (2007). African department database , March 29, 2007...Battle resumes over Iraq’s oil law. EIU ViewsWire. Retrieved November 2, 2007, from ABI/INFORM Global database . (Document ID: 1367901531). Eifert, B...Managerial and Decision Economics (1986-1998), 18(7/8), 529. Retrieved October 4, 2007, from ABI/INFORM Global database . (Document ID: 408937331

  9. JBSC_42_3_0501_0508_SI.docx

    Indian Academy of Sciences (India)

    Ashis Nandi

    C, GUS expression in the individual transgenic lines. Supplementary figure 5. cDNA sequence of OsMYC2-1. The bold and underlined sequence denotes the 397 bp region that was used as siRNA target. Supplementary figure 6. Generation of transgenic rice plants with OsMYC2-1 siRNA construct. A, Diagram of the vector ...

  10. Strategic Utility of the Russian Spetsnaz

    Science.gov (United States)

    2016-12-01

    Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington, VA 22202-4302, and to the Office of Management and Budget, Paperwork Reduction Project...Westview Press; Arms and Armour Press, 1984), 397. 25 David Holloway, “Military Power and Political Purpose in Soviet Policy,” Daedalus 109, no. 4 (1980...to decline. Still, Brezhnev managed the crisis skillfully and declared that the aim of the Soviet Union was to accomplish strategic parity rather

  11. The effect of elevated ambient CO2 and temperature increase on rhizosphere of perennial ryegrass (Lolium perenne L.)

    Czech Academy of Sciences Publication Activity Database

    Šantrůčková, Hana; Elhottová, Dana; Loiseau, P.; Soussana, F.

    2000-01-01

    Roč. 46, č. 9 (2000), s. 397-403 ISSN 0370-663X R&D Projects: GA ČR GA206/99/1410 Grant - others:-(EV) EV5V-CT92-0169 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 123100004 Subject RIV: EF - Botanics Impact factor: 0.256, year: 2000

  12. Theoretical study on ground-state proton/H-atom exchange in formic ...

    Indian Academy of Sciences (India)

    Marx D, Tuckerman M E, Hutter J and Parrinello M. 1999 Nature 397 601. 4. Agarwal P K, Webb S P and Hammes-Schiffer S 2000. J. Am. Chem. Soc. 122 4803. 5. Geissler P L, Dellago C, Chandler D, Hutter J and. Parrinello M 2001 Science 291 2121. 6. Rini M, Magnes B Z, Pines E and Nibbering E T J 2003. Science 301 ...

  13. A new entodiniomorphid ciliate, Troglocorys cava n. g., n. sp., from the wild eastern chimpanzee (Pan troglodytes schweinfurthii) from Uganda

    Czech Academy of Sciences Publication Activity Database

    Tokiwa, T.; Modrý, David; Ito, A.; Pomajbíková, K.; Petrželková, Klára Judita; Imai, S.

    2010-01-01

    Roč. 57, č. 2 (2010), s. 115-120 ISSN 1066-5234 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Infraciliature * Kalinzu Forest * protozoa * scanning electron microscopy Subject RIV: EG - Zoology Impact factor: 2.397, year: 2010

  14. 1998年の奈良県における小児急性神経疾患の発生状況

    OpenAIRE

    西野, 正人; 吉岡, 章

    1999-01-01

    A regional survey of the incidence of several acute infantile neurological disorders in 1998 was performed in Nara subsequently to 1997, concerning the incidence of adverse effects in preventive vaccinations. The total number (397) of cases reported in 1998 was very similar to that (394) in 1997, and the numbers of each neurological disease were also close to those in the previous year. The most frequent disorder in the survey was aseptic meningitis with 254 cases, while the second was epilep...

  15. A series of hybrid P450 BM3 enzymes with different catalytic activity in the light-initiated hydroxylation of lauric acid.

    Science.gov (United States)

    Tran, Ngoc-Han; Huynh, Ngoc; Chavez, Garrett; Nguyen, Angelina; Dwaraknath, Sudharsan; Nguyen, Thien-Anh; Nguyen, Maxine; Cheruzel, Lionel

    2012-10-01

    We have developed a series of hybrid P450 BM3 enzymes to perform the light-activated hydroxylation of lauric acid. These enzymes contain a Ru(II)-diimine photosensitizer covalently attached to single cysteine residues of mutant P450 BM3 heme domains. The library of hybrid enzymes includes four non-native single cysteine mutants (K97C, Q397C, Q109C and L407C). In addition, mutations around the heme active site, F87A and I401P, were inserted in the Q397C mutant. Two heteroleptic Ru(II) complexes, Ru(bpy)(2)phenA (1) and Ru(phen)(2)phenA (2) (bpy=bipyridine, phen=1,10-phenanthroline, and phenA=5-acetamido-1,10-phenanthroline), are used as photosensitizers. Upon visible light irradiation, the hybrid enzymes display various total turnover numbers in the hydroxylation of lauric acid, up to 140 for the L407C-1 mutant, a 16-fold increase compared to the F87A/Q397C-1 mutant. CO binding studies confirm the ability of the photogenerated Ru(I) compound to reduce the fraction of ferric high spin species present in the mutants upon substrate binding. Published by Elsevier Inc.

  16. Independent Emergence of the Cosmopolitan Asian Chikungunya Virus, Philippines 2012.

    Science.gov (United States)

    Tan, Kim-Kee; Sy, Ava Kristy D; Tandoc, Amado O; Khoo, Jing-Jing; Sulaiman, Syuhaida; Chang, Li-Yen; AbuBakar, Sazaly

    2015-07-23

    Outbreaks involving the Asian genotype Chikungunya virus (CHIKV) caused over one million infections in the Americas recently. The outbreak was preceded by a major nationwide outbreak in the Philippines. We examined the phylogenetic and phylogeographic relationships of representative CHIKV isolates obtained from the 2012 Philippines outbreak with other CHIKV isolates collected globally. Asian CHIKV isolated from the Philippines, China, Micronesia and Caribbean regions were found closely related, herein denoted as Cosmopolitan Asian CHIKV (CACV). Three adaptive amino acid substitutions in nsP3 (D483N), E1 (P397L) and E3 (Q19R) were identified among CACV. Acquisition of the nsP3-483N mutation in Compostela Valley followed by E1-397L/E3-19R in Laguna preceded the nationwide spread in the Philippines. The China isolates possessed two of the amino acid substitutions, nsP3-D483N and E1-P397L whereas the Micronesian and Caribbean CHIKV inherited all the three amino acid substitutions. The unique amino acid substitutions observed among the isolates suggest multiple independent virus dissemination events. The possible biological importance of the specific genetic signatures associated with the rapid global of the virus is not known and warrant future in-depth study and epidemiological follow-up. Molecular evidence, however, supports the Philippines outbreak as the possible origin of the CACV.

  17. Focal adhesion protein abnormalities in myelodysplastic mesenchymal stromal cells

    Energy Technology Data Exchange (ETDEWEB)

    Aanei, Carmen Mariana, E-mail: caanei@yahoo.com [Laboratoire Hematologie, CHU de Saint-Etienne, 42055, Saint-Etienne (France); Department of Immunology, Gr. T. Popa University of Medicine and Pharmacy, 700115, Iasi (Romania); Eloae, Florin Zugun [Department of Immunology, Gr. T. Popa University of Medicine and Pharmacy, 700115, Iasi (Romania); Flandrin-Gresta, Pascale [Laboratoire Hematologie, CHU de Saint-Etienne, 42055, Saint-Etienne (France); CNRS UMR 5239, Universite de Lyon, 42023, Saint-Etienne (France); Tavernier, Emmanuelle [Service Hematologie Clinique, Institut de Cancerologie de la Loire, 42270, Saint-Priest-en-Jarez (France); CNRS UMR 5239, Universite de Lyon, 42023, Saint-Etienne (France); Carasevici, Eugen [Department of Immunology, Gr. T. Popa University of Medicine and Pharmacy, 700115, Iasi (Romania); Guyotat, Denis [Service Hematologie Clinique, Institut de Cancerologie de la Loire, 42270, Saint-Priest-en-Jarez (France); CNRS UMR 5239, Universite de Lyon, 42023, Saint-Etienne (France); Campos, Lydia [Laboratoire Hematologie, CHU de Saint-Etienne, 42055, Saint-Etienne (France); CNRS UMR 5239, Universite de Lyon, 42023, Saint-Etienne (France)

    2011-11-01

    Direct cell-cell contact between haematopoietic progenitor cells (HPCs) and their cellular microenvironment is essential to maintain 'stemness'. In cancer biology, focal adhesion (FA) proteins are involved in survival signal transduction in a wide variety of human tumours. To define the role of FA proteins in the haematopoietic microenvironment of myelodysplastic syndromes (MDS), CD73-positive mesenchymal stromal cells (MSCs) were immunostained for paxillin, pFAK [Y{sup 397}], and HSP90{alpha}/{beta} and p130CAS, and analysed for reactivity, intensity and cellular localisation. Immunofluorescence microscopy allowed us to identify qualitative and quantitative differences, and subcellular localisation analysis revealed that in pathological MSCs, paxillin, pFAK [Y{sup 397}], and HSP90{alpha}/{beta} formed nuclear molecular complexes. Increased expression of paxillin, pFAK [Y{sup 397}], and HSP90{alpha}/{beta} and enhanced nuclear co-localisation of these proteins correlated with a consistent proliferative advantage in MSCs from patients with refractory anaemia with excess blasts (RAEB) and negatively impacted clonogenicity of HPCs. These results suggest that signalling via FA proteins could be implicated in HPC-MSC interactions. Further, because FAK is an HSP90{alpha}/{beta} client protein, these results suggest the utility of HSP90{alpha}/{beta} inhibition as a target for adjuvant therapy for myelodysplasia.

  18. Investigation on estrogen receptor alpha gene polymorphisms in Iranian women with recurrent pregnancy loss

    Science.gov (United States)

    Mahdavipour, Marzieh; Idali, Farah; Zarei, Saeed; Talebi, Saeed; Fatemi, Ramina; Jeddi-Tehrani, Mahmood; Pahlavan, Somayeh; Rajaei, Farzad

    2014-01-01

    Background: Recurrent pregnancy loss (RPL) is a multifactorial disorder. Environmental factors and genetics can affect pregnancy outcomes. Objective: Conflicting data suggest an association between estrogen receptor alpha (ESR1) gene polymorphisms and RPL. In this study, such association was investigated in Iranian women with RPL. Materials and Methods: In this case control study, blood samples were collected from 244 women with a history of three or more consecutive pregnancy losses and 104 healthy women with at least two live births. Using polymerase chain reaction- restriction fragment length polymorphism (PCR-RFLP), we studied -397C/T and -351A/G polymorphisms on ESR1 gene in case and control subjects. Results: The genotypic frequencies of -397C/T and -351A/G polymorphisms on ESR1were not significantly different between RPL and control groups (p=0.20 and p=0.09, respectively). A significantly negative correlation was observed between -397C/T and -351A/G (r=-0.852, p<0.001) in RPL women and complete linkage disequilibrium between the investigated polymorphisms was found (D’: 0.959; r-square= 0.758, p<0.001). Conclusion: This investigation suggests that the analyzed polymorphisms on ESR1gene are not associated with an increased risk of RPL in the studied population. PMID:25071847

  19. Estrogen receptor 1 gene polymorphisms and coronary artery disease in the Brazilian population

    Directory of Open Access Journals (Sweden)

    Almeida S.

    2006-01-01

    Full Text Available We examined the association of three established single nucleotide polymorphisms, IVS1-397T>C, IVS1-351A>G, and +261G>C, in the ESR1 gene with the prevalence and severity of coronary atherosclerosis in a southern Brazilian population of European ancestry. Three hundred and forty-one subjects (127 women and 214 men with coronary artery disease (CAD were classified as having significant disease (CAD+ patient group when they showed 60% or more luminal stenosis in at least one coronary artery or major branch segment at angiography; patients with 10% or less luminal stenosis were considered to have minimal CAD (CAD- patient group. The control sample consisted of 142 subjects (79 women and 63 men without significant disease, in whom coronary angiography to rule out the presence of asymptomatic CAD was not performed. The polymorphisms were investigated by polymerase chain reaction followed by restriction analyses. In the male sample, the +261G>C*C allele was more frequent in CAD+ than CAD- subjects (8 versus 1%, P = 0.024. Homozygosity for the C allele of the IVS1-397T>C polymorphism was also significantly associated with increased CAD severity (OR: 2.99; 95% CI = 1.35-6.63; P = 0.007. In agreement with previous findings, these results suggest that the IVS1-397T>C*C allele was associated with CAD severity independent of gender, whereas the association of the +261G>C variant with CAD was observed in males only. The relation between ESR1 variation and CAD may influence clinical decisions such as the use of hormone therapy, and additionally will be helpful to identify the genetic susceptibility determinants of cardiovascular disease development.

  20. Tyrosine Phosphorylation of Caspase-8 Abrogates Its Apoptotic Activity and Promotes Activation of c-Src

    Science.gov (United States)

    Tsang, Jennifer LY; Jia, Song Hui; Parodo, Jean; Plant, Pamela; Lodyga, Monika; Charbonney, Emmanuel; Szaszi, Katalin; Kapus, Andras; Marshall, John C.

