WorldWideScience

Sample records for alloy-ehi 397

  1. 49 CFR 397.225 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Judicial review. 397.225 Section 397.225... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.225 Judicial review. A party to a proceeding under § 397.205(a), § 397.213(a), or § 397.223(a) may seek review by the appropriate district...

  2. 49 CFR 397.211 - Preemption determination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Preemption determination. 397.211 Section 397.211... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.211 Preemption determination. (a) Upon... determination. (b) Notwithstanding that an application for a determination has not been filed under § 397.205...

  3. 49 CFR 397.13 - Smoking.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Smoking. 397.13 Section 397.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS TRANSPORTATION OF HAZARDOUS MATERIALS; DRIVING AND PARKING RULES General § 397.13...

  4. 49 CFR 397.11 - Fires.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Fires. 397.11 Section 397.11 Transportation Other... PARKING RULES General § 397.11 Fires. (a) A motor vehicle containing hazardous materials must not be operated near an open fire unless its driver has first taken precautions to ascertain that the vehicle can...

  5. 49 CFR 397.209 - Preemption processing.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.209 Preemption processing. (a) The... without prejudice if: (1) he or she determines that there is insufficient information upon which to base a...

  6. 49 CFR 397.217 - Waiver processing.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.217 Waiver processing. (a) The... application without prejudice if: (1) he or she determines that there is insufficient information upon which...

  7. 49 CFR 397.73 - Public information and reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Public information and reporting requirements. 397.73 Section 397.73 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL... Hazardous Materials § 397.73 Public information and reporting requirements. (a) Public information...

  8. 49 CFR 397.67 - Motor carrier responsibility for routing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Motor carrier responsibility for routing. 397.67 Section 397.67 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS...

  9. Fabrication of cold-rolled bands of the alloy-ehi 702 in rolls

    International Nuclear Information System (INIS)

    Zhuchin, V.N.; Gindin, A.Sh.; Shaburov, V.E.; Vladimirov, S.M.; Sokolov, V.A.; Shavkun, V.V.; Perepelitsa, I.V.; Markov, V.V.; Naymov, E.P.; Evstaf'ev, P.P.

    1977-01-01

    The questions are discussed, connected with the manufacture of cold-rolled strip of alloy EI702 in reels from strip blanks. It has been established that in the manufacture of hot-rolled stock from EI702 slabs it is necessary to use powerful rolling equipment because of high resistance to deformation. The reel method for manufacturing EI702 alloy improves the rolled stock and increases percentage of serviceable stock, as well as the output

  10. 49 CFR 397.219 - Waiver determination and order.

    Science.gov (United States)

    2010-10-01

    ... rational basis; (3) Whether the highway routing designation of the State, political subdivision thereof, or... readily identifiable by the Administrator as one who may be affected by the order. A copy of each order is... with § 397.223, an order issued under this section constitutes the final agency decision regarding...

  11. 17 CFR 39.7 - Fraud in connection with the clearing of transactions on a derivatives clearing organization.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Fraud in connection with the clearing of transactions on a derivatives clearing organization. 39.7 Section 39.7 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION DERIVATIVES CLEARING ORGANIZATIONS § 39.7 Fraud in connection...

  12. 49 CFR 397.2 - Compliance with Federal motor carrier safety regulations.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Compliance with Federal motor carrier safety...) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS TRANSPORTATION OF HAZARDOUS MATERIALS; DRIVING AND PARKING RULES General § 397.2 Compliance with...

  13. 14 CFR 135.397 - Small transport category airplane performance operating limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Small transport category airplane... PERSONS ON BOARD SUCH AIRCRAFT Airplane Performance Operating Limitations § 135.397 Small transport category airplane performance operating limitations. (a) No person may operate a reciprocating engine...

  14. Determination of persistent organohalogenated pollutants in human hair reference material (BCR 397): an interlaboratory study

    Energy Technology Data Exchange (ETDEWEB)

    Gill, Udai [Health Canada, Product Safety Laboratory, Ottawa, Ontario (Canada); Covaci, Adrian [University of Antwerp, Toxicological Center, Wilrijk (Belgium); Ryan, John Jake [Health Canada, Bureau of Chemical Safety, Health Products and Food Branch, Ottawa, Ontario (Canada); Emond, Andre [Health Canada, Environmental Research Division, First Nations and Inuit Health Branch, Ottawa, Ontario K1A0L2 (Canada)

    2004-12-01

    A human powdered hair material (BCR 397) was tested for its content in persistent organic pollutants (POPs), such as polychlorinated biphenyls (PCBs), organochlorine pesticides (OCPs) and polybrominated diphenyl ethers (PBDEs). Using different methods, three laboratories (two from Canada and one from Belgium) analysed a powdered hair sample to evaluate some methodologies and to obtain consensus values for selected POPs. Measured values for all PCB congeners and p,p'-DDE were within a relative standard deviation (RSD) of 15%. These first results contribute to the accuracy and precision for POPs quantification in hair and render test results more comparable among different laboratories. (orig.)

  15. pFAK-Y397 overexpression as both a prognostic and a predictive biomarker for patients with metastatic osteosarcoma.

    Science.gov (United States)

    Thanapprapasr, Kamolrat; Nartthanarung, Adisak; Thanapprapasr, Duangmani; Jinawath, Artit

    2017-01-01

    Focal adhesion kinase (FAK) is important for tumor cell survival and metastasis in various cancers. However, its expression and prognostic value in patients with metastatic osteosarcoma remain unknown. We investigated the expression of FAK and its phosphorylated form (pFAK-Y397) in osteosarcoma tissues from 53 patients by immunohistochemistry and evaluated their correlations with clinicopathologic characteristics and outcomes. The prognostic values were assessed using Kaplan-Meier survival and Cox regression analyses. Total FAK and pFAK-Y397 were overexpressed in 48 (90.6%) and 33 (62.3%) cases, respectively. pFAK-Y397 overexpression was correlated with poor histologic response after neoadjuvant chemotherapy in patients with osteosarcoma regardless of the presence of metastasis or not. Kaplan-Meier curve showed that patients with metastatic osteosarcoma with pFAK-Y397 overexpression had significantly worse overall survival (OS) than those with non-overexpression (P = 0.044). Multivariate Cox regression analysis confirmed pFAK-Y397 overexpression as an independent prognostic predictor for OS and post metastases OS (PMOS) (P = 0.017, P = 0.006, respectively). Age at diagnosis was also an independent indicator for PMOS (P = 0.003). However, total FAK expression was not correlated with any clinicopathologic characteristics or OS in patients with metastatic osteosarcoma. In conclusion, our findings identified FAK as a common aberrant protein overexpression in various subtypes of osteosarcoma. pFAK-Y397 overexpression can be used as a prognostic biomarker predicting poor OS for patients with metastatic osteosarcoma, and the expression of pFAK-Y397 differentiated good and poor responders to neoadjuvant chemotherapy.

  16. The applications of VIP 397/418 bulbs in free radical white pigmented coatings: UV curing evaluation for different free radical white pigmented formulations (I)

    International Nuclear Information System (INIS)

    Rong Bao; McCartney, R.

    1999-01-01

    White pigmented coatings have gained commercial success using a Gallium doped microwave F600-V bulb. A novel VIP 397/418 bulb has been made recently, by Fusion UV Systems, to increase UV curing efficiency of white pigmented coatings. Previous research work has shown that the VIP 397/418 bulb can cure cationic white pigmented coatings 40-60% faster than a F600-V bulb. Further evaluations of free radical white pigmented coatings have produced significant data indicating that better physical properties (40-50%) or higher cure speeds (50%) can be obtained by using the VIP 397/418 bulb than a F600-V bulb

  17. Ala397Asp mutation of myosin VIIA gene segregating in a Spanish family with type-Ib Usher syndrome.

    Science.gov (United States)

    Espinós, C; Millán, J M; Sánchez, F; Beneyto, M; Nájera, C

    1998-06-01

    In the current study, 12 Spanish families affected by type-I Usher syndrome, that was previously linked to chromosome 11q, were screened for the presence of mutations in the N-terminal coding portion of the motor domain of the myosin VIIA gene by single-strand conformation polymorphism analysis of the first 14 exons. A mutation (Ala397Asp) segregating with the disease was identified, and several polymorphisms were also detected. It is presumed that the other USHIB mutations in these families could be located in the unscreened regions of the gene.

  18. Safety Evaluation Report related to the operation of WPPSS Nuclear Project No. 2 (Docket No. 50-397)

    International Nuclear Information System (INIS)

    1984-04-01

    This report, Supplement No. 5 to the Safety Evaluation Report (SSER 5) on the Washington Public Power Supply System application for a license to operate WNP-2 (Docket No. 50-397), located in Benton County, Washington, approximately 12 miles north of Richland, Washington, has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplements No. 1, 2, 3, and 4

  19. Results of the independent verification of radiological remedial action at 397 East 3rd South Street, Monticello, Utah (MS00168)

    International Nuclear Information System (INIS)

    Wilson, M.J.; Crutcher, J.W.

    1991-07-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1987 and 1988, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 397 East 3rd South Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  20. Constraining the Single-degenerate Channel of Type Ia Supernovae with Stable Iron-group Elements in SNR 3C 397

    Energy Technology Data Exchange (ETDEWEB)

    Dave, Pranav; Kashyap, Rahul; Fisher, Robert [Department of Physics, University of Massachusetts Dartmouth, 285 Old Westport Road, North Dartmouth, MA 02740 (United States); Timmes, Frank [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Townsley, Dean [Department of Physics and Astronomy, Box 870324, University of Alabama, Tuscaloosa, AL 35487 (United States); Byrohl, Chris [Institut für Astrophysik, Georg August Universität Göttingen, Friedrich-Hund-Platz 1, D-37077 Göttingen (Germany)

    2017-05-20

    Recent Suzaku X-ray spectra of supernova remnant (SNR) 3C 397 indicate enhanced stable iron group element abundances of Ni, Mn, Cr, and Fe. Seeking to address key questions about the progenitor and explosion mechanism of 3C 397, we compute nucleosynthetic yields from a suite of multidimensional hydrodynamics models in the near-Chandrasekhar-mass, single-degenerate paradigm for Type Ia supernovae (SNe Ia). Varying the progenitor white dwarf (WD) internal structure, composition, ignition, and explosion mechanism, we find that the best match to the observed iron peak elements of 3C 397 are dense (central density ≥6 × 10{sup 9} g cm{sup −3}), low-carbon WDs that undergo a weak, centrally ignited deflagration, followed by a subsequent detonation. The amount of {sup 56}Ni produced is consistent with a normal or bright normal SNe Ia. A pure deflagration of a centrally ignited, low central density (≃2 × 10{sup 9} g cm{sup −3}) progenitor WD, frequently considered in the literature, is also found to produce good agreement with 3C 397 nucleosynthetic yields, but leads to a subluminous SN Ia event, in conflict with X-ray line width data. Additionally, in contrast to prior work that suggested a large supersolar metallicity for the WD progenitor for SNR 3C 397, we find satisfactory agreement for solar- and subsolar-metallicity progenitors. We discuss a range of implications our results have for the single-degenerate channel.

  1. Highly active antiretroviral therapy and outcome of AIDS-related Burkitt's lymphoma or leukemia. Results of the PETHEMA-LAL3/97 study.

    Science.gov (United States)

    Oriol, Albert; Ribera, Josep-Maria; Brunet, Salut; del Potro, Eloy; Abella, Eugènia; Esteve, Jordi

    2005-07-01

    Short, intensive cycles of chemotherapy have resulted in improved survival in BurkittOs lymphoma/leukemia (BL) in adults. The prognosis of patients with immunodeficiency virus (HIV)-associated BL is considered to be poor, but these patients have seldom been treated with BL-specific protocols. However, a study (PETHEMA-LAL3/97) in which patients with BL were treated regardless of their HIV status failed to find differences between HIV-infected and immunocompetent individuals. Furthermore, patients who received highly active antiretroviral therapy (HAART) seemed to have a slightly better disease-free survival than those who did not (p=0.051). We extended the follow-up analysis to elucidate the role of HAART in the survival of HIV-infected patients included in the PETHEMA-LAL3/97 protocol.

  2. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2, Docket No. 50-397, Washington Public Power Supply System

    International Nuclear Information System (INIS)

    1982-12-01

    Supplement 2 to the Safety Evaluation Report for Washington Public Power Supply System's application for a license to operate WNP-2 (Docket No. 50-397), located in Benton County, Washington, approximately 12 miles north of Richland, Washington, has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplement 1

  3. Characterization of the shape memory properties of a Ni45.3Ti39.7Hf10Pd5 alloy

    International Nuclear Information System (INIS)

    Acar, E.; Karaca, H.E.; Tobe, H.; Noebe, R.D.; Chumlyakov, Y.I.

    2013-01-01

    Highlights: •Ni 45.3 Ti 39.7 Hf 10 Pd 5 alloys have transformation strain of up to 4.6% and work output of up to 29 J cm −3 . •The alloy showed good superelastic behavior at 90 °C with recoverable strain of 4.3%. •The alloy exhibited 1.6% two-way shape memory strain after a simple training procedure. •The formation of 〈0 1 1〉 type II twins in martensite plates results in large transformation strain. -- Abstract: The load-biased shape memory and superelastic responses of a Ni 45.3 Ti 39.7 Hf 10 Pd 5 polycrystalline alloy were investigated in compression. Transformation strain of up to 4.6% and work output of up to 29 J cm −3 were determined from load-biased thermal cycling experiments. The alloy showed good superelastic behavior at 90 o C with recoverable strain of over 4%. It was also determined that the Ni 45.3 Ti 39.7 Hf 10 Pd 5 alloy could develop two-way shape memory strain of 1.6% without an intense training process. Transmission electron microscopy (TEM) revealed that the internal twins formed in the martensite variants were 〈0 1 1〉 type II twins

  4. A CHANDRASEKHAR MASS PROGENITOR FOR THE TYPE Ia SUPERNOVA REMNANT 3C 397 FROM THE ENHANCED ABUNDANCES OF NICKEL AND MANGANESE

    Energy Technology Data Exchange (ETDEWEB)

    Yamaguchi, Hiroya; Williams, Brian J.; Petre, Robert [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Badenes, Carles [Department of Physics and Astronomy and Pittsburgh Particle Physics, Astrophysics and Cosmology Center (PITT PACC), University of Pittsburgh, 3941 O’Hara Street, Pittsburgh, PA 15260 (United States); Foster, Adam R.; Brickhouse, Nancy S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Bravo, Eduardo [E.T.S. Arquitectura del Vallès, Universitat Politècnica de Catalunya, Carrer Pere Serra 1-15, E-08173 Sant Cugat del Vallès (Spain); Maeda, Keiichi [Department of Astronomy, Kyoto University, Kitashirakawa-oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Nobukawa, Masayoshi; Koyama, Katsuji [Department of Physics, Kyoto University, Kitashirakawa-oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Eriksen, Kristoffer A., E-mail: hiroya.yamaguchi@nasa.gov [Theoretical Design Division, Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States)

    2015-03-10

    Despite decades of intense efforts, many fundamental aspects of Type Ia supernovae (SNe Ia) remain elusive. One of the major open questions is whether the mass of an exploding white dwarf (WD) is close to the Chandrasekhar limit. Here, we report the detection of strong K-shell emission from stable Fe-peak elements in the Suzaku X-ray spectrum of the Type Ia supernova remnant (SNR) 3C 397. The high Ni/Fe and Mn/Fe mass ratios (0.11–0.24 and 0.018–0.033, respectively) in the hot plasma component that dominates the K-shell emission lines indicate a degree of neutronization in the supernova ejecta that can only be achieved by electron capture in the dense cores of exploding WDs with a near-Chandrasekhar mass. This suggests a single-degenerate origin for 3C 397, since Chandrasekhar mass progenitors are expected naturally if the WD accretes mass slowly from a companion. Together with other results supporting the double-degenerate scenario, our work adds to the mounting evidence that both progenitor channels make a significant contribution to the SN Ia rate in star-forming galaxies.

  5. A CHANDRASEKHAR MASS PROGENITOR FOR THE TYPE Ia SUPERNOVA REMNANT 3C 397 FROM THE ENHANCED ABUNDANCES OF NICKEL AND MANGANESE

    International Nuclear Information System (INIS)

    Yamaguchi, Hiroya; Williams, Brian J.; Petre, Robert; Badenes, Carles; Foster, Adam R.; Brickhouse, Nancy S.; Bravo, Eduardo; Maeda, Keiichi; Nobukawa, Masayoshi; Koyama, Katsuji; Eriksen, Kristoffer A.

    2015-01-01

    Despite decades of intense efforts, many fundamental aspects of Type Ia supernovae (SNe Ia) remain elusive. One of the major open questions is whether the mass of an exploding white dwarf (WD) is close to the Chandrasekhar limit. Here, we report the detection of strong K-shell emission from stable Fe-peak elements in the Suzaku X-ray spectrum of the Type Ia supernova remnant (SNR) 3C 397. The high Ni/Fe and Mn/Fe mass ratios (0.11–0.24 and 0.018–0.033, respectively) in the hot plasma component that dominates the K-shell emission lines indicate a degree of neutronization in the supernova ejecta that can only be achieved by electron capture in the dense cores of exploding WDs with a near-Chandrasekhar mass. This suggests a single-degenerate origin for 3C 397, since Chandrasekhar mass progenitors are expected naturally if the WD accretes mass slowly from a companion. Together with other results supporting the double-degenerate scenario, our work adds to the mounting evidence that both progenitor channels make a significant contribution to the SN Ia rate in star-forming galaxies

  6. Fusion evaporation-residue cross sections for 28Si+40Ca at E(28Si)=309, 397, and 452 MeV

    International Nuclear Information System (INIS)

    Vineyard, M.F.; Bauer, J.S.; Crum, J.F.; Gosdin, C.H.; Trotter, R.S.; Kovar, D.G.; Beck, C.; Henderson, D.J.; Janssens, R.V.F.; Wilkins, B.D.; Maguire, C.F.; Mateja, J.F.; Prosser, F.W.; Stephans, G.S.F.

    1992-01-01

    Velocity distributions of mass-identified evaporation residues produced in the 28 Si+ 40 Ca reaction have been measured at bombarding energies of 309, 397, and 452 MeV using time-of-flight techniques. These distributions were used to identify evaporation residues and to separate the complete-fusion and incomplete-fusion components. Angular distributions and upper limits for the total evaporation-residue and complete-fusion evaporation-residue cross sections were extracted at all three bombarding energies. The complete-fusion evaporation-residue cross sections and the deduced critical angular momenta are compared with earlier measurements and the predictions of existing models. The ratios of the complete-fusion evaporation-residue cross section to the total evaporation-residue cross section, along with those measured for the 28 Si+ 12 C and 28 Si+ 28 Si systems at the same energies, support the entrance-channel mass-asymmetry dependence of the incomplete-fusion evaporation-residue process reported earlier

  7. Illumina microRNA profiles reveal the involvement of miR397a in Citrus adaptation to long-term boron toxicity via modulating secondary cell-wall biosynthesis.

    Science.gov (United States)

    Huang, Jing-Hao; Qi, Yi-Ping; Wen, Shou-Xing; Guo, Peng; Chen, Xiao-Min; Chen, Li-Song

    2016-03-10

    The mechanisms underlying tolerance to B-toxicity in plants are still controversial. Our previous studies indicated that B-toxicity is mainly limited to leaves in Citrus and that alternations of cell-wall structure in vascular bundles are involved in tolerance to B-toxicity. Here, miRNAs and their expression patterns were first identified in B-treated Citrus sinensis (tolerant) and C. grandis (intolerant) leaves via high-throughput sequencing. Candidate miRNAs were then verified with molecular and anatomical approaches. The results showed that 51 miRNAs in C. grandis and 20 miRNAs in C. sinensis were differentially expressed after B-toxic treatment. MiR395a and miR397a were the most significantly up-regulated miRNAs in B-toxic C. grandis leaves, but both were down-regulated in B-toxic C. sinensis leaves. Four auxin response factor genes and two laccase (LAC) genes were confirmed through 5'-RACE to be real targets of miR160a and miR397a, respectively. Up-regulation of LAC4 resulted in secondary deposition of cell-wall polysaccharides in vessel elements of C. sinensis, whereas down-regulation of both LAC17 and LAC4, led to poorly developed vessel elements in C. grandis. Our findings demonstrated that miR397a plays a pivotal role in woody Citrus tolerance to B-toxicity by targeting LAC17 and LAC4, both of which are responsible for secondary cell-wall synthesis.

  8. Aspartic acid 397 in subunit B of the Na+-pumping NADH:quinone oxidoreductase from Vibrio cholerae forms part of a sodium-binding site, is involved in cation selectivity, and affects cation-binding site cooperativity.

    Science.gov (United States)

    Shea, Michael E; Juárez, Oscar; Cho, Jonathan; Barquera, Blanca

    2013-10-25

    The Na(+)-pumping NADH:quinone complex is found in Vibrio cholerae and other marine and pathogenic bacteria. NADH:ubiquinone oxidoreductase oxidizes NADH and reduces ubiquinone, using the free energy released by this reaction to pump sodium ions across the cell membrane. In a previous report, a conserved aspartic acid residue in the NqrB subunit at position 397, located in the cytosolic face of this protein, was proposed to be involved in the capture of sodium. Here, we studied the role of this residue through the characterization of mutant enzymes in which this aspartic acid was substituted by other residues that change charge and size, such as arginine, serine, lysine, glutamic acid, and cysteine. Our results indicate that NqrB-Asp-397 forms part of one of the at least two sodium-binding sites and that both size and charge at this position are critical for the function of the enzyme. Moreover, we demonstrate that this residue is involved in cation selectivity, has a critical role in the communication between sodium-binding sites, by promoting cooperativity, and controls the electron transfer step involved in sodium uptake (2Fe-2S → FMNC).

  9. Prevalence of ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms in Brazilian breast cancer-unaffected women

    Energy Technology Data Exchange (ETDEWEB)

    Giacomazzi, J.; Aguiar, E. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Palmero, E.I. [International Agency for Research on Cancer (IARC), Lyon (France); Schmidt, A.V. [Departamento de Estatística, UFRGS, Porto Alegre, RS (Brazil); Skonieski, G.; Filho, D.D. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Bock, H. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Saraiva-Pereira, M.L. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Bioquímica, UFRGS, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Ewald, I.P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Schuler-Faccini, L. [Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Camey, S.A. [Departamento de Estatística, Instituto de Matemática, UFRGS, Porto Alegre, RS (Brazil); Caleffi, M. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Giugliani, R. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Ashton-Prolla, P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (BR); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (BR); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (BR); Serviço de Genética Médica, HCPA, Porto Alegre, RS (BR); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (BR); Departamento de Genética, UFRGS, Porto Alegre, RS (BR)

    2012-05-18

    Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease.

  10. Publications | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3961 - 3970 of 6384 ... Climate change poses serious challenges to Sudan''s development priorities in agriculture, forestry, water resource management, and health. ... the progress toward the control and elimination of malaria, thanks to prevention policies and the increased availability of pharmaceutical drugs, this ...

  11. 49 CFR 397.71 - Federal standards.

    Science.gov (United States)

    2010-10-01

    ... Enforcement and Compliance (MC-EC), 1200 New Jersey Ave., SE., Washington, DC 20590-0001. (2) Public... 30-day period in which to comment. At any time during this period or following review of the comments... left to the discretion of the State or Indian tribe. (iii) The State or Indian tribe shall attempt to...

  12. TMFunction data: 397 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... L394F;I395S ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  13. US House of Representatives resolution 397

    Index Scriptorium Estoniae

    2008-01-01

    USA Kongressi Esindajatekoja Eesti teemaline resolutsioon, milles väljendatakse solidaarsust Eestiga ning mõistetakse hukka märatsejate vägivald Tallinnas ning rünnakud Eesti saatkonna vastu Moskvas

  14. 18 CFR 39.7 - Enforcement of Reliability Standards.

    Science.gov (United States)

    2010-04-01

    ... audits of compliance with Reliability Standards by users, owners and operators of the Bulk-Power System... resolved by an admission that the user, owner or operator of the Bulk-Power System violated a Reliability...-Power System for a violation of a Reliability Standard approved by the Commission if, after notice and...

  15. 40 CFR 98.397 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... of density and carbon share for any petroleum product or natural gas liquid for which CO2 emissions... gas liquids, biomass, and feedstocks, reporters shall maintain metering, guaging, and other records... quantities of petroleum products, natural gas liquids, biomass, and feedstocks reported under this subpart...

  16. ACOG committee opinion number 397, February 2008: surrogate motherhood.

    Science.gov (United States)

    2008-02-01

    Ethical responsibilities are described for obstetrician-gynecologists who choose to participate in surrogacy arrangements by 1) advising couples who are considering surrogacy, 2) counseling potential surrogate mothers, 3) providing obstetric services for pregnant women participating in surrogacy, or 4) offering assisted reproductive technologies related to surrogacy. Although the obligations of physicians will vary depending on the type and level of their involvement, in all cases physicians should carefully examine all relevant issues related to surrogacy, including medical, ethical, legal, and psychologic aspects.

  17. All projects related to | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Technologies for Social Inclusion and Public Policies in Latin America ... Topic: GOVERNMENT PROGRAMMES, Science and Technology, Poverty ... Region: Argentina, South America, Brazil, Chile, Peru, Uruguay, North and Central America.

  18. 397 Empirical Assessment of Agricultural Development in Manzini ...

    African Journals Online (AJOL)

    User

    happy about this turn-around in events given that the agricultural sector has been one of ... During the same period both commercial and family agriculture grew by 11,. 7% and 15 ... domestic product and foreign exchange earnings in large proportions ... economics has evolved in the direction of finer and finer specialisation.

  19. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 397

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...

  20. 76 FR 397 - iShares Trust, et al.; Notice of Application

    Science.gov (United States)

    2011-01-04

    ... control with BFA (a ``BFA Affiliate'') that may utilize active management strategies, subject to the terms... utilizing an ``active'' management strategy.\\3\\ The Funds may invest in equity or fixed income securities... advertised or marketed as an ``open-end investment company'' or a ``mutual fund.'' Instead, each Fund will be...

  1. SU-E-T-397: Include Organ Deformation Into Dose Calculation of Prostate Brachytherapy

    International Nuclear Information System (INIS)

    Shao, Y; Shen, D; Chen, R; Wang, A; Lian, J

    2014-01-01

    Purpose: Prostate brachytherapy is an important curative treatment for patients with localized prostate cancer. In brachytherapy, rectal balloon is generally needed to adjust for unfavorable prostate position for seed placement. However, rectal balloon causes prostate deformation, which is not accounted for in dosimetric planning. Therefore, it is possible that brachytherapy dosimetry deviates significantly from initial plan when prostate returns to its non-deformed state (after procedure). The goal of this study is to develop a method to include prostate deformation into the treatment planning of brachytherapy dosimetry. Methods: We prospectively collected ultrasound images of prostate pre- and post- rectal balloon inflation from thirty five consecutive patients undergoing I-125 brachytherapy. Based on the cylinder coordinate systems, we learned the initial coordinate transformation parameters between the manual segmentations of both deformed and non-deformed prostates of each patient in training set. With the nearest-neighbor interpolation, we searched the best transformation between two coordinate systems to maximum the mutual information of deformed and non-deformed images. We then mapped the implanted seeds of five selected patients from the deformed prostate into non-deformed prostate. The seed position is marked on original pre-inflation US image and it is imported into VariSeed software for dose calculation. Results: The accuracy of image registration is 87.5% as quantified by Dice Index. The prostate coverage V100% dropped from 96.5±0.5% of prostate deformed plan to 91.9±2.6% (p<0.05) of non-deformed plan. The rectum V100% decreased from 0.44±0.26 cc to 0.10±0.18 cc (p<0.05). The dosimetry of the urethra showed mild change but not significant: V150% changed from 0.05±0.10 cc to 0.14±0.15 cc (p>0.05) and D1% changed from 212.9±37.3 Gy to 248.4±42.8 Gy (p>0.05). Conclusion: We have developed a deformable image registration method that allows dosimetry calculation in the non-deformed prostate – which may be used to more accurately reflect “true” dosimetry during planning

  2. Korean Waste Management Law, Presidential Decree Number 13480, and Prime Minister Order Number 397

    Science.gov (United States)

    1994-06-01

    radioactive waste or substances that are contaminated by radioactivity and medical waste (which is regulated by Medical Law), wastewater (which is regulated...be exceeded when the domestic waste is disposed a. In case where water polutant , pursuant to Table 1 of toe Enforcement Regulaton in the Water...combustion burner and extra burner * Normal operation of safety facilities • Normal operation of preventive facilities * Density of polutant out of

  3. 49 CFR 397.101 - Requirements for motor carriers and drivers.

    Science.gov (United States)

    2010-10-01

    ... level of radiological risk; and (3) Tell the driver which route to take and that the motor vehicle... will access emergency assistance in each State to be entered. (e) No person may transport a package of highway route controlled quantity of Class 7 (radioactive) materials on a public highway unless: (1) The...

  4. WPPSS Nuclear Project No. 2: Final environmental statement (DOCKET No. 50-397)

    International Nuclear Information System (INIS)

    1981-12-01

    The proposed action is the issuance of an operating license to the Washington Public Power Supply System (WPPSS) for the startup and operation of the Washington Nuclear Project Number 2 (WNP-2) located on the Columbia River in Benton County, about 19 km (12 mi) north of Richland, Washington. The facility will employ a boiling water reactor to produce 3323 megawatts thermal (MWt). A steam turbine-generator will use this heat to provide a nominal gross electrical output of 1150 megawatts (MWe). The exhaust steam will be condensed by cooled water from six circular mechanical-draft cooling towers with water taken from and returned to the Columbia River. The information in this statement represents the second assessment of the environmental impact associated with the WNP-2 pursuant to the guidelines of the National Environmental Policy Act of 1969 (NEPA) and 10 CRF Part 51 of the Commission's Regulations. After receiving an application to construct this plant, the staff carried out a review of impacts that would occur during its construction and operation. That evaluation was issued as a Final Environmental Statement (construction phase). The construction of Unit 2 about 86% complete. The staff estimated a fuel-loading date of September 1983. In March 1977, the applicant applied for an operating license for the unit and submitted the required safety and environmental reports in support of the application. 20 figs., 19 tabs

  5. 7 CFR 1755.397 - RUS performance specification for line concentrators.

    Science.gov (United States)

    2010-01-01

    ... part 51. Copies of these standards are available for inspection during normal business hours at RUS.... (ii) There should be provisions for such types of lines as ground start, loop start, regular... surface of the protectors. Means for easy identification of pairs shall be provided. (v) Protectors shall...

  6. Bridge Busters: The 397th Bombardment Group (Medium) and the B-26 Marauder in World War II

    Science.gov (United States)

    2015-06-01

    wooded area of Foret de Blois , the group delivered relatively accurate attacks but noted no secondary explosions. Poor weather stopped them from bombing...Loire 88 7-Aug-44 Ammunition Dump Foret De Blois 89 8-Aug-44 Railroad Bridge/ Embankment Mantes Gassicourt 90 8-Aug-44 Coastal Defense

  7. Community College Partnerships for Student and Career Success: Program Profile of "Carreras en Salud." Fact Sheet #C397

    Science.gov (United States)

    Henrici, Jane

    2012-01-01

    Postsecondary students with children often need an array of supports to succeed in their studies, which can require significant coordination among new and existing services (Conway, Blair, and Helmer 2012; Henrici n.d.; Miller, Gault, and Thorman 2011). Such supports might include financial aid, academic and career counseling, job placement…

  8. SU-F-T-397: Evaluating the Impact of Bladder Filling Status for the Organs at Risk Dose Distribution in Cervical Cancer Patients with Intensity Modulated Radiotherapy

    International Nuclear Information System (INIS)

    Zhang, JY; Hong, DL

    2016-01-01

    Purpose: To investigate the impact of bladder filling status of the organs at risk (OARs) on dose distribution during intensity modulated radiotherapy (IMRT) for cervical cancer patients. Methods: Twelve cervical cancer patients treated with IMRT were selected for this study. The prescription dose was 45Gy/25 fractions with the 6 MV photon beam. All patients performed two CT scans, one with an empty bladder, the other one with bladder filled. For the registration of two CT scans, the fusion was automatically carried out upon the bony anatomy. The OARs (bladder, rectum, pelvic bone and small intestine) were delineated to planning CT to evaluate the dose distributions. These dose distributions were compared between empty bladder and bladder filling. Results: The bladder volume with empty bladder and bladder filling was 403.2±124.13cc and 101.4±87.5cc, respectively. There were no statistical differences between empty bladder and bladder filling in the mean value of pelvic bone V10Gy, V20Gy, V40Gy; rectum V40Gy and V45Gy. The bladder V40Gy and V45Gy were lower in the bladder filling group than in the empty bladder group (63.7%±5.8% vs 87.5%±7.8%, 45.1%±9.5% vs 62.4%±11.8%, respectively). The V45Gy for small intestine in the bladder filling group was significantly less than the empty bladder group (146.7cc±95.3cc vs 245.7cc±101.8cc). Conclusion: Our study finds that the bladder filling status did not have a significant impact on dose distribution in the rectum and pelvic bone. However, the changes of bladder filling have a large impact on bladder and small intestine doses. A full bladder is strongly recommended during treatment for cervical cancer patients.