    2016-01-01

    Src family tyrosine kinases (SFKs) phosphorylate caspase-8A at tyrosine (Y) 397 resulting in suppression of apoptosis. In addition, the phosphorylation of caspase-8A at other sites including Y465 has been implicated in the regulation of caspase-8 activity. However, the functional consequences of these modifications on caspase-8 processing/activity have not been elucidated. Moreover, various Src substrates are known to act as potent Src regulators, but no such role has been explored for caspase-8. We asked whether the newly identified caspase-8 phosphorylation sites might regulate caspase-8 activation and conversely, whether caspase-8 phosphorylation might affect Src activity. Here we show that Src phosphorylates caspase-8A at multiple tyrosine sites; of these, we have focused on Y397 within the linker region and Y465 within the p12 subunit of caspase-8A. We show that phosphomimetic mutation of caspase-8A at Y465 prevents its cleavage and the subsequent activation of caspase-3 and suppresses apoptosis. Furthermore, simultaneous phosphomimetic mutation of caspase-8A at Y397 and Y465 promotes the phosphorylation of c-Src at Y416 and increases c-Src activity. Finally, we demonstrate that caspase-8 activity prevents its own tyrosine phosphorylation by Src. Together these data reveal that dual phosphorylation converts caspase-8 from a pro-apoptotic to a pro-survival mediator. Specifically, tyrosine phosphorylation by Src renders caspase-8 uncleavable and thereby inactive, and at the same time converts it to a Src activator. This novel dynamic interplay between Src and caspase-8 likely acts as a potent signal-integrating switch directing the cell towards apoptosis or survival. PMID:27101103

  1. Rhizobium nepotum sp. nov. isolated from tumors on different plant species.

    Science.gov (United States)

    Puławska, Joanna; Willems, Anne; De Meyer, Sofie E; Süle, Sandor

    2012-06-01

    Five Gram-negative, rod-shaped, non-spore-forming bacteria were isolated from galls on different plant species in Hungary: strain 39/7(T) from Prunus cerasifera Myrobalan, strain 0 from grapevine var. Ezerjó, strain 7/1 from raspberry var. Findus and in Poland, strain C3.4.1 from Colt rootstock (Prunus avium × Prunus pseudocerasus) and strain CP17.2.2 from Prunus avium. Only one of these isolates, strain 0, is able to cause crown gall on different plant species. On the basis of 16S rRNA gene sequence similarity, the strains cluster together and belong to the genus Rhizobium and their closest relative is Rhizobium radiobacter (99.1%). Phylogenetic analysis of the novel strains using housekeeping genes atpD, glnA, gyrB, recA and rpoB revealed their distinct position separate from other known Rhizobium species and confirmed their relation to Rhizobium radiobacter. The major cellular fatty acids are 18:1 w7c, 16:0, 16:0 3OH, summed feature 2 (comprising 12:0 aldehyde, 16:1 iso I and/or 14:0 3OH) and summed feature 3 (comprising 16:1 w7c and/or 15 iso 2OH). DNA-DNA hybridization of strain 39/7(T) with the type strain of R. radiobacter LMG 140(T) revealed 45% DNA-DNA hybridization. Phenotypic and physiological properties differentiate the novel isolates from other closely related species. On the basis of the results obtained, the five isolates are considered to represent a novel species of the genus Rhizobium, for which the name Rhizobium nepotum sp. nov. (type strain 39/7(T)=LMG 26435(T)=CFBP 7436(T)) is proposed. Copyright © 2012 Elsevier GmbH. All rights reserved.

  2. INCREASES IN CORE TEMPERATURE COUNTERBALANCE EFFECTS OF HEMOCONCENTRATION ON BLOOD VISCOSITY DURING PROLONGED EXERCISE IN THE HEAT

    Science.gov (United States)

    Buono, Michael J.; Krippes, Taylor; Kolkhorst, Fred W.; Williams, Alexander T.; Cabrales, Pedro

    2015-01-01

    Previous studies have reported that blood viscosity is significantly increased following exercise. However, these studies measured both pre- and post-exercise blood viscosity at 37 °C even though core and blood temperatures would be expected to have increased during the exercise. Consequently, the effect of exercise-induced hyperthermia on mitigating change in blood viscosity may have been missed. The purpose of this study was to isolate the effects of exercise-induced hemoconcentration and hyperthermia, as well as determine their combined effects, on blood viscosity. Nine subjects performed 2 h of moderate-intensity exercise in the heat (37 °C, 40% rH), which resulted in significant increases from pre-exercise values for rectal temperature (37.11 ± 0.35 °C to 38.76 ± 0.13 °C), hemoconcentration (hematocrit = 43.6 ± 3.6% to 45.6 ± 3.5%), and dehydration (Δbody weight = −3.6 ± 0.7%). Exercise-induced hemoconcentration significantly (P viscosity by 9% (3.97 to 4.30 cP at 300 s−1) while exercise-induced hyperthermia significantly decreased blood viscosity by 7% (3.97 to 3.70 cP at 300 s−1). However, when both factors were considered together, there was no overall change in blood viscosity (3.97 to 4.03 cP at 300 s−1). The effects of exercise-induced hemoconcentration, increased plasma viscosity, and increased red blood cell aggregation, all of which increased blood viscosity, were counterbalanced by increased RBC deformability (e.g., RBC membrane shear elastic modulus and elongation index) caused by the hyperthermia. Thus, blood viscosity remained unchanged following prolonged moderate-intensity exercise in the heat. PMID:26682653

  3. The Effect of Roundtable and Clustering Teaching Techniques and Students’ Personal Traits on Students’ Achievement in Descriptive Writing

    Directory of Open Access Journals (Sweden)

    Megawati Sinaga

    2017-12-01

    Full Text Available The Objectives of this paper as an experimental research was to investigate the effect of Roundtable and Clustering teaching techniques and students’ personal traits on students’ achievement in descriptive writing. The students in grade ix of SMP Negeri 2 Pancurbatu 2016/2017 school academic year were chose as the population of this research.. The research design was experimental research by using factorial design 2x2. The students were divided into two experimental groups. The experimental group was treated by using Roundtable teaching technique and control group was treated by using Clustering teaching technique. The students are classified into the introvert and extrovert personal traits by conducting the questionnaire and the students’ achievement in descriptive writing was measured by using writing test, namely ‘Analytic Scoring’ by Weigle. The data were analyzed by applying two-way analysis of variance (ANOVA at the level of significance α = 0.05. The result reveals that (1 students’ achievement in descriptive writing taught by using  Roundtable teaching technique was higher than that taught by Clustering teaching technique, with Fobs = 4.59>Ftab=3.97, (2 students’ achievement in descriptive writing with introvert  personal trait was higher than that with extrovert personal traits with Fobs=4.90 Ftable=3.97, (3 there is interaction between teaching techniques and personal traits on students’ achievement in descriptive writing with Fobs =6,58 Ftable=3.97. After computing the Tuckey-Test, the result showed that introvert students got higher achievement if they were taught by using Roundtable teaching technique while extrovert students got higher achievement if they were taught by using Clustering teaching technique.

  4. Spectral and photophysical properties of α-carboline (1-azacarbazole) in aqueous solutions.

    Science.gov (United States)

    García-Fernández, Emilio; Carmona, Carmen; Muñoz, María A; Hidalgo, José; Balón, Manuel

    2012-05-01

    The absorption and fluorescence spectra of α-carboline, 9H-pyrido[2,3-b]indole, AC, in organic aprotic solvents containing different water proportions and in acid/base aqueous solutions inside and outside the pH range have been examined. In the organic aprotic solvents, the addition of increasing concentrations of water sequentially quenches and shifts to the red the fluorescence spectra of AC. These spectral changes have been rationalized assuming the formation, at the lower water concentrations, of a discrete ground state non-cyclic weakly fluorescent AC hydrate emitting at 376 nm that, upon increasing the water concentrations, evolves to a higher order AC poly hydrate emitting at 397 nm. The changes of the AC absorption spectra in aqueous acid/basic solutions indicate the existence of three ground state prototropic species; the pyridinic protonated cation, C (pK(a) = 4.10 ± 0.05), the neutral, N (pK(a) = 14.5 ± 0.2), and the pyrrolic deprotonated anion, A. Conversely, the changes of the AC fluorescence spectra in these media indicate the existence of four excited state species emitting at 376 nm, 397 nm, 460 nm and 465 nm. Since the emissions at 376 nm and 397 nm satisfactorily match those of the hydrates observed in the organic-water mixtures, they were consistently assigned to two differently hydrated ground state N species. The remaining emissions at 460 nm and 465 nm have been assigned without ambiguity, on the basis of their excitation spectra, to the C and A species, respectively. The excited-state pK(a)s of the prototropic species of AC have been estimated by using the Förster-Weller cycle.

  5. Neutropenia in infants with hemolytic disease of the newborn.

    Science.gov (United States)

    Blanco, Esther; Johnston, Donna L

    2012-06-01

    This study examined the incidence, outcome and risk factors of neutropenia in infants with hemolytic disease of the newborn (HDN). A retrospective chart review was performed on infants with HDN. Of 69 evaluable infants, 45% developed neutropenia. Only one infectious complication was recorded. In most instances the neutropenia resolved spontaneously, but in seven infants it persisted for a median of 397 days. Males were at higher risk for developing neutropenia, but severity of HDN, antibody specificity, or therapy were not significant risk factors. Neutropenia is a common feature of HDN, regardless of severity of disease, treatment received, or antibody specificity. Copyright © 2011 Wiley Periodicals, Inc.

  6. Fibre Optic Sensors Using Adiabatically Tapered Single Mode Fibres

    Science.gov (United States)

    1994-02-01

    Membrane L!2ht Scurce ,ettor ([3Iar~nca] Property ImmobilIzatIon Optical Flba UAnpLl Dynamoc Range SeMfle Su art Arran ramene ,-t n i esuaorn Tlrrm...8217Solution-deposited thin films as passive and active light guides’, Applied Optics, 1972, 11, No 2, pp. 428-34. 397. Urbano , E. , H. Offenbacher, O.S...Chimica Acta, 1988, 208, pp. 53-8. 427. Wolfbeis, O.S., E. Urbano , ’A fluorimetric, heavy-metal-free method for the analysis of chlorine, bromine, and

  7. Characterization of nutritional status, enteroparasitosis and socio-environmental conditions of the infant-juvenile population from La Plata department

    OpenAIRE

    Oyhenart, Evelia Edith; Garraza, Mariela; Bergel, María L.; Torres, María Fernanda; Castro, Luis Eduardo; Luis, María Antonia; Forte, Luis M.; Gamboa, María Inés; Zonta, María Lorena; Cesani Rossi, María Florencia; Quintero, Fabián; Luna, Maria E.; Navone, Graciela Teresa

    2013-01-01

    En el presente trabajo se caracterizaron el estado nutricional, las enteroparasitosis y las condiciones socio-ambientales de niños residentes en el Casco urbano y 11 localidades del Partido de La Plata, provincia de Buenos Aires, mediante un estudio transversal. Se midieron peso y talla de 6.397 niños entre 4.0 y 13.9 años. Se calculó el índice de masa corporal y se estimó el estado nutricional utilizando NHANES III. Las variables socio-ambientales se relevaron mediante encuesta estructurada....

  8. Caracterización del estado nutricional, enteroparasitosis y condiciones socio-ambientales de la población infanto-juvenil del partido de La Plata

    OpenAIRE

    Oyhenart, Evelia Edith; Garraza, Mariela; Bergel Sanchís, María Laura; Torres, María Fernanda; Castro, Luis E.; Luis, Maria A.; Forte, Luis M.; Gamboa, Maria I.; Zonta, Maria Lorena; Cesani Rossi, María Florencia; Quintero, Fabian A.; Luna, Maria Eugenia; Navone, Graciela Teresa

    2017-01-01

    En el presente trabajo se caracterizaron el estado nutricional, las enteroparasitosis y las condiciones socio-ambientales de niños residentes en el Casco urbano y 11 localidades del Partido de La Plata, provincia de Buenos Aires, mediante un estudio transversal. Se midieron peso y talla de 6.397 niños entre 4.0 y 13.9 años. Se calculó el índice de masa corporal y se estimó el estado nutricional utilizando NHANES III. Las variables socio-ambientales se relevaron mediante encuesta estructurada....

  9. Trial Characteristics as Contextual Factors when Evaluating Targeted Therapies in Patients with Psoriatic Disease

    DEFF Research Database (Denmark)

    Ballegaard, Christine; Jørgensen, Tanja S; Skougaard, Marie

    2018-01-01

    characteristics in stratified and meta-regression analyses. Odds ratios (OR) were calculated and compared among the trial eligibility criteria via the Ratio of Odds Ratios (ROR). RESULTS: Forty-eight PsA and psoriasis trials (51 comparisons, 17,737 patients) were eligible. Overall retention was OR 2.16 (1.70 to 2.......75) with higher odds for PsA trials compared with psoriasis trials (ROR = 2.55 [1.64 to 3.97]). The eligibility criteria "targeted therapy history", "minimum required disease duration", "required negative rheumatoid factor", and "required CASPAR criteria" were of importance for achieving ACR20 in Ps...

  10. A study on women's junior college students' eating habits (Part 3) : The difference of eating habits in student living style

    OpenAIRE

    山岸, 恵美子; 牛越, 静子

    1992-01-01

    We examined the difference of eating habits in the life styles of 397 students of Nagano Prefectual Women’s Junior College.The results are as follows.(1) Talking of breakfast, commuting students eat at about 7 o’clock, but boarding and dormitory students including those who cook for themselves about 8.The rising time through breakfast time is 21 and 34 minutes respectively.Both students have lunch at noon, but boarding and dormitory students have supper at about six thirty, and students who c...

  11. Thermophysical properties of composite fuel based on T grade coal (Alardinskoe deposit) and timber industry wastes

    Science.gov (United States)

    Yankovsky, S. A.; Tolokolnikov, A. A.; Gubin, V. E.; Slyusarskiy, K. V.; Zenkov, A. V.

    2017-09-01

    Results of experimental studies of composite fuel thermal decomposition processes based on T grade coal (Alardinskoe deposit) and timber industry wastes (fine wood) are presented. C, H, N, S weight percentage of each component of composite fuel was determined experimentally. It has been established that with an increase in wood concentration up to 50% in composite fuel, its energy characteristics decrease by less than 3.6%, while the yield of fly ash is 39.7%. An effective composite fuel composition has been defined as 50%/50%. Results of performed experimental studies suggest that it is possible to use composite fuels based on coal and wood at thermal power plants.

  12. in deutero‑isaiah

    African Journals Online (AJOL)

    14; 45:11; 47:4; 48:17; 49:7; 54:5; 55:5; 60:9, 14) and just 7 times in other Old. Testament books (see 2 Kegs. 19:22; Ps. 71:22; Ps. 78:41; Ps. 89:19; Jer. 50:29;. Jer. 51:5; Ezek. 39:7). 7 Oswalt (1998:33) comments the significance of qādôš in Isaiah is without question, because it is used by the prophet as the salient defining ...