  9. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2, (Docket No. 50-397). Supplement No. 4

    International Nuclear Information System (INIS)

    1983-12-01

    Supplement No. 4 to the Safety Evaluation Report on the application filed by Washington Public Power Supply System for a license to operate the WPPSS Nuclear Project No. 2, located in Richland, Washington, has been prepared by the Division of Licensing, Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplement Nos. 1, 2 and 3

  10. Final Scientific Report DE-FGO3-97ER62460 Stomatal Responses to CO2: A Comparison of Woody and Herbaceous Species in Arid and Humid Climates

    Energy Technology Data Exchange (ETDEWEB)

    Koch, George W.

    2003-12-19

    OAK-B135 The project involved a study of a fundamental response of terrestrial vegetation to rising atmospheric carbon dioxide (CO2) concentration, namely, the change in leaf conductance to gas diffusion associated with a change in the aperture of the microscopic pores (stomata) on the surface of leaves.

  11. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2. Docket No. 50-397, Washington Public Power Supply System

    International Nuclear Information System (INIS)

    1982-08-01

    Information is presented concerning site characteristics; design criteria for structures, systems, and components; engineered safety features; instrumentation and control; auxiliary systems; conduct of operations; and financial qualifications

  12. SU-F-T-397: Evaluating the Impact of Bladder Filling Status for the Organs at Risk Dose Distribution in Cervical Cancer Patients with Intensity Modulated Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, JY [Cancer Hospital of Shantou University Medical College, Shantou, Guangdong (China); Hong, DL [The First Affiliated Hospital of Shantou University Medical College, Shantou, Guangdong (China)

    2016-06-15

    Purpose: To investigate the impact of bladder filling status of the organs at risk (OARs) on dose distribution during intensity modulated radiotherapy (IMRT) for cervical cancer patients. Methods: Twelve cervical cancer patients treated with IMRT were selected for this study. The prescription dose was 45Gy/25 fractions with the 6 MV photon beam. All patients performed two CT scans, one with an empty bladder, the other one with bladder filled. For the registration of two CT scans, the fusion was automatically carried out upon the bony anatomy. The OARs (bladder, rectum, pelvic bone and small intestine) were delineated to planning CT to evaluate the dose distributions. These dose distributions were compared between empty bladder and bladder filling. Results: The bladder volume with empty bladder and bladder filling was 403.2±124.13cc and 101.4±87.5cc, respectively. There were no statistical differences between empty bladder and bladder filling in the mean value of pelvic bone V10Gy, V20Gy, V40Gy; rectum V40Gy and V45Gy. The bladder V40Gy and V45Gy were lower in the bladder filling group than in the empty bladder group (63.7%±5.8% vs 87.5%±7.8%, 45.1%±9.5% vs 62.4%±11.8%, respectively). The V45Gy for small intestine in the bladder filling group was significantly less than the empty bladder group (146.7cc±95.3cc vs 245.7cc±101.8cc). Conclusion: Our study finds that the bladder filling status did not have a significant impact on dose distribution in the rectum and pelvic bone. However, the changes of bladder filling have a large impact on bladder and small intestine doses. A full bladder is strongly recommended during treatment for cervical cancer patients.

  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available : 338 ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTCVAPNVFYSDPKLEG 397 ... ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTC...VAPNVFYSDPKLEG Sbjct: 121 ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTCVAPNVFYSDPKLEG 180 ...

  14. Atuação dos fisioterapeutas dos núcleos de apoio à saúde da família entre idosos do município de Arapiraca-Al, Brasil - doi: 10.5020/18061230.2012.p397

    Directory of Open Access Journals (Sweden)

    Almir Vieira Dibai Filho

    2013-07-01

    Full Text Available Objetivo: Analisar a atuação dos fisioterapeutas nos Núcleos de Apoio à Saúde da Família (NASF com indivíduos senescentes residentes no município de Arapiraca-AL, Brasil. Metodos: Estudo caracterizado como descritivo e qualitativo. Os sujeitos da pesquisa foram oito fisioterapeutas realizando intervenções junto aos idosos nos NASF, de ambos os sexos, regularmente inscritos no Conselho Regional de Fisioterapia e Terapia Ocupacional 1 (CREFITO 1. Os dados foram obtidos no mês de outubro de 2010 com a aplicação de um questionário para caracterizar a amostra, sendo coletados dados pessoais e questões relacionadas à formação acadêmica e ao trabalho nos NASF. Além disso, realizou-se uma entrevista abordando opiniões dos fisioterapeutas referentes ao cuidado com o idoso na Estratégia Saúde da Família (ESF e nos NASF, à atuação dos fisioterapeutas dos NASF com idosos, e às dificuldades vivenciadas nesse trabalho. Foi realizada uma análise qualitativa por meio da técnica do discurso do sujeito coletivo. Resultados: Os profissionais incluídos no estudo consideraram regular e positivo o cuidado ao idoso na ESF e nos NASF, respectivamente. As intervenções deles nos NASF se baseiam em ações sustentadas na atenção primária à saúde e as dificuldades encontradas dizem respeito à equipe multidisciplinar e à falta de recursos e infraestrutura. Conclusão: Os fisioterapeutas dos NASF do município em estudo desenvolvem suas ações na população senescente, com ênfase em medidas educativas, preventivas e promotoras de saúde.

  15. ORF Alignment: NC_004347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QGAIYPLLTPENDE Sbjct: 1 ... STKQPIAIIGGGLASAHLMLSLAEREQSSILFCKDNDLGQGASGNRQGAIYPLLTPENDE 60 ... Query: 338 QSQDWPAEIAYAVDASEAN...KIAKIGIDKAGFYYPLGGWVCPFEYAKAAVDKASQLANVQC 397 ... QSQDWPAEIAYAVDASEANKIAKIGIDKAGFYYPLGGW...VCPFEYAKAAVDKASQLANVQC Sbjct: 121 QSQDWPAEIAYAVDASEANKIAKIGIDKAGFYYPLGGWVCPFEYAKA

  16. ORF Alignment: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ATIENT Sbjct: 1 ... EEQFWATVSYYELNTRVGEQVKVSSTTITIDGFTDPCINGSKISLGLFSNVNRNATIENT 60 ... Query: 338 MEIFRQLLEDCSRRGFDASFDLQKMTFIRMS...FVKGWGAEYQRQDVTSTPCWIEIHLHAPL 397 ... MEIFRQLLEDCSRRGFDASFDLQKMTFIRMS...FVKGWGAEYQRQDVTSTPCWIEIHLHAPL Sbjct: 121 MEIFRQLLEDCSRRGFDASFDLQKMTFIRMSFVKGWGAEYQRQDVTSTPCWIEIHLHAPL 180 ...

  17. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available loti ... 1021] ... Length = 174 ... Query: 277 EMLGEKFHMDEAYLRELNPGVDFSIPGTTIKVVNPGPNKKGKVARIVADKAR...KQVLAYDE 336 ... EMLGEKFHMDEAYLRELNPGVDFSIPGTTIKVVNPGPNKKGKVARIVADKARKQV...LAYDE Sbjct: 1 ... EMLGEKFHMDEAYLRELNPGVDFSIPGTTIKVVNPGPNKKGKVARIVADKARKQVLAYDE 60 ... Query: 397 PVGTVWIALSKPTYG

  18. Biodeuterated Materials: High-Temperature Lubricants from Algae.

    Science.gov (United States)

    1986-01-06

    to obtain significant growth in D20 media. 1. Chlorella vulgaris (UTEX 397) 2. Chlorella vulgaris (Arg) 3. Scenedesmus obliquus (Arg) 4. Scenedesmus...the other two strains, and almost half of the total fatty acids of strain 1237 was 18:1. Effect of Nitrogen-Deficient Media Chlorella vulgaris (Arg...2.3 36 18 4.5 strain 1237 D20 31 2.9 -- 46 14 5.7 Chlorella vulgaris strain 397 H20 53 9.3 -- 1.6 5.6 19 12 strain 397 D20 28 2.3 -- 6.4 30 23 9.5

  19. Effect of soil moisture on root-associated fungal communities of Erica dominans in Drakensberg mountains in South Africa

    Czech Academy of Sciences Publication Activity Database

    Kohout, Petr; Tedersoo, L.

    2017-01-01

    Roč. 27, č. 4 (2017), s. 397-406 ISSN 0940-6360 Institutional support: RVO:67985939 Keywords : mycorrhiza * ecology * fungi Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.047, year: 2016

  20. Thermodynamic properties of solubility of 2-methyl-5-arylfuran-3-carboxylic acids in organic solvents

    Czech Academy of Sciences Publication Activity Database

    Sobechko, I.; Dibrivnyi, V.; Horak, Y.; Velychkivska, Nadiia; Kochubei, V.; Obushak, M.

    2017-01-01

    Roč. 11, č. 4 (2017), s. 397-404 ISSN 1996-4196 Institutional support: RVO:61389013 Keywords : enthalpy * entropy * Gibbs energy of solubility Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science

  1. 78 FR 57400 - National Cancer Institute; Notice of Meeting

    Science.gov (United States)

    2013-09-18

    ... Organizational Engagement; and Proposed Organizational Change: Division of Extramural Activities. Place: National....396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research Manpower; 93.399...

  2. Myosin-1E interacts with FAK proline-rich region 1 to induce fibronectin-type matrix

    DEFF Research Database (Denmark)

    Heim, Joel B; Squirewell, Edwin J; Neu, Ancilla

    2017-01-01

    Focal adhesion kinase (FAK) is a nonreceptor tyrosine kinase involved in development and human disease, including cancer. It is currently thought that the four-point one, ezrin, radixin, moesin (FERM)-kinase domain linker, which contains autophosphorylation site tyrosine (Y) 397, is not required...... for in vivo FAK function until late midgestation. Here, we directly tested this hypothesis by generating mice with FAK Y397-to-phenylalanine (F) mutations in the germline. We found that Y397F embryos exhibited reduced mesodermal fibronectin (FN) and osteopontin expression and died during mesoderm development...... and other FN-type matrix in both mouse embryonic fibroblasts and human melanoma. Our data support a model in which FAK Y397 autophosphorylation is required for FAK function in vivo and is positively regulated by MYO1E....

  3. Rozptýlení jako předpoklad soustředění: poznámky k pojetí recepce u Waltera Benjamina

    Czech Academy of Sciences Publication Activity Database

    Dvořák, Tomáš

    2003-01-01

    Roč. 15, č. 4 (2003), s. 67-84 ISSN 0862-397X Institutional research plan: CEZ:AV0Z9009908 Keywords : Walter Benjamin * distraction * concentration * media reception Subject RIV: AA - Philosophy ; Religion

  4. Modulární laboratorní fluorová linka v ÚOCHB AV ČR

    Czech Academy of Sciences Publication Activity Database

    Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef

    2014-01-01

    Roč. 108, č. 4 (2014), s. 394-397 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  5. Vaccination studies in type 1 diabetes

    Czech Academy of Sciences Publication Activity Database

    Buschard, K.; Funda, David P.

    2002-01-01

    Roč. 360, - (2002), s. 488-489 ISSN 0140-6736 Institutional research plan: CEZ:AV0Z5020903 Keywords : vaccination * diabetes Subject RIV: EE - Microbiology, Virology Impact factor: 15.397, year: 2002

  6. WT1 expression in peripheral leukocytes of patients with chronic myeloid leukemia serves for the prediction of Imatinib resistance

    Czech Academy of Sciences Publication Activity Database

    Otahalová, E.; Ullmannová-Benson, Veronika; Klamová, H.; Haškovec, C.

    2009-01-01

    Roč. 56, č. 5 (2009), s. 393-397 ISSN 0028-2685 Institutional research plan: CEZ:AV0Z50200510 Keywords : Imatinib * drug resistance * cml Subject RIV: EC - Immunology Impact factor: 1.192, year: 2009

  7. 77 FR 70170 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2012-11-23

    ... with the proposed research projects, the disclosure of which would constitute a clearly unwarranted..., Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398...

  8. 78 FR 41072 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2013-07-09

    ... with the proposed research projects, the disclosure of which would constitute a clearly unwarranted..., Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398...

  9. 76 FR 42719 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2011-07-19

    ... with the proposed research projects, the disclosure of which would constitute a clearly unwarranted... and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397...

  10. 76 FR 10381 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2011-02-24

    ... with the proposed research projects, the disclosure of which would constitute a clearly unwarranted... and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397...

  11. "Our Song!" Nationalism in Folk Music Research and Revival in Socialist Czechoslovakia

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2015-01-01

    Roč. 56, č. 4 (2015), s. 397-405 ISSN 1788-6244 Institutional support: RVO:68378076 Keywords : Czechoslovakia * folk music * folk song collections * revival * politics * nationalism * communism Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Jazyková komunikace a hodnotová atmosféra

    Czech Academy of Sciences Publication Activity Database

    Tondl, Ladislav

    2015-01-01

    Roč. 37, č. 4 (2015), s. 389-397 ISSN 1210-0250 Institutional support: RVO:67985955 Keywords : language * communication * value s * decision-making Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0260371

  13. Book Review: Africa and Europe in the Twenty-First Century ...

    African Journals Online (AJOL)

    Abstract. Title: Africa and Europe in the Twenty-First Century. Author: Osita C. Eze and Amadu Sesay. Publisher: Nigerian Institute of International Affairs, 2010, xvi + 397pp, Tables, Index. ISBN: 978-002-102-7 ...

  14. Mesozoic and Tertiary Anura of Laurasia

    Czech Academy of Sciences Publication Activity Database

    Roček, Zbyněk

    2013-01-01

    Roč. 93, č. 4 (2013), s. 397-439 ISSN 1867-1594 Institutional support: RVO:67985831 Keywords : Anura * Laurasia * taxonomic diagnoses * systematic review * stratigraphy * distribution Subject RIV: EG - Zoology

  15. Dissolution rate enhancement of repaglinide by solid dispersion

    African Journals Online (AJOL)

    Keywords: Diabetes, Solid dispersion, Repaglinide, Solubility, Dissolution, Burst release. Tropical Journal of ... high lipophilicity (logP = 3.97) and relatively low oral bioavailability (56 .... II drug, i.e., low soluble and high permeable in nature. As.

  16. 75 FR 11922 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-03-12

    .... TA-W-71,397; Teradyne, Inc., Semiconductor Test Div., CDI Talent Management, Richardson, TX. June 23..., 2008. TA-W-71,187; Cisco Systems, Inc., Network Management Technology Group, Boxborough, MA. May 18...

  17. Impact of demographic factors on management competencies of the municipal sport

    Directory of Open Access Journals (Sweden)

    Tripolitsioti Alexandra

    2016-04-01

    Full Text Available The purpose of this study was to define the competencies required for the administration of the sports facilities, of the municipal sport organizations and to compare them with selected variables, such as age, educational level, type of degree and years of employment. In the study participated 401 sport’s facilities managers, of the Municipal sport organizations of the country. They answered in a questionnaire designed for the study purposes, which was sent to them postal. The Multivariate Analysis of Variance (MANOVA between age, educational level, type of degree and years of employment revealed that: a there were statistically significant differences between the different age groups for the facility management factor (F(3, 397= 4.947, p< 0.002 and governance factor (F(3, 397= 3.170, p< 0.024, b there were statistically significant differences between the PhD holders, the Master holders, the Higher Education graduates or any other title for the event management factor (F(3, 397= 3.073, p< 0.028 and first aid/crisis management factor (F(3, 397= 4.311, p< 0.005, c there were statistically significant differences between the different titles for the first aid- crisis management factor (F(3, 397= 10.264, p< 0.000 and governance factor (F(3, 397= 4.104, p< 0.007 and d there were statistically significant differences between the total years of employment for the first aid-crisis management factor (F(3, 397= 6.869, p< 0.000 and governance factor (F(3, 397= 3.779, p< 0.011. It is concluded that the competency factors of the Sport’s Facilities managers of the municipal sport organizations are affected by the age, the educational level, the type of degree and the years of employment.

  18. Expression of focal adhesion kinase in uveal melanoma and the effects of Hsp90 inhibition by 17-AAG.

    Science.gov (United States)

    Faingold, Dana; Filho, Vasco Bravo; Fernandes, Bruno; Jagan, Lisa; de Barros, Alexandre M; Orellana, Maria Eugenia; Antecka, Emilia; Burnier, Miguel N

    2014-11-01

    Focal adhesion kinase (FAK) is implicated in tumor progression and metastatic cascade, and has been shown to be overexpressed in a variety of human cancers. However, the role of FAK in human uveal melanoma (UM) is not well defined. The purpose of this study was to evaluate the expression of FAK in UM tumors and normal eyes, and to determine the effect of Hsp90 inhibition on FAK expression in UM cells. FAK expression was assessed in 39 UM specimens, FAK[pY397] expression was assessed in 51 UM specimens, and both FAK and FAK[pY397] expression were assessed in 20 normal eyes. The expression of FAK and FAK[pY397] was detected by Western blot in five UM cell lines after treatment with 10 μmol/L of 17-AAG. FAK was positive in 87.2% and FAK[pY397] in 90% of UM specimens. Low FAK expression was detected in non-tumor structures and in normal eyes. The cell lines with the most proliferative, invasive phenotype (92.1, SP6.5 and MKT-BR) displayed high expression of FAK[pY397], and the levels of FAK and FAK[pY397] were decreased in the presence of 17-AAG starting with 24 h of exposure. FAK and FAK[pY397] were overexpressed in human UM tumors compared to normal ocular tissue and high levels of FAK[pY397] were seen in the most aggressive UM cell lines. Hsp90 inhibition led to downregulation of FAK expression. We propose a role for FAK in the pathogenesis of UM. Future studies are needed to explore the use of Hsp90 inhibitors as a feasible approach for modulating FAK in UM. Copyright © 2014 Elsevier GmbH. All rights reserved.

  19. The role of IL6 and ESR1 gene polymorphisms as immunological factors of pregnancy maintenance

    Directory of Open Access Journals (Sweden)

    Kucherenko A. M.

    2013-09-01

    Full Text Available Aim. The study is aimed at the evaluation of the association of IL6 gene -174G/C polymorphism and ESR1 gene -397C/T polymorphism with recurrent pregnancy loss (RPL pathogenesis and at the investigation of the ESR1 gene -397C/T variant regulatory significance for the IL6 gene function. Methods. A case group of 75 women with RPL history and a control group of 106 unrelated healthy women, who have given birth to at least one child conceived in natural way, were genotyped by a PCR based restriction fragment length polymorphism assay. Results. There was no significant difference in IL6 -174G/C or ESR1 -397C/T genotype and allele frequencies between the case and control groups. Combined genotype distribution analysis showed significantly (p < 0.05 lower frequency of individuals homozygous for both IL6 -174G and ESR1 -397C alleles in case group (0.026 comparing to control (0.094. Conclusions. Genotype comprising IL6 -174G and ESR1 -397C alleles in homozygous state may be considered as a genetic marker of successful pregnancy maintenance during gestation early stages.

  20. 生椎茸中のプレビタミンD_2およびビタミンD_2の同定

    OpenAIRE

    高村, 一知; 星野, 浩子; 叶多, 謙蔵; タカムラ, カズノリ; ホシノ, ヒロコ; カノウタ, ケンゾウ; KAZUNORI, TAKAMURA; HIROKO, HOSHINO; KENZO, KANOHTA

    1993-01-01

    Pre-vitamin D_2(pre-D_2)and vitamin D_2(D_2)in raw shiitake mushroom were identified by liquid chromatography-mass spectrometry (LC-MS) with modified plasmaspray. 1. Pre-D_2 and D_2 in raw shiitake mushroom were separated by LC. 2. Pre-D_2 was confirmed parent ion(m/z 397 [M+H]^+)to scan number 259 of total ion chromatogram. 3. D_2 was cofirmed parent ion(m/z 397 [M+H]^+) to scan number 296 of total ion chromatogram. 4. We have succeeded in obtaining mass spectra of pre-D_2 and D_2 that does ...

  1. QuickSOFA is an independent predictor of 30-day mortality among patients admitted to an emergency department with suspected or documented infection

    DEFF Research Database (Denmark)

    Bin Abdullah, Osama; Grand, Johannes; Sijapati, Astha

    .78; 95% CI 2.09-10.91) and lactate values (lactate values 4.0 (OR 3.97; 95% CI 1.44-2,92) were associated with 30-day mortality. Conclusion. qSOFA can be helpful to identify infectious patients in an ED...

  2. Nikkaji Dictionary: ノルケタミン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term ノルケタミン 名詞 一般 * * * * ノルケタミン ... Nikkaji J397.916D 200906056292209128 C CA06 UNKNOWN_1 ノルケタミン

  3. 78 FR 25349 - Policy Clarification Concerning Designation of Adjacent Coastal States for Deepwater Port License...

    Science.gov (United States)

    2013-04-30

    ... United States. The United Nations Convention on the Law of the Sea (``UNCLOS'') further clarifies the...\\ United Nations Convention on the Law of the Sea, Art. 2-3, Art. 33, Dec. 10, 1982, 1833 U.N.T.S. 397. \\13... three geographical miles into the Atlantic Ocean or the Pacific Ocean, or more than three marine leagues...

  4. Dislocation interaction with a .SIGMA.=3 grain boundary by .I.in-situ./I. TEM

    Czech Academy of Sciences Publication Activity Database

    Vystavěl, Tomáš; Jacques, A.; Gemperle, Antonín; Gemperlová, Juliana; George, A.

    294-296, - (1999), s. 397-400 ISSN 0255-5476. [Intergranular and Interphase Boundaries in Materials(iib`98). Praha, 06.07.1998-09.07.1998] R&D Projects: GA AV ČR IAA1010702; GA ČR GA202/98/1281 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.981, year: 1999

  5. Renal I-131-hippurate clearance overestimates true renal blood flow in the instrumented conscious dog

    NARCIS (Netherlands)

    Visscher, CA; DeZeeuw, D; Navis, G; VanZanten, AK; DeJong, PE; Huisman, RM

    We evaluated renal I-131-hippurate clearance (ERPF(hip)) as a measure of renal blood flow (RBF) in chronically instrumented conscious dogs. When adjusted for renal hippurate extraction (E(hip), 0.77 +/- 0.01) and hematocrit (Hct, 39.7 +/- 1%), calculated RBF(hip) (656 +/- 37 ml/min) markedly

  6. Accumulation of soil organic carbon in relation to other soil characteristic during spontaneous succession in non reclaimed colliery spoil heaps after brown coal mining near Sokolov (the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Kalčík, Jiří

    2006-01-01

    Roč. 25, č. 4 (2006), s. 388-397 ISSN 1335-342X R&D Projects: GA AV ČR 1QS600660505 Institutional research plan: CEZ:AV0Z60660521 Keywords : carbon accumulation * succession * soil formation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

  7. Do Children Who Bully Their Peers Also Play Violent Video Games? A Canadian National Study

    Science.gov (United States)

    Dittrick, Crystal J.; Beran, Tanya N.; Mishna, Faye; Hetherington, Ross; Shariff, Shaheen

    2013-01-01

    The study examined whether children who bully others are likely to prefer playing video games that are rated high in maturity and violence. A stratified random sample of Canadian children ages 10 to 17 years from the provinces of Canada was obtained. Parents (n = 397) and their children (n = 492) completed an online survey of children's bullying…

  8. Empirická sociologie filmu v Československu do roku 1989

    Czech Academy of Sciences Publication Activity Database

    Čížek, Tomáš

    2010-01-01

    Roč. 23, č. 4 (2010), s. 91-105 ISSN 0862-397X R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : cultural consumption * cinema attendance * cultural capital Subject RIV: AL - Art, Architecture, Cultural Heritage

  9. Corn starch: properties and processing. January 1972-December 1987 (citations from the Food Science and Technology Abstracts data base). Report for January 1972-December 1987

    International Nuclear Information System (INIS)

    1987-12-01

    This bibliography contains citations concerning corn starch processing. The physical and chemical properties, and nutritive value of corn starch and corn starch products are considered. Studies of gamma-irradiated corn starch are included. (This updated bibliography contains 397 citations, 123 of which are new entries to the previous edition.)

  10. The field high-amplitude SX Phe variable BL Cam: results from a multisite photometric campaign. II. Evidence of a binary - possibly triple - system

    Czech Academy of Sciences Publication Activity Database

    Fauvaud, S.; Sareyan, J.P.; Ribas, I.; Rodriguez, E.; Lampens, P.; Klingenberg, G.; Farrell, J.A.; Fumagalli, F.; Simonetti, J.H.; Wolf, M.; Santacana, G.; Zhou, A.; Michel, R.; Fox-Machado, L.; Alvarez, M.; Nava-Vega, A.; Lopez-Gonzalez, M.J.; Casanova, V.M.; Aceituno, F.J.; Scheggia, I.; Rives, J.-J.; Hintz, E.G.; Van Cauteren, P.; Helvaci, M.; Yesilyaprak, C.; Graham, K.A.; Král, L.; Kocián, R.; Kučáková, Hana; Fauvaud, M.; Granslo, B.H.; Michelet, J.; Nicholson, M.P.; Vugnon, J.-M.; Kotková, Lenka; Truparova, K.; Ulusoy, G.; Yasarsoy, B.; Avdibegovic, A.; Blazek, M.; Kliner, J.; Zasche, P.; Bartosikova, S.; Vilasek, M.; Trondal, O.; Van Den Abbeel, F.; Behrend, R.; Wuecher, H.

    2010-01-01

    Roč. 515, June (2010), A39/1-A39/7 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : variables stars * BL Camelopardalis * oscillations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

  11. Thermoregulation in the hippopotamus on land

    African Journals Online (AJOL)

    1986-11-28

    Nov 28, 1986 ... tadpoles (Anura: Bufonidae). Zool. Afr. 8:153-156. CHANNING, A. 1976. Rana johnstoni inyangae tadpoles from Rhodesia. Amoldia Rhod. 8: 1-4. CHANNING, A. 1978. A new bufonid genus (Amphibia: Anura) from Rhodesia. Herpetologica 34: 394-397. FROST, D.R 1985. Amphibian species of the world.

  12. Coping Styles with Student Misbehavior as Mediators of Teachers' Classroom Management Strategies

    Science.gov (United States)

    Tran, Van Dat

    2016-01-01

    The purpose of the present study is to identify how teachers' use of various coping styles with student misbehavior, and the extent to which these relate to their classroom management techniques -- punishment, recognition and reward, hinting, discussion, and aggression. It examines data from 397 junior high school teachers in Vietnam. The results…

  13. Interface affected polymer dynamics: NMR, SANS, and DLS study of the influence of shell-core interactions on the core chain mobility of poly(2-ethylhexyl acrylate)-block-poly(acrylic acid) micelles in water

    Czech Academy of Sciences Publication Activity Database

    Kříž, Jaroslav; Pleštil, Josef; Tuzar, Zdeněk; Pospíšil, Herman; Brus, Jiří; Jakeš, Jaromír; Masař, Bohumil; Vlček, Petr; Doskočilová, Danica

    1999-01-01

    Roč. 32, - (1999), s. 397-410 ISSN 0024-9297 R&D Projects: GA ČR GA203/95/1319; GA ČR GA203/96/1388; GA AV ČR KSK2050602 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.534, year: 1999

  14. Český filmový divák. Sociologická charakterizace na základě kvantitativních šetření

    Czech Academy of Sciences Publication Activity Database

    Vávra, Martin; Špaček, Ondřej; Čížek, Tomáš

    2010-01-01

    Roč. 23, č. 4 (2010), s. 107-125 ISSN 0862-397X R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : cultural consumption * cinema attendance * cultural capital Subject RIV: AO - Sociology, Demography

  15. 77 FR 71621 - Atlantic Wind One (ATLW1) Commercial Leasing for Wind Power on the Outer Continental Shelf...

    Science.gov (United States)

    2012-12-03

    ...,799 acres, the amount of rent payment will be $338,397 per year. The Lessee also must pay rent for any... Lessee must also pay the greater of $5.00 per acre per year or $450.00 per year. Operating Fee: The... then click ``search.'' Follow the instructions to submit public comments. 2. Written Comments: In...

  16. Situational Judgment Test Research: Informing the Debate on Practical Intelligence Theory

    Science.gov (United States)

    McDaniel, Michael A.; Whetzel, Deborah L.

    2005-01-01

    [Gottfredson, L. S. (2003). Dissecting practical intelligence theory: Its claims and evidence. Intelligence, 31, 343-397.] provided a detailed critique of Sternberg's [Sternberg, R. J., Fotsythe, G. B., Hedlund, J., Horvath, J. A., Wagner, R. K., Williams, W. M., Snook, S. A., Grigorenko, E. L. (2000). Practical intelligence in everyday life. New…

  17. Variation in chromosome numbers and nuclear DNA contents in genetic resources of Lactuca L. species (Asteraceae)

    Czech Academy of Sciences Publication Activity Database

    Doležalová, I.; Lebeda, A.; Janeček, J.; Čihalíková, Jarmila; Křístková, E.; Vránová, O.

    2002-01-01

    Roč. 49, č. 4 (2002), s. 385-397 ISSN 0925-9864 R&D Projects: GA AV ČR IAA6038204; GA AV ČR IBS5038104 Institutional research plan: CEZ:AV0Z5038910 Keywords : Asteraceae * Chromosome number * Flow cytometry Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.579, year: 2002

  18. Changes in Microtubular Alignment in Lactuca spp. (Asteraceae) Epidermal Cells during Early Stages of Infection by Bremia lactucae (Peronosporaceae)

    Czech Academy of Sciences Publication Activity Database

    Sedlářová, M.; Binarová, Pavla; Lebeda, A.

    2001-01-01

    Roč. 41, č. 1 (2001), s. 21-34 ISSN 0079-2047 R&D Projects: GA AV ČR IAA5020803; GA MŠk ME 397 Institutional research plan: CEZ:AV0Z5038910 Keywords : Bremia lactuca e * Peronosporaceae * resistance Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.275, year: 2001

  19. Isolation and characterization of a novel native Bacillus thuringiensis strain BRC-HZM2 capable of degrading chlorpyrifos

    Czech Academy of Sciences Publication Activity Database

    Wu, S.; Peng, Y.; Huang, Z.; Huang, Z.; Xu, L.; Gelbič, Ivan; Guan, X.; Zhang, L.; Zou, S.

    2015-01-01

    Roč. 55, č. 3 (2015), s. 389-397 ISSN 0233-111X Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * biopesticide * biodegradation Subject RIV: EE - Microbiology, Virology Impact factor: 1.585, year: 2015 http://onlinelibrary.wiley.com/doi/10.1002/jobm.201300501/epdf

  20. 76 FR 11291 - NextEra Energy Seabrook, LLC; Seabrook Station Unit No. 1; Notice of Consideration of Issuance of...

    Science.gov (United States)

    2011-03-01

    ... problems in accessing the documents located in ADAMS, contact the NRC's PDR reference staff at 1-800-397... and secondary side, and tubesheet rotation. Based on this design, the structural margins against burst... change does not involve a significant reduction in any margin of safety. The NRC staff has reviewed the...

  1. The Relationship between Age of Post-Graduate Adult Learning Students and Learning Style Preferences: A Case of Africa International University, Kenya

    Science.gov (United States)

    Ngala, Francisca Wavinya

    2017-01-01

    This paper sought to examine the relationship between age and learning preferences of post- graduate students at Africa International University (AIU). The study employed a descriptive survey design which used cross-sectional approach to data collection. The population of the study consisted of all the 397 post-graduate students at Africa…

  2. 41 CFR 50-204.75 - Transportation safety.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Transportation safety. 50... Transportation Safety § 50-204.75 Transportation safety. Any requirements of the U.S. Department of Transportation under 49 CFR Parts 171-179 and Parts 390-397 and 14 CFR Part 103 shall be applied to...

  3. Transforming bases to bytes: Molecular computing with DNA

    Indian Academy of Sciences (India)

    Despite the popular image of silicon-based computers for computation, an embryonic field of mole- cular computation is emerging, where molecules in solution perform computational ..... [4] Mao C, Sun W, Shen Z and Seeman N C 1999. A nanomechanical device based on the B-Z transition of DNA; Nature 397 144–146.

  4. An Examination of High School Social Science Students' Levels Motivation towards Learning Geography

    Science.gov (United States)

    Yildirim, Tahsin

    2017-01-01

    This aim of this research was to examine the levels of motivation among high school social science students towards learning geography. The study group consisted of 397 students from different classes at Aksaray Ahmet Cevdet Pasa High School in the College of Social Science. The research was carried out with a scanning model, with data obtained…

  5. Organisational Learning Approaches to School Leadership and Management: Teachers' Values and Perceptions of Practice

    Science.gov (United States)

    Pedder, David; MacBeath, John

    2008-01-01

    In this article, we report results of a survey of 1,397 teachers in 26 primary and 17 secondary schools in England as part of the Learning How to Learn project. We consider how school self-evaluation can be understood within an organisational learning frame. Factor analysis of teachers' responses helped us identify 4 dimensions of organisational…

  6. Multi-component titanium–copper–cobalt- and niobium nanostructured oxides as catalysts for ethyl acetate oxidation

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Henych, Jiří; Ivanova, R.; Kovacheva, D.; Štengl, Václav

    2015-01-01

    Roč. 116, č. 2 (2015), s. 397-408 ISSN 1878-5190 Institutional support: RVO:61388980 Keywords : Copper and cobalt oxides * Effect of support * Ethyl acetate combustion * Multicomponent oxides * Titania doped with niobium Subject RIV: CA - Inorganic Chemistry Impact factor: 1.265, year: 2015

  7. Why Girl Students Achieve English Presentation Learning Significantly Better in Shanghai University of Engineering Science (SUES)

    Science.gov (United States)

    Zhu, Wen; Liu, Zhixin

    2017-01-01

    In non literature major dominated university, it is obviously noted that girl students' English (as the second language) presentation scores often higher than boy students in the same teaching environment and evaluation system. A 397 samples' survey has been studied from the aspects of after school activities and sleep schedule to discuss if any…

  8. 14 CFR 25.367 - Unsymmetrical loads due to engine failure.

    Science.gov (United States)

    2010-01-01

    ... system, considering the probable pilot corrective action on the flight controls: (1) At speeds between V... the engine compressor from the turbine or from loss of the turbine blades are considered to be... may be based on the control forces specified in § 25.397(b) except that lower forces may be assumed...

  9. Social Influence as Reinforcement Learning

    Science.gov (United States)

    2016-01-13

    a brain region associated with motivation and reward learning. Further, individuals’ level of striatal activity in response to consensus tracks...experiment. Economics Letters, 2001. 71(3): p. 397-404. 14. Ledyard, J., Public goods: A survey of experimental research. Pub Econ , 1994.

  10. Lexical Bundle Analysis in Mathematics Classroom Discourse: The Significance of Stance

    Science.gov (United States)

    Herbel-Eisenmann, Beth; Wagner, David; Cortes, Viviana

    2010-01-01

    In this article, we introduce the lexical bundle, defined by corpus linguists as a group of three or more words that frequently recur together, in a single group, in a particular register (Biber, Johansson, Leech, Conrad, & Finegan, 2006; Cortes, "English for Specific Purposes" 23:397-423, 2004). Attention to lexical bundles helps to explore…

  11. Rhizosphere effect of colonizer plant species on the development of soil microbial community during primary succession on postmining sites

    Czech Academy of Sciences Publication Activity Database

    Elhottová, Dana; Krištůfek, Václav; Malý, S.; Frouz, Jan

    2009-01-01

    Roč. 40, 1-6 (2009), s. 758-770 ISSN 0010-3624 R&D Projects: GA MŠk LC06066; GA ČR GA526/03/1259 Institutional research plan: CEZ:AV0Z60660521 Keywords : colonizer plant * colliery spoil substrate * rhizosphere effect Subject RIV: EH - Ecology, Behaviour Impact factor: 0.397, year: 2009

  12. Childhood Acute Glomerulonephritis in Benin City | Ibadin | Nigerian ...

    African Journals Online (AJOL)

    , oliguria (47.6 percent) and pulmonary oedema (39.7 percent). Others were headache (11.1 percent) and convulsion (4.8 percent). Haematuria and proteinuria of varying degrees occurred in all the patients, while antecedent infections were ...

  13. Plio-Pleistocene basanitic and melilititic series of the Bohemian Massif: K-Ar ages, major/trace element and Sr–Nd isotopic data

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Ackerman, Lukáš; Balogh, K.; Hegner, E.; Jelínek, E.; Pécskay, Z.; Přichystal, A.; Upton, B. G. J.; Zimák, J.; Foltýnová, R.

    2013-01-01

    Roč. 73, č. 4 (2013), s. 429-450 ISSN 0009-2819 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Plio-Pleistocene * Basanite * Melilitite * K-Ar age * Magmatism * Sr–Nd isotopes Subject RIV: DD - Geochemistry Impact factor: 1.397, year: 2013

  14. 76 FR 66090 - Facility Operating License Amendment From Virginia Electric and Power Company, Surry Power...

    Science.gov (United States)

    2011-10-25

    ... process, thermal expansion mismatch between the tube and tubesheet, and from the differential pressure... staff at 1- 800-397-4209, 301-415-4737, or by e-mail to [email protected] . The application for... attachment to the application, dated July 28, 2011, contains SUNSI and, accordingly, this portion is being...

  15. Psychiatric Morbidity, Violent Crime, and Suicide among Children and Adolescents Exposed to Parental Death

    Science.gov (United States)

    Wilcox, Holly C.; Kuramoto, Satoko J.; Lichtenstein, Paul; Langstrom, Niklas; Brent, David A.; Runeson, Bo

    2010-01-01

    Objective: This retrospective cohort study examined the risk for suicide, psychiatric hospitalization, and violent criminal convictions among offspring of parents who died from suicide, accidents, and other causes. Method: Population-based data from multiple Swedish national registers were linked from 1969 to 2004. Participants were 44,397

  16. Data of evolutionary structure change: 1QRZC-2FODA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1QRZC-2FODA 1QRZ 2FOD C A FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTR--...ine> PHE CA 397 2FOD A 2FODA...> A 2FODA HGVTSFVSRLG...yChain> 2FOD A 2FODA HCVDR---ELTF...pdbChain>A 2FODA GCQGD-SGGPL

  17. 49 CFR 395.13 - Drivers declared out of service.

    Science.gov (United States)

    2010-10-01

    ... materials requirements prescribed in § 397.5 pertaining to attendance and surveillance of commercial motor... shall: (i) Require or permit a driver who has been declared out of service to operate a commercial motor... been declared out of service for failure to prepare a record of duty status to operate a commercial...

  18. Architekt František Kalivoda a hraběnka Hélène de Mandrot. "Několik poznámek nejen k ose Brno – La Sarraz"

    Czech Academy of Sciences Publication Activity Database

    Chatrný, Jindřich

    2012-01-01

    Roč. 25, č. 0 (2012), s. 397-470 ISSN 0524-689X R&D Projects: GA AV ČR KJB800330601 Institutional research plan: CEZ:AV0Z80330511 Keywords : Hélène de Mandrot * František Kalivoda * correspondence * congresses CIAM * architecture * film * art Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. A Cross-Cultural Analysis of Interpersonal Needs.

    Science.gov (United States)

    Cambra, Ronald E.; Klopf, Donald W.

    The Fundamental Interpersonal Relations Orientation--Behavior (FIRO-B) was administered to 504 Japanese, 219 Australian, 73 Korean, and 397 United States college students to assess interpersonal needs in the four cultures. The FIRO-B provides ratings for inclusion, control, and affection needs on an "expressed" dimension to indicate the…

  20. Výborné divadlo jako hezký film aneb Archeologie filmových Hrátek s čertem

    Czech Academy of Sciences Publication Activity Database

    Merenus, Aleš

    2016-01-01

    Roč. 28, č. 2 (2016), s. 77-103 ISSN 0862-397X Institutional support: RVO:68378068 Keywords : Czech drama * Drda, Jan * Mach, Josef * Brdečka, Jiří * film adaptation * Hrátky s čertem (Playing with the Devil) * fairy tales Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. 76 FR 20034 - Calvin Ramsey, M.D.; Revocation of Registration

    Science.gov (United States)

    2011-04-11

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration [Docket No. 10-25] Calvin Ramsey, M.D.; Revocation of Registration On December 18, 2009, the Deputy Assistant Administrator, Office of Diversion... constitutional right to appointed counsel in a proceeding under 21 U.S.C. 824(a). See Goldberg v. Kelly, 397 U.S...

  2. Prevalence and correlates of being bullied among in-school ...

    African Journals Online (AJOL)

    Adolescents who smoked cigarettes were more than three times more likely to reporting be bullied compared to non-smokers (AOR=3.97; 955 CI [3.83, 4.10]), while ... Traditional associated factors such alcohol and smoking as well as emotional correlates (loneliness, worry) were associated with being a victim of bullying.

  3. The Trace Fossil Chondrites in Uppermost Jurasic-Lower Cretaceous Deep Cavity Fills from the Western Carpathians, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Uchman, A.; Mikuláš, Radek; Houša, Václav

    2003-01-01

    Roč. 54, č. 3 (2003), s. 1-7 ISSN 1335-0552 R&D Projects: GA ČR GA205/00/0118 Institutional research plan: CEZ:AV0Z3013912 Keywords : jurassic * Cretaceous * trace fossils Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  4. Metal nano-film resistivity chemical sensor

    Czech Academy of Sciences Publication Activity Database

    Podešva, Pavel; Foret, František

    2016-01-01

    Roč. 37, č. 3 (2016), s. 392-397 ISSN 0173-0835 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : adsorption * chemiresistor * nano-film * thiol binding * thiol sensing Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.744, year: 2016

  5. Improvement for oil content in linseed by irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Sinha, S.K.; Srivastava, S.; Prasad, P.R.; Haider, Z.A. (Tirhut Coll. of Agriculture, Dholi, Bihar (India))

    1981-11-01

    A comparison of various doses of X-rays on linseed (Linum usitatissimum Linn.) indicated that isolates with high yield and oil content could be obtained with 40, 50 and 60 kR doses in 'NP 5' and with 30 kR in 'T 397' varieties.

  6. Improvement for oil content in linseed by irradiation

    International Nuclear Information System (INIS)

    Sinha, S.K.; Srivastava, S.; Prasad, P.R.; Haider, Z.A.

    1981-01-01

    A comparison of various doses of X-rays on linseed (Linum usitatissimum Linn.) indicated that isolates with high yield and oil content could be obtained with 40, 50 and 60 kR doses in 'NP 5' and with 30 kR in 'T 397' varieties. (author)

  7. Characterization of eight Bacillus thuringiensis isolates originated from fecal samples of Fuzhou Zoo and Fuzhou Panda Center

    Czech Academy of Sciences Publication Activity Database

    Wu, Ch.; Wu, L.; Zhang, L.; Gelbič, Ivan; Xu, L.; Guan, X.

    2014-01-01

    Roč. 17, č. 3 (2014), s. 395-397 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * faeces * microscophy Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.946, year: 2014 http://www.sciencedirect.com/science/article/pii/S122686151400034X

  8. Testicular volume of healthy term neonates: Determination of ...

    African Journals Online (AJOL)

    Subjects and Methods: This was a hospital.based, cross.sectional and descriptive study. Eight hundred and eleven apparently healthy term Igbo male neonates within the first 3 days of life were studied. The TV was measured with Prader Orchidometer (ZKL.135.H), ESP Model. Smoothed centiles (3.97th percentile values) ...

  9. The role of Her2 and other oncogenes of the PI3K/AKT pathway in mitochondria

    Czech Academy of Sciences Publication Activity Database

    Rohlenová, Kateřina; Neužil, Jiří; Rohlena, Jakub

    2016-01-01

    Roč. 397, č. 7 (2016), s. 607-615 ISSN 1431-6730 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : alpha-tocopheryl succinate * mitochondria * oxidase subunit-ii * protein-kinase b Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.273, year: 2016

  10. SOTER-based soil parameter estimates for Kenya (ver. 1.0)

    NARCIS (Netherlands)

    Batjes, N.H.

    2013-01-01

    This harmonized data set has been derived from the Soil and Terrain Database for Kenya (KENSOTER), at scale 1:1M, compiled by the Kenya Soil Survey. The land surface of the Republic of Kenya - excluding lakes and towns - has been characterized using 397 unique SOTER units corresponding with 623 soil

  11. Assessment of the relationship between geologic origin of soil, rhizobacterial community composition and soil receptivity to tobacco black root rot in Savoie region (France)

    Czech Academy of Sciences Publication Activity Database

    Almario, J.; Kyselková, Martina; Kopecký, J.; Ságová-Marečková, M.; Muller, D.; Grundmann, G.L.; Moënne-Loccoz, Y.

    2013-01-01

    Roč. 371, 1/2 (2013), s. 397-408 ISSN 0032-079X Grant - others:MŚMT(CZ) ME09077 Institutional support: RVO:60077344 Keywords : suppressive soils * Thielaviopsis basicola * black root rot Subject RIV: EE - Microbiology, Virology Impact factor: 3.235, year: 2013

  12. The Student Perception of University Support and Structure Scale: Development and Validation

    Science.gov (United States)

    Wintre, Maxine G.; Gates, Shawn K. E.; Pancer, W. Mark; Pratt, Michael S.; Polivy, Janet; Birnie-Lefcovitch, S.; Adams, Gerald

    2009-01-01

    A new scale, the Student Perception of University Support and Structure Scale (SPUSS), was developed for research on the transition to university. The scale was based on concepts derived from Baumrind's (1971) theory of parenting styles. Data were obtained from two separate cohorts of freshmen (n=759 and 397) attending six Canadian universities of…

  13. Physical mapping, expression analysis and polymorphism survey of ...

    Indian Academy of Sciences (India)

    Madhsudhan

    AC133216-10. RRGA11-180 do. TTCTTGAAGGAGGAGGAAGG. GAGTTATGGAGCGAGCAAGC. 60. 397. 3. AC133216-11. RRGA11-181 do. GTCCAGGGTGTACGAGATCC. GCATGAGAGGATGCAAGTAGC. 64. 535. 4. AC133216-13. RRGA11-182 do. CGATCACTGACCATGTTTGG. CCTTCTGCAGTCGATTCTCC. 60. 461.

  14. Twin's Birth-Order Differences in Height and Body Mass Index From Birth to Old Age

    DEFF Research Database (Denmark)

    Yokoyama, Yoshie; Jelenkovic, Aline; Sund, Reijo

    2016-01-01

    of age was 397,466. As expected, first-born twins had greater birth weight than second-born twins. With respect to height, first-born twins were slightly taller than second-born twins in childhood. After adjusting the results for birth weight, the birth order differences decreased and were no longer...

  15. A Meta-Analytic Review of Moral Licensing

    NARCIS (Netherlands)

    Blanken, Irene; van de Ven, Niels; Zeelenberg, Marcel

    2015-01-01

    Moral licensing refers to the effect that when people initially behave in a moral way, they are later more likely to display behaviors that are immoral, unethical, or otherwise problematic. We provide a state-of-the-art overview of moral licensing by conducting a meta-analysis of 91 studies (7,397

  16. A meta-analytic review of moral licensing

    NARCIS (Netherlands)

    Blanken, I.; van de Ven, N.; Zeelenberg, M.

    2015-01-01

    Moral licensing refers to the effect that when people initially behave in a moral way, they are later more likely to display behaviors that are immoral, unethical, or otherwise problematic. We provide a state-of-the-art overview of moral licensing by conducting a meta-analysis of 91 studies (7,397

  17. Understanding quantum scattering properties in terms of purely classical dynamics: Two-dimensional open chaotic billiards

    Czech Academy of Sciences Publication Activity Database

    Méndez-Bermúdez, J. A.; Luna-Acosta, G. A.; Šeba, Petr; Pichugin, K. N.

    2002-01-01

    Roč. 66, č. 4 (2002), 046207/1-046207/7 ISSN 1063-651X Grant - others:CONACyT(MX) 26163-E Institutional research plan: CEZ:AV0Z1010914 Keywords : quantum transport * resonance Subject RIV: BE - Theoretical Physics Impact factor: 2.397, year: 2002

  18. Classical versus quantum structure of the scattering probability matrix: Chaotic waveguides

    Czech Academy of Sciences Publication Activity Database

    Luna-Acosta, G. A.; Méndez-Bermúdez, J. A.; Šeba, Petr; Pichugin, K. N.

    2002-01-01

    Roč. 65, č. 4 (2002), 046605/1-046605/8 ISSN 1063-651X Grant - others:CONACYT(MX) 26163-E Institutional research plan: CEZ:AV0Z1010914 Keywords : scattering matrix * waveguids Subject RIV: BE - Theoretical Physics Impact factor: 2.397, year: 2002

  19. Characterization of Active Site Residues of Nitroalkane Oxidase†

    Science.gov (United States)

    Valley, Michael P.; Fenny, Nana S.; Ali, Shah R.; Fitzpatrick, Paul F.

    2010-01-01

    The flavoenzyme nitroalkane oxidase catalyzes the oxidation of primary and secondary nitrolkanes to the corresponding aldehydes and ketones plus nitrite. The structure of the enzyme shows that Serl71 forms a hydrogen bond to the flavin N5, suggesting that it plays a role in catalysis. Cys397 and Tyr398 were previously identified by chemical modification as potential active site residues. To more directly probe the roles of these residues, the S171A, S171V, S171T, C397S, and Y398F enzymes have been characterized with nitroethane as substrate. The C397S and Y398 enzymes were less stable than the wild-type enzyme, and the C397S enzyme routinely contained a substoichiometric amount of FAD. Analysis of the steady-state kinetic parameters for the mutant enzymes, including deuterium isotope effects, establishes that all of the mutations result in decreases in the rate constants for removal of the substrate proton by ~5-fold and decreases in the rate constant for product release of ~2-fold. Only the S171V and S171T mutations alter the rate constant for flavin oxidation. These results establish that these residues are not involved in catalysis, but rather are required for maintaining the protein structure. PMID:20056514

  20. Characterization of active site residues of nitroalkane oxidase.

    Science.gov (United States)

    Valley, Michael P; Fenny, Nana S; Ali, Shah R; Fitzpatrick, Paul F

    2010-06-01

    The flavoenzyme nitroalkane oxidase catalyzes the oxidation of primary and secondary nitroalkanes to the corresponding aldehydes and ketones plus nitrite. The structure of the enzyme shows that Ser171 forms a hydrogen bond to the flavin N5, suggesting that it plays a role in catalysis. Cys397 and Tyr398 were previously identified by chemical modification as potential active site residues. To more directly probe the roles of these residues, the S171A, S171V, S171T, C397S, and Y398F enzymes have been characterized with nitroethane as substrate. The C397S and Y398 enzymes were less stable than the wild-type enzyme, and the C397S enzyme routinely contained a substoichiometric amount of FAD. Analysis of the steady-state kinetic parameters for the mutant enzymes, including deuterium isotope effects, establishes that all of the mutations result in decreases in the rate constants for removal of the substrate proton by approximately 5-fold and decreases in the rate constant for product release of approximately 2-fold. Only the S171V and S171T mutations alter the rate constant for flavin oxidation. These results establish that these residues are not involved in catalysis, but rather are required for maintaining the protein structure. 2009 Elsevier Inc. All rights reserved.

  1. Insight into the genetics of hypertension, a core component of the metabolic syndrome

    Czech Academy of Sciences Publication Activity Database

    Pravenec, Michal; Petretto, E.

    2008-01-01

    Roč. 11, - (2008), s. 393-397 ISSN 1363-1950 Grant - others:HHMI(US) 55005624; EURATOOLS(XE) LSHG-CT-2005-019015 Institutional research plan: CEZ:AV0Z50110509 Keywords : genetics * hypertension * genome-wide association studies Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.690, year: 2008

  2. Two New Species of Trypanosomatid Parasites Isolated from Heteroptera

    Czech Academy of Sciences Publication Activity Database

    Maslov, D. A.; Yurchenko, V. Y.; Jirků, Milan; Lukeš, Julius

    2010-01-01

    Roč. 57, č. 2 (2010), s. 177-188 ISSN 1066-5234 Institutional research plan: CEZ:AV0Z60220518 Keywords : Blastocrithidia * kinetoplastid * Largidae * Leptomonas * Miridae * phylogeny * taxonomy * Trypanosomatidae Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2010

  3. Prevalence of biochemical and immunological abnormalities in ...

    African Journals Online (AJOL)

    Tile prevalence of biochemical and immunological abnormalities was studied in a group of 256 patients with rheumatoid arthritis (104 coloureds, 100 whites and 52 blacks). The most common biochemical abnormalities detected were a reduction in the serum creatinine value (43,4%), raised globulins (39,7%), raised serum ...

  4. Korean Cancer Patients' Awareness of Clinical Trials, Perceptions on the Benefit and Willingness to Participate.

    Science.gov (United States)

    Lim, Yoojoo; Lim, Jee Min; Jeong, Won Jae; Lee, Kyung-Hun; Keam, Bhumsuk; Kim, Tae-Yong; Kim, Tae Min; Han, Sae-Won; Oh, Do Youn; Kim, Dong-Wan; Kim, Tae-You; Heo, Dae Seog; Bang, Yung-Jue; Im, Seock-Ah

    2017-10-01

    The purpose of this study was to assess current levels of awareness of clinical trials (CTs), perceptions regarding their benefits and willingness to participate to CTs among Korean cancer patients. From December 2012 to August 2015, we distributed questionnaires to cancer patients receiving systemic anti-cancer therapy at Seoul National University Hospital, Seoul, Korea. A total of 397 out of 520 requested patients (76.3%) responded to the survey. Among the 397 patients, 62.5% were female and the median age was 52 years. Overall, 97.4% (387/397) answered that they have at least heard of CTs. When asked about their level of awareness, 23.8% (92/387) answered that they could more than roughly explain about CTs. The average visual analogue scale score of CT benefit in all patients was 6.43 (standard deviation, 2.20). Patients who were only familiar with the term without detailed knowledge of the contents had the least expectation of benefit from CTs (p=0.015). When asked about their willingness to participate in CTs, 56.7% (225/397) answered positively. Patients with higher levels of awareness of CTs showed higher willingness to participate (p awareness regarding CTs was positively related to the positive perception and willingness to participate. Although the general awareness of CTs was high, a relatively large proportion of patients did not have accurate knowledge; therefore, proper and accurate patient education is necessary.

  5. Korean Cancer Patients’ Awareness of Clinical Trials, Perceptions on the Benefit and Willingness to Participate

    Science.gov (United States)

    Lim, Yoojoo; Lim, Jee Min; Jeong, Won Jae; Lee, Kyung-Hun; Keam, Bhumsuk; Kim, Tae-Yong; Kim, Tae Min; Han, Sae-Won; Oh, Do Youn; Kim, Dong-Wan; Kim, Tae-You; Heo, Dae Seog; Bang, Yung-Jue; Im, Seock-Ah

    2017-01-01

    Purpose The purpose of this study was to assess current levels of awareness of clinical trials (CTs), perceptions regarding their benefits and willingness to participate to CTs among Korean cancer patients. Materials and Methods From December 2012 to August 2015, we distributed questionnaires to cancer patients receiving systemic anti-cancer therapy at Seoul National University Hospital, Seoul, Korea. Results A total of 397 out of 520 requested patients (76.3%) responded to the survey. Among the 397 patients, 62.5% were female and the median age was 52 years. Overall, 97.4% (387/397) answered that they have at least heard of CTs. When asked about their level of awareness, 23.8% (92/387) answered that they could more than roughly explain about CTs. The average visual analogue scale score of CT benefit in all patients was 6.43 (standard deviation, 2.20). Patients who were only familiar with the term without detailed knowledge of the contents had the least expectation of benefit from CTs (p=0.015). When asked about their willingness to participate in CTs, 56.7% (225/397) answered positively. Patients with higher levels of awareness of CTs showed higher willingness to participate (p awareness regarding CTs was positively related to the positive perception and willingness to participate. Although the general awareness of CTs was high, a relatively large proportion of patients did not have accurate knowledge; therefore, proper and accurate patient education is necessary. PMID:28392549

  6. Factors Influencing Pop Music Preferences of Young Persons.

    Science.gov (United States)

    Boyle, J. David; And Others

    1981-01-01

    Examined and compared self-reported reasons for pop music preferences of 397 students in grades five, seven, nine, eleven, and college. Results revealed that characteristics such as melody, mood, rhythm, and lyrics were the most important reasons for selection. Differences in response by age and background characteristics were noted. (Author/SJL)

  7. 76 FR 2725 - Draft Regulatory Guide: Issuance, Availability

    Science.gov (United States)

    2011-01-14

    ...-0001, telephone: 301-415-7495 or e- mail [email protected] . SUPPLEMENTARY INFORMATION: I. Introduction..., which provides text and image files of NRC's public documents. If you do not have access to ADAMS or if... 1-800-397-4209, 301-415-4737, or by e-mail to [email protected] . The Regulatory Analysis is...

  8. 76 FR 23845 - Draft Regulatory Guide: Issuance, Availability

    Science.gov (United States)

    2011-04-28

    ... INFORMATION: I. Introduction The U.S. Nuclear Regulatory Commission (NRC) is issuing for public comment a... provides text and image files of the NRC's public documents. If you do not have access to ADAMS or if there...- 800-397-4209, 301-415-4737, or by e-mail to [email protected] . The Regulatory Analysis is...

  9. 75 FR 72845 - Notice of Availability; NUREG-1307, Revision 14, “Report on Waste Burial Charges Changes in...

    Science.gov (United States)

    2010-11-26

    ... problems in accessing the documents located in ADAMS, contact the NRC PDR Reference Staff at 1-800-397-4209... annually adjust the estimate of the cost of decommissioning their plants, in dollars of the current year.... The sources of information used in the formula are identified, and the values developed for the...

  10. Natural History of Chronic Kidney Disease Stages 2-4 | Yousi | Arab ...

    African Journals Online (AJOL)

    Results: Males constituted 57.7% of the study population, one third of patients were older than 65 years of age, 93% were white and 39.7% were diabetic. The study showed that 52.7% of patients had a progressive course of CKD. Gender, old age, ethnicity and diabetic status were not significantly different between ...

  11. Histopathological aspects of liver under variable food restriction: Has the intense one-week food restriction a protective effect on non-alcoholic-fatty-liver-disease (NAFLD) development?

    Czech Academy of Sciences Publication Activity Database

    Makovický, P.; Tůmová, E.; Volek, Z.; Makovický, P.; Vodičková, Ludmila; Slyšková, Jana; Svoboda, Miroslav; Rejhová, Alexandra; Vodička, Pavel; Samasca, G.; Králová, A.; Nagy, M.; Mydlarova-Blascakova, M.; Poracova, J.

    2014-01-01

    Roč. 210, č. 12 (2014), s. 855-862 ISSN 0344-0338 R&D Projects: GA MZd(CZ) NT14329 Grant - others:GA MZE(CZ) 0002701404 Institutional support: RVO:68378041 Keywords : fasting * liver * starvation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.397, year: 2014

  12. Posttreatment plasma transforming growth factor beta 1 (TGF-beta1) level

    Czech Academy of Sciences Publication Activity Database

    Feltl, D.; Závadová, E.; Pála, M.; Hozák, Pavel

    2005-01-01

    Roč. 52, č. 5 (2005), s. 393-397 ISSN 0028-2685 R&D Projects: GA AV ČR(CZ) IAA5039202 Institutional research plan: CEZ:AV0Z50390512 Keywords : head and neck cancer * late morbidity Subject RIV: EE - Microbiology, Virology Impact factor: 0.731, year: 2005

  13. 32 CFR 716.7 - Payment of the death gratuity.

    Science.gov (United States)

    2010-07-01

    ... certification and voucher for the death gratuity payment. The Comptroller General of the United States has... Certification and Voucher for Death Gratuity Payment, DD Form 397, in original and five copies, completing... 32 National Defense 5 2010-07-01 2010-07-01 false Payment of the death gratuity. 716.7 Section 716...

  14. Oribatid mites (Acari: Oribatida) in casts and burrows of an endemic earthworm .i.Dendrobaena mrazeki./i. and in litter of thermophilous oak forests

    Czech Academy of Sciences Publication Activity Database

    Starý, Josef; Pižl, Václav

    2007-01-01

    Roč. 26, č. 4 (2007), s. 390-397 ISSN 1335-342X R&D Projects: GA ČR GA206/03/0056 Institutional research plan: CEZ:AV0Z60660521 Keywords : soil oribatid mites * earthworms * casts and burrows Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

  15. Seasonal diet pattern of non-native tubenose goby (Proterorhinus semilunaris) in the lowland reservoir (Mušov, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Adámek, Z.; Jurajda, Pavel; Prášek, Václav; Sukop, I.

    2010-01-01

    Roč. 397, 02 (2010), s. 1-12 ISSN 1961-9502 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : Gobiidae * food * lowland reservoir * rip-rap bank * the Dyje River Subject RIV: EG - Zoology Impact factor: 0.304, year: 2010

  16. Big Five Personality Traits as the Predictor of Teachers' Organizational Psychological Capital

    Science.gov (United States)

    Bozgeyikli, Hasan

    2017-01-01

    The method of the research was defined as the descriptive survey model since it was aimed to test whether the personality traits of teachers are a significant predictor of their psychological capital levels in this study. 416 teachers (60.3% female, 39.7% male) who were teaching in the schools of Ministry of National Education in Istanbul and were…

  17. The Returns to Human Capital Migration within the Department of Defense Civilian Internal Labor Market

    Science.gov (United States)

    2005-09-01

    a period of time from year 1 to year T † From Ronald Ehrenberg and Robert Smith. Modern Labor Economics : Theory and...Economic Literature 13 (June): 397- 433. Ehrenberg, Ronald G. and Robert S. Smith. 2003. Modern Labor Economics : Theory and Public Policy. 8th ed

  18. High-Resolution Spectrum and Rovibrational Analysis of the .nu..sub.2./sub./.nu..sub.5./sub. Dyad of D.sub.3./sub.SiF near 700 cm.sup.-1./sup..

    Czech Academy of Sciences Publication Activity Database

    Badaoui, M.; Sari-Zizi, N. B.; Graner, G.; Mkadmi, E. B.; Bürger, H.; Pracna, Petr

    2000-01-01

    Roč. 200, č. 1 (2000), s. 72-88 ISSN 0022-2852 Grant - others: Max - Planck -Gesellschaft(DE) PICS 599 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.397, year: 2000

  19. 77 FR 59818 - Technical, Organizational, and Conforming Amendments to the Federal Motor Carrier Safety Regulations

    Science.gov (United States)

    2012-10-01

    ... ``contacted'' to correct a typographical error. Section 397.101. In paragraphs (b) [introductory text], (b)(2...] 0 27. Amend Sec. 375.209(b) introductory text by removing the word ``four'' and replacing it with... under the centerhead ``K. Supporting Data for Reports and Statistics,'' revise number 2. Appendix A to...

  20. Texto documental

    Directory of Open Access Journals (Sweden)

    Elkin Gómez

    2000-09-01

    Full Text Available Borges enamorado. (Ensayos críticos. Diálogos con Borges. Rescate y glosa de textos de Borges y sobre Borges. Juan Gustavo Cobo Borda. Instituto Caro y Cuervo, La Granada Entreabierta, Bogotá, 1999, 397 págs.

  1. Parental background and other-regarding preferences in children

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Chytilová, J.; Pertold-Gebicka, B.

    2014-01-01

    Roč. 17, č. 1 (2014), s. 24-46 ISSN 1386-4157 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : other-regarding preferences * altruism * selfishness Subject RIV: AH - Economics Impact factor: 1.397, year: 2014

  2. Disease: H00082 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 0:397-409 (2004) DOI:10.1046/j.1365-2265.2004.01978.x ... PMID:12734493 (gene, env_factor, marker, autoantigen) ... AUTHORS ... Ai J, Leonha...rdt JM, Heymann WR. ... TITLE ... Autoimmune thyroid diseases: etiology, pathogenesis

  3. Implicit proofs

    Czech Academy of Sciences Publication Activity Database

    Krajíček, Jan

    2004-01-01

    Roč. 69, č. 2 (2004), s. 387-397 ISSN 0022-4812 R&D Projects: GA AV ČR IAA1019901; GA MŠk LN00A056 Institutional research plan: CEZ:AV0Z1019905 Keywords : propositional proof system s * circuits * polynomial simulation Subject RIV: BA - General Mathematics Impact factor: 0.331, year: 2004

  4. Transcriptional regulation of the operon encoding stress-responsive ECF sigma factor SigH and its anti-sigma factor RshA, and control of its regulatory network in Corynebacterium glutamicum

    Czech Academy of Sciences Publication Activity Database

    Busche, T.; Šilar, Radoslav; Pičmanová, Martina; Pátek, Miroslav; Kalinowski, J.

    2012-01-01

    Roč. 13, č. 445 (2012), s. 445-464 ISSN 1471-2164 R&D Projects: GA ČR GC204/09/J015 Institutional research plan: CEZ:AV0Z50200510 Keywords : Corynebacterium glutamicum * ECF sigma factor * Anti-sigma factor Subject RIV: EE - Microbiology, Virology Impact factor: 4.397, year: 2012

  5. Case report

    African Journals Online (AJOL)

    abp

    4 févr. 2015 ... Noonan KJ, Levenda A, Snead J, Feinberg JR, Mih A. Evaluation of the forearm in untreated adult subjects with multiple hereditary osteochondromatosis. The Journal of bone and joint surgery American volume. 2002 Mar;84-A(3):397-. 403. PubMed | Google Scholar. 7. Caton J, Kohler R, Fournet-Fayard J, ...