  13. Perioperative Myocardial Injury After Noncardiac Surgery: Incidence, Mortality, and Characterization.

    Science.gov (United States)

    Puelacher, Christian; Lurati Buse, Giovanna; Seeberger, Daniela; Sazgary, Lorraine; Marbot, Stella; Lampart, Andreas; Espinola, Jaqueline; Kindler, Christoph; Hammerer, Angelika; Seeberger, Esther; Strebel, Ivo; Wildi, Karin; Twerenbold, Raphael; du Fay de Lavallaz, Jeanne; Steiner, Luzius; Gurke, Lorenz; Breidthardt, Tobias; Rentsch, Katharina; Buser, Andreas; Gualandro, Danielle M; Osswald, Stefan; Mueller, Christian

    2018-03-20

    Perioperative myocardial injury (PMI) seems to be a contributor to mortality after noncardiac surgery. Because the vast majority of PMIs are asymptomatic, PMI usually is missed in the absence of systematic screening. We performed a prospective diagnostic study enrolling consecutive patients undergoing noncardiac surgery who had a planned postoperative stay of ≥24 hours and were considered at increased cardiovascular risk. All patients received a systematic screening using serial measurements of high-sensitivity cardiac troponin T in clinical routine. PMI was defined as an absolute high-sensitivity cardiac troponin T increase of ≥14 ng/L from preoperative to postoperative measurements. Furthermore, mortality was compared among patients with PMI not fulfilling additional criteria (ischemic symptoms, new ECG changes, or imaging evidence of loss of viable myocardium) required for the diagnosis of spontaneous acute myocardial infarction versus those that did. From 2014 to 2015 we included 2018 consecutive patients undergoing 2546 surgeries. Patients had a median age of 74 years and 42% were women. PMI occurred after 397 of 2546 surgeries (16%; 95% confidence interval, 14%-17%) and was accompanied by typical chest pain in 24 of 397 patients (6%) and any ischemic symptoms in 72 of 397 (18%). Crude 30-day mortality was 8.9% (95% confidence interval [CI], 5.7-12.0) in patients with PMI versus 1.5% (95% CI, 0.9-2.0) in patients without PMI ( P PMI not fulfilling any other of the additional criteria required for spontaneous acute myocardial infarction (280/397, 71%) versus those with at least 1 additional criterion (10.4%; 95% CI, 6.7-15.7, versus 8.7%; 95% CI, 4.2-16.7; P =0.684). PMI is a common complication after noncardiac surgery and, despite early detection during routine clinical screening, is associated with substantial short- and long-term mortality. Mortality seems comparable in patients with PMI not fulfilling any other of the additional criteria required for

  14. Patient reported outcomes in patients undergoing arthroscopic partial meniscectomy for traumatic or degenerative meniscal tears

    DEFF Research Database (Denmark)

    Thorlund, Jonas Bloch; Englund, Martin; Christensen, Robin

    2017-01-01

    -55, and undergoing arthroscopic partial meniscectomy for a traumatic or degenerative meniscal tear (defined by a combination of age and symptom onset). INTERVENTIONS: Both participant groups underwent arthroscopic partial meniscectomy for a meniscal tear, with operating surgeons recording relevant information......, sport and recreational function, and quality of life (KOOS4). A 95% confidence interval excluding differences greater than 10 KOOS points between groups was interpreted as absence of a clinically meaningful difference. Analyses adjusted for age, sex, and body mass index. RESULTS: 397 eligible adults (42...

  15. Exceptional gravimetric and volumetric CO2 uptake in a palladated NbO-type MOF utilizing cooperative acidic and basic, metal-CO2 interactions.

    Science.gov (United States)

    Spanopoulos, I; Bratsos, I; Tampaxis, C; Vourloumis, D; Klontzas, E; Froudakis, G E; Charalambopoulou, G; Steriotis, T A; Trikalitis, P N

    2016-08-18

    A novel NbO-type MOF is reported based on a palladated organic linker, showing a remarkable gravimetric and volumetric CO2 uptake, reaching 201.8 cm(3) g(-1) (9.0 mmol g(-1), 39.7 wt%) and 187.8 cm(3) cm(-3) at 273 K and 1 bar, respectively. Accurate theoretical calculations revealed that the exceptional CO2 uptake is due to the combination of Lewis base Pd(ii)-CO2 (24.3 kJ mol(-1)) and Lewis acid Cu(ii)-CO2 (30.3 kJ mol(-1)) interactions, as well as synergistic pore size effects.

  16. Enfoques de aprendizaje en estudiantes universitarios de Buenos Aires

    OpenAIRE

    Freiberg Hoffmann, Agustín; Fernández Liporace, Mercedes; Ledesma, Rubén

    2017-01-01

    Introducción: Los enfoques de aprendizaje aluden a la predisposición para aprender en diferentes situaciones académicas. Objetivo: Se analizan estos enfoques (tipos profundo y superficial) en estudiantes universitarios de Buenos Aires. Metodología: Participaron 397 estudiantes de diferentes Facultades (Exactas y Naturales, Psicología, Ingeniería, Derecho, Medicina) entre 18 y 36 años. Resultados: Los resultados mostraron diferencias según sexo en los enfoque profundo y superficial, favorables...

  17. A comparison of DNA binding profiles of dinuclear platinum compounds with polyamine linkers and the trinuclear platinum phase II clinical agent BBR3464

    Czech Academy of Sciences Publication Activity Database

    McGregor, T. D.; Hegmans, A.; Kašpárková, Jana; Neplechová, Kamila; Nováková, Olga; Peňázová, Hana; Vrána, Oldřich; Brabec, Viktor; Farrel, N.

    2002-01-01

    Roč. 7, 4/5 (2002), s. 397-404 ISSN 0949-8257 R&D Projects: GA ČR GA305/99/0695; GA ČR GA301/00/0556; GA ČR GA301/98/P231; GA AV ČR IAA5004101; GA AV ČR IAA7004805 Institutional research plan: CEZ:AV0Z5004920 Keywords : unwinding * dinuclear platinum * hydrogen bonding Subject RIV: BO - Biophysics Impact factor: 3.911, year: 2002

  18. Evading the Boomerang Effect

    DEFF Research Database (Denmark)

    Laursen, Keld; Moreira, Solon; Reichstein, Toke

    2017-01-01

    Technology licensing agreements potentially can create future appropriability problems. Drawing on the appropriability literature, we argue that the inclusion of a grant-back clause in technology licensing agreements is an attempt to balance the gains from and protection of the focal firms’ techn...... the hypotheses on a sample of 397 licensed technologies. This method allows us to model the choice to include a grant-back clause as nested in the decision about which technologies to license out. We find broad support for our theoretical arguments....

  19. Pace studying worldwide coke production

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    Pace Consultants Inc., Houston, has started a multiclient study of world-wide petroleum coke production, examining environmental initiatives and eventually forecasting prices of fuel grade coke. Pace expects coker expansions, increased operating severity, and reduced cycle times to boost coke supply to more than 50 million metric tons/year in 2000, compared with 39.7 million metric tons in 1992. Increased supply and tightened environmental rules in countries consuming large amounts of petroleum coke will be the main factors affecting coke markets. The paper discusses coke quality and the Japanese market

  20. Batch production of L(+) lactic acid from whey by Lactobacillus casei (NRRL B-441)

    OpenAIRE

    Büyükkileci, Ali Oğuz; Harsa, Hayriye Şebnem

    2004-01-01

    The effects of temperature, pH, and medium composition on lactic acid production by Lactobacillus casei were investigated. The highest lactic acid productivity values were obtained at 37 °C and pH 5.5. The productivity was 1.87 g dm-3 h-1 at 37 °C in shake flasks. In the fermenter, a productivity of 3.97 g dm-3 h-1 was obtained at pH 5.5. The most appropriate yeast extract concentration was 5.0 g dm-3. Whey yielded a higher productivity value than the analytical lactose and glucose. Initial w...

  1. Induced Proton Polarization for pi0 Electroproduction at Q2 = 0.126 GeV2/c2 Around the Delta(1232) Resonance

    International Nuclear Information System (INIS)

    Glen Warren; Ricardo Alarcon; Christopher Armstrong; Burin Asavapibhop; David Barkhuff; William Bertozzi; Volker Burkert; Chen, J.; Jian-Ping Chen; Joseph Comfort; Daniel Dale; George Dodson; Dolfini, S.; Dow, K.; Martin Epstein; Manouchehr Farkhondeh; John Finn; Shalev Gilad; Ralf Gothe; Xiaodong Jiang; Mark Jones; Kyungseon Joo; Karabarbounis, A.; James Kelly; Stanley Kowalski; Kunz, C.; Liu, D.; Lourie, R.W.; Richard Madey; Demetrius Margaziotis; Pete Markowitz; Justin McIntyre; Mertz, C.; Brian Milbrath; Rory Miskimen; Joseph Mitchell; Mukhopadhyay, S.; Costas Papanicolas; Charles Perdrisat; Vina Punjabi; Liming Qin; Paul Rutt; Adam Sarty; Jeffrey Shaw; Soong, S.B.; Tieger, D.; Christoph Tschalaer; William Turchinetz; Paul Ulmer; Scott Van Verst; Vellidis, C.; Lawrence Weinstein; Steven Williamson; Rhett Woo; Alaen Young

    1998-01-01

    We present a measurement of the induced proton polarization P n in π 0 electroproduction on the proton around the Δ resonance. The measurement was made at a central invariant mass and a squared four-momentum transfer of W = 1231 MeV and Q 2 = 0.126 GeV 2 /c 2 , respectively. We measured a large induced polarization, P n = -0.397 ± 0.055 ± 0.009. The data suggest that the scalar background is larger than expected from a recent effective Hamiltonian model

  2. Identification of MHC class I H-2 Kb/Db-restricted immunogenic peptides derived from retinal proteins

    DEFF Research Database (Denmark)

    Wang, Mingjun; Bai, Fang; Pries, Mette

    2006-01-01

    -antigen), recoverin, phosducin, and pigment epithelium-derived factor (PEDF). The affinity of the peptides was analyzed by their abilities to upregulate the expression of major histocompatibility complex (MHC) class I on TAP-deficient cells (RMA-S cells) with flow cytometry. C57BL/6 mice were immunized subcutaneously......-397, PEDF139-147, and PEDF272-279, induced specific CTL responses in vivo, whereas the remaining 16 peptides, including 5 IRBP-derived peptides, 5 S-antigen-derived peptides, 1 recoverin-derived peptide, 1 phosducin-derived peptide, and 4 PEDF-derived peptides, did not induce specific CTL reactivity...

  3. New Fluidic-Oscillator Concept for Flow-Separation Control

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav; Zhong, S.; Rasheed, F.

    2013-01-01

    Roč. 51, č. 2 (2013), s. 397-405 ISSN 0001-1452 R&D Projects: GA ČR(CZ) GCP101/11/J019; GA TA ČR TA02020795; GA ČR GA13-23046S Institutional research plan: CEZ:AV0Z20760514 Institutional support: RVO:61388998 Keywords : fluidics * fluidic oscillator * resonator Subject RIV: BK - Fluid Dynamics Impact factor: 1.165, year: 2013 http://arc.aiaa.org/doi/abs/10.2514/1.J051791?journalCode=aiaaj

  4. COMPOSIÇÃO QUÍMICA E AVALIAÇÃO DA ATIVIDADE CARRAPATICIDA DO ÓLEO ESSENCIAL DE Cinnamomun zeylanicum NO CONTROLE DE Rhipicephalus microplus

    OpenAIRE

    ILDENICE NOGUEIRA MONTEIRO

    2013-01-01

    Os constituintes do óleo de Cinnamomum zeylanicum foram identificados por cromatografia gasosa acoplada à espectrometria de massas (CG-EM). Também foi avaliada a atividade deste óleo essencial contra larvas e fêmeas de Rhipicephalus microplus (carrapato bovino). O óleo das folhas mostrou um rendimento de 1,03% e seus principais constituintes foram Benzoato de Benzila (65,39%), Linalol (5,37%), E-Cinamaldeido (3,97%), α-Pineno (3,95%), β-Felandreno (3,42%), Eugenol (3,36%) e Benzalde...

  5. Serum insulin-like growth factors, insulin-like growth factor binding proteins, and breast cancer risk in postmenopausal women

    DEFF Research Database (Denmark)

    Grønbaek, Henning; Flyvbjerg, Allan; Mellemkjaer, Lene

    2004-01-01

    BACKGROUND: Studies have shown a positive association between serum insulin-like growth factor (IGF)-I and breast cancer risk in premenopausal but not postmenopausal women. IGF-II and estrogen receptor (ER) status has never been investigated. We examined the association between IGF-I, IGF-II, IGF...... cases with breast cancer and a matched control group including 397 cohort members. We estimated breast cancer risk using Cox regression analysis with adjustment for known breast cancer risk factors. RESULTS: We observed no association for IGF-I but a positive association between levels of IGFBP-3...

  6. Structures to Resist the Effects of Accidental Explosions

    Science.gov (United States)

    1990-11-01

    ication (Fed. Spec.) 6-150 TM 5-1300/NAVFAC P-397/AFR 88-22 TT-P-37D Paint, Alkyd Resin ; Exterior Trim, Deep Colors TT-P-645A Primer, Paint Zinc...2-197 2-156 Scaled gas impulse (W/Vf - 0.015, i,/W1ŗ - 20). ..................2-198 2-157 Scaled gas impulse (W/Vf - 0.015, ir ...W113 - 100) . . . . .... . 2-199 2-158 Scaled gas impulse (W/Vf - 0.015, ir :/W 113 600) .. ................2-200W 2-159 Scaled gas impulse (W/Vf - 0.15

  7. Glial cells and volume transmission in the CNS

    Czech Academy of Sciences Publication Activity Database

    Syková, Eva; Chvátal, Alexandr

    2000-01-01

    Roč. 36, - (2000), s. 397-409 ISSN 0197-0186 R&D Projects: GA ČR GV307/96/K226; GA ČR GV309/97/K048; GA ČR GA309/99/0657; GA ČR GA305/99/0655; GA MŠk VS96130 Institutional research plan: CEZ:AV0Z5039906 Keywords : ion homeostasis * glia * tortuossity Subject RIV: FH - Neurology Impact factor: 2.662, year: 2000

  8. Experimental performance of DWDM quadruple Vernier racetrack resonators.

    Science.gov (United States)

    Boeck, Robert; Flueckiger, Jonas; Chrostowski, Lukas; Jaeger, Nicolas A F

    2013-04-08

    We demonstrate that one can meet numerous commercial requirements for filters used in dense wavelength-division multiplexing applications using quadruple Vernier racetrack resonators in the silicon-on-insulator platform. Experimental performance shows a ripple of 0.2 dB, an interstitial peak suppression of 39.7 dB, an adjacent channel isolation of 37.2 dB, an express channel isolation of 10.2 dB, and a free spectral range of 37.52 nm.