  6. Isolated peat bog habitats and their food connections: parasitoids (Hymenoptera: Ichneumonoidea) and their lepidopteran hosts

    Czech Academy of Sciences Publication Activity Database

    Lozan, Aurel; Spitzer, Karel; Jaroš, Josef

    2012-01-01

    Roč. 16, č. 3 (2012), s. 391-397 ISSN 1366-638X Institutional research plan: CEZ:AV0Z50070508 Keywords : Paleorefugia * relict peat bogs * specific Lepidoptera Subject RIV: EH - Ecology, Behaviour Impact factor: 1.801, year: 2012 http://www.springerlink.com/content/78u173hn60701033/

  7. Aquatic Environment 2000

    DEFF Research Database (Denmark)

    Svendsen, L. M.; Bijl, L. van der; Boutrup, S.

    The report summarizes the results of the Danish Aquatic Monitoring and Assessment Programme 1998-2003. Danish Environmental Protection Agency 2000: NOVA-2003. Programbeskrivelse for det nationale program for overvågning af vandmiljøet 1998-2003. 397 pp. - Redegørelse fra Miljøstyrelsen nr. 1 (in...

  8. Biological, Biochemical, and Molecular Characterization of a New Clinical Trichophyton rubrum Isolate Resistant to Terbinafine

    Science.gov (United States)

    Osborne, Colin S.; Leitner, Ingrid; Hofbauer, Bettina; Fielding, Ceri A.; Favre, Bertrand; Ryder, Neil S.

    2006-01-01

    We have characterized a new clinical strain of Trichophyton rubrum highly resistant to terbinafine but exhibiting normal susceptibility to drugs with other mechanisms of action. Resistance to terbinafine in this strain is caused by a missense mutation in the squalene epoxidase gene leading to the amino acid substitution F397L. PMID:16723593

  9. 76 FR 66965 - Treasure Coast Specialty Pharmacy Decision and Order

    Science.gov (United States)

    2011-10-28

    ... standards applied to an indictment at common law.'' Citizens State Bank of Marshfield v. FDIC, 751 F.2d 209...,403 (DEA 2011) (citing Goldberg, 397 U.S. at 270 (quoting Greene v. McElroy, 360 U.S. 474, 496 (1959...

  10. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. David L Beveridge. Articles written in Journal of Biosciences. Volume 37 Issue 3 July 2012 pp 379-397 Articles. The ABCs of molecular dynamics simulations on B-DNA, circa 2012 · David L Beveridge Thomas E Cheatham III Mihaly Mezei · More Details Abstract Fulltext PDF.

  11. Transferases and transporters mediate the detoxification and capacity to tolerate trinitrotoluene in Arabidopsis

    Czech Academy of Sciences Publication Activity Database

    Landa, Přemysl; Štorchová, Helena; Hodek, J.; Vaňková, Radomíra; Podlipná, Radka; Maršík, Petr; Ovesná, J.; Vaněk, Tomáš

    2010-01-01

    Roč. 10, č. 4 (2010), s. 547-559 ISSN 1438-793X R&D Projects: GA MŠk 2B06187; GA MŠk 2B08058 Institutional research plan: CEZ:AV0Z50380511 Keywords : Microarrays * Arabidopsis thaliana * TNT Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.397, year: 2010

  12. Comparative measurements of transpiration an canopy conductance in two mixed deciduous woodlands differing in structure and species composition

    DEFF Research Database (Denmark)

    Herbst, Mathias; Rosier, Paul T.W.; Morecroft, Michael D.

    2008-01-01

    a continuous hazel (Corylus avellana L.) understory. Wytham Woods, which had an LAI of 3.6, was dominated by ash (Fraxinus excelsior L.) and sycamore (Acer pseudoplatanus L.) and had only a sparse understory. Annual canopy transpiration was 367 mm for Grimsbury Wood and 397 mm for Wytham Woods. These values...

  13. Child Abuse and Aggression among Seriously Emotionally Disturbed Children

    Science.gov (United States)

    Ford, Julian D.; Fraleigh, Lisa A.; Connor, Daniel F.

    2010-01-01

    Abused children may be at risk for problems with aggression. In a sample of 397 seriously emotionally disturbed children, reactive aggression was associated with documented history of physical abuse but not sexual abuse. Girls were equally likely to be classified as reactively aggressive regardless of physical abuse history, but boys with physical…

  14. Pýthagorův závoj

    Czech Academy of Sciences Publication Activity Database

    Dvořák, Tomáš

    2007-01-01

    Roč. 19, č. 13 (2007), s. 163-176 ISSN 0862-397X R&D Projects: GA ČR(CZ) GP403/06/P451 Institutional research plan: CEZ:AV0Z90090514 Keywords : hearing and listening of sounds * reproduced music * acousmatic listening Subject RIV: AA - Philosophy ; Religion

  15. Piezoelectric PZT thin films on flexible copper-coated polymer films

    Czech Academy of Sciences Publication Activity Database

    Suchaneck, G.; Volkonskiy, O.; Gerlach, G.; Hubička, Zdeněk; Dejneka, Alexandr; Jastrabík, Lubomír; Kiselev, D.; Bdikin, I.; Kholkin, A.

    636/637, - (2010), s. 392-397 ISSN 0255-5476 R&D Projects: GA ČR GC202/09/J017; GA AV ČR KJB100100703 Institutional research plan: CEZ:AV0Z10100522 Keywords : plasma jet deposition * PZT * kapton® film substrate * piezoresponse force microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism

  16. Rané vzpomínky a jejich možnosti jako projektivního diagnostického nástroje

    Czech Academy of Sciences Publication Activity Database

    Šťástná, L.; Miovský, Michal; Polák, A.

    2004-01-01

    Roč. 48, č. 5 (2004), s. 397-409 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : early memories * projective method * psychodiagnostics Subject RIV: AN - Psychology Impact factor: 0.209, year: 2004

  17. 75 FR 4593 - New Postal Product

    Science.gov (United States)

    2010-01-28

    ... POSTAL REGULATORY COMMISSION [Docket No. CP2010-20; Order No. 397] New Postal Product AGENCY... Service request to add GEPS 2 (CP2009-50) to the Competitive Product List. The Postal Service has also... Global Expedited Package Services 2 to the Competitive Product List, August 28, 2009 (Order No. 290). \\4...

  18. The Nature of Developmental Dyslexia in a Transparent Orthography

    Science.gov (United States)

    Verhoeven, Ludo; Keuning, Jos

    2018-01-01

    The present study aimed to explore the nature of developmental dyslexia in a language considered to have a transparent orthography, namely, Dutch. We assessed the accuracy and efficiency of decoding words and pseudowords with four lengths as well as three types of phonological ability in 2,760 typical children and 397 peers with dyslexia across…

  19. Effects of Emergency Preparedness and Disaster Response on Hospital Focusing on Ancillary and Support Services: Policy Analysis

    Science.gov (United States)

    2007-02-12

    trauma centers are required to have immediate availability of trauma surgeons, anesthesiologists, physician specialists, nurses , and resuscitation...has emphasized alternative delivery settings, such as outpatient treatments, home health care, and the use of nursing homes. Managed care...hospitals should do to prepare for an influenza pandemic. Biosecurity and Bioterrorism: Biodefense Strategy, Practice, and Science, 4(4), 397-402

  20. Positive and Negative Affectivity as Mediator and Moderator of the Relationship between Optimism and Life Satisfaction in Turkish University Students

    Science.gov (United States)

    Kapikiran, Necla Acun

    2012-01-01

    The main purpose of this study is to examine the mediator and moderator role of positive and negative affectivity variables on the relationship between optimism and life satisfaction in university students. 397 university students, ranging in age from 18 to 27 (M = 20.98), attending different departments of the Faculty of Education, at Pamukkale…

  1. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Mihaly Mezei. Articles written in Journal of Biosciences. Volume 37 Issue 3 July 2012 pp 379-397 Articles. The ABCs of molecular dynamics simulations on B-DNA, circa 2012 · David L Beveridge Thomas E Cheatham III Mihaly Mezei · More Details Abstract Fulltext PDF. This article ...

  2. Intrapersonal and interpersonal sexual behaviors of Chinese university students: gender differences in prevalence and correlates

    NARCIS (Netherlands)

    Chi, X.; van de Bongardt, D.; Hawk, S.T.

    2015-01-01

    The main aim of the present study was to investigate gender differences among university students in contemporary China regarding (1) the prevalence of various types of intrapersonal and interpersonal sexual behaviors and (2) their sociodemographic and psychosocial predictors. A total of 1,397

  3. Cutaneous lupus erythematosus

    DEFF Research Database (Denmark)

    Biazar, Cyrus; Sigges, Johanna; Patsinakidis, Nikolaos

    2013-01-01

    ) patients with different subtypes of CLE, such as acute CLE (ACLE, 304 patients), subacute CLE (SCLE, 236 patients), chronic CLE (CCLE, 397 patients), and intermittent CLE (ICLE, 65 patients), from 13 European countries were collected and statistically analyzed by an SPSS database. The main outcome measures...

  4. Nikkaji Dictionary: α-ノルテストステロン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term α-ノルテストステロン 名詞 一般 * * * * α-ノルテストステロン ... Nikkaji J397.312C 200906035667295941 C CA06 UNKNOWN_2 α - ノルテストステロン

  5. Motor Skill Abilities in Toddlers with Autistic Disorder, Pervasive Developmental Disorder-Not Otherwise Specified, and Atypical Development

    Science.gov (United States)

    Matson, Johnny L.; Mahan, Sara; Fodstad, Jill C.; Hess, Julie A.; Neal, Daniene

    2010-01-01

    Motor skills were assessed in 397 toddlers, and it was demonstrated that atypically developing toddlers exhibited significantly greater motor skill abilities than toddlers with autistic disorder. No significant difference on gross or fine motor skill abilities were found between atypically developing toddlers and toddlers with pervasive…

  6. Connectivity between the Algerian population of Greater Flamingo ...

    African Journals Online (AJOL)

    In this paper, we document the wintering and breeding of European flamingos in Algeria and provide the first post-fledging dispersal data for flamingos born in Algeria. At breeding colonies in Algeria, most ringed birds (99.4% of 835 birds) originated from north-western Mediterranean colonies (397 individuals born in ...

  7. Habitat use of the endangered butterfly Euphydryas maturna and forestry in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Freese, A.; Beneš, Jiří; Bolz, R.; Čížek, Oldřich; Dolek, M.; Geyer, A.; Gros, P.; Konvička, Martin; Liegl, A.; Stettmer, C.

    2006-01-01

    Roč. 9, č. 4 (2006), s. 388-397 ISSN 1367-9430 R&D Projects: GA ČR GA526/04/0417 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterfly conservation * coppicing * forest pasture Subject RIV: EH - Ecology, Behaviour Impact factor: 1.926, year: 2006

  8. Investigar la comunicación en Loja- Ecuador: el valor de la formación, producción y consumo

    OpenAIRE

    Isidro Marín Gutiérrez

    2015-01-01

    Nombre de libro: Investigar la comunicación en Loja- Ecuador: el valor de la formación, producción y consumo. - Coordinadora: Ana Isabel Rodríguez Vázquez. - Ciudad: Loja. - Editorial: Universidad Técnica Particular de Loja. - Año: 2012. - Páginas: 568. - ISBN: 978-9942-08-397-5.

  9. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    to-child transmission (PMTCT) programme in the central region of Ethekweni Metro, ... cells/μl. Only 13% of the women had CD4 counts less than 200 cells/μl. The median viral load at first presentation was 3.97 (IQR 1.6 - 5.8) logs or 11 391.

  10. Mesenteric artery response to head-up tilt-induced central hypovolaemia and hypotension

    DEFF Research Database (Denmark)

    Perko, M J; Madsen, P; Perko, Grazyna

    1997-01-01

    the normotensive and the hypotensive phase of HUT, the SMA diameter (5.7 +/- 0.03 mm) and blood flow (514 +/- 75 ml min-1) did not change significantly, although the end-diastolic velocity increased from 9.7 +/- 4.8 to 39.7 +/- 4.0 cm s-1 (P

  11. Alcohol and Drug Use in Young Apprentices: Effect of Social Control in the Family.

    Science.gov (United States)

    Burcu, Esra

    2003-01-01

    Examined the social control used by families of young apprentices in Turkey in relation to deviant behaviors, such as alcohol and drug use. Data for 397 apprentices show that those who use alcohol are most frequently exposed to stringent controls and oral and physical violence, and those who use drugs frequently were exposed to battering by their…

  12. Challenges in gluten-free diet in coeliac disease: Prague consensus

    Czech Academy of Sciences Publication Activity Database

    Samasca, G.; Lerner, U.; Girbovan, A.; Sur, G.; Lupan, I.; Makovický, Peter; Matthias, T.; Freeman, H.J.

    2017-01-01

    Roč. 47, č. 5 (2017), s. 394-397 ISSN 0014-2972 Institutional support: RVO:68378050 Keywords : Adult * biomarkers * childhood * dietary adherence * gluten-free diet * transition Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Nutrition, Dietetics Impact factor: 2.714, year: 2016

  13. 10 CFR 430.3 - Materials incorporated by reference.

    Science.gov (United States)

    2010-01-01

    ...-Conditioning, Heating, and Refrigeration Institute, 2111 Wilson Blvd, Suite 500, Arlington, VA 22201, 703-524... B. (d) ANSI Reseller. Global Engineering Documents, 15 Inverness Way, East Englewood, CO 80112, Phone: 800.854.7179 or 303.397.7956, http://www.global.ihs.com, E-mail: global@ihs.com. DOE does not...

  14. Worry as a Predictor of Nutrition Behaviors: Results from a Nationally Representative Survey

    Science.gov (United States)

    Ferrer, Rebecca A.; Bergman, Hannah E.; Klein, William M. P.

    2013-01-01

    Worry has been shown to predict a variety of health behaviors, such as cancer screening, yet there are few studies linking worry and nutrition. This study used nationally representative data from National Cancer Institute's Food Attitudes and Behavior Survey ("n" = 3,397) to examine the association between health-related worry and a variety of…

  15. 76 FR 17019 - List of Approved Spent Fuel Storage Casks: HI-STORM Flood/Wind Addition

    Science.gov (United States)

    2011-03-28

    ... problems in accessing the documents located in ADAMS, contact the NRC's PDR Reference staff at 1-800-397... FW System provides the following: (1) The ability to store and transport Boiling Water Reactor (BWR... fuel to be stored in certain designated locations; (5) greater heat rejection capacity with lower peak...

  16. Perceived Disgust and Personal Experiences are Associated with Acceptance of Dissections in Schools

    Science.gov (United States)

    Fancovicova, Jana; Prokop, Pavol; Leskova, Andrea

    2013-01-01

    Animal dissections are essential parts of anatomy/zoology courses, but their effectiveness is influenced by student attitudes and emotions. Here we examined attitudes toward dissections in 397 prospective biology teachers enrolling two Slovak universities. Perceived disgust of dissections negatively correlated with other attitudes toward…

  17. Absorption spectra of ammonia near 1 mu m

    Czech Academy of Sciences Publication Activity Database

    Barton, E. J.; Polyansky, O. L.; Yurchenko, S. N.; Tennyson, J.; Civiš, Svatopluk; Ferus, Martin; Hargreaves, R.; Ovsyannikov, R. I.; Kyuberis, A. A.; Zobov, N. F.; Béguier, S.; Campargue, A.

    2017-01-01

    Roč. 203, DEC 2017 (2017), s. 392-397 ISSN 0022-4073 EU Projects: European Commission(XE) 267219 - EXOMOL Grant - others:RFBR(RU) 16-32-00244 Institutional support: RVO:61388955 Keywords : room temperature * ammonia * absorption intensities * FTIR spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.419, year: 2016

  18. Self-adaptation in Software-intensive Cyber-physical Systems: From System Goals to Architecture Configurations

    Czech Academy of Sciences Publication Activity Database

    Gerostathopoulos, I.; Bureš, Tomáš; Hnětynka, P.; Keznikl, Jaroslav; Kit, M.; Plášil, F.; Plouzeau, N.

    2016-01-01

    Roč. 122, December (2016), s. 378-397 ISSN 0164-1212 Grant - others:GA MŠk(CZ) LD15051 Institutional support: RVO:67985807 Keywords : cyber–physical systems * self-adaptivity * dependability Subject RIV: JC - Computer Hardware ; Software Impact factor: 2.444, year: 2016

  19. Neonatal Sepsis: past, present and future; a review article | Tripathi ...

    African Journals Online (AJOL)

    Sepsis is the most common cause of neonatal mortality. As per National Neonatal Perinatal Database (NNPD) 2002-2003, the incidence of neonatal sepsis in India was 30 per 1000 live birth. It is 3% among intramural babies and 39.7% among extramural admissions. The early manifestations of neonatal sepsis are vague ...

  20. On the Geometry of Visual Correspondence

    Science.gov (United States)

    1994-07-01

    from point and line matches. In Proc. International Conference on Computer Vision, pages 25-34, 1987. [11] 0. Faugeras and S. Maybank . Motion from...image. Proceed- ings of the Royal Society, London B, 208:385-397, 1980. (23] S. Maybank . Theory of Reconstruction from Image Motion. Springer, Berlin

  1. Multilevel Mediation: Cumulative Contextual Risk, Maternal Differential Treatment, and Children's Behavior within Families

    Science.gov (United States)

    Meunier, Jean Christophe; Boyle, Michael; O'Connor, Thomas G.; Jenkins, Jennifer M.

    2013-01-01

    This study tests the hypothesis that links between contextual risk and children's outcomes are partially explained by differential parenting. Using multi-informant measurement and including up to four children per family (M[subscript age] = 3.51, SD = 2.38) in a sample of 397 families, indirect effects (through maternal differential…

  2. Time-lapse micro-tomography analysis of the deformation response of a gellan-gum-based scaffold

    Czech Academy of Sciences Publication Activity Database

    Kytýř, Daniel; Fenclová, Nela; Zlámal, Petr; Kumpová, Ivana; Fíla, Tomáš; Koudelka_ml., Petr; Gantar, A.; Novak, S.

    2017-01-01

    Roč. 51, č. 3 (2017), s. 397-402 ISSN 1580-2949 Institutional support: RVO:68378297 Keywords : bone scaffold * gellan gum * time-lapse micro CT * digital volume correlation Subject RIV: JJ - Other Materials OBOR OECD: Materials engineering Impact factor: 0.436, year: 2016 http://mit.imt.si/Revija/izvodi/mit173/kytyr.pdf

  3. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 4. Issue front cover thumbnail Issue back cover thumbnail. Volume 13, Issue 4. April 2008 ... K R Y Simha Dhruv C Hoysall · More Details Fulltext PDF. pp 394-397 Think It Over. Solution to How Many Birds are Unwatched · Soubhik Chakraborty.

  4. Metamorphosed carbonates of Krkonoše Mountains and Paleozoic evolution of Sudetic terranes (NE Bohemia, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Hladil, Jindřich; Patočka, František; Kachlík, V.; Melichar, R.; Hubačík, M.

    2003-01-01

    Roč. 54, č. 5 (2003), s. 281-297 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Institutional research plan: CEZ:AV0Z3013912 Keywords : Cambrium * carbonates * Krkonoše Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  5. Chromosome identification for the carnivorous plant Genlisea margaretae

    Czech Academy of Sciences Publication Activity Database

    Tran, T.D.; Šimková, Hana; Schmidt, R.; Doležel, Jaroslav; Schubert, I.; Fuchs, J.

    2017-01-01

    Roč. 126, č. 3 (2017), s. 389-397 ISSN 0009-5915 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACs * Genlisea * Karyotyping * Multicolor fluorescence in situ hybridization (mcFISH) * Reprobing Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.414, year: 2016

  6. FY 2016 and FY 2017 Pollution Prevention Grant Program Request for Proposals

    Science.gov (United States)

    To assist state and tribal governments to encourage businesses to adopt environmental strategies and solutions that significantly reduce or eliminate waste from the source, EPA anticipates it will award approximately $3.97 million for the P2 Grant in 2016.

  7. A stereospecific pathway for the introduction of deuterium on the brassinosteroid skeleton by reductive dechlorination of chlorocarbonates

    Czech Academy of Sciences Publication Activity Database

    Marek, Aleš; Patil, Mahadeo Rajshekhar; Klepetářová, Blanka; Kohout, Ladislav; Elbert, Tomáš

    2012-01-01

    Roč. 53, č. 16 (2012), s. 2048-2050 ISSN 0040-4039 R&D Projects: GA AV ČR IAA400550801 Institutional research plan: CEZ:AV0Z40550506 Keywords : brassinosteroids * reductive dechlorination * stereospecific reactions Subject RIV: CC - Organic Chemistry Impact factor: 2.397, year: 2012

  8. AcEST: BP918158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase OS=Thermotoga petrophila... 40 0.12 tr|B7RFK1|B7RFK1_9THEM Guanylate kinase OS=Marinitoga piezophila.....7RFK1|B7RFK1_9THEM Guanylate kinase OS=Marinitoga piezophila KA3 GN=gmk PE=4 SV=1 Length = 207 Score = 39.7

  9. Functional groups of fossil marattialeans: chemotaxonomic implications for Pennsylvanian tree ferns and pteridophylls

    Czech Academy of Sciences Publication Activity Database

    Pšenička, J.; Zodrow, E. L.; Mastalerz, M.; Bek, Jiří

    2005-01-01

    Roč. 61, 3-4 (2005), s. 259-280 ISSN 0166-5162 R&D Projects: GA AV ČR(CZ) IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : interdisciplinary approach * functional groups * FTIR Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.397, year: 2005

  10. Drug: D02099 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02099 Drug Propoxycaine hydrochloride (USP); Ravocaine hydrochloride; Blockaine h...ydrochloride (TN) ... C16H26N2O3. HCl D02099.gif ... CAS: 550-83-4 PubChem: 7849160 ChEMBL: CHEMBL1769 LigandBox: D02099 NIKKAJI: J404.397I ...

  11. National strategy for the prevention and management of transfusion ...

    African Journals Online (AJOL)

    cost-effective and a balance has to be found between the cost of the ..... threshold for treatment should probably be lower in children, as the virus ..... France. Hepatology 1991; 13: 393-397. 58. Saraceo G, Rosina F, Torrani Cerenzia MA, et al.

  12. Motor proficiency profile of Grade 1 learners in the North West ...

    African Journals Online (AJOL)

    This study aimed to establish a comprehensive profile of the motor proficiency of Grade 1 learners in the North West Province of South Africa, taking into account gender and racial differences and strengths and weaknesses. A stratified randomised sample of 816 Grade 1 learners (419 boys, 397 girls, mean age 6.84 years ...

  13. Automatic Configuration of Programmable Logic Controller Emulators

    Science.gov (United States)

    2015-03-01

    download.php?articleid= sec v6 n12 2013 3 . [FGM+99] Roy Fielding, Jim Gettys, Jeffrey Mogul, Henrik Frystyk, Larry Masin- ter, Paul Leach, and Tim...2011 ACM SIGCOMM Conference on, IMC ’11, pages 397–412, New York, NY, USA, 2011. ACM. [LBZH13] Patrick LaRoche, Aimee Burrows , and A. Nur Zincir

  14. High human immunodeficiency virus incidence in a cohort of Rwandan female sex workers

    NARCIS (Netherlands)

    Braunstein, Sarah L.; Ingabire, Chantal M.; Kestelyn, Evelyne; Uwizera, Aline Umutoni; Mwamarangwe, Lambert; Ntirushwa, Justin; Nash, Denis; Veldhuijzen, Nienke J.; Nel, Annalene; Vyankandondera, Joseph; van de Wijgert, Janneke H. H. M.

    2011-01-01

    Measurement of human immunodeficiency virus(HIV) incidence among female sex workers in Rwanda is a key part of preparing for HIV prevention trials. HIV-negative, nonpregnant female sex workers (N =397) were tested for HIV-1, sexually transmitted infections, and pregnancy quarterly for 12 months, and

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. B. N. Dwivedi. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 397-401 Session X – Cycle Variation in the Quiet Corona & Coronal Holes. The EUV Spectrum of Sunspot Plumes ...

  16. 75 FR 5353 - Energy Northwest; Notice of Receipt and Availability of Application for Renewal of Columbia...

    Science.gov (United States)

    2010-02-02

    ... NUCLEAR REGULATORY COMMISSION [NRC-2010-0029; Docket No. 50-397] Energy Northwest; Notice of Receipt and Availability of Application for Renewal of Columbia Generating Station Facility Operating... Commission) has received an application, dated January 19, 2010, from Energy Northwest (EN), filed pursuant...

  17. Anion recognition by calix[4]arene-based p-nitrophenyl amides

    Czech Academy of Sciences Publication Activity Database

    Flídrová, K.; Tkadlecová, M.; Lang, Kamil; Lhoták, P.

    2012-01-01

    Roč. 53, č. 6 (2012), s. 678-680 ISSN 0040-4039 R&D Projects: GA ČR GA203/09/0691 Institutional research plan: CEZ:AV0Z40320502 Keywords : calixarenes * anion recognition * receptor * complexation * UV/Vis titration Subject RIV: CA - Inorganic Chemistry Impact factor: 2.397, year: 2012

  18. Obstetric performance of elderly primi gravida in Jos University ...

    African Journals Online (AJOL)

    During the study period, 411 primigravidae delivered in the labour ward unit of Jos University Teaching Hospital. Out of these, 397 (96.6%) were aged ≤ 34 years while only 14 (3.4%) were aged ≥ 35 years. The commonest obstetric complication was failure to progress in labour (FTP),18(4.4%). Three hundred and thirteen ...

  19. FAK tyrosine phosphorylation is regulated by AMPK and controls metabolism in human skeletal muscle

    DEFF Research Database (Denmark)

    Lassiter, David G; Nylén, Carolina; Sjögren, Rasmus J O

    2018-01-01

    the FAK gene, PTK2. RESULTS: AMPK activation reduced tyrosine phosphorylation of FAK in skeletal muscle. AICAR reduced p-FAKY397in isolated human skeletal muscle and cultured myotubes. Insulin stimulation did not alter FAK phosphorylation. Serum starvation increased AMPK activation, as demonstrated...

  20. AcEST: DK951242 [AcEST

    Lifescience Database Archive (English)

    Full Text Available umbagini... 398 e-110 sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 397 e-110 sp|P25819|CATA2...FSHHP 180 Query: 628 ESMHMFSWLFDDVGIPLNYRH 690 ES+HMFS+LFDD+G+P +YRH Sbjct: 181 ESLHMFSFLFDDLGVPQDYRH 201 >sp|O24339|CATA_SOLAP

  1. AcEST: DK950143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 398 e-110 sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 397 e-110 sp|P25819|CATA2_ARATH C...0 Query: 619 ESMHMFSWLFDDVGIPLNYRH 681 ES+HMFS+LFDD+G+P +YRH Sbjct: 181 ESLHMFSFLFDDLGVPQDYRH 201 >sp|O24339|CATA_SOLAP

  2. Molecular epidemiology studies of carcinogenic environmental pollutants. Effects of polycyclic aromatic hydrocarbons (PAHs) in environmental pollution on exogenous and oxidative DNA damage

    Czech Academy of Sciences Publication Activity Database

    Farmer, P. B.; Singh, R.; Kaur, B.; Šrám, Radim; Binková, Blanka; Kalina, I.; Popov, T. A.; Garte, S.; Taioli, E.; Gabelova, A.; Cebulska-Wasilewska, A.

    2003-01-01

    Roč. 544, 2-3 (2003), s. 397-402 ISSN 1383-5742 Institutional research plan: CEZ:AV0Z5039906 Keywords : molecular epidemiology Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 5.783, year: 2003

  3. High Prevalence of Human Liver Infection by Amphimerus spp. Flukes, Ecuador

    OpenAIRE

    Calvopiña, Manuel; Cevallos, William; Kumazawa, Hideo; Eisenberg, Joseph

    2011-01-01

    Amphimerus spp. flukes are known to infect mammals, but human infections have not been confirmed. Microscopy of fecal samples from 397 persons from Ecuador revealed Opisthorchiidae eggs in 71 (24%) persons. Light microscopy of adult worms and scanning electron microscopy of eggs were compatible with descriptions of Amphimerus spp. This pathogen was only observed in communities that consumed undercooked fish.

  4. Pamětní místa na komunismus v České republice. Dokumentace a interpretace

    Czech Academy of Sciences Publication Activity Database

    Tůma, Oldřich

    2015-01-01

    Roč. 22, 3/4 (2015), s. 366-397 ISSN 1210-7050 R&D Projects: GA MK(CZ) DF11P01OVV034 Keywords : Federal Assembly * velvet revolution 1989 * Czechoslovakia Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  5. TMFunction data: 408 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Y382S;V397L ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  6. Alterations in synaptic curvature in the dentate gyrus following induction of long-term potentiation, long-term depression, and treatment with the N-methyl-D-aspartate receptor antagonist CPP

    Czech Academy of Sciences Publication Activity Database

    Medvedev, N. I.; Popov, V. I.; Dallerac, G.; Davies, H.A.; Laroche, S.; Kraev, I. V.; Rodríguez Arellano, Jose Julio; Doyere, V.; Stewart, M.G.

    2010-01-01

    Roč. 171, č. 2 (2010), s. 390-397 ISSN 0306-4522 Institutional research plan: CEZ:AV0Z50390703 Keywords : D synaptic ultrastructure * hippocampus * long term potentiation and depression Subject RIV: FH - Neurology Impact factor: 3.215, year: 2010

  7. Selection of yeast strains for the production of alcohol from lactoserum

    Energy Technology Data Exchange (ETDEWEB)

    Laham-Guillaume, M; Moulin, G; Galzy, P

    1979-01-01

    Five of 11 yeast strains tested fermented 85 g lactose/L to approximately 5% EtOH. Four of these strains, Candida pseudotropicalis CBS 19384 and IP 513, and Kluyveromyces fragilis CBS 397, and CBS 5795, anaerobically fermented deproteinized whey to EtOH.

  8. The effect of the first dynode`s geometry on the detection efficiency of a 119EM electron multiplier used as a highly charged ion detector

    Czech Academy of Sciences Publication Activity Database

    Krása, Josef; Pfeifer, Miroslav; Stöckli, M. P.; Lehnert, U.; Fry, D.

    1999-01-01

    Roč. 152, - (1999), s. 397-402 ISSN 0168-583X R&D Projects: GA AV ČR IAA1010819; GA ČR GA202/97/0918 Institutional research plan: CEZ:AV0Z1010921 Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.118, year: 1999

  9. Mollusc trace fossils Ptychoplasma Fenton and Fenton, 1937 and Oravaichnium Plička and Uhrová, 1990: Their type material and ichnospecies

    Czech Academy of Sciences Publication Activity Database

    Uchman, A.; Mikuláš, Radek; Rindsberg, A. K.

    2011-01-01

    Roč. 44, č. 4 (2011), s. 387-397 ISSN 0016-6995 R&D Projects: GA ČR GA205/05/0917 Institutional research plan: CEZ:AV0Z30130516 Keywords : locomotion trace fossils * Bivalves * flysch * Carboniferous * Cretaceous * Paleogene Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.010, year: 2011

  10. Control of flowering time and spike development in cereals: the earliness per se Eps-1 region in wheat, rice, and Brachypodium

    Czech Academy of Sciences Publication Activity Database

    Faricelli, M. E.; Valárik, Miroslav; Dubcovsky, J.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 293-306 ISSN 1438-793X Institutional research plan: CEZ:AV0Z50380511 Keywords : Comparative genomics * Earliness per se * Flowering Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.397, year: 2010

  11. Temperature structure function in the Bolgiano regime of thermal convection

    Czech Academy of Sciences Publication Activity Database

    Skrbek, Ladislav; Niemela, J. J.; Sreenivasan, K. R.; Donnelly, J.

    2002-01-01

    Roč. 66, č. 3 (2002), 036303/1-036303/6 ISSN 1063-651X Institutional research plan: CEZ:AV0Z1010914 Keywords : thermal convection * temperature fluctuations * Bolgiano regime Subject RIV: BK - Fluid Dynamics Impact factor: 2.397, year: 2002

  12. Hydrobiont animals in floodplain soil: Are they positively or negatively affected by flooding?

    Czech Academy of Sciences Publication Activity Database

    Devetter, Miloslav; Schöll, K.

    2014-01-01

    Roč. 69, February (2014), s. 393-397 ISSN 0038-0717 Grant - others:Deutsche Bundesstiftung Umwelt(DE) AZ 24050 Institutional support: RVO:60077344 Keywords : Rotifers * Bdelloids * floodplain * limnoterrestrial communities * species response * variance partitioning Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  13. Particulate composite on the basis of HA and TCP microparticles and nanoparticles as a possible biomaterial for spine therapy

    Czech Academy of Sciences Publication Activity Database

    Rýglová, Šárka; Sucharda, Zbyněk; Černý, Martin; Suchý, Tomáš; Šupová, Monika; Žaloudková, Margit

    2010-01-01

    Roč. 54, č. 4 (2010), s. 386-397 ISSN 0862-5468 R&D Projects: GA MPO FT-TA3/131 Institutional research plan: CEZ:AV0Z30460519 Keywords : particulate composite * preparation * hydroxyapatite Subject RIV: JI - Composite Materials Impact factor: 0.297, year: 2010

  14. 77 FR 40385 - Withdrawal of Regulatory Guide 7.3; Procedures for Picking Up and Receiving Packages of...

    Science.gov (United States)

    2012-07-09

    ... Picking Up and Receiving Packages of Radioactive Material AGENCY: Nuclear Regulatory Commission. ACTION.... Nuclear Regulatory Commission (NRC or Commission) is withdrawing RG 7.3, ``Procedures for Picking Up and... Public Document Room (PDR) reference staff at 1-800-397-4209, or 301-415-4737, or by email at PDR...

  15. 77 FR 36017 - Regulatory Guide 7.3, Procedures for Picking Up and Receiving Packages of Radioactive Material

    Science.gov (United States)

    2012-06-15

    ... NUCLEAR REGULATORY COMMISSION [NRC-2012-0139] Regulatory Guide 7.3, Procedures for Picking Up and... Guide (RG) 7.3, ``Procedures for Picking Up and Receiving Packages of Radioactive Material.'' The guide..., please contact the NRC's Public Document Room (PDR) reference staff at 1-800-397-4209, or 301-415-4737...

  16. 75 FR 71368 - Erik Erb; Notice of Receipt of Petition for Rulemaking

    Science.gov (United States)

    2010-11-23

    ... and Adjudications Staff. E-mail comments to: [email protected] . If you do not receive a... accessing the documents located in ADAMS, then contact the NRC's PDR reference staff at 800-397-4209, or 301... overtime must now ``pick up the slack,'' sometimes to the point of being forced to work overtime. The...

  17. 75 FR 20370 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-04-19

    ... Special Emphasis Panel, Breast Cancer Biology. Date: May 20, 2010. Time: 8 a.m. to 5 p.m. Agenda: To..., [email protected] . Name of Committee: National Cancer Institute Special Emphasis Panel, Molecular... Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research Manpower; 93.399, Cancer Control...

  18. 76 FR 576 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2011-01-05

    ...; Development of Molecular Diagnostics Assay to Detect Basal- like Breast Cancer. Date: February 15, 2011. Time... Institute Special Emphasis Panel; Collaborative Research in Integrative Cancer Biology and the Tumor... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397...

  19. 76 FR 9353 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2011-02-17

    ....gov . Name of Committee: National Cancer Institute Special Emphasis Panel; Molecular Pharmacodynamic... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  20. 75 FR 14172 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-03-24

    ... Cancer Institute Special Emphasis Panel, Nucleic Acid Analysis for the Molecular Characterization of... Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  1. 76 FR 14675 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2011-03-17

    ...-7565, [email protected] . Name of Committee: National Cancer Institute Special Emphasis Panel; Molecular... Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  2. 77 FR 33476 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2012-06-06

    ... Cancer Institute Special Emphasis Panel; Biopsy Instruments and Devices That Preserve Molecular Profiles... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  3. 78 FR 55750 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2013-09-11

    ... Innovative Molecular Analysis Technology Development for Cancer Research (R21). Date: October 24, 2013. Time...: National Cancer Institute Special Emphasis Panel; Integrative Cancer Biology. Date: October 29, 2013. Time... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397...

  4. 77 FR 19674 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2012-04-02

    ... Institute Special Emphasis Panel; Innovative Molecular Analysis Technologies for Cancer (R21). Date: June 26... Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  5. 75 FR 59099 - Cable Television Act of 1992

    Science.gov (United States)

    2010-09-27

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 76 [MM Docket No. 92-266, FCC 95-397] Cable Television Act of 1992 AGENCY: Federal Communications Commission. ACTION: Final rule; announcement of effective date. SUMMARY: This document announces the effective date of rules published in the Federal...

  6. 78 FR 11988 - Cable Television Act of 1992

    Science.gov (United States)

    2013-02-21

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 76 [MM Docket No. 92-266, FCC 95-397] Cable Television Act of 1992 AGENCY: Federal Communications Commission. ACTION: Final rule; announcement of effective date. SUMMARY: This document announces the effective date of rules published in the Federal...

  7. Conflict between parents and adolescents : Variation by family constitution

    NARCIS (Netherlands)

    Honess, T.M; Charman, E.A; Zani, B; Cicognani, E; Xerri, M.L; Jackson, A.E.; Bosma, H.A.

    Conflicts between parents and adolescents were explored from the viewpoint of 13- and 15-year-old children (N = 397). There was support for Steinberg's (1989) distancing hypothesis: older children reported more aggression, more frustration and lower intimacy outcomes. There was also support for the

  8. Direct Monte Carlo Simulation Methods for Nonreacting and Reacting Systems at Fixed Total Internal Energy or Enthalpy

    Czech Academy of Sciences Publication Activity Database

    Smith, W.; Lísal, Martin

    2002-01-01

    Roč. 66, č. 1 (2002), s. 011104-1 - 011104-1 ISSN 1063-651X R&D Projects: GA ČR GA203/02/0805 Grant - others:NSERC(CA) OGP1041 Keywords : MC * simulation * reaction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.397, year: 2002

  9. Being different at work : How gender dissimilarity relates to social inclusion and absenteeism

    NARCIS (Netherlands)

    Jansen, Wiebren S.; Otten, Sabine; I. van der Zee, Karen

    We investigated how and when gender dissimilarity relates to two highly important individual work outcomes: social inclusion and absenteeism. We collected survey data among 397 employees from a university of applied sciences and combined these with data from the organization's personnel

  10. Being different at work : How gender dissimilarity relates to social inclusion and absenteeism

    NARCIS (Netherlands)

    Jansen, Wiebren S.; Otten, Sabine; van der Zee, K.I.

    2017-01-01

    We investigated how and when gender dissimilarity relates to two highly important individual work outcomes: social inclusion and absenteeism. We collected survey data among 397 employees from a university of applied sciences and combined these with data from the organization’s personnel

  11. Quietly Does It: Questioning assumptions about class, sustainability and consumption

    Czech Academy of Sciences Publication Activity Database

    Smith, J.; Kostelecký, Tomáš; Jehlička, P.

    2015-01-01

    Roč. 67, č. 10 (2015), s. 223-232 ISSN 0016-7185 Institutional support: RVO:68378025 Keywords : Sustainability * Ethical consumption * Class Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.397, year: 2015 http://dx.doi.org/10.1016/j.geoforum.2015.03.017

  12. Kasinath Ojha

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. KASINATH OJHA. Articles written in Journal of Chemical Sciences. Volume 129 Issue 3 March 2017 pp 397-404 Regular Article. Biomass derived graphene-like activated and non-activated porous carbon for advanced supercapacitors · KASINATH OJHA BHARAT KUMAR ...

  13. Urinary endogenous sex hormone levels and the risk of postmenopausal breast cancer

    NARCIS (Netherlands)

    Onland-Moret, N.C.; Kaaks, R.; Noord, P.A.H. van; Rinaldi, S.; Key, T.; Grobbee, D.E.; Peeters, P.H.M.

    2003-01-01

    To assess the relation between urinary endogenous sex steroid levels and the risk of postmenopausal breast cancer, a nested case–cohort study was conducted within a large cohort (the DOM cohort) in the Netherlands (n¼9 349). Until the end of follow-up (1 January 1996), 397 postmenopausal breast

  14. Disease: H00223 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available :12787534 ... AUTHORS ... Buchanan GS, Rodgers GM, Ware Branch D ... TITLE ... The inherited thrombophilias: genet...ics, epidemiology, and laboratory evaluation. ... JOURNAL ... Best Pract Res Clin Obstet Gynaecol 17:397-411 (2003) DOI:10.1016/S1521-6934(03)00010-5 ...

  15. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal

    2015-01-01

    Roč. 267, 15 September (2015), s. 397-408 ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sum s * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015 http://www.sciencedirect.com/science/article/pii/S0096300315002155

  16. 75 FR 5092 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-02-01

    ... . Name of Committee: National Cancer Institute Special Emphasis Panel, Quantitative Cell-Based Imaging....396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research Manpower; 93.399... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  17. 76 FR 52960 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2011-08-24

    ... Emphasis Panel, Mechanisms of Cell Signaling in Cancer. Date: October 13-14, 2011. Time: 3 to 5 p.m. Agenda..., Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute...

  18. On White’s Expansion of Lukasiewicz Logic

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    2010-01-01

    Roč. 20, č. 2 (2010), s. 389-397 ISSN 0955-792X R&D Projects: GA ČR GEICC/08/E018 Institutional research plan: CEZ:AV0Z10300504 Keywords : Lukasiewicz fuzzy logic * Cantor-Lukasiewicz set theory * full comprehension Subject RIV: BA - General Mathematics Impact factor: 0.586, year: 2010

  19. On the quantization of wave fields⋆

    Science.gov (United States)

    Rosenfeld, L.

    2017-04-01

    Originally published in German "Zur Quantelung der Wellenfelder" in Annalen der Physik 397, 113 (1930). Submitted for publication on March 18, 1930Translated by Donald Salisbury, Max-Planck-Institut für Wissenschaftsgeschichte, Berlin and Austin College, Sherman, TX, USA and Kurt Sundermeyer, Max-Planck-Institut für Wissenschaftsgeschichte, Berlin. DSalisbury@austincollege.edu

  20. Brilliant Green Dye Elimination from Water Using Psidium guajava Leaves and Solanum tuberosum Peels as Adsorbents in Environmentally Benign Way

    Directory of Open Access Journals (Sweden)

    Rabia Rehman

    2015-01-01

    Full Text Available The aim of this study is to check the feasibility of Psidium guajava (Guava leaves and peels of Solanum tuberosum (Potato as biosorbents in removal of Brilliant Green (BG in batch mode. Surface analysis of biosorbents was done by FT-IR and quantitatively analyzed by Boehm titration. The removal of dye was confirmed by UV-VIS spectroscopy. Isothermal modeling was studied by using Langmuir, Freundlich, and Temkin isotherms. Various isothermal parameters for adsorption of Brilliant Green such as qm=1.075 mg/g, 1.173 mg/g ΔG°=-3.397, and −2.397 KJ/mol were noted for Solanum tuberosum peels (PP and Psidium guajava leaves (GL, respectively. Similarly pH, moisture content, and various metals were quantitatively analyzed. Results showed that leaves of Psidium guajava were more effective for removal of Brilliant Green.

  1. Cibachrome testing. [photographic processing and printing materials

    Science.gov (United States)

    Weinstein, M. S.

    1974-01-01

    The use of Cibachrome products as a solution to problems encountered when contact printing Kodak film type SO-397 onto Kodak Ektrachrome color reversal paper type 1993 is investigated. A roll of aerial imagery consisting of Kodak film types SO-397 and 2443 was contact printed onto Cibachrome and Kodak materials and compared in terms of color quality, resolution, cost, and compatibility with existing equipment and techniques. Objective measurements are given in terms of resolution and sensitometric response. Comparison prints and transparencies were viewed and ranked according to overall quality and aesthetic appeal. It is recommended that Cibachrome Print material be used in place of Kodak Ektachrome paper because it is more easily processed, the cost is equivalent, and it provides improved resolution, color quality, and image fade resistance.

  2. CONSUMO DE ALCOHOL Y FACTORES DE RIESGO EN ESTUDIANTES DE DOS UNIVERSIDADES COLOMBIANAS. (ALCOHOL CONSUMPTION AND RISK FACTORS IN STUDENTS OF TWO COLOMBIAN UNIVERSITIES

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Cano Bedoya

    2012-06-01

    Full Text Available El objetivo fue identificar factores de riesgo del consumo de alcohol en estudiantes universitarios colombianos. Participaron 397 mujeres y 312 hombres, estudiantes de dos universidades privadas y católicas de la ciudad de Medellín (Colombia. Los resultados identificaron como factores de riesgo las dificultades para decir “no” a la gente (p=0.012 y el consumo de sustancias psicoactivas por miembros de la familia (p=0.022.Abstract:The objective of the current research was to identify the risk factors associated to alcohol consumption of Colombian University students. 397 women and 312 men, students from two private and Catholic universities in the city of Medellín (Colombia took part in it. The results identified as risk factors the difficulties to say 'no' to the people (p=0.012 and the consumption of psychoactive substances by members of the family (p=0.022.

  3. QT interval prolongation in users of selective serotonin reuptake inhibitors in an elderly surgical population

    DEFF Research Database (Denmark)

    van Haelst, Ingrid M M; van Klei, Wilton A; Doodeman, Hieronymus J

    2014-01-01

    OBJECTIVE: To investigate the association between the use of a selective serotonin reuptake inhibitor (SSRI) and the occurrence of QT interval prolongation in an elderly surgical population. METHOD: A cross-sectional study was conducted among patients (> 60 years) scheduled for outpatient...... preanesthesia evaluation in the period 2007 until 2012. The index group included elderly users of an SSRI. The reference group of nonusers of antidepressants was matched to the index group on sex and year of scheduled surgery (ratio, 1:1). The primary outcome was the occurrence of QT interval prolongation shown...... on electrocardiogram. The QT interval was corrected for heart rate (QTc interval). The secondary outcome was the duration of the QTc interval. The outcomes were adjusted for confounding by using regression techniques. RESULTS: The index and reference groups included 397 users of an SSRI and 397 nonusers, respectively...

  4. Self assembly and properties of C:WO3 nano-platelets and C:VO2/V2O5 triangular capsules produced by laser solution photolysis

    CSIR Research Space (South Africa)

    Mwakikunga, BW

    2010-01-01

    Full Text Available -Structured Materials, P. O. Box 395, Pretoria, South Africa 123 Nanoscale Res Lett (2010) 5:389–397 DOI 10.1007/s11671-009-9494-4 coherent, intense and almost monochromatic laser light allows it to be tuned to selectively dissociate specific bonds in a precursor... in the current set of experiments. 390 Nanoscale Res Lett (2010) 5:389–397 123 2WðO � C2H5Þ6��! 248nm CxWO3�y þ . . . 2VðO � C2H5Þ4��! 248nm CxVO2þy þ . . . ð3Þ When the same precursors are irradiated with the 248-nm beam from the KrF excimer laser, the W(OR)6...

  5. Self assembly and properties of C:WO3 nano-platelets and C:VO2/V2O5 triangular capsules produced by laser solution photolysis

    CSIR Research Space (South Africa)

    Mwakikunga, BW

    2009-01-01

    Full Text Available Africa M. Scriba � E. Manikandan DST/CSIR National Centre for Nano-Structured Materials, P. O. Box 395, Pretoria, South Africa 123 Nanoscale Res Lett (2010) 5:389–397 DOI 10.1007/s11671-009-9494-4 coherent, intense and almost monochromatic laser... amorphous carbon, graphite and diamond. However, carbon can also be found in the matrix of WO3 as a dopant as in Eq. 3. This has been observed in the current set of experiments. 390 Nanoscale Res Lett (2010) 5:389–397 123 2WðO� C2H5Þ6��!248nmCxWO3�y þ...

  6. Dynamics of Inter-heavy Chain Interactions in Human Immunoglobulin G (IgG) Subclasses Studied by Kinetic Fab Arm Exchange

    NARCIS (Netherlands)

    Rispens, Theo; Davies, Anna M.; Ooijevaar-de Heer, Pleuni; Absalah, Samira; Bende, Onno; Sutton, Brian J.; Vidarsson, Gestur; Aalberse, Rob C.

    2014-01-01

    Background: Fab arm exchange requires weak interactions between CH3 domains, such as in human IgG4. Results: CH3-CH3 interactions differ >1,000,000-fold between human subclasses and allotypes due to variations Lys/Asn-392, Val/Met-397, and Lys/Arg-409. Conclusion: For IgG2 and IgG3, but not IgG1,

  7. High Cycle Fatigue Damage Mechanisms of MAR-M 247 Superalloy at High Temperatures

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Horník, Vít; Hutař, Pavel; Hrbáček, K.; Kunz, Ludvík

    2016-01-01

    Roč. 69, č. 2 (2016), s. 393-397 ISSN 0972-2815 R&D Projects: GA TA ČR(CZ) TA04011525; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : High cycle fatigue * S-N curves * Fractography * High temperature * EBSD analysis Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.533, year: 2016

  8. Maternal patterns of postpartum alcohol consumption by age: A longitudinal analysis of adult urban mothers

    OpenAIRE

    Liu, Weiwei; Mumford, Elizabeth A.; Petras, Hanno

    2015-01-01

    The purpose of this study is to investigate a) longitudinal patterns of maternal postpartum alcohol use as well as its variation by maternal age at child birth; b) within maternal age groups, the association between other maternal characteristics and alcohol use patterns for the purposes of informed prevention design. Study sample consists of 3,397 mothers from the Fragile Families and Child Wellbeing Study representing medium and large U.S. urban areas. Maternal drinking and binge drinking w...

  9. An analysis of climatic impacts and adaptation strategies in Tanzania

    CSIR Research Space (South Africa)

    Ojoyi, MM

    2015-03-01

    Full Text Available International Journal of Climate Change Strategies and Management An analysis of climatic impacts and adaptation strategies in Tanzania Mercy M. Ojoyi School of Environmental Sciences, University of KwaZulu-Natal, Pietermaritzburg, South Africa... of feedback results from analysis of variance tests conducted. Major indicators of climate variability and change include: increased dry spells (39.7 per cent), drying of rivers (34.7 per cent), a reduction in water flows (14.6 per cent) and poor economy...

  10. Effect of multiple substrates in ethanol fermentations from cheese whey

    Energy Technology Data Exchange (ETDEWEB)

    Wang, C J; Jayanata, Y; Bajpai, R K

    1987-01-01

    Ethanol fermentations from cheese whey by Kluyveromyces marxianus CBS 397 were investigated. Cheese whey, which contains lactose as the major sugar, has been found to have small amounts of glucose and galactose, depending on the source and operating conditions. Fermentation performance was strongly influenced by the presence of glucose and galactose. However, lactose did not significantly affect the cell growth and product formation even at a high concentration. A logistical model was proposed to take into account the effect of lactose. (Refs. 6).

  11. Comparative analysis of a plant pseudoautosomal region (PAR) in Silene latifolia with the corresponding S. vulgaris autosome

    Czech Academy of Sciences Publication Activity Database

    Blavet, N.; Blavet, Hana; Čegan, Radim; Zemp, N.; Ždánská, Jana; Janoušek, Bohuslav; Hobza, Roman; Widmer, A.

    2012-01-01

    Roč. 13, č. 226 (2012), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR(CZ) GA522/09/0083; GA ČR GBP501/12/G090 Institutional research plan: CEZ:AV0Z50040702 Keywords : BAC library * pseudoautosomal region * Silene latifolia Subject RIV: BO - Biophysics Impact factor: 4.397, year: 2012

  12. How to interpret Methylation Sensitive Amplified Polymorphism (MSAP) profiles?

    Czech Academy of Sciences Publication Activity Database

    Fulneček, Jaroslav; Kovařík, Aleš

    2014-01-01

    Roč. 15, JAN 2014 (2014) ISSN 1471-2156 R&D Projects: GA ČR(CZ) GBP501/12/G090; GA ČR(CZ) GA13-10057S; GA ČR(CZ) GA206/09/1751 Institutional support: RVO:68081707 Keywords : MSAP * DNA methylation * Methylcytosine Subject RIV: BO - Biophysics Impact factor: 2.397, year: 2014

  13. Evaluation of Mechanisms of Alteration and Humification of PAHs for Water Quality Management

    OpenAIRE

    Sims, Ronald C.; Abbott, Carolyn K.

    1992-01-01

    Introduction: Creosote-pentachlorophenol (PCP) is a mixture commonly used as a wood preservative in the U.S. (1). A 1988 survey (2) indicated that 1,397 wood preserving waste contaminated sites exist in the United States consisting of 555 active wood treatment plants and 842 inactive plants. Stinson (3) indentifed 58 wood preserving sites on the National Priorities List, of which 51 have PCP and/or creosote or po...

  14. Alpha-Tocopheryl succinate causes mitochondrial permeabilization by preferential formation of Bak channels

    Czech Academy of Sciences Publication Activity Database

    Procházka, L.; Dong, L.F.; Vališ, Karel; Freeman, R.; Ralph, S.J.; Turánek, J.; Neužil, Jiří

    2010-01-01

    Roč. 15, č. 7 (2010), s. 782-794 ISSN 1360-8185 R&D Projects: GA AV ČR(CZ) KAN200520703; GA AV ČR(CZ) IAA500520702; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Vitamin E succinate * apoptosis * Noxa-Bak Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.397, year: 2010

  15. Planning for Post-Regime Change Environments: The Introduction of a Post-Regime Environment Planning Partnership (PREPP)

    Science.gov (United States)

    2016-05-26

    Bush Administration. Hillary Clinton served as the Secretary of State after conceding the Democratic presidential nomination to then Senator Obama in...York: Vintage, 2015), 521. 64 Hillary Rodham Clinton , Hard Choices, Reprint ed. (New York: Simon & Schuster, 2015), 397. 65 Gates, Duty: Memoirs, 523...georgewbush-whitehouse.archives.gov/nsc/history.html# clinton . Clinton , Hillary Rodham. Hard Choices. Reprint ed. New York: Simon & Schuster, 2015

  16. Le VIH chez le malade neurologique aux CHU de Lome ...

    African Journals Online (AJOL)

    Etude prospective à propos de 397 malades hospitalisés du 1er Janvier au 31 Décembre 2015. Objectifs: Evaluer l'évolution de la séroprévalence hospitalière et les manifestations cliniques neurologiques de l'infection à VIH. Méthodologie: Notre étude s'est déroulée du 1er Janvier au 31 Décembre 2015 dans les services ...

  17. Synthesis of a new chiral cyclic aminal derived from rac-1,2-propanediamine

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Pacheco, D.J.; Ríos-Motta, J.; Fejfarová, Karla; Dušek, Michal

    2012-01-01

    Roč. 53, č. 45 (2012), s. 6132-6135 ISSN 0040-4039 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : aminal cage * axial chirality * imidazolidine-bridged bis(phenols) * Mannich condensation * 1,2-propanediamine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.397, year: 2012

  18. New cyclic aminals derived from rac-trans-1,2-diaminocyclohexane: synthesis and crystal structure of racemic 1,8,10,12-tetraazatetracyclo[8.3.1.1..sup.8,12./sup.O.sup.2,7./sup.] pentadecane and a route to its enantiomerically pure (R,R) and (S,S) isomers

    Czech Academy of Sciences Publication Activity Database

    Rivera, A.; Quiroga, D.; Jiménez-Cruz, L.; Fejfarová, Karla; Dušek, Michal

    2012-01-01

    Roč. 53, č. 3 (2012), s. 345-348 ISSN 0040-4039 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : crystal structure * X-ray diffraction * Jana2006 * chiral cyclic aminals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.397, year: 2012

  19. Integrating Systems Thinking Into Nursing Education.

    Science.gov (United States)

    Phillips, Janet M; Stalter, Ann M

    2016-09-01

    A critical need exists for nursing leadership in current complex health care settings. Systems thinking can be incorporated into nursing education at all levels by using evidence-based principles in education. Teaching tips are provided using a systems awareness model to guide nurse educators in the assessment and integration of systems thinking and engaging learners in interprofessional education and practice. J Contin Educ Nurs. 2016;47(9):395-397. Copyright 2016, SLACK Incorporated.

  20. Research

    African Journals Online (AJOL)

    raoul

    16 janv. 2011 ... Les femmes au foyer (24%) et les sujets non scolarisés (62,8%) représentaient les couches sociales les plus touchées. Les forages ont été la source de boisson de 39,7% des patients 72 heures avant le début de la maladie. Tous les patients ont présenté une diarrhée aqueuse. Vibrio cholerae, sérotype ...

  1. Comparative analysis of dose rates in bricks determined by neutron activation analysis, alpha counting and X-ray fluorescence analysis for the thermoluminescence fine grain dating method

    Czech Academy of Sciences Publication Activity Database

    Bártová, H.; Kučera, Jan; Musílek, L.; Trojek, T.

    2014-01-01

    Roč. 104, NOV (2014), s. 393-397 ISSN 0969-806X. [1st International Conference on Dosimetry and its Applications (ICDA). Prague, 23.6.2013-28.6.2013] R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : Alpha coutning * neutron activation analysis * X-ray fluorescence * thermoluminescence dating * dose rate Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.380, year: 2014

  2. Membrane ion transport in erythrocytes of salt hypertensive Dahl rats and their F2 hybrids: the importance of cholesterol

    Czech Academy of Sciences Publication Activity Database

    Vokurková, Martina; Dobešová, Zdenka; Kuneš, Jaroslav; Zicha, Josef

    2003-01-01

    Roč. 26, č. 5 (2003), s. 397-404 ISSN 0916-9636 R&D Projects: GA ČR GA305/00/1638; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : ion transport * salt hypertension * plasma lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 2.013, year: 2003

  3. Reducing maternal mortality in conflict areas: Surgical-anesthetic experience in Boost Hospital - Afghanistan

    OpenAIRE

    Izquierdo, Gilda; Trelles, Miguel; Khan, Nasrullah

    2016-01-01

    Introduction: Helmand province, whose capital is Lashkar-Gah, is one of the most volatile provinces affected by the conflict in Afghanistan. Doctors without Borders began to work in Boost Hospital in 2009. Method: Retrospective review of surgical procedures at the Doctors without Borders Operational Center in Brussels, February 11, 2010 to September 30, 2012. Results: 5719 surgeries were performed on 4334 patients. 47% were emergency interventions and 75% were first interventions. 39.7% (n = ...

  4. Oncogenic Receptor Tyrosine Kinases Directly Phosphorylate Focal Adhesion Kinase (FAK) as a Resistance Mechanism to FAK-Kinase Inhibitors.

    Science.gov (United States)

    Marlowe, Timothy A; Lenzo, Felicia L; Figel, Sheila A; Grapes, Abigail T; Cance, William G

    2016-12-01

    Focal adhesion kinase (FAK) is a major drug target in cancer and current inhibitors targeted to the ATP-binding pocket of the kinase domain have entered clinical trials. However, preliminary results have shown limited single-agent efficacy in patients. Despite these unfavorable data, the molecular mechanisms that drive intrinsic and acquired resistance to FAK-kinase inhibitors are largely unknown. We have demonstrated that receptor tyrosine kinases (RTK) can directly bypass FAK-kinase inhibition in cancer cells through phosphorylation of FAK's critical tyrosine 397 (Y397). We also showed that HER2 forms a direct protein-protein interaction with the FAK-FERM-F1 lobe, promoting direct phosphorylation of Y397. In addition, FAK-kinase inhibition induced two forms of compensatory RTK reprogramming: (i) the rapid phosphorylation and activation of RTK signaling pathways in RTK High cells and (ii) the long-term acquisition of RTKs novel to the parental cell line in RTK Low cells. Finally, HER2 +: cancer cells displayed resistance to FAK-kinase inhibition in 3D growth assays using a HER2 isogenic system and HER2 + cancer cell lines. Our data indicate a novel drug resistance mechanism to FAK-kinase inhibitors whereby HER2 and other RTKs can rescue and maintain FAK activation (pY397) even in the presence of FAK-kinase inhibition. These data may have important ramifications for existing clinical trials of FAK inhibitors and suggest that individual tumor stratification by RTK expression would be important to predict patient response to FAK-kinase inhibitors. Mol Cancer Ther; 15(12); 3028-39. ©2016 AACR. ©2016 American Association for Cancer Research.

  5. The effect of elevated ambient CO2 and temperature increase on rhizosphere of perennial ryegrass (Lolium perenne L.)

    Czech Academy of Sciences Publication Activity Database

    Šantrůčková, Hana; Elhottová, Dana; Loiseau, P.; Soussana, F.

    2000-01-01

    Roč. 46, č. 9 (2000), s. 397-403 ISSN 0370-663X R&D Projects: GA ČR GA206/99/1410 Grant - others:-(EV) EV5V-CT92-0169 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 123100004 Subject RIV: EF - Botanics Impact factor: 0.256, year: 2000

  6. 78 FR 45213 - Medicaid Program; State Allotments for Payment of Medicare Part B Premiums for Qualifying...

    Science.gov (United States)

    2013-07-26

    ... 9,166,126 NA NA 6,691,552......... 3.6701 3,027,397......... NA 12,830,281 New Mexico 10 0.75 5,468... whose incomes are at least 120% but less than 135% of federal poverty level. Source: Census Bureau... 9,901,642 NA NA 11,318,885........ 7.0247 7,274,411......... NA 13,946,116 New Mexico 9 0.62 4,774...

  7. On Tight Separation for Blum Measures Applied to Turing Machine Buffer Complexity

    Czech Academy of Sciences Publication Activity Database

    Šíma, Jiří; Žák, Stanislav

    2017-01-01

    Roč. 152, č. 4 (2017), s. 397-409 ISSN 0169-2968 R&D Projects: GA ČR GBP202/12/G061; GA ČR GAP202/10/1333 Institutional support: RVO:67985807 Keywords : Turing machine * hierarchy * buffer complexity * diagonalization Subject RIV: IN - Informatics, Computer Science OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.687, year: 2016

  8. A note on the effect of gamma-irradiation on the seed germination of Linum usitatissimum L

    International Nuclear Information System (INIS)

    Ghouse, A.K.M.; Abidi, S.H.; Kazmi, Reshma

    1979-01-01

    A study on the effect of different acute doses of gamma-irradiation on the seeds of Linum usitatissimum L. varieties Heera, Mukta and T 397 revealed that the process of germination has been retarded, particularly, at its initial stage, under the influence of this ionizing agency, although the overall germination percentage does not vary to any considerable extent under the different intensities of irradiation tested. (auth.)

  9. Consumer Willingness to Pay for Dengue Vaccine (CYD-TDV, Dengvaxia?) in Brazil; Implications for Future Pricing Considerations

    OpenAIRE

    God?i, Isabella P.; Santos, Andr? S.; Reis, Edna A.; Lemos, Livia L. P.; Brand?o, Cristina M. R.; Alvares, Juliana; Acurcio, Francisco A.; Godman, Brian; Guerra J?nior, Augusto A.

    2017-01-01

    Introduction and Objective: Dengue virus is a serious global health problem with an estimated 3.97 billion people at risk for infection worldwide. In December 2015, the first vaccine (CYD-TDV) for dengue prevention was approved in Brazil, developed by Sanofi Pasteur. However, given that the vaccine will potentially be paid via the public health system, information is need regarding consumers’ willingness to pay for the dengue vaccine in the country as well as discussions related to the possib...

  10. 2180-IJBCS-Article-epolyste Adjeffa

    African Journals Online (AJOL)

    hp

    pédologique, une analyse des indicateurs physico-chimiques et une instrumentation piézométrique du périmètre ... Sondage pédologique et analyse de sols. Pour réaliser le sondage pédologique du périmètre irrigué de ..... terres dans les pays du sahel. Diagnostic et conseil aux paysans. Collection « le point sur », 397p.

  11. Lipoxygenase inhibiting and antioxidant iridoids from Buddleja crispa.

    Science.gov (United States)

    Ahmad, Ijaz; Chen, Shilin; Peng, Yong; Chen, Sibao; Xu, Lijia

    2008-02-01

    Phytochemical investigations on the ethyl acetate-soluble fraction of the whole plant of Buddleja crispa led to the isolation of the iridoids 1-7. Compound 2 displayed significant inhibitory potential against enzyme lipoxygenase in a concentration-dependant fashion with IC(50) value of 39.7 +/- 0.02microM, along with DPPH radical scavenging activity with IC(50) value 0.638 mM.

  12. Brief Report: Checklist for Autism Spectrum Disorder--Most Discriminating Items for Diagnosing Autism

    Science.gov (United States)

    Mayes, Susan D.