  9. PENENTUAN KEUNTUNGAN MAKSIMUM PADA PENJUALAN OLAHAN TAPE DENGAN MENGGUNAKAN METODE LAGRANGE (Studi Kasus: UD. Sari Madu

    Directory of Open Access Journals (Sweden)

    FEMY AYU ASTITI

    2013-01-01

    Full Text Available Optimization problems can be solved by various methods, such as Lagrange Method.   This  method can be used to find the solution. Using Lagrange method, the extreme value can be obtained, so that the optimal solution can be found. In this research, the maximum revenue of UD. Sari Madu is a limited by several constraints. After the objective function and constraint function being model, than maximum revenue is found. From first until fourth quarterly, the maximum revenue is found Rp. 9.701.333, Rp. 10.064.148, 9.793.272 and Rp. 9.397.730 respectively.

  10. Lithium ion conducting biopolymer electrolyte based on pectin doped with Lithium nitrate

    Science.gov (United States)

    Manjuladevi, R.; Selvin, P. Christopher; Selvasekarapandian, S.; Shilpa, R.; Moniha, V.

    2018-04-01

    The Biopolymer electrolyte based on pectin doped with lithium nitrate of different concentrations have been prepared by solution casting technique. The decrease in crystalline nature of the biopolymer has been identified by XRD analyses. The complex formation between the polymer and the salt has been revealed using FTIR analysis. The ionic conductivity has been explored using A.C. impedance spectroscopy which reveals that the biopolymer containing 30 wt% Pectin: 70wt%LiNO3 has highest ionic conductivity of 3.97 × 10-3 Scm-1.

  11. A multiwavelength study of superoutbursts in dwarf novae

    International Nuclear Information System (INIS)

    Woerd, H.J. van der.

    1987-01-01

    Dwarf novae are stellar systems consisting of two stars which orbit around each other within a few hours. In dwarf novae one of the stars, which is a bit smaller and less massive than our sun, loses matter to a very compact and degenerated star: a white dwarf. This white dwarf has nearly the same mass as our sun but its radius is about a hundred times smaller. The process of mass transport was studied on the basis of observations with the Exosat-satelite (European X-ray Observatory satelite). 397 refs.; 50 figs.; 21 tabs

  12. Modelling of Lévy walk kinetics of charged particles in edge electrostatic turbulence in tokamaks

    Czech Academy of Sciences Publication Activity Database

    Krlín, Ladislav; Papřok, R.; Svoboda, V.

    2008-01-01

    Roč. 48, č. 1 (2008), s. 95-109 ISSN 1434-6060 R&D Projects: GA AV ČR IAA100430502; GA ČR GA202/07/0044 Institutional research plan: CEZ:AV0Z20430508 Keywords : PLASMA TURBULENCE * DIFFUSION * TRANSPORT * FIELD * WAVES Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.397, year: 2008 http://www.springerlink.com/content/101161/?p=0fb843e139344681908c5cc2140bb828&pi=0

  13. Dityrosine formation is impaired by tyrosine phosphorylation.

    Science.gov (United States)

    Christian, S; Bernhard, G; Patrizia, R; Brigitte, M

    1992-10-15

    Using pure tyrosine and phosphotyrosine we have recently shown that phosphotyrosine is unable to form peroxidase catalyzed dimers (1989, FEBS Lett. 255, 395-397). In the present report, the effect of phosphotyrosine residues within a protein structure on dityrosine formation was studied using casein as a model protein. Dephosphorylation of casein resulted in a dose and time dependent increased synthesis of dityrosines following treatment with peroxidase/H2O2. The extent of crosslink formation was inversely related to the amount of phosphorylated tyrosine residues as quantitated by immunoblotting. Thus, phosphorylation of tyrosine residues could play a regulatory role in protein-crosslinking where dityrosine bonds are involved.

  14. Effect of 810 nm Diode Laser Therapy on the Rate of Extraction Space Closure

    OpenAIRE

    Naseem Joy Garg; Gurkeerat Singh; Sridhar Kannan; Deepak Rai; Ankur Kaul; Ashish Gupta; Abhishek Goyalia; Gaurav Gupta

    2014-01-01

    Purpose: To determine if biostimulation using a 810 nm diode laser was capable of affecting the rate of extraction space closure during orthodontic treatment. Materials and methods: Forty dental arches of patients above 17 years of age requiring bilateral first premolar extractions were exposed to a 810 nm diode laser with a power density of 3.97 W/cm2 at 3 weeks intervals for total duration of 12 weeks during the space closure phase under direct anchorage using miniscrews. Space closure m...

  15. RELIABILITY ANALYSIS OF POWER DISTRIBUTION SYSTEMS

    Directory of Open Access Journals (Sweden)

    Popescu V.S.

    2012-04-01

    Full Text Available Power distribution systems are basic parts of power systems and reliability of these systems at present is a key issue for power engineering development and requires special attention. Operation of distribution systems is accompanied by a number of factors that produce random data a large number of unplanned interruptions. Research has shown that the predominant factors that have a significant influence on the reliability of distribution systems are: weather conditions (39.7%, defects in equipment(25% and unknown random factors (20.1%. In the article is studied the influence of random behavior and are presented estimations of reliability of predominantly rural electrical distribution systems.

  16. The EIS (Environmental Impact Statement) Process in Relation to the Proposed Naval Task Force at Everett, Washington,

    Science.gov (United States)

    1983-01-01

    2.0% 2.6. (Bremrton) •5, . -’ Island County 46.0 49.7 54.6 2.7% 2.0 * (Whidbey Island) Whatcom County 111.1 115.1 121.0 1.2% 1.0 *;- -": (Cherry Point...Unincorporated 15,609 4,616 .30 2.59 . Incorporated 5,263 397 .08 2.84 Oak Harbor 4,407 300 .07 2.97 Whatcom County 47,479 7,849 .17 2.60 . Unincorporated

  17. Agent–host–environment model of blunt abdominal trauma in ...

    African Journals Online (AJOL)

    3.85. 0.14. Building breakdown (14). 5. 2.4. 6. 2.3. 3. 2.4. 0.001. 0.99. Swing (12). 7. 3.4. 2. 0.8. 3. 2.4. 3.97. 0.13. Child abuse (9). 5. 2.4. 3. 1.2. 1. 0.8. 1.73. 0.42. RTA, road traffic accidents. Table 5 Physical situation distribution. Situation. Number. (N = 590). Percentage. Street. 329. 55.8. Pedestrian (alone). 227. 38.5. Car.

  18. Comparison of Soxhlet and Shake Extraction of Polycyclic Aromatic Hydrocarbons from Coal Tar Polluted Soils Sampled in the Field

    DEFF Research Database (Denmark)

    Lindhardt, Bo; Holst, Helle; Christensen, Thomas Højlund

    1994-01-01

    This study compares three extraction methods for PAHs in coal tar polluted soil: 3-times repeated shaking of the soil with dichloromethane-methanol (1:1), Soxhlet extraction with dichloromethane, and Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol....... The extraction efficiencies were determined for ten selected PAHs in triplicate samples of six soils sampled at former gasworks sites. The samples covered a wide range of PAH concentrations, from 0.6 to 397 mg/kg soil. Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol......, in general, was the most efficient method yielding 30 to 50 % higher concentrations than the other methods....

  19. Comparing nowcastings of three severe convective events by statistical and NWP models

    Czech Academy of Sciences Publication Activity Database

    Sokol, Zbyněk; Pešice, Petr

    2009-01-01

    Roč. 93, 1-3 (2009), s. 397-407 ISSN 0169-8095. [European Conference on Severe Storms /4./. Miramare -Trieste, 10.09.2007-14.09.2007] R&D Projects: GA ČR GA205/07/0905; GA MŠk OC 112; GA MŠk 1P05ME748 Institutional research plan: CEZ:AV0Z30420517 Keywords : Precipitation forecast * NWP model * Statistical model * Nowcasting * Local convective precipitation Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.811, year: 2009 http://www.sciencedirect.com/science/journal/01698095

  20. Corrections to "basins of attraction in fully asynchronous discrete-time discrete-state dynamic networks".

    Science.gov (United States)

    Bahi, Jacques M; Contassot-Vivier, Sylvain

    2009-08-01

    This paper brings a correction to the formulation of the basins of fixed-point states of fully asynchronous discrete-time discrete-state dynamic networks presented in our paper that appeared in the IEEE Transactions on Neural Networks, vol. 17, no. 2, pp. 397-408, March 2006. In our subsequent works on totally asynchronous systems, we have discovered that the formulation given in that previous paper lacks an additional condition. We present in this paper why the previous formulation is incomplete and give the correct formulation.

  1. Cell adhesion on polytetrafluoroethylene modified by UV-irradiation in an ammonia atmosphere

    Czech Academy of Sciences Publication Activity Database

    Heitz, J.; Švorčík, V.; Bačáková, Lucie; Ročková, K.; Ratajová, E.; Gumpenberger, T.; Bäuerle, D.; Dvořánková, B.; Kahr, H.; Graz, I.; Romanin, C.

    67A, č. 1 (2003), s. 130-137 ISSN 0021-9304 R&D Projects: GA AV ČR IAA5011301 Grant - others:FWF(AT) P14476-TPH; GA FRVŠ(CZ) 283-2002-G1; CZ-AT Scientific-Technical Cooperation(CZ) 2002-7 Institutional research plan: CEZ:AV0Z5011922 Keywords : cell adhesion * UV-modified polymer * amino acid grafting Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.397, year: 2003

  2. A autoestima afeta a insatisfação corporal em adolescentes do sexo feminino?

    OpenAIRE

    Fortes,Leonardo de Sousa; Cipriani,Flávia Marcele; Coelho,Fernanda Dias; Paes,Santiago Tavares; Ferreira,Maria Elisa Caputo

    2014-01-01

    Objetivo: O objetivo do estudo foi avaliar a influência da autoestima na insatisfação corporal de adolescentes do sexo feminino. Métodos: Participaram 397 adolescentes com idade entre 12 e 17 anos. Utilizou-se o Body Shape Questionnaire (BSQ) para avaliar a insatisfação corporal. A Escala de Autoestima de Rosemberg foi utilizada para avaliar a autoestima. Foram mensurados peso corporal, estatura e dobras cutâneas. Esses dados antropométricos foram controlados nas análises estatísticas. ...

  3. A construção literária dos germanos por Sinésio de Cirene: marcas de repulsa e integração em De Regno e De Providentia

    Directory of Open Access Journals (Sweden)

    José Petrúcio Farias Júnior

    2013-12-01

    Full Text Available Objetivamos discutir a partir de De Regno e De Providentia, escritas por Sinésio de Cirene (370 – 412/3, no momento de sua embaixada à Constantinopla (397/8 – 399/400, a construção da representação literária do outro (bárbaros, citas/germanos com a finalidade de compreender em que medida tal construção discursiva contribui para refletir sobre as marcas de integração dos germanos na sociedade romana oriental tardia.

  4. Obesidad infantil y su relación con indicadores cardiopulmonares en escolares mexicanos

    OpenAIRE

    José Arias-Rico; Sandy Marlene Cortés-Cortés; Esther Ramírez-Moreno; Ma. Luisa Sánchez-Padilla; Reyna Cristina Jiménez-Sánchez; Teresita de Jesús Saucedo-Molina

    2016-01-01

    Objetivo: determinar la relación entre obesidad y anormalidades de parámetros cardiopulmonares en escolares. Materiales y mé- todos: participaron 78 escolares entre 5 a 11 años de edad, 47 hombres (60,3 % ) y 31 mujeres (39,7 % ), pertenecientes a una escuela primaria particular de la ciudad de Pachuca (México). Se evaluó: índice de masa corporal (IMC), circunferencia de cintura (CC), grasa corporal (GC), frecuencia cardiaca (FC), presión arterial (PA), frecu...

  5. Algorithm 896: LSA: Algorithms for Large-Scale Optimization

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    2009-01-01

    Roč. 36, č. 3 (2009), 16-1-16-29 ISSN 0098-3500 R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : algorithms * design * large-scale optimization * large-scale nonsmooth optimization * large-scale nonlinear least squares * large-scale nonlinear minimax * large-scale systems of nonlinear equations * sparse problems * partially separable problems * limited-memory methods * discrete Newton methods * quasi-Newton methods * primal interior -point methods Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.904, year: 2009

  6. β-Keto and β-hydroxyphosphonate analogs of biotin-5’-AMP are inhibitors of holocarboxylase synthetase

    OpenAIRE

    Sittiwong, Wantanee; Cordonier, Elizabeth L.; Zempleni, Janos; Dussault, Patrick H.

    2014-01-01

    Holocarboxylase synthetase (HLCS) catalyzes the covalent attachment of biotin to cytoplasmic and mitochondrial carboxylases, nuclear histones, and over a hundred human proteins. Nonhydrolyzable ketophosphonate (β-ketoP) and hydroxyphosphonate (β-hydroxyP) analogs of biotin-5′-AMP inhibit holocarboxylase synthetase (HLCS) with IC50 values of 39.7 μM and 203.7 μM. By comparison, an IC50 value of 7 μM was observed with the previously reported biotinol-5'-AMP. The Ki values, 3.4 μM and 17.3 μM, r...