    2018-01-01

    The smallest subset of items from the 30-item Checklist for Autism Spectrum Disorder (CASD) that differentiated 607 referred children (3-17 years) with and without autism with 100% accuracy was identified. This 6-item subset (CASD-Short Form) was cross-validated on an independent sample of 397 referred children (1-18 years) with and without autism…

  13. Nikkaji Dictionary: 9-アントリルジアゾメタン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term 9-アントリルジアゾメタン 名詞 一般 * * * * 9-アントリルジアゾメタン... ... Nikkaji J397.305K 200906032514656750 C CA06 UNKNOWN_2 9 - アントリルジアゾメタン

  14. Nikkaji Dictionary: 9−アントリルジアゾメタン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term 9−アントリルジアゾメタン 名詞 一般 * * * * 9-アントリルジアゾメタン... ... Nikkaji J397.305K 200906032514656750 C CA06 UNKNOWN_2 9 − アントリルジアゾメタン

  15. EU Civilian Crisis Management: The Record So Far

    Science.gov (United States)

    2010-01-01

    significant contribution to the construction of an Afghan police force. 1 See for example, Dempsey, 2006; DiManno, 2008; and Graw , 2007. 18 EU Civilian...Giegerich, Bastian, European Military Crisis Management: Connecting Ambition and Reality, Adelphi Paper No. 397, London: Routledge, 2008. Graw , Ansgar...4. Gros-Verheyde, Nicolas, “Interview with Stephen White, Head of EUJUST Lex Mission for Iraq,” Europolitics, January 21, 2009. References 51

  16. Correlative Light and Electron Microscopy (CLEM) and its applications in infectious disease

    Science.gov (United States)

    2016-05-20

    has been shown to handle OsO4 fixation by withstanding standard EM processing concentrations of 1% [29]. A great utility of FPs is the endogenous...Development of imaging techniques to study the pathogenesis of biosafety level 2/3 infectious agents. Pathog Dis, 2014. 72(3): p. 167-73. 3. Sridhar...3): p. 397-406. 32. Johnson, E., et al., Correlative in-resin super-resolution and electron microscopy using standard fluorescent proteins. Sci Rep

  17. Crystallization and crystallographic analysis of the Rhodococcus rhodochrous NCIMB 13064 DhaA mutant DhaA31 and its complex with 1,2,3-trichloropropane

    Czech Academy of Sciences Publication Activity Database

    Lahoda, M.; Chaloupková, R.; Stsiapanava, A.; Damborský, J.; Kutá-Smatanová, Ivana

    2011-01-01

    Roč. 67, Part 3 (2011), s. 397-400 ISSN 1744-3091 R&D Projects: GA MŠk(CZ) LC06010; GA MŠk(CZ) ED1.1.00/02.0073 Institutional research plan: CEZ:AV0Z60870520 Keywords : haloalkane dehalogenases * DhaA * Rhodococcus rhodochrous Subject RIV: CE - Biochemistry Impact factor: 0.506, year: 2011

  18. Fertility of a spontaneous hexaploid male Siberian sturgeon, Acipenser baerii

    Czech Academy of Sciences Publication Activity Database

    Havelka, M.; Hulák, M.; Ráb, Petr; Rábová, Marie; Lieckfeldt, D.; Ludwig, A.; Rodina, M.; Gela, D.; Pšenička, M.; Bytyutskyy, D.; Flajšhans, M.

    2014-01-01

    Roč. 15, č. 5 (2014) ISSN 1471-2156 Grant - others:GA MŠk(CZ) EE2.3.30.0049; GA MŠk(CZ) ED2.1.00/01.0024; GA ČR(CZ) GA523/08/0824 Program:GA Institutional support: RVO:67985904 Keywords : Acipenseridae * polyploidy determination * sperm quality Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2014

  19. Determination of insoluble avian eggshell matrix proteins

    Czech Academy of Sciences Publication Activity Database

    Mikšík, Ivan; Sedláková, Pavla; Lacinová, Kateřina; Pataridis, Statis; Eckhardt, Adam

    2010-01-01

    Roč. 397, č. 1 (2010), s. 205-214 ISSN 1618-2642 R&D Projects: GA MŠk(CZ) 1M0510; GA ČR(CZ) GA203/09/0675; GA ČR(CZ) GA203/08/1428 Institutional research plan: CEZ:AV0Z50110509 Keywords : eggshell proteins * insoluble proteins * matrix proteins Subject RIV: CE - Biochemistry Impact factor: 3.841, year: 2010

  20. Graphite structure and magnetic parameters of flake graphite cast iron

    Czech Academy of Sciences Publication Activity Database

    Vértesy, G.; Uchimoto, T.; Takagi, T.; Tomáš, Ivan; Kage, H.

    2017-01-01

    Roč. 442, Nov (2017), s. 397-402 ISSN 0304-8853 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:68378271 Keywords : magnetic NDE * magnetic adaptive testing * cast iron * graphite structure * pearlite content Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

  1. A viable mouse model for Netherton syndrome based on mosaic inactivation of the Spink5 gene

    Czech Academy of Sciences Publication Activity Database

    Kašpárek, Petr; Ileninová, Zuzana; Hanečková, Radka; Kanchev, Ivan; Jeníčková, Irena; Sedláček, Radislav

    2016-01-01

    Roč. 397, č. 12 (2016), s. 1287-1292 ISSN 1431-6730 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk(CZ) LQ1604; GA MŠk(CZ) LM2011032; GA MŠk(CZ) LO1509 Institutional support: RVO:68378050 Keywords : mosaicism * mouse model * netherton syndrome * skin * SPINK5 * TALEN Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.273, year: 2016

  2. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 66; Issue 6 ... 2.397 Å. SrS is found to have the lowest electron density at the mid-bond (0.003 e/Å3) at 2.118 Å from the origin leaving it more ionic than the other two sulphides studied in this work. ... Department of Physics, The Madura College, Madurai 625 011, India ...

  3. Turbulent Boundary Layers - Experiments, Theory and Modelling

    Science.gov (United States)

    1980-01-01

    anemometry, London, Academic Press, 1976. 7. H.R.E. van Maanen, K. van der Molen and J. Blom, "Reduction of ambiguity noise in laser-Doppler...Raumfahrttechnik Hochschule der Bundeswehr München 8014 Neubiberg — Germany Professor Dr J.L. Van Ingen Dept. of Aerospace Engineering Delft...proximity to a solid boundary. J.Fluid Mech.12, 388 - 397, 1962. (21) Van Thin N., Messungen mit einem Hitzdraht in einer turbulenten Strömung in der

  4. Characterization, molecular cloning and localization of calreticulin in Eisenia fetida earthworms

    Czech Academy of Sciences Publication Activity Database

    Šilerová, Marcela; Kauschke, E.; Kohlerová, Petra; Josková, Radka; Tučková, Ludmila; Bilej, Martin

    2007-01-01

    Roč. 397, - (2007), s. 169-177 ISSN 0378-1119 R&D Projects: GA ČR GD310/03/H147; GA AV ČR IAA5020208; GA MŠk 2B06155 Institutional research plan: CEZ:AV0Z50200510 Keywords : earthworms * annelids * invertebrates Subject RIV: EE - Microbiology, Virology Impact factor: 2.871, year: 2007

  5. A simple rank-based Markov chain with self-organized criticality

    Czech Academy of Sciences Publication Activity Database

    Swart, Jan M.

    2017-01-01

    Roč. 23, č. 1 (2017), s. 87-102 ISSN 1024-2953 R&D Projects: GA ČR GAP201/12/2613; GA ČR(CZ) GA15-08819S Institutional support: RVO:67985556 Keywords : self-reinforcement * self-organized criticality * canyon Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.397, year: 2016 http://library.utia.cas.cz/separaty/2017/SI/swart-0476009.pdf

  6. A glimpse of the Quaternary monsoon history from India and adjoining seas

    Digital Repository Service at National Institute of Oceanography (India)

    Saraswat, R.; Nigam, R.; Correge, T.

    /plain; charset=UTF-8 1    Author version: Palaeogeogr. Palaeoclimatol. Palaeoecol., vol.397; 2014; 1-6 A glimpse of the Quaternary monsoon history from India and adjoining seas Rajeev Saraswat1, Rajiv Nigam1, Thierry Correge2 1 National... and radionuclide (210Pb) analyses to understand past environmental changes from the sediment cores collected from mudflat regions of central west coast of India. A significant shift in sediment characteristics is observed post 1980, probably in response...

  7. In situ microdialysis of intramuscular prostaglandin and thromboxane in contracting skeletal muscle in humans

    DEFF Research Database (Denmark)

    Karamouzis, M; Langberg, Henning; Skovgaard, D

    2001-01-01

    , perfusion rate: 3 microL min-1). Relative recovery always rose with transition from rest to exercise (82 +/- 8% (A) and 75 +/- 7% (B), respectively) and returned to basal values during postexercise. Interstitial PGE2 concentrations rose 4-fold with dynamic exercise (0.95 +/- 0.26 ng mL-1 (rest) to 3.......97 +/- 0.75 (exercise), P alpha) concentration did not change with intermittent static exercise. The present study demonstrates measurable...

  8. Alpha (alpha-) and beta (beta-carboranyl-C-deoxyribosides: Syntheses, structures and biological evaluation

    Czech Academy of Sciences Publication Activity Database

    Šnajdr, I.; Janoušek, Zbyněk; Takagaki, M.; Císařová, I.; Hosmane, N. S.; Kotora, Martin

    2014-01-01

    Roč. 83, Aug 18 (2014), s. 389-397 ISSN 0223-5234 R&D Projects: GA MŠk 1M0508 Grant - others:GA MŠk(CZ) LC06070; GA ČR(CZ) GA13-15915S Program:LC Institutional support: RVO:61388963 Keywords : alkynes * carboranes * boron neutron capture therapy * antitumor agents * drug research Subject RIV: CC - Organic Chemistry Impact factor: 3.447, year: 2014

  9. Geochemical discrimination of metasedimentary sequences in the Krkonoše-Jizera Terrane (West Sudetes, Bohemian Massif): paleotectonic and stratigraphic constraints

    Czech Academy of Sciences Publication Activity Database

    Winchester, J. A.; Patočka, František; Kachlík, V.; Melzer, M.; Nawakowski, C.; Crowley, Q. G.; Floyd, P. A.

    2003-01-01

    Roč. 54, č. 5 (2003), s. 267-280 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Grant - others:CZ-XE(XE) PACE TMR Network ERBFMRXCT97-0136 Institutional research plan: CEZ:AV0Z3013912 Keywords : geochemistry * metasediments * tectonic setting Subject RIV: DD - Geochemistry Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  10. 78 FR 6334 - Housing Choice Voucher Program; Office of Public and Indian Housing Announcement of Funding...

    Science.gov (United States)

    2013-01-30

    ..., SHEFFIELD, AL 35660.. 16 $41,247 AL: HA OF TUSCALOOSA 2117 JACK WARNER PKWY, 125 532,966 TUSCALOOSA, AL... for HOPE VI CO: HA OF CITY AND CO OF DENVER 777 GRANT ST, DENVER, CO 80203... 54 369,647 MA: BOSTON HA 52 CHAUNCY ST, BOSTON, MA 02111.. 51 655,397 MA: TAUNTON HA 30 OLNEY ST, STE B, TAUNTON, MA 165 1,599...

  11. Charge exchange signatures in x-ray line emission accompanying plasma-wall interaction

    Czech Academy of Sciences Publication Activity Database

    Renner, Oldřich; Dalimier, E.; Liska, R.; Oks, E.; Šmíd, Michal

    2012-01-01

    Roč. 397, č. 1 (2012), s. 1-6 ISSN 1742-6588 R&D Projects: GA ČR GAP205/10/0814; GA ČR GAP208/10/2302; GA AV ČR IAAX00100903 Institutional research plan: CEZ:AV0Z10100523 Keywords : laser-produced plasma * particle jets generation * plasma-wall interaction * x-ray spectroscopy * charge exchange Subject RIV: BL - Plasma and Gas Discharge Physics

  12. Universal Dimensions of Meaning Derived from Semantic Relations among Words and Senses: Mereological Completeness vs. Ontological Generality (Open Access, Publisher’s Version)

    Science.gov (United States)

    2014-07-15

    Octopus 3.99 Reptilia −2.82 linolenic_acid 3.97 Dilleniidae −2.82 horseshoe_crab 3.94 Asteridae −2.78 Asian_horseshoe_crab 3.88 Eutheria −2.71...corresponds to a movement toward a definite meaning (e.g., more positive, or more exciting, or more abstract), but pairs of unrelated concepts can be found

  13. Generations in Analysis of Costumer Behaviors: A Study On Social Media Using

    OpenAIRE

    Sarıtaş, Emel; Barutçu, Süleyman

    2016-01-01

    In this study, generation concept is analyzed and social media was investigated by level of use varies according to generation in terms of marketing management and consumer behavior. The face to face survey conducted on 397 people from different generation. According to results; X-Y-Z generation that important tool grouping customer behavior, don’t show great difference for the purpose of social media, especially disappear difference “start communication, share the content, entertainment”. Ho...

  14. Dislocation glide velocity in creep of Mg alloys derived from dip tests

    Czech Academy of Sciences Publication Activity Database

    Eisenlohr, P.; Blum, W.; Milička, Karel

    510-511, Sp. Iss. (2009), s. 393-397 ISSN 0921-5093. [Creep 2008. Bayreuth, 04.05.2008-09.05.2008] R&D Projects: GA ČR GA106/06/1354 Institutional research plan: CEZ:AV0Z20410507 Keywords : Dislocation glide velocity * Temperature dependence * Solute drag * Forest cutting * Prismatic glide Subject RIV: JG - Metallurgy Impact factor: 1.901, year: 2009

  15. Edueufooriast tekkinud eelarvekriis / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2008-01-01

    Kui 1997. a. pandi riigieelarvesse 39,7% SKT-st, siis 2005. a. 35,7%. Neljaprotsendine ühisraha osatähtsuse langus tähendab 2009. aastal, et valitsussektori käsutuses on 12 mld. krooni vähem kui olnuks 1997. a. osalusmäära korral. Autori sõnul on inimareng õhukese riigi poliitikaga lepitamatus vastuolus kogu maailmas

  16. Operator ordering and causality

    OpenAIRE

    Plimak, L. I.; Stenholm, S. T.

    2011-01-01

    It is shown that causality violations [M. de Haan, Physica 132A, 375, 397 (1985)], emerging when the conventional definition of the time-normal operator ordering [P.L.Kelley and W.H.Kleiner, Phys.Rev. 136, A316 (1964)] is taken outside the rotating wave approximation, disappear when the amended definition [L.P. and S.S., Annals of Physics, 323, 1989 (2008)] of this ordering is used.

  17. Heritability and whole genome linkage of pulse pressure in Chinese twin pairs

    DEFF Research Database (Denmark)

    Jiang, Wengjie; Zhang, Dongfeng; Pang, Zengchang

    2012-01-01

    with a heritability estimate of 0.45. Genome-wide non-parametric linkage analysis identified three significant linkage peaks on chromosome 11 (lod score 4.06 at 30.5 cM), chromosome 12 (lod score 3.97 at 100.7 cM), and chromosome 18 (lod score 4.01 at 70.7 cM) with the last two peaks closely overlapping with linkage...

  18. Coexisting Miocene Alkaline Volcanic Series Associated with the Cheb-Domažlice Graben (W Bohemia): Geochemical Characteristics

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Štěpánková, Jana; Lloyd, F. E.; Balogh, K.

    2003-01-01

    Roč. 54, č. 1 (2003), s. 53-64 ISSN 1335-0552 R&D Projects: GA ČR GA205/99/0907 Grant - others:Hungarian Academy of Sciences Foundation(HU) T 014961 Institutional research plan: CEZ:AV0Z3013912 Keywords : W Bohemia * Miocene volkanism * geochemistry Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  19. Nikkaji Dictionary: α−ノルテストステロン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term α−ノルテストステロン 名詞 一般 * * * * α-ノルテストステロン ... Nikkaji J397.312C 200906035667295941 C CA06 UNKNOWN_2 α − ノルテストステロン

  20. Sexual Orientation and Harassment: The Role of Sexism in Predicting Reactions to Harassment

    Science.gov (United States)

    2017-06-07

    sexual harassment in 2012 (Defense Manpower Data Center, 2012). More recently , the 2014 RAND Military Workplace Study found that approximately...Journal of Women’s Studies , 8, 388-397. Campbell, R. (2008). The psychological impact of rape victims’ experiences with the legal, medical, and...and alcohol related outcomes: The mediating role of psychological distress. Journal of Studies on Alcohol and Drugs, 63, 412-419. Rosen, L. N

  1. The power of negative thinking: corruption, perception and willingness to bribe in Ukraine

    Czech Academy of Sciences Publication Activity Database

    Čábelková, I.; Hanousek, Jan

    2004-01-01

    Roč. 36, č. 4 (2004), s. 383-397 ISSN 0003-6846 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : corruption, perception and willingness to bribe * Ukraine Subject RIV: AH - Economics Impact factor: 0.211, year: 2004 http://search.ebscohost.com/login.aspx?direct=true&db=bth&AN=12453997&site=ehost-live

  2. A new entodiniomorphid ciliate, Troglocorys cava n. g., n. sp., from the wild eastern chimpanzee (Pan troglodytes schweinfurthii) from Uganda

    Czech Academy of Sciences Publication Activity Database

    Tokiwa, T.; Modrý, David; Ito, A.; Pomajbíková, K.; Petrželková, Klára Judita; Imai, S.

    2010-01-01

    Roč. 57, č. 2 (2010), s. 115-120 ISSN 1066-5234 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Infraciliature * Kalinzu Forest * protozoa * scanning electron microscopy Subject RIV: EG - Zoology Impact factor: 2.397, year: 2010

  3. On mean reward variance in semi-Markov processes

    Czech Academy of Sciences Publication Activity Database

    Sladký, Karel

    2005-01-01

    Roč. 62, č. 3 (2005), s. 387-397 ISSN 1432-2994 R&D Projects: GA ČR(CZ) GA402/05/0115; GA ČR(CZ) GA402/04/1294 Institutional research plan: CEZ:AV0Z10750506 Keywords : Markov and semi-Markov processes with rewards * variance of cumulative reward * asymptotic behaviour Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.259, year: 2005

  4. Multi-objective optimization of glycopeptide antibiotic production in batch and fed batch processes

    DEFF Research Database (Denmark)

    Maiti, Soumen K.; Eliasson Lantz, Anna; Bhushan, Mani

    2011-01-01

    batch operations using process model for Amycolatopsis balhimycina, a glycopeptide antibiotic producer. This resulted in a set of several pareto optimal solutions with the two objectives ranging from (0.75gl−1, 3.97g$-1) to (0.44gl−1, 5.19g$-1) for batch and from (1.5gl−1, 5.46g$-1) to (1.1gl−1, 6.34g...

  5. Career Decision-making of Women's Junior College Students and Career Guidance : An Examination of Self-growth Motivation and Career Decision-making Self-efficacy

    OpenAIRE

    泉水, 清志; Sensui, Kiyoshi

    2008-01-01

    The purpose of this study was to examine effects of career decision-making by measuring self-growth motivation and career decision-making self-efficacy of women's junior college students, and to examine career guidance in junior college. A questionnaire was administered to 397, including 286 qualification major and 111 general education major, with women's junior college students. Results showed that self-growth motivation was higher with second-year and general education major students, that...

  6. Dal “criminal profiling” all’autopsia psicologica della vittima

    OpenAIRE

    Laura Volpini

    2012-01-01

    Investigative psychology as a field of research, study and application of forensic psychology has come into being in our country in the last fifteen years. In particular, act 397 on defensive investigations in 2000, has, at the stage of preliminary investigation, expanded the possibilities for action and cooperation with the judicial authorities and with the defense. It is therefore necessary to test and spread tools and techniques to improve investigative strategies as well as techniques to ...

  7. The posterior medial cortex is involved in visual but not in verbal memory encoding processing: an intracerebral recording study

    Czech Academy of Sciences Publication Activity Database

    Štillová, K.; Jurák, Pavel; Chládek, Jan; Halámek, Josef; Telecká, S.; Rektor, I.

    2013-01-01

    Roč. 120, č. 3 (2013), s. 391-397 ISSN 0300-9564 R&D Projects: GA ČR GAP103/11/0933; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : Event-related potential (ERP) * Memory * Posterior medial cortex (PMC) – SEEG Subject RIV: BD - Theory of Information Impact factor: 2.871, year: 2013

  8. Youth behaviour about digital piracy: Research with public high school students

    OpenAIRE

    Grohmann, Márcia Zampieri; Rosa, Ana Claudia da; Nunes, Jankel Dal’osto; Piveta, Maíra Nunes

    2014-01-01

    This paper aims to identify the profile of younger who download more software pirates; understand young people's behavior in relation to digital piracy; verify if this profile impact in young justice perception and attitude toward digital piracy . The research is characterized by quantitative and descriptive, using Suki, Suki and Ramayah (2011) model in a 397 student sample. The results showed that: the using of software pirates is more high among men and who made less use of software pirates...

  9. Effect of the particle size and surface area of tungstated zirconia on the WOx nuclearity and n-heptane isomerization over Pt/WO3–ZrO2

    Czech Academy of Sciences Publication Activity Database

    Kaucký, Dalibor; Wichterlová, Blanka; Dědeček, Jiří; Sobalík, Zdeněk; Jakubec, Ivo

    2011-01-01

    Roč. 397, 1-2 (2011), s. 82-93 ISSN 0926-860X R&D Projects: GA AV ČR KAN100400702 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z40400503 Keywords : n-heptane isomeration * Pt/WO3-ZrO2 * nano ZrO2 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.903, year: 2011

  10. An Update on Analyzing Differences Between Public and Private Sector Information Resource Management: Strategic Information Challenges and Critical Technologies

    Science.gov (United States)

    2004-06-01

    ecommerce architecture is the business—it is the company’s competitive advantage. (Morgan, 1998:40) Morgan goes on to illustrate this point by...396 JONES APPAREL GROUP INC 896 NATIONAL RURAL UTILITIES COOPERATIVE 397 COX COMMUNICATIONS INC 897 TRANS WORLD ENTERTAINMENT 398 MELLON FINANCIAL...It Can Work in the Public Sector,” MIS Quarterly, Dec:435-448, 1990. Morgan, T.P. “ Ecommerce Options,” Global Technology Business, Sept:40-42

  11. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    We have made observations of the associated HI absorption of a high redshift radio galaxy 0902+34 at = 3.395 with the Giant Meterwave Radio Telescope in the 323+1 MHz band. We find a narrow absorption line with a flux density of 11.5 mJy at a redshift of 3.397 consistent with that observed by Uson et al. (1991) ...

  12. Seasonal and spatial dynamics of gas ebullition in a temperate water-storage reservoir

    Czech Academy of Sciences Publication Activity Database

    Tušer, Michal; Picek, T.; Sajdlová, Zuzana; Jůza, Tomáš; Muška, Milan; Frouzová, Jaroslava

    2017-01-01

    Roč. 53, č. 10 (2017), s. 8266-8276 ISSN 0043-1397 R&D Projects: GA ČR GAP504/12/1186; GA MŠk(CZ) LM2015075; GA MŠk(CZ) EF16_013/0001782 Institutional support: RVO:60077344 Keywords : ebullitive flux * hydroacoustics * methane * river impoundment * season Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Marine biology, freshwater biology, limnology Impact factor: 4.397, year: 2016

  13. Evidence of long-term change in zonal wind in the tropical lower mesosphere: Observations and model simulations

    Czech Academy of Sciences Publication Activity Database

    Ratnam, M. V.; Kumar, G. K.; Rao, N. V.; Murthy, B. V. K.; Laštovička, Jan; Qian, L.

    2013-01-01

    Roč. 40, č. 2 (2013), s. 397-401 ISSN 0094-8276 R&D Projects: GA ČR GAP209/10/1792 Institutional support: RVO:68378289 Keywords : mesosphere * zonal wind * long-term trends * TIME-GCM * climate change Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 4.456, year: 2013 http://onlinelibrary.wiley.com/doi/10.1002/grl.50158/abstract

  14. Production, purification and oxidative folding of the mouse recombinant prion protein

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, A.; Bednárová, Lucie; Holada, K.

    2007-01-01

    Roč. 52, č. 4 (2007), s. 391-397 ISSN 0015-5632 R&D Projects: GA ČR GD310/05/H533 Grant - others:GA ČR(CZ) GA310/04/0419 Institutional research plan: CEZ:AV0Z40550506 Keywords : recombinant prion protein * production * purification * folding Subject RIV: CE - Biochemistry Impact factor: 0.989, year: 2007 http://www.biomed.cas.cz/mbu/folia/

  15. Öğretmenlerin İş Doyum Düzeylerinin İncelenmesi An Investigation about Job Satisfaction of Teachers

    OpenAIRE

    KUMAŞ, Volkan; DENİZ, Levent

    2013-01-01

    The main purpose of the research is to find out job satisfaction levels of teachers and to investigate the differences on the job satisfaction levels of teachers in relation to their sexes, ages, working years, school types, education levels, subject fields and willingness of choosing their profession. In this research Minnesota Job Satisfaction Questionnaire, 20 items likert type scale, was used. The data collected from the 397 teachers, who work in 36 high schools in province of Zeytinburnu...

  16. Chromosomes in the flow to simplify genome analysis

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jaroslav; Vrána, Jan; Šafář, Jan; Bartoš, Jan; Kubaláková, Marie; Šimková, Hana

    2012-01-01

    Roč. 12, č. 3 (2012), s. 397-416 ISSN 1438-793X R&D Projects: GA ČR GAP501/10/1740; GA ČR GAP501/10/1778 Institutional research plan: CEZ:AV0Z50380511 Keywords : Chromosome sorting * Chromosome-specific BAC libraries * Chromosome sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.292, year: 2012

  17. A vision of uses and gratifications applied to the study of Internet use by adolescents

    OpenAIRE

    García-Jiménez, A. (Antonio); López-Ayala-López, M.C. (María Cruz); Gaona-Pisionero, C. (Carmen)

    2012-01-01

    Based on uses and gratifications theory, the aim of this paper is to identify the reasons for using Internet among teenagers and to check different variables in order to predict types of uses. After conducting a representative survey applied to 397 high school students in Community of Madrid (Spain), Internet users’ gratifications and their relationships with variables related to adolescent characteristics, family context and time of online exposure are analyzed. The article concludes that da...

  18. Examining Wetland Frequency Discrepancies Produced by Data Collected at Wetland Boundaries and across the Landscape: Using Tsuga canadensis (L.) Carr. (Eastern Hemlock) as a Case Study

    Science.gov (United States)

    2017-08-01

    Continental Canada. The Bryologist 98:218–227. Wiens, J. A. 1989. Spatial Scaling in Ecology . Functional Ecology 3:385–397. REPORT DOCUMENTATION...EPA U.S. Environmental Protection Agency FAC Facultative FACU Facultative Upland FACW Facultative Wetland FWS U.S. Fish and Wildlife Service...National and Regional Panel members from four cooperat- ing federal agencies: the Corps, the U.S. Environmental Protection Agency (EPA), the U.S. Fish and

  19. PCR/LDR/capillary electrophoresis for detection of single-nucleotide differences between fetal and maternal DNA in maternal plasma.

    Science.gov (United States)

    Yi, Ping; Chen, Zhuqin; Zhao, Yan; Guo, Jianxin; Fu, Huabin; Zhou, Yuanguo; Yu, Lili; Li, Li

    2009-03-01

    The discovery of fetal DNA in maternal plasma has opened up an approach for noninvasive diagnosis. We have now assessed the possibility of detecting single-nucleotide differences between fetal and maternal DNA in maternal plasma by polymerase chain reaction (PCR)/ligase detection reaction((LDR)/capillary electrophoresis. PCR/LDR/capillary electrophoresis was applied to detect the genotype of c.454-397T>gene (ESR1) from experimental DNA models of maternal plasma at different sensitivity levels and 13 maternal plasma samples.alphaC in estrogen receptor. (1) Our results demonstrated that the technique could discriminate low abundance single-nucleotide mutation with a mutant/normal allele ratio up to 1:10 000. (2) Examination of ESR1 c.454-397T>C genotypes by using the method of restriction fragment length analysis was performed in 25 pregnant women, of whom 13 pregnant women had homozygous genotypes. The c.454-397T>C genotypes of paternally inherited fetal DNA in maternal plasma of these 13 women were detected by PCR/LDR/capillary electrophoresis, which were accordant with the results of umbilical cord blood. PCR/LDR/capillary electrophoresis has very high sensitivity to distinguish low abundance single nucleotide differences and can discriminate point mutations and single-nucleotide polymorphisms(SNPs) of paternally inherited fetal DNA in maternal plasma.

  20. The age and emplacement of obducted oceanic crust in the Urals from Sm-Nd and Rb-Sr systematics

    International Nuclear Information System (INIS)

    Edwards, R.L.; Wasserburg, G.J.

    1985-01-01

    The Urals contain a 2000 km belt of mafic-ultramafic bodies. The Sm-Nd and Rb-Sr systematics of two of these bodies, the Kempersai Massif in the South Ural Mountains and the Voykar-Syninsky Ophiolite Complex in the Polar Ural Mountains have been examined. These data confirm the hypothesis that these bodies represent fragments of pre-collision oceanic crust and establish constraints on the nature and timing of events in the Uralian Orogeny. Two Kempersai gabbros define Sm-Nd internal isochrons of 397 +- 20 My and 396 +- 33 My with epsilonsub(Nd)(T) = +8.7 -+ 0.6 and +8.4 -+ 1.3, respectively. Whole rock samples of pillow basalt, diabase, gabbros, troctolite, and a metasediment give Sm-Nd values which lie on this isochron indicating that these rocks are genetically related and have an igneous crystallization age of 397 My. Whole rock samples of Voykar-Syninsky diabase, gabbros, and clinopyroxenite give Sm-Nd values which lie on or within proportional 1 epsilon-unit of this isochron indicating an age and epsilonsub(Nd)(T) virtually identical to those of Kempersai. epsilonsub(Nd)(T) for the Kempersai and Voykar-Syninsky mafic samples range from +7.3 to +9.0 with an average value of +8.4. This indicates that the Urals ophiolites are derived from an ancient depleted mantle source and are most plausibly pieces of the oceanic crust and lithosphere. The fact that a metasediment has the same epsilonsub(Nd)(397 My) as the other samples indicates derivation from an oceanic source with negligible continental input. epsilonsub(Nd)(T) for the massifs is proportional 1.5 epsilon-units lower than the average for modern MORBs. (orig./HSI)

  1. Feasibility and safety of a novel in vivo model to assess playground falls in children.

    Science.gov (United States)

    Ehrlich, Peter F; Young, Justin G; Ulin, Sheryl; Wooley, Charles; Armstrong, Thomas J; Buschmann, Bethany; Galecki, Andrzej; Ashton-Miller, James A

    2013-07-01

    Falls are the leading cause of nonfatal unintentional injuries among hospitalized children with playground equipment accounting for more than 50%. National standards for playground rung and rail design exist, but there a lack of in vivo models available to test these standards. We developed a novel in vivo model to test rung and rail design. We report the feasibility and safety of the model. A device was built to simulate children hanging onto a playground bar until their hand slips off. This was defined as breakaway strength. The handle unit was mounted on a vertical cable that was mechanically raised and lowered using a linear actuator controlled by the experimenter. The unit was padded and contained a video camera that recorded the posture of the hand during each trial. Breakaway force and torque were recorded as they held onto the handle by LabView software. In addition, standard anthropometrics and grip strength were recorded. Biomedical engineering approved the device. There were 425 eligible students aged 5 years to 11 years. Of these, 93% (397) participated (212 males and 185 females). Ninety-nine percent (396 of 397) completed all three experimental stations, one declined because of fear. There were no injuries and no falls. Average time to complete the study was 22 ± 0.5 minutes. Ninety-one percent of participants were right handed; the ethnicity was representative of the local area with 79% being white. Mean ± SD height, weight, and body mass index for the 397 participants were 1.28 ± 0.11 m, 28.0 ± 8.12 kg, and 16.31 ± 2.59 kg/m², respectively. Hand size, grip strength, and maximum breakaway force increased with age. This model is safe and feasible and maybe a viable method to assess rung and rail design for playgrounds.

  2. Rubella natural immunity among adolescent girls in Tanzania: the need to vaccinate child bearing aged women.

    Science.gov (United States)

    Mirambo, Mariam M; Majigo, Mtebe; Scana, Seth D; Mushi, Martha F; Aboud, Said; Groß, Uwe; Kidenya, Benson R; Mshana, Stephen E

    2018-01-03

    Rubella primary infection during early stages of pregnancy is associated with high risk of congenital Rubella syndrome (CRS). Prevention of CRS in the resource-limited countries requires multiple strategies. Here, we document the data on the magnitude of Rubella natural immunity among adolescent girls which is a crucial group in devising effective control strategies to prevent CRS. A cross sectional study involving 397 adolescent girls was conducted in the city of Mwanza involving five secondary schools. Socio-demographic and other relevant information were collected using pre-tested data collection tool. Rubella IgG antibodies were determined using enzyme immunoassay. The presence of Rubella IgG titers of >10 IU/ml indicated natural immunity. The mean age of the study participants was 15.18 ± 1.48 years. Of 397 girls, 340 (85.6%) and 57 (14.4%) were from secondary schools representing peri-urban and rural areas, respectively. Out of 397 girls, 90.4% (95% CI: 87-93) were found to be naturally immune with median Rubella IgG antibodies titers of 56.7 IU/ml interquartile range (IQR): 40.8-137. The median Rubella IgG antibodies titers were significantly high in adolescent girls from families with high socio-economic status (63.96 vs. 47.13 IU/ml, P girls from peri-urban areas of the city (63.33 vs. 39.9 IU/ml, P girls in the city of Mwanza are naturally immune to Rubella virus. There is a need to compare the effectiveness of screening and vaccinating susceptible adolescent girls with the effectiveness of vaccinating all women of childbearing in controlling CRS in low-income countries.