  7. Sleep Problems and Daily Functioning in Children With ADHD

    DEFF Research Database (Denmark)

    Virring, Anne; Lambek, Rikke; Jennum, Poul Jørgen

    2017-01-01

    problem profile, but having a comorbid internalizing or autistic disorder lead to higher sleep problem score. CONCLUSION: Sleep problems and impaired daily functioning were more common in children with ADHD, but the overall association between sleep problems and impaired daily functioning was similar...... in clinical and nonclinical children. Internalizing or autistic comorbid disorders added significantly to the sleep problems.......OBJECTIVE: Little systematic information is available regarding how sleep problems influence daytime functioning in children with ADHD, as the role of ADHD presentations and comorbidity is unclear. METHOD: In total, 397 children were assessed with the Children's Sleep Habits Questionnaire...

  8. Acute Mesenteric Venous Thrombosis with a Vaginal Contraceptive Ring

    Directory of Open Access Journals (Sweden)

    Wesley Eilbert

    2014-07-01

    Full Text Available Mesenteric venous thrombosis is a rare cause of abdominal pain, which if left untreated may result in bowel infarction, peritonitis and death. The majority of patients with this illness have a recognizable, predisposing prothrombotic condition. Oral contraceptives have been identified as a predisposing factor for mesenteric venous thrombosis in reproductive-aged women. In the last fifteen years new methods of hormonal birth control have been introduced, including a transdermal patch and an intravaginal ring. In this report, we describe a case of mesenteric venous thrombosis in a young woman caused by a vaginal contraceptive ring. [West J Emerg Med. 2014;15(4:395-397.

  9. Mapping of single-copy genes by TSA-FISH in th codling moth, Cydia pomonella

    Czech Academy of Sciences Publication Activity Database

    Carabajal Paladino, Leonela Z.; Nguyen, Petr; Šíchová, Jindra; Marec, František

    2014-01-01

    Roč. 15, Supplement 2 (2014), S15 ISSN 1471-2156 R&D Projects: GA ČR(CZ) GA14-22765S; GA ČR(CZ) GP14-35819P; GA MŠk(CZ) EE2.3.30.0032 Grant - others:GA JU(CZ) 052/2013/P; IAEA, Vienna(AT) 15838 Institutional support: RVO:60077344 Keywords : Cydia pomonella Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2014 http://www.biomedcentral.com/content/pdf/1471-2156-15-S2-S15.pdf

  10. Thermal study of sandstones from different Czech localities

    Czech Academy of Sciences Publication Activity Database

    Plevová, Eva; Vaculíková, Lenka; Kožušníková, Alena; Daněk, T.; Ritz, M.; Simha Martynková, G.

    2011-01-01

    Roč. 103, č. 3 (2011), s. 835-843 ISSN 1388-6150 R&D Projects: GA ČR GA105/08/1398; GA ČR GP105/07/P416 Grant - others:GA ČR(CZ) GP105/09/397 Institutional research plan: CEZ:AV0Z30860518 Keywords : thermomechanical and differential thermal analysis * optical microscopy * sandstones Subject RIV: CA - Inorganic Chemistry Impact factor: 1.604, year: 2011 http://www.springerlink.com/content/71n5427j2707g331/

  11. Application of infrared spectroscopy and chemometric methods to identification of selected minerals

    Czech Academy of Sciences Publication Activity Database

    Ritz, M.; Vaculíková, Lenka; Plevová, Eva

    2011-01-01

    Roč. 8, č. 1 (2011), s. 47-58 ISSN 1214-9705 R&D Projects: GA ČR GA105/08/1398; GA ČR GP105/07/P416 Grant - others:GA ČR(CZ) GP105/09/P397; GA MŠk(CZ) ED2.1.00/01.0040 Institutional research plan: CEZ:AV0Z30860518 Keywords : minerals * infrared spectroscopy * chemometric methods Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/01_11/5_Vaculikova.pdf

  12. Determinants of knowledge gain in evidence-based medicine short courses: an international assessment

    DEFF Research Database (Denmark)

    Witt, Klaus; Kunz, Regina; Wegscheider, Karl

    2010-01-01

    Background: Health care professionals worldwide attend courses and workshops to learn evidence-based medicine (EBM), but evidence regarding the impact of these educational interventions is conflicting and of low methodologic quality and lacks generalizability. Furthermore, little is known about...... the course. Results: A total of 15 centres participated in the study and 420 learners from North America and Europe completed the study. The baseline score across courses was 7.49 points (range 3.97–10.42 points) out of a possible 15 points. The average increase in score was 1.40 points (95% confidence...

  13. Rapid detection of the pandemic 2009 H1N1 virus M gene by real?time and gel?based RT?PCR assays

    OpenAIRE

    Ma, Wenjun; Oberst, Richard; Li, Xi; Clouser, Deborah; Hesse, Richard; Rowland, Raymond; Richt, Juergen A.

    2010-01-01

    Please cite this paper as: Ma et?al. (2010) Rapid detection of the pandemic 2009 H1N1 virus M gene by real?time and gel?based RT?PCR assays. Influenza and Other Respiratory Viruses 4(6), 397?403. Background? Since the first pandemic 2009 H1N1 (pH1N1) virus was isolated from humans, it has also been detected in other mammalian (pigs, cats, dogs, ferrets) and avian (turkey) species, most likely because of cross?species transmission from humans. The pH1N1 contains six genes derived from swine in...

  14. Incidence of cardiovascular and cerebrovascular disease in Danish men and women with a prolonged heavy alcohol intake

    DEFF Research Database (Denmark)

    Hvidtfeldt, Ulla Arthur; Frederiksen, M.E.; Thygesen, L.C.

    2008-01-01

    BACKGROUND: Several epidemiological studies have found U- or J-shaped relationships between alcohol intake and cardiovascular conditions. The influence of heavy drinking is, however, sparsely studied. The objective of the present study was to examine whether alcohol addicts have higher incidence......) according to sex, age and calendar time to compare subjects' cardio- and cerebrovascular incidence with that of the general population of Copenhagen. RESULTS: During the period 1977 to 2001 a total of 9,397 events of cardio- and cerebrovascular disease were observed. In both men and women, statistically...

  15. Spreading of alien species and diversity of communities

    Czech Academy of Sciences Publication Activity Database

    Kindlmann, Pavel; Honěk, A.; Martinková, Z.

    2017-01-01

    Roč. 62, č. 3 (2017), s. 397-407 ISSN 1386-6141 R&D Projects: GA ČR GA14-26561S; GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : pallas coleoptera-coccinellidae * lady beetle coleoptera * harmonia-axyridis * harlequin ladybird * intraguild predation * geographical-distribution * generalist predators * biological-control * invasion history * native range * Alien species * Native species * Ladybirds * Aphid predators * Simulation model * Community Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 1.918, year: 2016

  16. Determining Recoverable and Irrecoverable Contributions to Accumulated Strain in a NiTiPd High-Temperature Shape Memory Alloy During Thermomechanical Cycling

    Science.gov (United States)

    Monroe, J. A.; Karaman, I.; Lagoudas, D. C.; Bigelow, G.; Noebe, R. D.; Padula, S., II

    2011-01-01

    When Ni(29.5)Ti(50.5)Pd30 shape memory alloy is thermally cycled under stress, significant strain can accumulate due to elasticity, remnant oriented martensite and plasticity. The strain due to remnant martensite can be recovered by further thermal cycling under 0 MPa until the original transformation-induced volume change and martensite coefficient of thermal expansion are obtained. Using this technique, it was determined that the 8.15% total accumulated strain after cycling under 200 MPa consisted of 0.38%, 3.97% and 3.87% for elasticity, remnant oriented martensite and creep/plasticity, respectively.

  17. Seroprevalence of West Nile Virus in Feral Horses on Sheldon National Wildlife Refuge, Nevada, United States

    OpenAIRE

    Franson, J. Christian; Hofmeister, Erik K.; Collins, Gail H.; Dusek, Robert J.

    2011-01-01

    We screened 1,397 feral horses (Equus caballus) on Sheldon National Wildlife Refuge, Nevada, United States, for IgM and IgG against flavivirus during 2004–2006, 2008, and 2009. Positive serum samples were tested for neutralizing antibodies to West Nile virus (WNV) and St. Louis encephalitis virus (SLEV). One animal was positive for antibody against WNV in 2004, but all others tested in 2004–2006 were negative. In 2008 and 2009, we found evidence of increasing seropositive horses with age, whe...

  18. The formation and design of the TRIAGE study--baseline data on 6005 consecutive patients admitted to hospital from the emergency department

    DEFF Research Database (Denmark)

    Plesner, Louis Lind; Iversen, Anne Kristine Servais; Langkjær, Sandra

    2015-01-01

    categorized as green, 2386 (39.7 %) yellow, 1616 (26.9 %) orange and 25 (0.4 %) red. Median age was 62 years (IQR 46-76), 49.8 % were male and median length of stay was 1 day (IQR 0-4). No events were found in 2658 (44.2 %) and 158 (2.6 %) were admitted to intensive or intermediate-intensive care unit and 219...... (3.6 %) died within 30 days. A higher triage acuity level was associated with numerous events, including acute surgery, endovascular intervention, i.v. treatment, cardiac arrest, stroke, admission to intensive care, hospital transfer, and mortality within 30 days (p

  19. Primal Interior-Point Method for Large Sparse Minimax Optimization

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    2009-01-01

    Roč. 45, č. 5 (2009), s. 841-864 ISSN 0023-5954 R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : unconstrained optimization * large-scale optimization * minimax optimization * nonsmooth optimization * interior-point methods * modified Newton methods * variable metric methods * computational experiments Subject RIV: BA - General Mathematics Impact factor: 0.445, year: 2009 http://dml.cz/handle/10338.dmlcz/140034

  20. Program Objectives Memorandum Data Base Management System (POM-DBMS). Users Manual

    Science.gov (United States)

    1981-05-01

    use methe POM DBMS is "menu-driven" system that requires the user merely to select options from menus in order to control the system. The system...Gui to t ’e- Meth - g odbg - Final Technical Report *PR8--26-158. McLean, Virqinia: Decisions and Designs, Inc., December 1980.(U) This companion...9000 4749.6 17 2 6)E1180 45 PISTOL UNF .010 .003 397 99999.0 26 3 1) MULE 14AS 70.000 20.408 73344 3593.9 15 3 2)XM36EI FZ SET MIN 3C.500 8.89.’ 905 101.8

  1. Development of a high-resolution bathymetry dataset for the Columbia River through the Hanford Reach

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, Andre M.; Ward, Duane L.; Larson, Kyle B.; Lettrick, Joseph W.

    2010-10-08

    A bathymetric and topographic data collection and processing effort involving existing and newly collected data has been performed for the Columbia River through the Hanford Reach in central Washington State, extending 60-miles from the tailrace of Priest Rapids Dam (river mile 397) to near the vicinity of the Interstate 182 bridge just upstream of the Yakima River confluence (river mile 337). The contents of this report provide a description of the data collections, data inputs, processing methodology, and final data quality assessment used to develop a comprehensive and continuous merged 1m resolution bathymetric and topographic surface dataset for the Columbia River through the Hanford Reach.

  2. The roads of decentralisation. The history of rural road construction in Ethiopia

    OpenAIRE

    Emmenegger, Rony

    2012-01-01

    Roads, in particular rural roads, play a major role in deve- lopment. In Ethiopia, where the vast majority of the popula- tion depends on agricultural production, this is even more so, and the country’s road network has become a major po- licy issue with significant consequences for the population. An extensive network of 114,397 km of different roads has been constructed, maintained, and classified to date. Alt- hough community roads account for nearly two-thirds of the country’s total road ...

  3. Multicolor tunable yellow-red emission in Eu/Er:LiNbO3 under ultraviolet and blue excitation

    Science.gov (United States)

    Zhang, Zhengyu; Tang, Xunze; Qian, Yannan; Zhang, Haiyan; Wang, Wenguang; Wang, Rui

    2017-12-01

    The ability to manipulate the multicolor luminescence will greatly enhance the scope of their applications, ranging from infrared solar cells to volumetric multiplexed bioimaging. Tuning from yellow to red emission was successfully achieved in Eu/Er:LiNbO3 under ultraviolet (UV) and blue excitation. The excitation spectra of Eu/Er:LiNbO3 monitored at 590 nm/618 nm/626 nm were studied. The CIE 1931 color coordinates showed that the emissions fell within the yellow and red region, respectively, under 376 nm and 397 nm excitation. The color coordinates shifted from yellow toward red region upon diode laser excitation of 476 nm.

  4. Bol d'Or success for all-women crew from CERN

    CERN Multimedia

    2001-01-01

    The boat 'Mic Mac' and its CERN's all-woman crew (left to right), Christine Theurillat, Ursula Haenger , Paola Catapano, Petra Riedler, and skipper Cristina Morone. Spectacular highlight of the Lake Leman sailing calendar is the annual Bol d'Or race. Held this year on 16 and 17 June, the event attracted nearly 500 teams who competed under extreme weather conditions for the honours. Among the competitors was an all-woman crew from the CERN Yachting Club, sailing their Surprise boat, Mic Mac. The team was not only among the 397 boats to finish, but also the first all-woman crewed single hull boat to cross the line.

  5. Black Officer Accession and Retention

    Science.gov (United States)

    1980-05-15

    W CO Te im -xinn in dd pepw w dus of drn wdsw aM do 110 rmm nbell ct ts vim of th Depnanmt of Ddna i m y of ift oipmin. Thso0 11m o enmd6 opec...All Don’. Blacks Bla "k Know 1 2 3 4 5 6 7 9 0% 1-197. 20-397. 40-597Z 60-79Y, 80--991, 100Y. 68. COMBINED JUNIOR-SENIOR HIGH (ONE IN WHICH YOU SPENT

  6. PENGOLAHAN LIMBAH LOGAM BERAT INDUSTRI TEKSTIL MENGGUNAKAN FOTOKATALIS TiO2/ARANG AKTIF

    OpenAIRE

    Kapti Riyani; Tien Setyaningtyas; Roy Andreas

    2008-01-01

    Study about the use of active charcoal rice straws (AAJP) was done in order to decrease heavy metal ion on textile waste water by using photocatalyst AAJP/TiO2. Rice straws were gained from the Banyumas Regency and samples textile waste water from one of textile industry in Pemalang. This study was begun by the making of active charcoal from the rice straws, and then the modification of photocatalyst AAJP/TiO2 was done with the comparison 1:99, 2:98, 3:97, 4:96, 5:95. The test of heavy metal ...