  3. Hydrogeologic characteristics and water quality of a confined sand unit in the surficial aquifer system, Hunter Army Airfield, Chatham County, Georgia

    Science.gov (United States)

    Gonthier, Gerard

    2012-01-01

    An 80-foot-deep well (36Q397, U.S. Geological Survey site identification 320146081073701) was constructed at Hunter Army Airfield to assess the potential of using the surficial aquifer system as a water source to irrigate a ballfield complex. A 300-foot-deep test hole was drilled beneath the ballfield complex to characterize the lithology and water-bearing characteristics of sediments above the Upper Floridan aquifer. The test hole was then completed as well 36Q397 open to a 19-foot-thick shallow, confined sand unit contained within the surficial aquifer system. A single-well, 24-hour aquifer test was performed by pumping well 36Q397 at a rate of 50 gallons per minute during July 13-14, 2011, to characterize the hydrologic properties of the shallow, confined sand unit. Two pumping events prior to the aquifer test affected water levels. Drawdown during all three pumping events and residual drawdown during recovery periods were simulated using the Theis formula on multiple changes in discharge rate. Simulated drawdown and residual drawdown match well with measured drawdown and residual drawdown using values of horizontal hydraulic conductivity and specific storage, which are typical for a confined sand aquifer. Based on the hydrologic parameters used to match simulated drawdown and residual drawdown to measured drawdown and residual drawdown, the transmissivity of the sand was determined to be about 400 feet squared per day. The horizontal hydraulic conductivity of the sand was determined to be about 20 feet per day. Analysis of a water-quality sample indicated that the water is suitable for irrigation. Sample analysis indicated a calcium-carbonate type water having a total dissolved solids concentration of 39 milligrams per liter. Specific conductance and concentrations of all analyzed constituents were below those that would be a concern for irrigation, and were below primary and secondary water-quality criteria levels.

  4. Genotype distribution of estrogen receptor-alpha, catechol-O-methyltransferase, and cytochrome P450 17 gene polymorphisms in Caucasian women with uterine leiomyomas.

    Science.gov (United States)

    Denschlag, Dominik; Bentz, Eva-Katrin; Hefler, Lukas; Pietrowski, Detlef; Zeillinger, Robert; Tempfer, Clemens; Tong, Dan

    2006-02-01

    To evaluate the association between the presence of uterine leiomyomas and three functional single nucleotide polymorphisms (SNPs) of the estrogen receptor alpha (ESR1), catechol-O-methyltransferase (COMT), and cytochrom P450 17 (CYP17A) genes, which have been described to modify the estrogen metabolism. Prospective case control study. Academic research institution. One hundred thirty women with clinically and surgically diagnosed uterine leiomyomas and 139 population controls. Peripheral venous puncture. Polymerase chain reaction and pyrosequencing were performed to genotype women with respect to the ESR1 IVS1-397 T/C (PvuII), COMT G158A, and the CYP17A 34T-->C SNPs. Comparing women with uterine leiomyomas and controls, no statistically significant differences with respect to allele frequency and genotype distribution were ascertained for ESR1 IVS 1-397 T/C (PvuII) (P=0.9 and P=0.6, respectively), COMT G158A (P=0.3 and P=0.6, respectively), and CYP17A 34T-->C (P=0.1 and P=0.5, respectively). When all two-way interactions of investigated SNPs were ascertained, no significant interactions were observed. In a multivariate model, no SNP was significantly associated with leiomyomas. Carriage of the ESR1 IVS1-397 T/C (PvuII), COMT G158A, and the CYP17A 34T-->C SNPs is not associated with the susceptibility to uterine leiomyoma in a Caucasian population.

  5. INCREASES IN CORE TEMPERATURE COUNTERBALANCE EFFECTS OF HEMOCONCENTRATION ON BLOOD VISCOSITY DURING PROLONGED EXERCISE IN THE HEAT

    Science.gov (United States)

    Buono, Michael J.; Krippes, Taylor; Kolkhorst, Fred W.; Williams, Alexander T.; Cabrales, Pedro

    2015-01-01

    Previous studies have reported that blood viscosity is significantly increased following exercise. However, these studies measured both pre- and post-exercise blood viscosity at 37 °C even though core and blood temperatures would be expected to have increased during the exercise. Consequently, the effect of exercise-induced hyperthermia on mitigating change in blood viscosity may have been missed. The purpose of this study was to isolate the effects of exercise-induced hemoconcentration and hyperthermia, as well as determine their combined effects, on blood viscosity. Nine subjects performed 2 h of moderate-intensity exercise in the heat (37 °C, 40% rH), which resulted in significant increases from pre-exercise values for rectal temperature (37.11 ± 0.35 °C to 38.76 ± 0.13 °C), hemoconcentration (hematocrit = 43.6 ± 3.6% to 45.6 ± 3.5%), and dehydration (Δbody weight = −3.6 ± 0.7%). Exercise-induced hemoconcentration significantly (P viscosity by 9% (3.97 to 4.30 cP at 300 s−1) while exercise-induced hyperthermia significantly decreased blood viscosity by 7% (3.97 to 3.70 cP at 300 s−1). However, when both factors were considered together, there was no overall change in blood viscosity (3.97 to 4.03 cP at 300 s−1). The effects of exercise-induced hemoconcentration, increased plasma viscosity, and increased red blood cell aggregation, all of which increased blood viscosity, were counterbalanced by increased RBC deformability (e.g., RBC membrane shear elastic modulus and elongation index) caused by the hyperthermia. Thus, blood viscosity remained unchanged following prolonged moderate-intensity exercise in the heat. PMID:26682653

  6. Inhibition of Focal Adhesion Kinase Signaling by Integrin α6β1 Supports Human Pluripotent Stem Cell Self-Renewal.

    Science.gov (United States)

    Villa-Diaz, Luis G; Kim, Jin Koo; Laperle, Alex; Palecek, Sean P; Krebsbach, Paul H

    2016-07-01

    Self-renewal of human embryonic stem cells and human induced pluripotent stem cells (hiPSCs)-known as pluripotent stem cells (PSC)-is influenced by culture conditions, including the substrate on which they are grown. However, details of the molecular mechanisms interconnecting the substrate and self-renewal of these cells remain unclear. We describe a signaling pathway in hPSCs linking self-renewal and expression of pluripotency transcription factors to integrin α6β1 and inactivation of focal adhesion kinase (FAK). Disruption of this pathway results in hPSC differentiation. In hPSCs, α6β1 is the dominant integrin and FAK is not phosphorylated at Y397, and thus, it is inactive. During differentiation, integrin α6 levels diminish and Y397 FAK is phosphorylated and activated. During reprogramming of fibroblasts into iPSCs, integrin α6 is upregulated and FAK is inactivated. Knockdown of integrin α6 and activation of β1 integrin lead to FAK phosphorylation and reduction of Nanog, Oct4, and Sox2, suggesting that integrin α6 functions in inactivation of integrin β1 and FAK signaling and prevention of hPSC differentiation. The N-terminal domain of FAK, where Y397 is localized, is in the nuclei of hPSCs interacting with Oct4 and Sox2, and this immunolocalization is regulated by Oct4. hPSCs remodel the extracellular microenvironment and deposit laminin α5, the primary ligand of integrin α6β1. Knockdown of laminin α5 resulted in reduction of integrin α6 expression, phosphorylation of FAK and decreased Oct4. In conclusion, hPSCs promote the expression of integrin α6β1, and nuclear localization and inactivation of FAK to supports stem cell self-renewal. Stem Cells 2016;34:1753-1764. © 2016 AlphaMed Press.

  7. The Effect of Roundtable and Clustering Teaching Techniques and Students’ Personal Traits on Students’ Achievement in Descriptive Writing

    Directory of Open Access Journals (Sweden)

    Megawati Sinaga

    2017-12-01

    Full Text Available The Objectives of this paper as an experimental research was to investigate the effect of Roundtable and Clustering teaching techniques and students’ personal traits on students’ achievement in descriptive writing. The students in grade ix of SMP Negeri 2 Pancurbatu 2016/2017 school academic year were chose as the population of this research.. The research design was experimental research by using factorial design 2x2. The students were divided into two experimental groups. The experimental group was treated by using Roundtable teaching technique and control group was treated by using Clustering teaching technique. The students are classified into the introvert and extrovert personal traits by conducting the questionnaire and the students’ achievement in descriptive writing was measured by using writing test, namely ‘Analytic Scoring’ by Weigle. The data were analyzed by applying two-way analysis of variance (ANOVA at the level of significance α = 0.05. The result reveals that (1 students’ achievement in descriptive writing taught by using  Roundtable teaching technique was higher than that taught by Clustering teaching technique, with Fobs = 4.59>Ftab=3.97, (2 students’ achievement in descriptive writing with introvert  personal trait was higher than that with extrovert personal traits with Fobs=4.90 Ftable=3.97, (3 there is interaction between teaching techniques and personal traits on students’ achievement in descriptive writing with Fobs =6,58 Ftable=3.97. After computing the Tuckey-Test, the result showed that introvert students got higher achievement if they were taught by using Roundtable teaching technique while extrovert students got higher achievement if they were taught by using Clustering teaching technique.

  8. Comparison of Soxhlet and Shake Extraction of Polycyclic Aromatic Hydrocarbons from Coal Tar Polluted Soils Sampled in the Field

    DEFF Research Database (Denmark)

    Lindhardt, Bo; Holst, Helle; Christensen, Thomas Højlund

    1994-01-01

    This study compares three extraction methods for PAHs in coal tar polluted soil: 3-times repeated shaking of the soil with dichloromethane-methanol (1:1), Soxhlet extraction with dichloromethane, and Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol....... The extraction efficiencies were determined for ten selected PAHs in triplicate samples of six soils sampled at former gasworks sites. The samples covered a wide range of PAH concentrations, from 0.6 to 397 mg/kg soil. Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol...

  9. Induced Proton Polarization for pi0 Electroproduction at Q2 = 0.126 GeV2/c2 Around the Delta(1232) Resonance

    International Nuclear Information System (INIS)

    Glen Warren; Ricardo Alarcon; Christopher Armstrong; Burin Asavapibhop; David Barkhuff; William Bertozzi; Volker Burkert; Chen, J.; Jian-Ping Chen; Joseph Comfort; Daniel Dale; George Dodson; Dolfini, S.; Dow, K.; Martin Epstein; Manouchehr Farkhondeh; John Finn; Shalev Gilad; Ralf Gothe; Xiaodong Jiang; Mark Jones; Kyungseon Joo; Karabarbounis, A.; James Kelly; Stanley Kowalski; Kunz, C.; Liu, D.; Lourie, R.W.; Richard Madey; Demetrius Margaziotis; Pete Markowitz; Justin McIntyre; Mertz, C.; Brian Milbrath; Rory Miskimen; Joseph Mitchell; Mukhopadhyay, S.; Costas Papanicolas; Charles Perdrisat; Vina Punjabi; Liming Qin; Paul Rutt; Adam Sarty; Jeffrey Shaw; Soong, S.B.; Tieger, D.; Christoph Tschalaer; William Turchinetz; Paul Ulmer; Scott Van Verst; Vellidis, C.; Lawrence Weinstein; Steven Williamson; Rhett Woo; Alaen Young

    1998-01-01

    We present a measurement of the induced proton polarization P n in π 0 electroproduction on the proton around the Δ resonance. The measurement was made at a central invariant mass and a squared four-momentum transfer of W = 1231 MeV and Q 2 = 0.126 GeV 2 /c 2 , respectively. We measured a large induced polarization, P n = -0.397 ± 0.055 ± 0.009. The data suggest that the scalar background is larger than expected from a recent effective Hamiltonian model

  10. Slovenske elektrarne has fulfilled the plan of electric power production at 101 %

    International Nuclear Information System (INIS)

    Anon

    2004-01-01

    Slovenske elektrarne, a. s., produced in 2003 year the electric power in capacity 26,047.6 GWh, whereby they fulfilled business plan at 101 %. In compare with the last year it is a reduction in production by 1,397.3 GWh. The biggest share of production - till 68.6 % of overall production of the Slovenske elektrarne, was provided by nuclear sources. Nuclear power plants fulfilled business plan at 104 %, when Jaslovske Bohunice NPP has produced 11,625 GWh and Mochovce NPP 6,238 GWh. The share of other power plants on the electricity production is presented

  11. COMPOSIÇÃO QUÍMICA E AVALIAÇÃO DA ATIVIDADE CARRAPATICIDA DO ÓLEO ESSENCIAL DE Cinnamomun zeylanicum NO CONTROLE DE Rhipicephalus microplus

    OpenAIRE

    ILDENICE NOGUEIRA MONTEIRO

    2013-01-01

    Os constituintes do óleo de Cinnamomum zeylanicum foram identificados por cromatografia gasosa acoplada à espectrometria de massas (CG-EM). Também foi avaliada a atividade deste óleo essencial contra larvas e fêmeas de Rhipicephalus microplus (carrapato bovino). O óleo das folhas mostrou um rendimento de 1,03% e seus principais constituintes foram Benzoato de Benzila (65,39%), Linalol (5,37%), E-Cinamaldeido (3,97%), α-Pineno (3,95%), β-Felandreno (3,42%), Eugenol (3,36%) e Benzalde...

  12. A multiwavelength study of superoutbursts in dwarf novae

    International Nuclear Information System (INIS)

    Woerd, H.J. van der.

    1987-01-01

    Dwarf novae are stellar systems consisting of two stars which orbit around each other within a few hours. In dwarf novae one of the stars, which is a bit smaller and less massive than our sun, loses matter to a very compact and degenerated star: a white dwarf. This white dwarf has nearly the same mass as our sun but its radius is about a hundred times smaller. The process of mass transport was studied on the basis of observations with the Exosat-satelite (European X-ray Observatory satelite). 397 refs.; 50 figs.; 21 tabs

  13. A comparison of DNA binding profiles of dinuclear platinum compounds with polyamine linkers and the trinuclear platinum phase II clinical agent BBR3464

    Czech Academy of Sciences Publication Activity Database

    McGregor, T. D.; Hegmans, A.; Kašpárková, Jana; Neplechová, Kamila; Nováková, Olga; Peňázová, Hana; Vrána, Oldřich; Brabec, Viktor; Farrel, N.

    2002-01-01

    Roč. 7, 4/5 (2002), s. 397-404 ISSN 0949-8257 R&D Projects: GA ČR GA305/99/0695; GA ČR GA301/00/0556; GA ČR GA301/98/P231; GA AV ČR IAA5004101; GA AV ČR IAA7004805 Institutional research plan: CEZ:AV0Z5004920 Keywords : unwinding * dinuclear platinum * hydrogen bonding Subject RIV: BO - Biophysics Impact factor: 3.911, year: 2002

  14. PENENTUAN KEUNTUNGAN MAKSIMUM PADA PENJUALAN OLAHAN TAPE DENGAN MENGGUNAKAN METODE LAGRANGE (Studi Kasus: UD. Sari Madu

    Directory of Open Access Journals (Sweden)

    FEMY AYU ASTITI

    2013-01-01

    Full Text Available Optimization problems can be solved by various methods, such as Lagrange Method.   This  method can be used to find the solution. Using Lagrange method, the extreme value can be obtained, so that the optimal solution can be found. In this research, the maximum revenue of UD. Sari Madu is a limited by several constraints. After the objective function and constraint function being model, than maximum revenue is found. From first until fourth quarterly, the maximum revenue is found Rp. 9.701.333, Rp. 10.064.148, 9.793.272 and Rp. 9.397.730 respectively.

  15. A construção literária dos germanos por Sinésio de Cirene: marcas de repulsa e integração em De Regno e De Providentia

    Directory of Open Access Journals (Sweden)

    José Petrúcio Farias Júnior

    2013-12-01

    Full Text Available Objetivamos discutir a partir de De Regno e De Providentia, escritas por Sinésio de Cirene (370 – 412/3, no momento de sua embaixada à Constantinopla (397/8 – 399/400, a construção da representação literária do outro (bárbaros, citas/germanos com a finalidade de compreender em que medida tal construção discursiva contribui para refletir sobre as marcas de integração dos germanos na sociedade romana oriental tardia.

  16. Bol d'Or success for all-women crew from CERN

    CERN Multimedia

    2001-01-01

    The boat 'Mic Mac' and its CERN's all-woman crew (left to right), Christine Theurillat, Ursula Haenger , Paola Catapano, Petra Riedler, and skipper Cristina Morone. Spectacular highlight of the Lake Leman sailing calendar is the annual Bol d'Or race. Held this year on 16 and 17 June, the event attracted nearly 500 teams who competed under extreme weather conditions for the honours. Among the competitors was an all-woman crew from the CERN Yachting Club, sailing their Surprise boat, Mic Mac. The team was not only among the 397 boats to finish, but also the first all-woman crewed single hull boat to cross the line.

  17. Orthorhombic BN: A novel superhard sp{sup 3} boron nitride allotrope

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhiguo [College of Physics, Beihua University, Jilin 132013 (China); Lu, Mingchun [Department of Aeronautical Engineering Professional Technology, Jilin Institute of Chemical Technology, Jilin 132102 (China); Zhu, Li; Zhu, Lili; Li, Yadan [College of Physics, Beihua University, Jilin 132013 (China); Zhang, Miao, E-mail: zhangmiaolmc@126.com [College of Physics, Beihua University, Jilin 132013 (China); College of Materials Science and Engineering, National Laboratory of Superhard Materials, Jilin University, Changchun 130012 (China); Li, Quan, E-mail: liquan777@jlu.edu.cn [College of Materials Science and Engineering, National Laboratory of Superhard Materials, Jilin University, Changchun 130012 (China)

    2014-02-07

    Here, a novel superhard orthorhombic allotrope of boron nitride (O-BN) with the space group of Pbam has been predicted using first-principles calculations. Our results revealed that O-BN simultaneously posses incompressible with a high bulk modulus of 397.38 GPa, and superhard properties with a high Vickers hardness of 65 GPa. Further phonon calculations show O-BN structure is dynamically stable. Moreover, it is thermodynamics energetically more preferable than previous proposed BN allotropes and a transparent insulator with an indirect band gap of about 4.85 eV. Our researches represent a significant step toward the exploration of superhard materials.

  18. Primal Interior-Point Method for Large Sparse Minimax Optimization

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    2009-01-01

    Roč. 45, č. 5 (2009), s. 841-864 ISSN 0023-5954 R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : unconstrained optimization * large-scale optimization * minimax optimization * nonsmooth optimization * interior-point methods * modified Newton methods * variable metric methods * computational experiments Subject RIV: BA - General Mathematics Impact factor: 0.445, year: 2009 http://dml.cz/handle/10338.dmlcz/140034

  19. Urban political ecologies of informal recyclers׳ health in Buenos Aires, Argentina.

    Science.gov (United States)

    Parizeau, Kate

    2015-05-01

    Buenos Aires׳ informal recyclers (cartoneros) confront multiple health hazards in their work. Based in a survey with (n=397) informal recyclers, this study establishes that these workers experience uneven health landscapes as evidenced through their health outcomes, the social determinants of their health, and their living and working environments. I argue that the analytical framework of urban political ecology can provide insights to the ways that the urban environments where cartoneros live and work are socially-constructed phenomena, drawing on concepts of crisis, metabolism, and multi-scalar analyses. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Perioperative ω-3 Polyunsaturated Fatty Acid Nutritional Support in Gastrointestinal Cancer Surgical Patients

    DEFF Research Database (Denmark)

    Ma, Ying-Jie; Liu, Lian; Xiao, Jing

    2016-01-01

    journals. Randomized controlled trials (RCTs) examining the effects of n-3 PUFA intake relative to conventional nutrition in surgical patients were included. The main outcomes were the duration of systemic inflammatory response syndrome (SIRS), length of hospital stay (LOS), serum C-reactive protein (CRP.......22), and serum CRP levels (MD, -3.97 mg/l; 95% CI, -7.88 to -0.07) compared with consumption of conventional nutrition, as well as reduced incidence of postoperative infectious complications (risk ratio, 0.66; 95% CI, 0.49-0.87). This systematic evaluation suggests that n-3 PUFA significantly reduces...

  1. Insurgency and Terrorism in the Philippines: A New Front in the War Against Islamist Extremists

    Science.gov (United States)

    2017-11-22

    Pacific Review 24, no. 4 (2011): 397-420. U.S. Office of the Chairman of the Joint Chiefs of Staff, Counterinsurgency, “Joint Publica- tion (JP) 3-24,” Washington, DC: CJCS, 22 November 2013. ...Highway, Suite 1204, Arlington, VA 22202-4302, and to the Office of Management and Budget, Paperwork Reduction Project (0704-0188) Washington, DC...City by Islamic insurgents demonstrates the growing financial resources, compelling narrative, and mili-tary capability of these rebel groups. Left

  2. Measurement of parton shower observables with OPAL

    Directory of Open Access Journals (Sweden)

    Fischer N.

    2016-01-01

    Full Text Available A study of QCD coherence is presented based on a sample of about 397,000 e+e- hadronic annihilation events collected at √s = 91 GeV with the OPAL detector at LEP. The study is based on four recently proposed observables that are sensitive to coherence effects in the perturbative regime. The measurement of these observables is presented, along with a comparison with the predictions of different parton shower models. The models include both conventional parton shower models and dipole antenna models. Different ordering variables are used to investigate their influence on the predictions.

  3. A study on women's junior college students' eating habits (Part 3) : The difference of eating habits in student living style

    OpenAIRE

    山岸, 恵美子; 牛越, 静子

    1992-01-01

    We examined the difference of eating habits in the life styles of 397 students of Nagano Prefectual Women’s Junior College.The results are as follows.(1) Talking of breakfast, commuting students eat at about 7 o’clock, but boarding and dormitory students including those who cook for themselves about 8.The rising time through breakfast time is 21 and 34 minutes respectively.Both students have lunch at noon, but boarding and dormitory students have supper at about six thirty, and students who c...

  4. Thermophysical properties of composite fuel based on T grade coal (Alardinskoe deposit) and timber industry wastes

    Science.gov (United States)

    Yankovsky, S. A.; Tolokolnikov, A. A.; Gubin, V. E.; Slyusarskiy, K. V.; Zenkov, A. V.

    2017-09-01

    Results of experimental studies of composite fuel thermal decomposition processes based on T grade coal (Alardinskoe deposit) and timber industry wastes (fine wood) are presented. C, H, N, S weight percentage of each component of composite fuel was determined experimentally. It has been established that with an increase in wood concentration up to 50% in composite fuel, its energy characteristics decrease by less than 3.6%, while the yield of fly ash is 39.7%. An effective composite fuel composition has been defined as 50%/50%. Results of performed experimental studies suggest that it is possible to use composite fuels based on coal and wood at thermal power plants.

  5. RELIABILITY ANALYSIS OF POWER DISTRIBUTION SYSTEMS

    Directory of Open Access Journals (Sweden)

    Popescu V.S.

    2012-04-01

    Full Text Available Power distribution systems are basic parts of power systems and reliability of these systems at present is a key issue for power engineering development and requires special attention. Operation of distribution systems is accompanied by a number of factors that produce random data a large number of unplanned interruptions. Research has shown that the predominant factors that have a significant influence on the reliability of distribution systems are: weather conditions (39.7%, defects in equipment(25% and unknown random factors (20.1%. In the article is studied the influence of random behavior and are presented estimations of reliability of predominantly rural electrical distribution systems.

  6. Iodine deficiency in pregnancy in Denmark. Regional variations and frequency of individual iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, P; Børlum, K G

    1993-01-01

    micrograms/g creatinine). These values are far below internationally recommended levels. The consequences remain to be evaluated and no firm recommendations can be given. It seems reasonable, however, to recommend a high intake of food containing iodine (e.g. milk products) during pregnancy and lactation...... containing vitamin/mineral tablets. Approximately one third of the women had received tablets containing iodine. In women who had not received iodine supplementation urinary iodine was low with a median value of 39.7 micrograms/g creatinine (Aalborg 28, Randers 33, Ringkøbing 34, Arhus 43 and Copenhagen 62...

  7. High prevalence of parental delivery of plastic debris in Cory’s shearwaters (Calonectris diomedea)

    OpenAIRE

    Rodríguez, Airam; Rodríguez, Beneharo; Carrasco, María Nazaret

    2012-01-01

    Plastic ingestion by adult Procellariiformes has been widely recorded, but few studies have evaluated intergenerational transfer. We assessed the prevalence of plastic particles, as well as their basic character- istics, in the gut content of dead Cory’s shearwater fledglings stranded by light pollution on Canary Islands. Eighty-three percent of birds were affected, containing on average 8.0 plastic pieces per bird. The average plastic weight per bird was low (2.97 ± 3.97 mg) compared with ...

  8. Neutropenia in infants with hemolytic disease of the newborn.

    Science.gov (United States)

    Blanco, Esther; Johnston, Donna L

    2012-06-01

    This study examined the incidence, outcome and risk factors of neutropenia in infants with hemolytic disease of the newborn (HDN). A retrospective chart review was performed on infants with HDN. Of 69 evaluable infants, 45% developed neutropenia. Only one infectious complication was recorded. In most instances the neutropenia resolved spontaneously, but in seven infants it persisted for a median of 397 days. Males were at higher risk for developing neutropenia, but severity of HDN, antibody specificity, or therapy were not significant risk factors. Neutropenia is a common feature of HDN, regardless of severity of disease, treatment received, or antibody specificity. Copyright © 2011 Wiley Periodicals, Inc.

  9. Cell adhesion on polytetrafluoroethylene modified by UV-irradiation in an ammonia atmosphere

    Czech Academy of Sciences Publication Activity Database

    Heitz, J.; Švorčík, V.; Bačáková, Lucie; Ročková, K.; Ratajová, E.; Gumpenberger, T.; Bäuerle, D.; Dvořánková, B.; Kahr, H.; Graz, I.; Romanin, C.

    67A, č. 1 (2003), s. 130-137 ISSN 0021-9304 R&D Projects: GA AV ČR IAA5011301 Grant - others:FWF(AT) P14476-TPH; GA FRVŠ(CZ) 283-2002-G1; CZ-AT Scientific-Technical Cooperation(CZ) 2002-7 Institutional research plan: CEZ:AV0Z5011922 Keywords : cell adhesion * UV-modified polymer * amino acid grafting Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.397, year: 2003

  10. Lithium ion conducting biopolymer electrolyte based on pectin doped with Lithium nitrate

    Science.gov (United States)

    Manjuladevi, R.; Selvin, P. Christopher; Selvasekarapandian, S.; Shilpa, R.; Moniha, V.

    2018-04-01

    The Biopolymer electrolyte based on pectin doped with lithium nitrate of different concentrations have been prepared by solution casting technique. The decrease in crystalline nature of the biopolymer has been identified by XRD analyses. The complex formation between the polymer and the salt has been revealed using FTIR analysis. The ionic conductivity has been explored using A.C. impedance spectroscopy which reveals that the biopolymer containing 30 wt% Pectin: 70wt%LiNO3 has highest ionic conductivity of 3.97 × 10-3 Scm-1.

  11. Mapping of single-copy genes by TSA-FISH in th codling moth, Cydia pomonella

    Czech Academy of Sciences Publication Activity Database

    Carabajal Paladino, Leonela Z.; Nguyen, Petr; Šíchová, Jindra; Marec, František

    2014-01-01

    Roč. 15, Supplement 2 (2014), S15 ISSN 1471-2156 R&D Projects: GA ČR(CZ) GA14-22765S; GA ČR(CZ) GP14-35819P; GA MŠk(CZ) EE2.3.30.0032 Grant - others:GA JU(CZ) 052/2013/P; IAEA, Vienna(AT) 15838 Institutional support: RVO:60077344 Keywords : Cydia pomonella Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2014 http://www.biomedcentral.com/content/pdf/1471-2156-15-S2-S15.pdf

  12. Pace studying worldwide coke production

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    Pace Consultants Inc., Houston, has started a multiclient study of world-wide petroleum coke production, examining environmental initiatives and eventually forecasting prices of fuel grade coke. Pace expects coker expansions, increased operating severity, and reduced cycle times to boost coke supply to more than 50 million metric tons/year in 2000, compared with 39.7 million metric tons in 1992. Increased supply and tightened environmental rules in countries consuming large amounts of petroleum coke will be the main factors affecting coke markets. The paper discusses coke quality and the Japanese market

  13. Glial cells and volume transmission in the CNS

    Czech Academy of Sciences Publication Activity Database

    Syková, Eva; Chvátal, Alexandr

    2000-01-01

    Roč. 36, - (2000), s. 397-409 ISSN 0197-0186 R&D Projects: GA ČR GV307/96/K226; GA ČR GV309/97/K048; GA ČR GA309/99/0657; GA ČR GA305/99/0655; GA MŠk VS96130 Institutional research plan: CEZ:AV0Z5039906 Keywords : ion homeostasis * glia * tortuossity Subject RIV: FH - Neurology Impact factor: 2.662, year: 2000

  14. Mental health predicts better academic outcomes: A longitudinal study of elementary school students in Chile

    OpenAIRE

    Murphy, J. Michael; Guzmán, Javier; McCarthy, Alyssa; Squicciarini, Ana María; George, Myriam; Canenguez, Katia; Dunn, Erin C.; Baer, Lee; Simonsohn, Ariela; Smoller, Jordan W.; Jellinek, Michael

    2015-01-01

    The world’s largest school-based mental health program, Habilidades para la Vida [Skills for Life, SFL], has been operating at a national scale in Chile for fifteen years. SFL’s activities include using standardized measures to screen elementary school students and providing preventive workshops to students at risk for mental health problems. This paper used SFL’s data on 37,397 students who were in first grade in 2009 and third grade in 2011 to ascertain whether first grade mental health pre...

  15. Determining Recoverable and Irrecoverable Contributions to Accumulated Strain in a NiTiPd High-Temperature Shape Memory Alloy During Thermomechanical Cycling

    Science.gov (United States)

    Monroe, J. A.; Karaman, I.; Lagoudas, D. C.; Bigelow, G.; Noebe, R. D.; Padula, S., II

    2011-01-01

    When Ni(29.5)Ti(50.5)Pd30 shape memory alloy is thermally cycled under stress, significant strain can accumulate due to elasticity, remnant oriented martensite and plasticity. The strain due to remnant martensite can be recovered by further thermal cycling under 0 MPa until the original transformation-induced volume change and martensite coefficient of thermal expansion are obtained. Using this technique, it was determined that the 8.15% total accumulated strain after cycling under 200 MPa consisted of 0.38%, 3.97% and 3.87% for elasticity, remnant oriented martensite and creep/plasticity, respectively.

  16. Mitochondrial DNA sequence evolution in the Arctoidea.

    OpenAIRE

    Zhang, Y P; Ryder, O A

    1993-01-01

    Some taxa in the superfamily Arctoidea, such as the giant panda and the lesser panda, have presented puzzles to taxonomists. In the present study, approximately 397 bases of the cytochrome b gene, 364 bases of the 12S rRNA gene, and 74 bases of the tRNA(Thr) and tRNA(Pro) genes from the giant panda, lesser panda, kinkajou, raccoon, coatimundi, and all species of the Ursidae were sequenced. The high transition/transversion ratios in cytochrome b and RNA genes prior to saturation suggest that t...

  17. Nurses' Experiences and Perceptions of Mobile Learning: A Survey in Beijing, China.

    Science.gov (United States)

    Xiao, Qian; Sun, Aihua; Wang, Yicong; Zhang, Yan; Wu, Ying

    2018-01-01

    To explore nurses' experience and perceptions toward mobile learning, 397 nurses were investigated. All of them used mobile learning in the past one year through internet, e-books and WeChat. Smartphones were the most used mobile learning tools, followed by a tablet and laptop computer. The mean score of nurses' intention towards mobile learning was 12.1 (ranged from 7 to 15), and it related to nurses' gender, education background, expected effect, ease of operation, self-learning management and perceived interest. Nurses had positive perception toward mobile learning and enough conditions to promote nurses' mobile learning should be provided.