  7. Use and knowledge of single dose activated charcoal: A survey of Australian doctors.

    Science.gov (United States)

    Corcoran, Gabriela; Chan, Betty; Chiew, Angela

    2016-10-01

    The use of single dose activated charcoal (SDAC) as a means of gastric decontamination is declining. The present study examined the potential use of SDAC in common overdose scenarios by Australian emergency doctors, compared with clinical toxicologists and current guidelines. We conducted a cross-sectional survey of emergency doctors and toxicologists on the use of SDAC. The survey covered demographic data, education and previous use of SDAC and six clinical scenarios. The scenarios selected included agents not bound to SDAC, sustained-release preparations and ingestions at varying time points. Statistical calculations were performed using Fisher's exact test. There were 397 emergency doctors and 20 toxicologists who responded to the survey. Seventy-one per cent (n = 280/397) of emergency doctors indicated they had received some education on decontamination. Eighty-three per cent (n = 331/397) had administered SDAC during their medical career, 29% (n = 117/397) within the past year. There was a significant difference in responses between emergency doctors and toxicologists in two scenarios; a toxic paracetamol ingestion presenting within 1 h (P = 0.009) and verapamil ingestion in a 3 year old boy (P = 0.001). Toxicologists were more likely to administer SDAC in these scenarios, 89% (n = 16/18) and 88% (n = 15/17), respectively, compared with 52% (n = 197/381) and 43% (n = 158/371) of emergency doctors. Our study showed that there is a significant variation in the use of SDAC between toxicologists and emergency doctors in some scenarios. Clinical toxicologists are more likely to administer SDAC in certain overdose settings. It is essential to provide education on the benefits versus actual risks of SDAC in acute poisoning so that doctors will understand when to administer SDAC or seek further advice. © 2016 Australasian College for Emergency Medicine and Australasian Society for Emergency Medicine.

  8. Exhumed Craters

    Science.gov (United States)

    2004-01-01

    5 July 2004 Burial and exhumation is a theme that repeats itself, all over the surface of Mars. This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows several north mid-latitude meteor impact craters with bouldery ejecta deposits. Each of the craters was once buried and later exhumed. Mesas on the floors of these craters are remnants of the materials that once filled and covered them. The craters are located near 39.7oN, 206.0oW. The image covers an area about 3 km (1.9 mi) wide; sunlight illuminates the scene from the lower left.

  9. Comparison of Soxhlet and Shake Extraction of Polycyclic Aromatic Hydrocarbons from Coal Tar Polluted Soils Sampled in the Field

    DEFF Research Database (Denmark)

    Lindhardt, Bo; Holst, Helle; Christensen, Thomas Højlund

    1994-01-01

    This study compares three extraction methods for PAHs in coal tar polluted soil: 3-times repeated shaking of the soil with dichloromethane-methanol (1:1), Soxhlet extraction with dichloromethane, and Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol....... The extraction efficiencies were determined for ten selected PAHs in triplicate samples of six soils sampled at former gasworks sites. The samples covered a wide range of PAH concentrations, from 0.6 to 397 mg/kg soil. Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol...

  10. Electrocatalytic properties of prussian blue nanoparticles supported on poly(m-aminobenzenesulphonic acid)-functionalised single-walled carbon nanotubes towards the detection of dopamine

    CSIR Research Space (South Africa)

    Adekunle, AS

    2012-06-01

    Full Text Available .-P. Lee, Analyst 135 (2010) 397. [42] J. W. Mo, B. Ogorevc, Anal.Chem. 73 (2001) 1196. [43] R. M. Wightman, L. J. May, A. C. Michael, Anal. Chem. 60 (1998) 769A. [44] L. Wang, S. Guo, X. Hu, S. Dong, Colld. Surf. A: Physicochem. Eng. Aspects 317 (2008... sample. 2.3 Electrode modification via sequential chemical deposition The EPPGE surface was cleaned by gentle polishing in an aqueous slurry of alumina nanopowder, Sigma-Aldrich (grain size <100 nm) on a SiC-emery paper and finally to a mirror...

  11. Micro-Fabricated Perforated Polymer Devices for Long-Term Drug Delivery

    Science.gov (United States)

    2011-02-24

    Kirke, IEEE Trans Biomed Eng 48(3), 361–371 (2001) J. Santini, M. Cima , R. Langer, Nature 397(6717), 335–338 (1999) J. Santini Jr., A. Richards, R...Scheidt, M. Cima , R. Langer, Angew Chem Int Ed 39(14), 2396–2407 (2000) T. Tang, S. Smith, B. Flynn, J. Stevenson, A. Gundlach, H. Reekie, A. Murray, D...Shive, R. Shawgo, H. Recum, J. Anderson, M. Cima , R. Langer, Biomaterials 24(11), 1959–1967 (2003) Biomed Microdevices (2011) 13:485–491 491 Copyright

  12. Energy dependence of fusion evaporation-residue cross sections in the 28Si+28Si reaction

    International Nuclear Information System (INIS)

    Vineyard, M.F.; Bauer, J.S.; Gosdin, C.H.; Trotter, R.S.; Kovar, D.G.; Beck, C.; Henderson, D.J.; Janssens, R.V.F.; Wilkins, B.D.; Rosner, G.; Chowdhury, P.; Ikezoe, H.; Kuhn, W.; Kolata, J.J.; Hinnefeld, J.D.; Maguire, C.F.; Mateja, J.F.; Prosser, F.W.; Stephans, G.S.F.

    1990-01-01

    Velocity distributions of mass-identified evaporation residues produced in the 28 Si+ 28 Si reaction have been measured at bombarding energies of 174, 215, 240, 309, 397, and 452 MeV using time-of-flight techniques. These distributions were used to identify evaporation residues and to separate the complete-fusion and incomplete-fusion components. Angular distributions and total cross sections were extracted at all six bombarding energies. The complete-fusion evaporation-residue cross sections and the deduced critical angular momenta are compared with lower energy data and the predictions of existing models

  13. 18th Middle Atlantic Regional Meeting, American Chemical Society

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The Proceedings of the 18th Middle Atlantic Regional Meeting of the American Chemical Society held May 21-23, 1984, include information about the meeting, e.g. area map and list of exhibitors, and abstracts for most of the 397 papers. A few papers are only title listed. The papers are arranged into sections dealing with analytical chemistry, biochemistry, chemical education, environmental chemistry, fuel chemistry, history of chemistry, industrial and engineering chemistry, inorganic chemistry, photochemistry, physical chemistry, polymer chemistry, and polymeric materials. Sections are also included to highlight undergraduate research and papers by chemical technicians and younger chemists. Separate abstracts have been prepared for 36 papers

  14. Thin nanodiamond membranes and their microstructural, optical and photoelectrical properties

    Czech Academy of Sciences Publication Activity Database

    Mortet, V.; D´Haen, J.; Potměšil, Jiří; Kravets, Roman; Drbohlav, Ivo; Vorlíček, Vladimír; Rosa, Jan; Vaněček, Milan

    2005-01-01

    Roč. 14, - (2005), s. 393-397 ISSN 0925-9635 R&D Projects: GA MŠk(CZ) LN00A015; GA ČR(CZ) GA202/05/2233; GA MŠk(CZ) LC510 EU Projects: European Commission(XE) HPRN-CT-1999-00139 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanodiamond * structural characterization * optical properties * defect spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.988, year: 2005

  15. Measurement of parton shower observables with OPAL

    Directory of Open Access Journals (Sweden)

    Fischer N.

    2016-01-01

    Full Text Available A study of QCD coherence is presented based on a sample of about 397,000 e+e- hadronic annihilation events collected at √s = 91 GeV with the OPAL detector at LEP. The study is based on four recently proposed observables that are sensitive to coherence effects in the perturbative regime. The measurement of these observables is presented, along with a comparison with the predictions of different parton shower models. The models include both conventional parton shower models and dipole antenna models. Different ordering variables are used to investigate their influence on the predictions.

  16. Premonitory Urge for Tics Scale (PUTS): replication and extension of psychometric properties in youth with chronic tic disorders (CTDs).

    Science.gov (United States)

    Raines, Jeremy M; Edwards, Kimberly R; Sherman, Martin F; Higginson, Christopher I; Winnick, Joel B; Navin, Kelly; Gettings, Julie M; Conteh, Fatmata; Bennett, Shannon M; Specht, Matthew W

    2018-04-01

    Individuals with chronic tic disorders (CTDs) frequently describe aversive subjective sensory sensations that precede their tics. The first aim of the present study was to explore the psychometric properties of a standardized self-report measure to assess premonitory urges in CTDs, The Premonitory Urge for Tics Scale (PUTS), by replicating the analyses of Woods et al. (J Dev Behav Pediatr 26:397-403, 2005) using a sample twice the size of theirs. The second aim was to conduct an exploratory factor analysis of the PUTS. Eighty-four youth with CTDs, recruited from a pediatric OCD and tic specialty clinic, completed the PUTS while their caregivers completed The Parent Tic Questionnaire (PTQ) and a demographic measure. Consistent with (Woods et al. J Dev Behav Pediatr 26:397-403, 2005), the PUTS was found to be internally consistent (α = 0.82) and significantly correlated with overall tic severity as measured by the PTQ (r = 0.24, p tics than the frequency or intensity of tics.

  17. Femtosecond laser control of the angular distribution of electrons due to autoionization

    International Nuclear Information System (INIS)

    Bajema, M.L.; Jones, R.R.; Gallagher, T.F.

    2004-01-01

    Using two 500-fs laser pulses and a controlled time delay between them we are able to manipulate the angular distributions of the electrons ejected by autoionization of Ca atoms in the 4p 3/2 21s and 4p 3/2 19d states. Subsequent to their isolated core excitation by a 500-fs 393-nm laser pulse, Ca 4p 3/2 21s(19d) Rydberg atoms coherently evolve, via configuration interaction, into the degenerate 4p 1/2 ns(nd) states. While in the 4p 1/2 ns(nd) states atoms can be de-excited to bound 4sns(nd) levels using a 500-fs 397-nm pulse. Removing these atoms from the autoionizing states leads to a greater fraction of electrons leaving the atom along the direction of the laser polarization than is possible through direct excitation of 4 3/2 ns(nd) or 4p 1/2 ns(nd) using either the 393- or 397-nm pulse alone

  18. [Detection of ALK, ROS1 and RET fusion genes in non-small cell lung cancer patients and its clinicopathologic correlation].

    Science.gov (United States)

    Zhong, Shan; Zhang, Haiping; Bai, Dongyu; Gao, Dehong; Zheng, Jie; Ding, Yi

    2015-09-01

    To study the prevalence of ALK, ROS1 and RET fusion genes in non-small cell lung cancer (NSCLC), and its correlation with clinicopathologic features. Formalin-fixed and paraffin-embedded tissue sections from samples of 302 patients with NSCLC were screened for ALK, ROS1, RET fusions by real-time polymerase chain reaction (PCR). All of the cases were validated by Sanger DNA sequencing. The relationship between ALK, ROS1, RET fusion genes and clinicopathologic features were analyzed. In the cohort of 302 NSCLC samples, 3.97% (12/302) were found to contain ALK fusion genes, including 3 cases with E13; A20 gene fusion, 3 cases with E6; A20 gene fusion and 3 cases with E20; A20 gene fusion. There was no statistically significant difference in patient's gender, age, smoking history and histologic type. Moreover, in the 302 NSCLC samples studied, 3.97% (12/302) were found to contain ROS1 fusion genes, with CD74-ROS1 fusion identified in 9 cases. There was no statistically significant difference in patients' gender, age, smoking history and histologic type. One non-smoking elderly female patient with pulmonary adenocarcinoma had RET gene fusion. None of the cases studied had concurrent ALK, ROS1 and RET mutations. The ALK, ROS1 and RET fusion gene mutation rates in NSCLC are low, they represent some specific molecular subtypes of NSCLC. Genetic testing has significant meaning to guide clinical targeted therapy.

  19. Host specificity and experimental assessment of the early establishment of the mistletoe Phoradendron crassifolium (Pohl ex DC. Eichler (Santalaceae in a fragment of Atlantic Forest in southeast Brazil

    Directory of Open Access Journals (Sweden)

    Patrícia Aparecida Messias

    2014-12-01

    Full Text Available Mistletoe establishment relies heavily on a seed reaching a proper host plant. Small frugivorous birds usually disperse large numbers of mistletoe seeds. However, in the field, mistletoes are absent from some potential available hosts. We investigated whether the mistletoe Phoradendron crassifolium has some preferences for specific host trees in a fragment of Atlantic Forest in southeast Brazil. We surveyed 397 tree individuals of 50 species within 25 families. Seven of those species (14% bore P. crassifolium infections. Although prevalence at the individual level was low (11.6%, there were marked deviations in infection levels among species and families. Most (87% of the infections (40 of 46 occurred in species belonging to the families Anacardiaceae (Lithraea molleoides and Tapirira guianensis and Siparunaceae (Siparuna guianensis, which nevertheless accounted for only 26% of the potential individual hosts (103 of 397. We also performed an experiment simulating bird behavior. We inoculated 480 mistletoe seeds to the bark of four potential hosts in field, following the fate of the seeds for five months. No differences in host preference were observed. The low specificity detected at the local level was confirmed by a survey of exsiccata collected over the geographical distribution of the mistletoe, suggesting that P. crassifolium prevalence is more dependent on dispersal limitation than on mistletoe-host compatibility.

  20. Physiological Study of Lactobacillus delbrueckii subsp. bulgaricus Strains in a Novel Chemically Defined Medium

    Science.gov (United States)

    Chervaux, Christian; Ehrlich, S. Dusko; Maguin, Emmanuelle

    2000-01-01

    We developed a chemically defined medium called milieu proche du lait (MPL), in which 22 Lactobacillus delbrueckii subsp. bulgaricus (L. bulgaricus) strains exhibited growth rates ranging from 0.55 to 1 h−1. MPL can also be used for cultivation of other lactobacilli and Streptococcus thermophilus. The growth characteristics of L. bulgaricus in MPL containing different carbon sources were determined, including an initial characterization of the phosphotransferase system transporters involved. For the 22 tested strains, growth on lactose was faster than on glucose, mannose, and fructose. Lactose concentrations below 0.4% were limiting for growth. We isolated 2-deoxyglucose-resistant mutants from strains CNRZ397 and ATCC 11842. CNRZ397-derived mutants were all deficient for glucose, fructose, and mannose utilization, indicating that these three sugars are probably transported via a unique mannose-specific-enzyme-II-like transporter. In contrast, mutants of ATCC 11842 exhibited diverse phenotypes, suggesting that multiple transporters may exist in that strain. We also developed a protein labeling method and verified that exopolysaccharide production and phage infection can occur in MPL. The MPL medium should thus be useful in conducting physiological studies of L. bulgaricus and other lactic acid bacteria under well controlled nutritional conditions. PMID:11097906

  1. Frequency and spectrum of hemoglobinopathy mutations in a Uruguayan pediatric population

    Directory of Open Access Journals (Sweden)

    Julio Da Luz

    2013-01-01

    Full Text Available Hemoglobinopathies are the most common recessive diseases worldwide but their prevalence in Uruguay has not been investigated. In this study, 397 unrelated outpatient children from the Pereira Rosell Hospital Center (CHPR, as well as 31 selected patients with microcytic anemia and 28 β-thalassemia carriers were analyzed for hemoglobinopathies by using biochemical and molecular biology methods. Parametric and non-parametric methods were used to compare the hematological indices between groups of genotypes. Of the 397 patients in the first group, approximately 1% (0.76% HbS and 0.25% β-thalassemia had a mutation in the HBB gene and 3.3% had α-thalassemia. These mutations had a heterogeneous distribution that varied according to individual ancestry. HbS was found exclusively in individuals with declared African ancestry and had a carrier frequency of 2.2%. The frequency of α-thalassemia carriers in outpatients of European and African ancestry was 1.2% and 6.5%, respectively. In contrast, the frequency of α-thalassemia carriers in patients with microcytic anemia was 25.8%, significantly higher (p < 0.01 than that observed in the sample as a whole and in Afro-descendants and Euro-descendants. Significant differences were observed in the hematological parameters between individuals with thalassemia genotypes and those with a normal genotype. These results indicate that hemoglobinopathies are a relevant health problem in Uruguay.

  2. Observational Evidence for High Neutronization in Supernova Remnants: Implications for Type Ia Supernova Progenitors

    Science.gov (United States)

    Martínez-Rodríguez, Héctor; Badenes, Carles; Yamaguchi, Hiroya; Bravo, Eduardo; Timmes, F. X.; Miles, Broxton J.; Townsley, Dean M.; Piro, Anthony L.; Mori, Hideyuki; Andrews, Brett; Park, Sangwook

    2017-07-01

    The physical process whereby a carbon-oxygen white dwarf explodes as a Type Ia supernova (SN Ia) remains highly uncertain. The degree of neutronization in SN Ia ejecta holds clues to this process because it depends on the mass and the metallicity of the stellar progenitor, and on the thermodynamic history prior to the explosion. We report on a new method to determine ejecta neutronization using Ca and S lines in the X-ray spectra of Type Ia supernova remnants (SNRs). Applying this method to Suzaku data of Tycho, Kepler, 3C 397, and G337.2-0.7 in the Milky Way, and N103B in the Large Magellanic Cloud, we find that the neutronization of the ejecta in N103B is comparable to that of Tycho and Kepler, which suggests that progenitor metallicity is not the only source of neutronization in SNe Ia. We then use a grid of SN Ia explosion models to infer the metallicities of the stellar progenitors of our SNRs. The implied metallicities of 3C 397, G337.2-0.7, and N103B are major outliers compared to the local stellar metallicity distribution functions, indicating that progenitor metallicity can be ruled out as the origin of neutronization for these SNRs. Although the relationship between ejecta neutronization and equivalent progenitor metallicity is subject to uncertainties stemming from the 12C + 16O reaction rate, which affects the Ca/S mass ratio, our main results are not sensitive to these details.

  3. Giardíase e criptosporidiose em crianças institucionalizadas em creches no estado de São Paulo Giardiasis and cryptosporidiosis in children institutionalized at daycare centers in the state of São Paulo

    Directory of Open Access Journals (Sweden)

    Luciene Maura Mascarini

    2006-12-01

    Full Text Available Realizou-se dois estudos transversais em 2002 (N=379 e 2003 (N=397 onde estimou-se a prevalência de enteroparasitas em crianças de cinco creches municipais de Botucatu, SP. Coletou-se variáveis socioeconômicas, sanitárias e educacionais e realizou-se exames coproparasitológicos. Giardia duodenalis apresentou prevalência de 23,7% (2002 e 21,4% (2003 seguido por Cryptosporidium sp com 15,5% (2002 e 3,7% (2003.Two cross-sectional studies were conducted, in 2002 (N=379 and 2003 (N=397, to estimate the prevalence of intestinal parasites among children at five municipal daycare centers in Botucatu, State of São Paulo. Socioeconomic, sanitary and educational data were collected and parasitological tests were performed on feces. Giardia duodenalis presented prevalence of 23.7% (2002 and 21.4% (2003 followed by Cryptosporidium sp with 15.5% (2002 and 3.7% (2003.

  4. Developing competencies for medical librarians in Pakistan.

    Science.gov (United States)

    Ullah, Midrar; Anwar, Mumtaz A

    2013-03-01

    To identify competencies for medical librarians and get these validated from head librarians and employers. The survey method was used. A structured questionnaire, listing 84 competency statements, covering eight areas, prepared after extensive literature review, expert scrutiny and pilot testing, using a 5-point Likert scale was distributed among the head librarians and chairpersons of library committees (CLC) in 115 medical libraries. Sixty seven (58%) useable responses were received from head librarians and 63 (55%) from CLC. Of the 84 competency statements 83 were validated by the head librarians, 44 receiving four or higher mean score while the other 39 statements getting mean scores in the range of 3.97 and 3.06. The CLC validated 80 statements. Only 27 statements received four or higher mean score from CLC while the other 53 got mean scores in the range of 3.97 and 3.22. Medical librarians are required to be well versed with all those competencies which are needed for general librarianship. In addition, they are expected to have adequate knowledge of health sciences environment including medical terminologies and concepts. Sound knowledge of some competencies specific for medical libraries is an additional requirement for library personnel. © 2012 The authors. Health Information and Libraries Journal © 2012 Health Libraries Group.

  5. Evaluation of hybrids of So/anum po/yadenium Greenm for white worm resistance in potatoe (Premmotripes voraxHustoche. Evaluación de híbridos de Solanum polyadenium Greenm. Para resistencia al gusano blanco de la papa (Premnotrypes vorax Hustache

    Directory of Open Access Journals (Sweden)

    Trillos G. Ofelia

    1993-12-01

    Full Text Available Four Solanum polyadenlum crossed with Solanum berthanltil, Solanum chacoense and Solanum phureja were evaluated for resistance to the Andean potato weevil (Premnotrypes vorax Hustache. From the set of 397 hybrids avaluated six (1,52%
    were selected for resistance. For other agronomical and biochemical characteristics the most promising hybrids were the 12 th, the 14 th and the 15 th from the second family (498096.1-Solanum polyadenlium x Solanum phureja. The type of resistance found was antibiosis which affects both the development and the reproduction of the insect.Enel presente trabajo se evaluó el grado de resistencia
    al gusano blanco de la Papa (Premnotrypes voraxHustache de los hibrldos obtenidos mediante el cruzamiento de la especie Solanum polyadenium con las especies Solanum berthanltil, Solanum chacoense y Solanum phureja. De un total de 397 hibridos evaluados, se seleccionaron seis (1.5% por su alto nivel de resistencia al gusano blanco. Porotras caracteristicas agronómicas y bioquimicas, se consideraron como losmás importantesen un programa de mejoramiento a los hibridos 12; 14 y 15 de la Familia 2 (498096.1 - hibrido de Solanum polyadenlum x Amarilla Perú - Solanum phureja. El mecanismo de resistencia observado es del tipo antibiosis, el cual afecta la supervivencia, desarrollo y reproducción del insecto.

  6. O Lugar da Leitura Silenciosa e da Leitura Oral na vida de Ambrósio, Bispo de Milão (Século IV d. C. * The Place of Silent Reading and Oral Reading in the Life of Ambrose, Bishop of Milan (Fourth-Century A.D.

    Directory of Open Access Journals (Sweden)

    JANIRA FELICIANO POHLMANN

    2014-02-01

    Full Text Available Resumo: Neste artigo nos propomos a relacionar elementos próprios da leitura silenciosa e da leitura oral na vida de Aurélio Ambrósio, bispo da cidade de Milão entre os anos de 374 e 397. Também aproveitamos a oportunidade para esclarecer algumas funções episcopais assinaladas por Ambrósio, especialmente a tarefa de ensinar. Para tanto, entre as obras examinadas para a execução deste trabalho, ressaltamos De Officiis Ministrorum Libri Tres e Exameron, de autoria do próprio bispo milanês, e o livro Confessionis de Agostinho, discípulo de Ambrósio.Palavras-chave: Ambrósio – Bispo – Leitura silenciosa. Abstract: In this article we propose to relate elements own of silent reading and reading oral in the life of Aurelius Ambrosius, bishop of the city of Milan between the years of 374 and 397. Also took the opportunity to clarify some episcopal functions signaled by Ambrosius, specially the task of teaching. For the achievement of our goals, we mainly examined De Officiis Ministrorum Libri Tres and Exameron, authored by own bishop milanese, and the book Confessionis of Augustinus, disciple of Ambrosius.Keywords: Ambrosius – Bishop – Silent reading.

  7. Demographic and microbial characteristics of extrapulmonary tuberculosis cases diagnosed in Malatya, Turkey, 2001-2007

    Directory of Open Access Journals (Sweden)

    Koroglu Mehmet

    2011-03-01

    Full Text Available Abstract Background Extrapulmonary tuberculosis (EPTB has an increasing rate in Turkey. The reason remains largely unknown. A better understanding of the demographic and microbial characteristics of EPTB in the Turkish population would extend the knowledgebase of EPTB and allow us to develop better strategies to control tuberculosis (TB. Methods We retrospectively evaluated clinical and laboratory data of 397 bacteriologically-confirmed TB cases diagnosed during an eight year-period using by chi-square analysis and multivariate logistic regression model. Results Of the 397 study patients, 103 (25.9% had EPTB and 294 (74.1% had pulmonary tuberculosis (PTB. The most commonly seen two types of EPTB were genitourinary TB (27.2% and meningeal TB (19.4%. TB in bone/joints, pleural cavity, lymph nodes, skin, and peritoneal cavity occurred at a frequency ranging from 9.7% to 10.7%. The age distribution was significantly different (P Conclusions EPTB accounted for a significant proportion of TB cases in Malatya, Turkey between 2001 and 2007. The current study has provided an insight into the dynamics of EPTB in Malatya, Turkey. However, the risk factors for having EPTB in Malatya, Turkey remain to be assessed in future studies using population-based or randomly selected sample.

  8. Colorimetric recognition of 6-benzylaminopurine in environmental samples by using thioglycolic acid functionalized silver nanoparticles

    Science.gov (United States)

    Zheng, Mingda; He, Jiang; Wang, Yingying; Wang, Chenge; Ma, Shuang; Sun, Xiaohan

    2018-03-01

    A simple and selective colorimetric sensor thioglycolic acid capped silver nanoparticles (TGA-AgNPs) was developed for the detection of 6-benzylaminopurine (6-BAP). The synthesized TGA-AgNPs were characterized by UV-vis spectroscopy, dynamic light scattering (DLS), and transmission electron microscopic (TEM) techniques. The TGA-AgNPs as a sensor for binding 6-BAP through hydrogen-bonding and π-π bonding that causes large conjugate clusters, resulting in a color change from yellow to reddish orange. The surface plasmon resonance (SPR) band of TGA-AgNPs at 397 nm is red-shifted to 510 nm, which confirms that 6-BAP induces the aggregation of TGA-AgNPs. Under the optimized conditions, a linear relationship between the absorption ratio (A510 nm/A397 nm) and 6-BAP concentration was found in the range of 4-26 μM. The detection limit of 6-BAP was 0.2 μM, which is lower than the other analytical techniques. Moreover, the proposed sensor was successfully applied for the detection of 6-BAP in environmental samples with good recoveries. The proposed assay provides a simple and cost-effective method for the analysis of 6-BAP in vegetable and water samples.

  9. Hydrogen generation from deliquescence of ammonia borane using Ni-Co/r-GO catalyst

    Science.gov (United States)

    Chou, Chang-Chen; Chen, Bing-Hung

    2015-10-01

    Hydrogen generation from the catalyzed deliquescence/hydrolysis of ammonia borane (AB) using the Ni-Co catalyst supported on the graphene oxide (Ni-Co/r-GO catalyst) under the conditions of limited water supply was studied with the molar feed ratio of water to ammonia borane (denoted as H2O/AB) at 2.02, 3.97 and 5.93, respectively. The conversion efficiency of ammonia borane to hydrogen was estimated both from the cumulative volume of the hydrogen gas generated and the conversion of boron chemistry in the hydrolysates analyzed by the solid-state 11B NMR. The conversion efficiency of ammonia borane could reach nearly 100% under excess water dosage, that is, H2O/AB = 3.97 and 5.93. Notably, the hydrogen storage capacity could reach as high as 6.5 wt.% in the case with H2O/AB = 2.02. The hydrolysates of ammonia borane in the presence of Ni-Co/r-GO catalyst were mainly the mixture of boric acid and metaborate according to XRD, FT-IR and solid-state 11B NMR analyses.

  10. Arrhythmogenic cardiomyopathy in a patient with a rare loss-of-function KCNQ1 mutation.

    Science.gov (United States)

    Xiong, Qinmei; Cao, Qing; Zhou, Qiongqiong; Xie, Jinyan; Shen, Yang; Wan, Rong; Yu, Jianhua; Yan, Sujuan; Marian, Ali J; Hong, Kui

    2015-01-23

    Ventricular tachycardia (VT) is a common manifestation of advanced cardiomyopathies. In a subset of patients with dilated cardiomyopathy, VT is the initial and the cardinal manifestation of the disease. The molecular genetic basis of this subset of dilated cardiomyopathy is largely unknown. We identified 10 patients with dilated cardiomyopathy who presented with VT and sequenced 14 common causal genes for cardiomyopathies and arrhythmias. Functional studies included cellular patch clamp, confocal microscopy, and immunoblotting. We identified nonsynonymous variants in 4 patients, including a rare missense p.R397Q mutation in the KCNQ1 gene in a 60-year-old man who presented with incessant VT and had mild cardiac dysfunction. The p.R397Q mutation was absent in an ethnically matched control group, affected a conserved amino acid, and was predicted by multiple algorithms to be pathogenic. Co-expression of the mutant KCNQ1 with its partner unit KCNE1 was associated with reduced tail current density of slowly activating delayed rectifier K(+) current (IKs). The mutation reduced membrane localization of the protein. Dilated cardiomyopathy with an initial presentation of VT may be a forme fruste of arrhythmogenic cardiomyopathy caused by mutations in genes encoding the ion channels. The findings implicate KCNQ1 as a possible causal gene for arrhythmogenic cardiomyopathy. © 2015 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley Blackwell.

  11. Dynamic multi-objective optimization using PSO

    CSIR Research Space (South Africa)

    Helbig, M

    2012-01-01

    Full Text Available .42642 0.82876 9.5 8.5 25 DVEPSOu 76.0 0.00145 1.00077 0.99249 0.00021 0.43903 0.86418 5.0 4 25 DNSGAII-A 39.7 0.00043 1.00314 0.99484 7.579x10?06 0.72841 0.78969 2.5 6 25 DNSGAII-B 39.7 0.00051 1.00314 0.99484 6.707x10?06 0.7268 0.83159 1 2 25 dCOEA 39....00177 0.80396 0.76349 10 10 25 DVEPSOre 100.0 0.00386 0.99892 0.9684 0.00049 0.72382 0.72943 6 6.5 25 DVEPSOu 100.0 0.00361 1.0082 0.94919 0.00276 0.72882 0.75882 6 5 25 DNSGAII-A 39.3 0.0004 0.9998 0.93468 7.896x10?06 0.15351 0.97874 1 1 25 DNSGAII-B...

  12. Use of routine computed tomography brain scanning of psychiatry patients

    International Nuclear Information System (INIS)

    Agzarian, M.J.; Chryssidis, S.; Davies, R.P.; Pozza, C.H.

    2006-01-01

    The aim of this study was to evaluate the usefulness of CT of the brain in patients presenting with a psychiatric condition without focal neurological signs. The reports of 397 consecutive CT brain scans of patients presenting to two acute tertiary hospital psychiatric services over a 2-year period were assessed retrospectively. Of the 397 patients, 241 had psychosis, 87 had depression, 44 had bipolar affective disorder, seven had alcohol dependence, five had dementia, and the remaining 13 had a variety of diagnoses including personality disorder and transient ischaemic attack. Findings on 377 (95%) of the CT scans showed no abnormality. Specific abnormalities were described in 20 (5%) of the CT scans. Three scans showed non-specific minor abnormalities, which, when followed up by MRI, showed no relevant abnormality. All the abnormalities shown on CT were considered to be clinically unrelated to the patient's psychiatric condition. In conclusion, the pretest probability of finding a space-occupying lesion or other pertinent abnormality in patients presenting with psychiatric illnesses in this retrospective study appears not to be greater than that of the general population. The outcome of this study could be implemented to develop a clinical pathway for limiting assessment by CT for possible organic pathology in acute psychiatric illness. Copyright (2006) Blackwell Science Pty Ltd

  13. OPTIMIZATION OF MEDIUM COMPOSITIONS FOR SACCHAROMYCES BOULARDII BY BOX-BEHNKEN DESIGN

    Directory of Open Access Journals (Sweden)

    ZHANGTENG LEI

    2016-12-01

    Full Text Available Based on the previous experimental results, the Box-Behnken design (BBD was employed to study the individual and interactive effects of sucrose, malt extract, calf serum and sodium citrate on the growth of Saccharomyces boulardii, and the optimum medium compositions were obtained. Meanwhile, the optical density (OD in the fermentation suspension was measured at 560 nm after 36 h of incubation. It is shown that the optimized medium compositions were 36.28 g·L-1 sucrose, 6.38 g·L-1 malt extract, 5.69 g·L-1 calf serum and 5.3 g·L-1 sodium citrate. The result indicated that the growth of S. boulardii could increase significantly in the optimized medium, and the OD560nm value reached 1.397 ± 0.013 after 36 h, which increased 18.59 % compared with that of pre-optimized medium. In addition, the OD560nm value 1.397 ± 0.013 in the optimized medium was very closely to the expected value 1.394. This result suggested that optimization of medium compositions for S. boulardii by BBD in this study was reliable and effective.

  14. Effect of Clinically Relevant CAD/CAM Zirconia Polishing on Gingival Fibroblast Proliferation and Focal Adhesions

    Directory of Open Access Journals (Sweden)

    Nicholas G. Fischer

    2017-11-01

    Full Text Available Mucosal seal formation around dental abutments is critical to the successful integration of dental implants into the human oral cavity. No information exists for how clinically relevant polishing procedures for computer-aided design and computer-aided manufactured (CAD/CAM zirconia abutments affects cellular responses important to mucosal seal formation. CAD/CAM zirconia was divided into four groups for clinically relevant polishing utilizing commercial polishing heads: control, coarse, coarse plus medium, and coarse plus medium plus fine. Surfaces were analyzed with scanning electron microscopy (SEM, atomic force microscopy (AFM, and optical profilometry (OP. Subsequently, human gingival fibroblasts (HGFs were seeded onto the zirconia surfaces. Proliferation was measured via a quantitative SEM technique and focal adhesion kinase (FAK phosphorylation status was measured by an enzyme-linked immunosorbent assay (ELISA. Results showed an increase in proliferation on all polished surfaces as compared to the control. Phosphorylation of FAK at tyrosine 397 (Y397 was up-modulated on the control surfaces. The associated cell adaptation is discussed. In all cases, FAK phosphorylation was greater at 24 h than 48 h. These results suggest that clinicians should be mindful of the effects of abutment polishing methodology, as this may have an impact on early mucosal seal formation.

  15. Oestrogen receptor α gene haplotype and postmenopausal breast cancer risk: a case control study

    International Nuclear Information System (INIS)

    Wedrén, Sara; Stiger, Fredrik; Persson, Ingemar; Baron, John; Weiderpass, Elisabete; Lovmar, Lovisa; Humphreys, Keith; Magnusson, Cecilia; Melhus, Håkan; Syvänen, Ann-Christine; Kindmark, Andreas; Landegren, Ulf; Fermér, Maria Lagerström

    2004-01-01

    Oestrogen receptor α, which mediates the effect of oestrogen in target tissues, is genetically polymorphic. Because breast cancer development is dependent on oestrogenic influence, we have investigated whether polymorphisms in the oestrogen receptor α gene (ESR1) are associated with breast cancer risk. We genotyped breast cancer cases and age-matched population controls for one microsatellite marker and four single-nucleotide polymorphisms (SNPs) in ESR1. The numbers of genotyped cases and controls for each marker were as follows: TA n , 1514 cases and 1514 controls; c.454-397C → T, 1557 cases and 1512 controls; c.454-351A → G, 1556 cases and 1512 controls; c.729C → T, 1562 cases and 1513 controls; c.975C → G, 1562 cases and 1513 controls. Using logistic regression models, we calculated odds ratios (ORs) and 95% confidence intervals (CIs). Haplotype effects were estimated in an exploratory analysis, using expectation-maximisation algorithms for case-control study data. There were no compelling associations between single polymorphic loci and breast cancer risk. In haplotype analyses, a common haplotype of the c.454-351A → G or c.454-397C → T and c.975C → G SNPs appeared to be associated with an increased risk for ductal breast cancer: one copy of the c.454-351A → G and c.975C → G haplotype entailed an OR of 1.19 (95% CI 1.06–1.33) and two copies with an OR of 1.42 (95% CI 1.15–1.77), compared with no copies, under a model of multiplicative penetrance. The association with the c.454-397C → T and c.975C → G haplotypes was similar. Our data indicated that these haplotypes were more influential in women with a high body mass index. Adjustment for multiple comparisons rendered the associations statistically non-significant. We found suggestions of an association between common haplotypes in ESR1 and the risk for ductal breast cancer that is stronger in heavy women

  16. In-beam γ-ray spectroscopy of the neutron rich 39Si

    International Nuclear Information System (INIS)

    Sohler, D.; Dombradi, Zs.; Achouri, N.L.; Angelique, J.C.; Bastin, B.; Azaiez, F.; Baiborodin, D.; Borcea, R.

    2009-01-01

    Complete text of publication follows. In order to clarify the role of proton excitations across the Z = 14 subshell closure in neutron-rich Si isotopes, we investigated the structure of the 14 39 Si 25 isotope, having three neutron-hole configurations with respect to an N = 28 core. The excited states of 39 Si were studied by in-beam γ-ray spectroscopy trough fragmentation of radioactive beams. The experiment was performed at the GANIL facility in France. The radioactive beams were produced by the fragmentation of the stable 48 Ca beam of 60 MeV/u energy and 4μA intensity on a 12 C target in the SISSI device. The cocktail beam produced was impinged onto a 9 Be target. The nuclei produced in the secondary fragmentation reaction were selected and unambiguously identified by the SPEG spectrometer. In the performed experiment the 39 Si nuclei were obtained via 1p, 1p1n, 2p1n and 2p2n knockout reactions from the 40,41 P and 42,43 S secondary beams. To measure the γ rays emitted from the excited states, the secondary target was surrounded by the 4π 'Chateau de Crystal' array consisting of 74 BaF 2 scintillators. The γ-ray spectra were generated by gating event-by-event on the incoming secondary beam particles and the ejectiles after the secondary target. For the γ rays emitted by the fast moving fragments accurate Doppler correction was performed. From the obtained γ spectra of 39 Si displayed in Figure 1, two strong γ transitions at 163 and 397 keV as well as weaker ones at 303, 657, 906, 1143 and 1551 keV have been identified. γγ coincidences were obtained in 39 Si after having added all data from the various reaction channels giving rise to 39 Si. Analysing these data the 163 keV transition was found to be in coincidence with the 657, 1143 and 1551 keV ones, but not with the 397 keV transition. The two lines of the 303+397 keV doublet are in mutual coincidence, and one or both of them are found in coincidence with the 906 keV transition.

  17. Big five personality and residential mobility: a state-level analysis of the USA.

    Science.gov (United States)

    McCann, Stewart J H

    2015-01-01

    Relations of the state-aggregated Big Five personality scores of 619,397 residents to four 2005 state-level residential mobility criteria were examined with the 50 states as cases. Multiple regression controlling for five state demographic variables showed (a) higher state neuroticism was strongly associated with lower mobility, lower same-county mobility, and lower between-county mobility; (b) higher state extraversion was associated with lower mobility and lower same-county mobility, but only with neuroticism and/or conscientiousness controlled; and (c) conscientiousness was related to same-residence, same-county, and different-county mobility, but only without demographic variables controlled. Discussion is grounded in the dangers of cross-level speculation and the potential of a basic assumption of geographical psychology that an area's aggregate position on a dispositional variable is associated there with behavioral and psychological tendencies related to that variable.

  18. Personality in Late Midlife: Associations With Demographic Factors and Cognitive Ability

    DEFF Research Database (Denmark)

    Mortensen, E. L.; Flensborg-Madsen, T.; Molbo, D.

    2014-01-01

    Objectives: To analyze associations in late midlife between sex, age, education and social class, and the Big Five personality traits; to analyze associations between personality traits and cognitive ability in late midlife; and to evaluate how these associations are influenced by demographic...... factors. Methods: The study sample comprised 5,397 late midlife participants from three cohorts who had completed the NEO Five-Factor Inventory (NEO-FFI) and a measure of cognitive ability. Results: Associations were demonstrated between the five NEO-FFI personality traits, and all included demographic...... factors. Cognitive ability and years of education correlated with several NEO-FFI personality traits in analyses adjusting for demographic variables. Cohort differences were observed for Extraversion and Openness. Discussion: Robust sex, educational, and social class differences in personality may...

  19. Antianginal efficacy of the combination of felodipine-metoprolol 10/100 mg compared with each drug alone in patients with stable effort-induced angina pectoris

    DEFF Research Database (Denmark)

    Emanuelsson, H; Egstrup, K; Nikus, K

    1999-01-01

    OBJECTIVE: The primary objective of this randomized, double-blind, parallel group trial was to compare the antianginal and antiischemic efficacy of a combination tablet of felodipine-metoprolol 10/100 mg once daily with both drugs given separately once daily in patients with stable effort......-daily treatment with either felodipine-metoprolol 10/100 mg, felodipine 10 mg, or metoprolol 100 mg. The duration of active double-blind treatment was 4 weeks. There were 3 primary efficacy variables in the study; time until end of exercise, time until onset of chest discomfort, and time until 1-mm ST depression...... during a standardized exercise test. RESULTS: The number of patients randomized was 397. There was a statistically significant improvement in time until end of exercise with felodipine-metoprolol 10/100 mg compared with metoprolol 100 mg (P =.04) and felodipine 10 mg compared with metoprolol 100 mg ( P...

  20. FeCrO Nanoparticles as Anode Catalyst for Ethane Proton Conducting Fuel Cell Reactors to Coproduce Ethylene and Electricity

    Directory of Open Access Journals (Sweden)

    Jian-Hui Li

    2011-01-01

    Full Text Available Ethylene and electrical power are cogenerated in fuel cell reactors with FeCr2O4 nanoparticles as anode catalyst, La0.7Sr0.3FeO3- (LSF as cathode material, and BaCe0.7Zr0.1Y0.2O3- (BCZY perovskite oxide as proton-conducting ceramic electrolyte. FeCr2O4, BCZY and LSF are synthesized by a sol-gel combustion method. The power density increases from 70 to 240 mW cm−2, and the ethylene yield increases from about 14.1% to 39.7% when the operating temperature of the proton-conducting fuel cell reactor increases from 650∘C to 750∘C. The FeCr2O4 anode catalyst exhibits better catalytic performance than nanosized Cr2O3 anode catalyst.