  18. Perioperative Myocardial Injury After Noncardiac Surgery: Incidence, Mortality, and Characterization.

    Science.gov (United States)

    Puelacher, Christian; Lurati Buse, Giovanna; Seeberger, Daniela; Sazgary, Lorraine; Marbot, Stella; Lampart, Andreas; Espinola, Jaqueline; Kindler, Christoph; Hammerer, Angelika; Seeberger, Esther; Strebel, Ivo; Wildi, Karin; Twerenbold, Raphael; du Fay de Lavallaz, Jeanne; Steiner, Luzius; Gurke, Lorenz; Breidthardt, Tobias; Rentsch, Katharina; Buser, Andreas; Gualandro, Danielle M; Osswald, Stefan; Mueller, Christian

    2018-03-20

    Perioperative myocardial injury (PMI) seems to be a contributor to mortality after noncardiac surgery. Because the vast majority of PMIs are asymptomatic, PMI usually is missed in the absence of systematic screening. We performed a prospective diagnostic study enrolling consecutive patients undergoing noncardiac surgery who had a planned postoperative stay of ≥24 hours and were considered at increased cardiovascular risk. All patients received a systematic screening using serial measurements of high-sensitivity cardiac troponin T in clinical routine. PMI was defined as an absolute high-sensitivity cardiac troponin T increase of ≥14 ng/L from preoperative to postoperative measurements. Furthermore, mortality was compared among patients with PMI not fulfilling additional criteria (ischemic symptoms, new ECG changes, or imaging evidence of loss of viable myocardium) required for the diagnosis of spontaneous acute myocardial infarction versus those that did. From 2014 to 2015 we included 2018 consecutive patients undergoing 2546 surgeries. Patients had a median age of 74 years and 42% were women. PMI occurred after 397 of 2546 surgeries (16%; 95% confidence interval, 14%-17%) and was accompanied by typical chest pain in 24 of 397 patients (6%) and any ischemic symptoms in 72 of 397 (18%). Crude 30-day mortality was 8.9% (95% confidence interval [CI], 5.7-12.0) in patients with PMI versus 1.5% (95% CI, 0.9-2.0) in patients without PMI ( P PMI not fulfilling any other of the additional criteria required for spontaneous acute myocardial infarction (280/397, 71%) versus those with at least 1 additional criterion (10.4%; 95% CI, 6.7-15.7, versus 8.7%; 95% CI, 4.2-16.7; P =0.684). PMI is a common complication after noncardiac surgery and, despite early detection during routine clinical screening, is associated with substantial short- and long-term mortality. Mortality seems comparable in patients with PMI not fulfilling any other of the additional criteria required for

  19. Effects of Financial Training on Financial Performance of Schools in Kenya: a survey of Administrators of Secondary Schools in Trans-Nzoia County

    OpenAIRE

    Humphrey Nabiswa Chetambe; Maurice Sakwa

    2013-01-01

    The ever increasing cost of education to Governments and to citizens calls for effective management of school resources by administrators. When the Government of Kenya (GOK) introduced free secondary education, the national budgetary allocation for the program was between Ksh.25 billion and Ksh.39.7 billion in the financial year 2007/08 and this figure was projected to increase to between Ksh.28.3 billion and Ksh.74.3 billion in 2011 due to increasing demand for secondary education (Republic ...

  20. Acute Mesenteric Venous Thrombosis with a Vaginal Contraceptive Ring

    Directory of Open Access Journals (Sweden)

    Wesley Eilbert

    2014-07-01

    Full Text Available Mesenteric venous thrombosis is a rare cause of abdominal pain, which if left untreated may result in bowel infarction, peritonitis and death. The majority of patients with this illness have a recognizable, predisposing prothrombotic condition. Oral contraceptives have been identified as a predisposing factor for mesenteric venous thrombosis in reproductive-aged women. In the last fifteen years new methods of hormonal birth control have been introduced, including a transdermal patch and an intravaginal ring. In this report, we describe a case of mesenteric venous thrombosis in a young woman caused by a vaginal contraceptive ring. [West J Emerg Med. 2014;15(4:395-397.

  1. Effective Client Management: Maximizing The Influence of External Sponsors Over Affiliated Armed Groups

    Science.gov (United States)

    2017-12-01

    David and his men with sanctuary— thinking them to be allies against Saul.9 However, David was deceiving Achish about his attacks against Israel, and...main objectives with this strategy. First, it was hedging its bets —any faction that gained political power would have some type of relationship with... think -16291. 397 Garrison, “Disaggregating the ‘Axis of Resistance,’” 67; Ali, “ISW Blog.” 398 Mansour, “From Militia to State Force.” 399 Jean

  2. Factores que predisponen, facilitan y refuerzan el uso del preservativo en jóvenes universitarios de cali, colombia

    OpenAIRE

    Valencia, Claudia Patricia

    2013-01-01

    Objetivos Identificar la frecuencia del uso habitual del condón y los factores que predicen, facilitan y refuerzan su uso en jóvenes universitarios. Métodos Estudio analítico de corte transversal con análisis multivariado. La muestra fue de 397 estudiantes seleccionados aleatoriamente mediante un muestreo estratificado por Facultades a quienes se les aplicó una encuesta asistida por computador denominada “Reconociendo mi salud sexual”. Resultados El uso habitual de condón se da para el 33 % d...

  3. Thermal study of sandstones from different Czech localities

    Czech Academy of Sciences Publication Activity Database

    Plevová, Eva; Vaculíková, Lenka; Kožušníková, Alena; Daněk, T.; Ritz, M.; Simha Martynková, G.

    2011-01-01

    Roč. 103, č. 3 (2011), s. 835-843 ISSN 1388-6150 R&D Projects: GA ČR GA105/08/1398; GA ČR GP105/07/P416 Grant - others:GA ČR(CZ) GP105/09/397 Institutional research plan: CEZ:AV0Z30860518 Keywords : thermomechanical and differential thermal analysis * optical microscopy * sandstones Subject RIV: CA - Inorganic Chemistry Impact factor: 1.604, year: 2011 http://www.springerlink.com/content/71n5427j2707g331/

  4. The Visual Orbit of the 1.1 Day Spectroscopic Binary Sigma2 Coronae Borealis From Interferometry at the Chara Array

    Science.gov (United States)

    2009-01-01

    UBV bands from Grenier et al. (1985) and Perryman & ESA (1997), and JHKS bands from the Two Micron All Sky Survey9 ( 2MASS ) and transformed them to...calibrated 9 http://www.ipac.caltech.edu/ 2mass No. 1, 2009 σ 2 CrB VISUAL ORBIT 397 Table 2 Interferometric Visibilities for σ 2 CrB HJD Measured V σV...that a 10% change inΔK ′ for σ 2 CrB results in only 0.1% change in visibility. This, along with the poor-quality K magnitude listed in 2MASS (for σ 2

  5. Modelling of Lévy walk kinetics of charged particles in edge electrostatic turbulence in tokamaks

    Czech Academy of Sciences Publication Activity Database

    Krlín, Ladislav; Papřok, R.; Svoboda, V.

    2008-01-01

    Roč. 48, č. 1 (2008), s. 95-109 ISSN 1434-6060 R&D Projects: GA AV ČR IAA100430502; GA ČR GA202/07/0044 Institutional research plan: CEZ:AV0Z20430508 Keywords : PLASMA TURBULENCE * DIFFUSION * TRANSPORT * FIELD * WAVES Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.397, year: 2008 http://www.springerlink.com/content/101161/?p=0fb843e139344681908c5cc2140bb828&pi=0

  6. HIV Risk Perception, Sexual Behavior, and HIV Prevalence among Men-Who-Have-Sex-with-Men at a Community-Based Voluntary Counseling and Testing Center in Kuala Lumpur, Malaysia

    OpenAIRE

    Koh, Kwee Choy; Yong, Lit Sin

    2014-01-01

    We describe the HIV risk perception, sexual behavior, and HIV prevalence among 423 men-who-have-sex-with-men (MSM) clients who received voluntary counseling and testing (VCT) services at a community-based center in Kuala Lumpur, Malaysia. The mean age was 29 years old. One hundred one (23.9%) clients rated themselves as low risk, 118 (27.9%) as medium risk, 36 (8.5%) as high risk, and 168 (39.7%) were unsure of their risk. Twenty-four (9.4%) clients tested HIV positive (4 (4%) low risk, 9 (7....

  7. GPs and end of life decisions : views and experiences

    OpenAIRE

    Abela, Jurgen

    2015-01-01

    The views and experiences of GPs with respect to end of life (EoL) care are seldom addressed. The aim of this article is to better understand this aspect of care. A cross-sectional survey of all doctors in the country was designed and set up. The overall response was 396 (39.7%), 160 of which were GPs. 28.7% of GPs received no formal training in palliative medicine. 89.8% of respondents declared that their religion was important in EoL care. 45.3% agreed with the right of a patient to decide ...

  8. Buying and Selling Behavior of Individual Investors in Option-like Securities

    OpenAIRE

    Schmitz, Philipp; Weber, Martin

    2007-01-01

    We analyze the trading behavior of individual investors in option-like securities, namely bank-issued warrants, and thus expand the growing literature of investors behavior to a new kind of securities. A unique data set from a large German discount broker gives us the opportunity to analyze the trading behavior of 1,454 investors, making 89,958 transactions in 6,724 warrants on 397 underlyings. In different logit regression, we make use of the facts that investors can speculate on rising and ...

  9. Maxwell AFB, Montgomery, Alabama. Revised Uniform Summary of Surface Weather Observations (RUSSWO)

    Science.gov (United States)

    1974-09-19

    VISION GAS . MAY 00-02 09 3,8 90 3,8 499 7,7 .1 11.6 3150 ___03.05, 1.1 4,0 1__ __ 4t, 15t6 139, *1 24#7 3188 0o.o13l ,5 397 __ 3t7 10,8 17,6 1__ 1 2497...WINDDIRECTION AND SPEED i (FROM HOURLY OBSERVATIONS) i ( ..1AXWELL AF B A-AA/HMM15C)MIRY 37m,72 sr-P STA TIONl STATIO lolUNK Tgllil "Ol N CLADA NOPAll (IS T

  10. ALCOHOL CONSUMPTION AND RISK FACTORS IN STUDENTS OF TWO COLOMBIAN UNIVERSITIES

    OpenAIRE

    Arias Zapata, Francisco Javier; Calderón Vallejo, Gustavo Adolfo; Cano Bedoya, Víctor Hugo; Castaño Pérez, Guillermo Alonso

    2012-01-01

    El objetivo fue identificar factores de riesgo del consumo de alcohol en estudiantes universitarios colombianos. Participaron 397 mujeres y 312 hombres, estudiantes de dos universidades privadas y católicas de la ciudad de Medellín (Colombia). Los resultados identificaron como factores de riesgo las dificultades para decir “no” a la gente (p=0.012) y el consumo de sustancias psicoactivas por miembros de la familia (p=0.022).Abstract:The objective of the current research was to identify the ri...

  11. Spreading of alien species and diversity of communities

    Czech Academy of Sciences Publication Activity Database

    Kindlmann, Pavel; Honěk, A.; Martinková, Z.

    2017-01-01

    Roč. 62, č. 3 (2017), s. 397-407 ISSN 1386-6141 R&D Projects: GA ČR GA14-26561S; GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : pallas coleoptera-coccinellidae * lady beetle coleoptera * harmonia-axyridis * harlequin ladybird * intraguild predation * geographical-distribution * generalist predators * biological-control * invasion history * native range * Alien species * Native species * Ladybirds * Aphid predators * Simulation model * Community Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 1.918, year: 2016

  12. The Air Force Nuclear Engineering Center Structural Activation and Integrity Evaluation

    Science.gov (United States)

    1990-03-01

    ASTMA -212 1433 406 SS-304 927 263 Lead 96 39 42/Core Walls 2󈧎...34 * 6𔃼" * 5" ASTMA -212 4699 1333 SS-304 3435 974 Lead 3350 1373 43/Wing Walls 24" * 6𔃼" * 5" ASTMA -212 15622 4430 SS-304 5541 1571 Lead 15683 6425 44...Wing Ceiling 28" * 6𔃼" * 5" ASTMA -212 4809 1364 SS-304 305 87 Lead 970 397 45/Wing Floor 28" * 6𔃼" * 5" ASTMA -212 5174 1467 SS-304 322 91 Lead

  13. New Fluidic-Oscillator Concept for Flow-Separation Control

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav; Zhong, S.; Rasheed, F.

    2013-01-01

    Roč. 51, č. 2 (2013), s. 397-405 ISSN 0001-1452 R&D Projects: GA ČR(CZ) GCP101/11/J019; GA TA ČR TA02020795; GA ČR GA13-23046S Institutional research plan: CEZ:AV0Z20760514 Institutional support: RVO:61388998 Keywords : fluidics * fluidic oscillator * resonator Subject RIV: BK - Fluid Dynamics Impact factor: 1.165, year: 2013 http://arc.aiaa.org/doi/abs/10.2514/1.J051791?journalCode=aiaaj

  14. Energy dependence of fusion evaporation-residue cross sections in the 28Si+28Si reaction

    International Nuclear Information System (INIS)

    Vineyard, M.F.; Bauer, J.S.; Gosdin, C.H.; Trotter, R.S.; Kovar, D.G.; Beck, C.; Henderson, D.J.; Janssens, R.V.F.; Wilkins, B.D.; Rosner, G.; Chowdhury, P.; Ikezoe, H.; Kuhn, W.; Kolata, J.J.; Hinnefeld, J.D.; Maguire, C.F.; Mateja, J.F.; Prosser, F.W.; Stephans, G.S.F.

    1990-01-01

    Velocity distributions of mass-identified evaporation residues produced in the 28 Si+ 28 Si reaction have been measured at bombarding energies of 174, 215, 240, 309, 397, and 452 MeV using time-of-flight techniques. These distributions were used to identify evaporation residues and to separate the complete-fusion and incomplete-fusion components. Angular distributions and total cross sections were extracted at all six bombarding energies. The complete-fusion evaporation-residue cross sections and the deduced critical angular momenta are compared with lower energy data and the predictions of existing models

  15. Fully-resonant, tunable, monolithic frequency conversion as a coherent UVA source.

    Science.gov (United States)

    Zielińska, Joanna A; Zukauskas, Andrius; Canalias, Carlota; Noyan, Mehmet A; Mitchell, Morgan W

    2017-01-23

    We demonstrate a monolithic frequency converter incorporating up to four tuning degrees of freedom, three temperature and one strain, allowing resonance of pump and generated wavelengths simultaneous with optimal phase-matching. With a Rb-doped periodically-poled potassium titanyl phosphate (KTP) implementation, we demonstrate efficient continuous-wave second harmonic generation from 795 to 397, with low-power efficiency of 72% and high-power slope efficiency of 4.5%. The measured performance shows good agreement with theoretical modeling of the device. We measure optical bistability effects, and show how they can be used to improve the stability of the output against pump frequency and amplitude variations.

  16. Thin nanodiamond membranes and their microstructural, optical and photoelectrical properties

    Czech Academy of Sciences Publication Activity Database

    Mortet, V.; D´Haen, J.; Potměšil, Jiří; Kravets, Roman; Drbohlav, Ivo; Vorlíček, Vladimír; Rosa, Jan; Vaněček, Milan

    2005-01-01

    Roč. 14, - (2005), s. 393-397 ISSN 0925-9635 R&D Projects: GA MŠk(CZ) LN00A015; GA ČR(CZ) GA202/05/2233; GA MŠk(CZ) LC510 EU Projects: European Commission(XE) HPRN-CT-1999-00139 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanodiamond * structural characterization * optical properties * defect spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.988, year: 2005

  17. Synthesis of [3]DIPPA: a potent irreversible antagonist selective for the κ opioid receptor

    International Nuclear Information System (INIS)

    Chang, Anchih; Portoghese, P.S.

    1995-01-01

    2-(3,4-Dichlorophenyl)-N-methyl-N-[(1S)-1-(3-isothiocyanatophe nyl)-2-(1-pyrrolidinyl)ethyl]acetamide (1,DIPPA) has been previously reported to be an opioid receptor affinity label that produces selective and long-lasting κ opioid receptor antagonism in mice. High specific activity [ 3 H]DIPPA (39.7 Ci/mmol) was prepared by bromination and catalytic tritiation of the amino precursor of DIPPA followed by conversion to the isothiocyanate with thiophosgene. (Author)

  18. Prevalence of dental caries in primary and permanent teeth and its relation with tooth brushing habits among schoolchildren in Eastern Saudi Arabia

    OpenAIRE

    Farooqi, Faraz A.; Khabeer, Abdul; Moheet, Imran A.; Khan, Soban Q.; Farooq, Imran; ArRejaie, Aws S.,

    2015-01-01

    Objectives: To determine the prevalence of dental caries in the primary and permanent teeth, and evaluate the brushing habits of school children in Dammam, Kingdom of Saudi Arabia (KSA). Methods: This study was conducted at Dammam, KSA. Oral examination of the participants was conducted from February to May 2014. The total sample size for this cross-sectional study was 711. There were 397 children between the age of 6-9 years, who were examined for primary teeth caries, and 314 between the ag...

  19. Sustainable multifunctional landscapes: a review to implementation

    CSIR Research Space (South Africa)

    O'Farrell, PJ

    2010-05-01

    Full Text Available 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429..., 36:522-527. 11. Antrop M: Landscape change: plan or chaos? Landscape Urban Plan 1998, 41:155-161. 12. Knight AT, Cowling RM, Campbell BM: An operational model for implementing conservation action. Conserv Biol 2006, 20:408- 419. 13. � Fischer...

  20. 18th Middle Atlantic Regional Meeting, American Chemical Society

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The Proceedings of the 18th Middle Atlantic Regional Meeting of the American Chemical Society held May 21-23, 1984, include information about the meeting, e.g. area map and list of exhibitors, and abstracts for most of the 397 papers. A few papers are only title listed. The papers are arranged into sections dealing with analytical chemistry, biochemistry, chemical education, environmental chemistry, fuel chemistry, history of chemistry, industrial and engineering chemistry, inorganic chemistry, photochemistry, physical chemistry, polymer chemistry, and polymeric materials. Sections are also included to highlight undergraduate research and papers by chemical technicians and younger chemists. Separate abstracts have been prepared for 36 papers

  1. Femtosecond laser control of the angular distribution of electrons due to autoionization

    International Nuclear Information System (INIS)

    Bajema, M.L.; Jones, R.R.; Gallagher, T.F.

    2004-01-01

    Using two 500-fs laser pulses and a controlled time delay between them we are able to manipulate the angular distributions of the electrons ejected by autoionization of Ca atoms in the 4p 3/2 21s and 4p 3/2 19d states. Subsequent to their isolated core excitation by a 500-fs 393-nm laser pulse, Ca 4p 3/2 21s(19d) Rydberg atoms coherently evolve, via configuration interaction, into the degenerate 4p 1/2 ns(nd) states. While in the 4p 1/2 ns(nd) states atoms can be de-excited to bound 4sns(nd) levels using a 500-fs 397-nm pulse. Removing these atoms from the autoionizing states leads to a greater fraction of electrons leaving the atom along the direction of the laser polarization than is possible through direct excitation of 4 3/2 ns(nd) or 4p 1/2 ns(nd) using either the 393- or 397-nm pulse alone

  2. Frequency and spectrum of hemoglobinopathy mutations in a Uruguayan pediatric population

    Directory of Open Access Journals (Sweden)

    Julio Da Luz

    2013-01-01

    Full Text Available Hemoglobinopathies are the most common recessive diseases worldwide but their prevalence in Uruguay has not been investigated. In this study, 397 unrelated outpatient children from the Pereira Rosell Hospital Center (CHPR, as well as 31 selected patients with microcytic anemia and 28 β-thalassemia carriers were analyzed for hemoglobinopathies by using biochemical and molecular biology methods. Parametric and non-parametric methods were used to compare the hematological indices between groups of genotypes. Of the 397 patients in the first group, approximately 1% (0.76% HbS and 0.25% β-thalassemia had a mutation in the HBB gene and 3.3% had α-thalassemia. These mutations had a heterogeneous distribution that varied according to individual ancestry. HbS was found exclusively in individuals with declared African ancestry and had a carrier frequency of 2.2%. The frequency of α-thalassemia carriers in outpatients of European and African ancestry was 1.2% and 6.5%, respectively. In contrast, the frequency of α-thalassemia carriers in patients with microcytic anemia was 25.8%, significantly higher (p < 0.01 than that observed in the sample as a whole and in Afro-descendants and Euro-descendants. Significant differences were observed in the hematological parameters between individuals with thalassemia genotypes and those with a normal genotype. These results indicate that hemoglobinopathies are a relevant health problem in Uruguay.

  3. Developing competencies for medical librarians in Pakistan.

    Science.gov (United States)

    Ullah, Midrar; Anwar, Mumtaz A

    2013-03-01

    To identify competencies for medical librarians and get these validated from head librarians and employers. The survey method was used. A structured questionnaire, listing 84 competency statements, covering eight areas, prepared after extensive literature review, expert scrutiny and pilot testing, using a 5-point Likert scale was distributed among the head librarians and chairpersons of library committees (CLC) in 115 medical libraries. Sixty seven (58%) useable responses were received from head librarians and 63 (55%) from CLC. Of the 84 competency statements 83 were validated by the head librarians, 44 receiving four or higher mean score while the other 39 statements getting mean scores in the range of 3.97 and 3.06. The CLC validated 80 statements. Only 27 statements received four or higher mean score from CLC while the other 53 got mean scores in the range of 3.97 and 3.22. Medical librarians are required to be well versed with all those competencies which are needed for general librarianship. In addition, they are expected to have adequate knowledge of health sciences environment including medical terminologies and concepts. Sound knowledge of some competencies specific for medical libraries is an additional requirement for library personnel. © 2012 The authors. Health Information and Libraries Journal © 2012 Health Libraries Group.

  4. Physiological Study of Lactobacillus delbrueckii subsp. bulgaricus Strains in a Novel Chemically Defined Medium

    Science.gov (United States)

    Chervaux, Christian; Ehrlich, S. Dusko; Maguin, Emmanuelle

    2000-01-01

    We developed a chemically defined medium called milieu proche du lait (MPL), in which 22 Lactobacillus delbrueckii subsp. bulgaricus (L. bulgaricus) strains exhibited growth rates ranging from 0.55 to 1 h−1. MPL can also be used for cultivation of other lactobacilli and Streptococcus thermophilus. The growth characteristics of L. bulgaricus in MPL containing different carbon sources were determined, including an initial characterization of the phosphotransferase system transporters involved. For the 22 tested strains, growth on lactose was faster than on glucose, mannose, and fructose. Lactose concentrations below 0.4% were limiting for growth. We isolated 2-deoxyglucose-resistant mutants from strains CNRZ397 and ATCC 11842. CNRZ397-derived mutants were all deficient for glucose, fructose, and mannose utilization, indicating that these three sugars are probably transported via a unique mannose-specific-enzyme-II-like transporter. In contrast, mutants of ATCC 11842 exhibited diverse phenotypes, suggesting that multiple transporters may exist in that strain. We also developed a protein labeling method and verified that exopolysaccharide production and phage infection can occur in MPL. The MPL medium should thus be useful in conducting physiological studies of L. bulgaricus and other lactic acid bacteria under well controlled nutritional conditions. PMID:11097906

  5. Premonitory Urge for Tics Scale (PUTS): replication and extension of psychometric properties in youth with chronic tic disorders (CTDs).

    Science.gov (United States)

    Raines, Jeremy M; Edwards, Kimberly R; Sherman, Martin F; Higginson, Christopher I; Winnick, Joel B; Navin, Kelly; Gettings, Julie M; Conteh, Fatmata; Bennett, Shannon M; Specht, Matthew W

    2018-04-01

    Individuals with chronic tic disorders (CTDs) frequently describe aversive subjective sensory sensations that precede their tics. The first aim of the present study was to explore the psychometric properties of a standardized self-report measure to assess premonitory urges in CTDs, The Premonitory Urge for Tics Scale (PUTS), by replicating the analyses of Woods et al. (J Dev Behav Pediatr 26:397-403, 2005) using a sample twice the size of theirs. The second aim was to conduct an exploratory factor analysis of the PUTS. Eighty-four youth with CTDs, recruited from a pediatric OCD and tic specialty clinic, completed the PUTS while their caregivers completed The Parent Tic Questionnaire (PTQ) and a demographic measure. Consistent with (Woods et al. J Dev Behav Pediatr 26:397-403, 2005), the PUTS was found to be internally consistent (α = 0.82) and significantly correlated with overall tic severity as measured by the PTQ (r = 0.24, p tics than the frequency or intensity of tics.

  6. Stethoscope Hygiene: Practice and Attitude of Medical Students.

    Science.gov (United States)

    Gazibara, Tatjana; Radovanovic, Sanja; Maric, Gorica; Rancic, Biljana; Kisic-Tepavcevic, Darija; Pekmezovic, Tatjana

    2015-01-01

    The purpose of this study was to evaluate the frequency and attitude of medical students towards cleaning their stethoscopes. A cross-sectional study was carried out in the first week of December 2013. The study included 771 students (397 in their fourth and 374 in their sixth year) from the Faculty of Medicine, University of Belgrade, Serbia. An anonymous questionnaire was distributed to students before the start of compulsory lessons in classrooms. 317 of the 397 fourth-year students (79.8%) and 306 of the 374 sixth-year students (81.9%) cleaned their stethoscope. The stethoscope diaphragm was most commonly cleaned, while the flexible tubing was the least commonly cleaned area, mainly using ethyl alcohol-based agents. The strongest positive attitude was observed for the statement 'It is important that my stethoscope is clean' (4.3 out of 5.0). A positive correlation (Spearman's x03C1; = 0.105) was observed between a higher frequency of cleaning and the stronger positive notion that a stethoscope should be cleaned. A considerably high proportion of the students studied had ever cleaned their stethoscopes. Based on the students' responses, it would be useful to implement instructions on stethoscope hygiene in the regular practical curriculum with the aim of applying stethoscope disinfection in daily work. © 2015 S. Karger AG, Basel.

  7. One pot synthesis of pure micro/nano photoactive α-PbO crystals

    Science.gov (United States)

    Bhagat, Dharini; Waldiya, Manmohansingh; Vanpariya, Anjali; Mukhopadhyay, Indrajit

    2018-05-01

    The present study reports a simple, fast and cost effective precipitation technique for synthesis of pure α-PbO powder. Lead monoxide powder with tetragonal structure was synthesized chemically at an elevated temperature using lead acetate and sodium hydroxide solution bath. XRD powder diffraction was used to find the structural properties as well as phase transition from alpha to beta. Study revealed that synthesized PbO powder was crystalline with tetragonal symmetry, having an average crystallite size of 70 nm and lattice constants; a=3.97Å, b=3.97Å, and c=5.02Å. Phase transition from tetragonal to orthorhombic structure was studied by comparing the XRD data of the annealed samples in the temperature range from 200 °C to 600 °C. UV-Visible spectroscopy was used to find out the optical properties of prepared PbO powder. Diffuse reflectance and absorbance spectra confirmed the formation of α-PbO with obtained direct band gap of 1.9 eV. Synthesized lead monoxide (α-PbO) powder has promising application in energy conversion as well as energy storage applications.

  8. Thermoelectric effects of amorphous Ga-Sn-O thin film

    Science.gov (United States)

    Matsuda, Tokiyoshi; Uenuma, Mutsunori; Kimura, Mutsumi

    2017-07-01

    The thermoelectric effects of an amorphous Ga-Sn-O (a-GTO) thin film have been evaluated as a physical parameter of a novel oxide semiconductor. Currently, a-GTO thin films are greatly desired not only because they do not contain rare metals and are therefore free from problems on the exhaustion of resources and the increase in cost but also because their initial characteristics and performance stabilities are excellent when they are used in thin-film transistors. In this study, an a-GTO thin film was deposited on a quartz substrate by RF magnetron sputtering and postannealing was performed in air at 350 °C for 1 h using an annealing furnace. The Seebeck coefficient and electrical conductivity of the a-GTO thin film were -137 µV/K and 31.8 S/cm at room temperature, and -183 µV/K and 43.8 S/cm at 397 K, respectively, and as a result, the power factor was 1.47 µW/(cm·K2) at 397 K; these values were roughly as high as those of amorphous In-Ga-Zn-O (a-IGZO) thin films. Therefore, a-GTO thin films will be a candidate material for thermoelectric devices fabricated in a large area at a low cost by controlling the carrier mobility, carrier density, device structures, and so forth.

  9. Hydrogen generation from deliquescence of ammonia borane using Ni-Co/r-GO catalyst

    Science.gov (United States)

    Chou, Chang-Chen; Chen, Bing-Hung

    2015-10-01

    Hydrogen generation from the catalyzed deliquescence/hydrolysis of ammonia borane (AB) using the Ni-Co catalyst supported on the graphene oxide (Ni-Co/r-GO catalyst) under the conditions of limited water supply was studied with the molar feed ratio of water to ammonia borane (denoted as H2O/AB) at 2.02, 3.97 and 5.93, respectively. The conversion efficiency of ammonia borane to hydrogen was estimated both from the cumulative volume of the hydrogen gas generated and the conversion of boron chemistry in the hydrolysates analyzed by the solid-state 11B NMR. The conversion efficiency of ammonia borane could reach nearly 100% under excess water dosage, that is, H2O/AB = 3.97 and 5.93. Notably, the hydrogen storage capacity could reach as high as 6.5 wt.% in the case with H2O/AB = 2.02. The hydrolysates of ammonia borane in the presence of Ni-Co/r-GO catalyst were mainly the mixture of boric acid and metaborate according to XRD, FT-IR and solid-state 11B NMR analyses.

  10. CNGA3 mutations in two United Arab Emirates families with achromatopsia.

    Science.gov (United States)

    Ahuja, Yachna; Kohl, Susanne; Traboulsi, Elias I

    2008-07-10

    ACHROMATOPSIA RESULTS FROM MUTATIONS IN ONE OF THREE GENES: cyclic nucleotide-gated channel, alpha-3 (CNGA3); cyclic nucleotide-gated channel, beta-3 (CNGB3); and guanine nucleotide-binding protein, alpha-transducing activity polypeptide 2 (GNAT2). We report the responsible mutations in two United Arab Emirates families who have this autosomal recessive disease. Clinical examinations were performed in seven patients from three nuclear families. Molecular genetic testing for common CNGA3 and CNGB3 mutations was undertaken using standard protocols. All patients were extremely light sensitive and had reduced visual acuity and no color perception. Fundus examinations did not show any visible abnormalities. After further pedigree analysis, two of the families were found to be linked through the paternal line. Two mutations in CNGA3 were identified: Arg283Trp and Gly397Val. Family A, the larger pedigree, had one branch in which two sisters and one brother were homozygous for the Gly397Val mutation and another branch in which a brother and sister were compound heterozygous for both aforenamed mutations. Family B, however, only had two brothers who were homozygous for the Arg283Trp mutation. Achromatopsia in these two United Arab Emirates families results from two different mutations in CNGA3. Two branches of the same pedigree had individuals with both homozygous and compound heterozygous disease, demonstrating a complex molecular pathology in this large family.

  11. Use of routine computed tomography brain scanning of psychiatry patients

    International Nuclear Information System (INIS)

    Agzarian, M.J.; Chryssidis, S.; Davies, R.P.; Pozza, C.H.

    2006-01-01

    The aim of this study was to evaluate the usefulness of CT of the brain in patients presenting with a psychiatric condition without focal neurological signs. The reports of 397 consecutive CT brain scans of patients presenting to two acute tertiary hospital psychiatric services over a 2-year period were assessed retrospectively. Of the 397 patients, 241 had psychosis, 87 had depression, 44 had bipolar affective disorder, seven had alcohol dependence, five had dementia, and the remaining 13 had a variety of diagnoses including personality disorder and transient ischaemic attack. Findings on 377 (95%) of the CT scans showed no abnormality. Specific abnormalities were described in 20 (5%) of the CT scans. Three scans showed non-specific minor abnormalities, which, when followed up by MRI, showed no relevant abnormality. All the abnormalities shown on CT were considered to be clinically unrelated to the patient's psychiatric condition. In conclusion, the pretest probability of finding a space-occupying lesion or other pertinent abnormality in patients presenting with psychiatric illnesses in this retrospective study appears not to be greater than that of the general population. The outcome of this study could be implemented to develop a clinical pathway for limiting assessment by CT for possible organic pathology in acute psychiatric illness. Copyright (2006) Blackwell Science Pty Ltd

  12. Improving the diagnosis of pulmonary tuberculosis in HIV-infected individuals in Ho Chi Minh City, Viet Nam.

    Science.gov (United States)

    Nguyen, D T M; Hung, N Q; Giang, L T; Dung, N H; Lan, N T N; Lan, N N; Yen, N T B; Bang, N D; Ngoc, D V; Trinh, L T T; Beasley, R P; Ford, C E; Hwang, L-Y; Graviss, E A

    2011-11-01

    District 6, An Hoa Clinic in Ho Chi Minh City (HCMC), Viet Nam. To evaluate the performance of various algorithms in tuberculosis (TB) screening and diagnosis in a human immunodeficiency virus (HIV) infected population in HCMC, Viet Nam. A cross-sectional study of 397 consecutive HIV-infected patients seeking care at the An Hoa Clinic from August 2009 to June 2010. Data on participant demographics, clinical status, chest radiography (CXR) and laboratory results were collected. A multiple logistic regression model was developed to assess the association of covariates and pulmonary TB (PTB). The prevalence of sputum culture-confirmed PTB, acid-fast bacilli (AFB) positive TB, and multidrugresistant TB among the 397 HIV-infected patients was respectively 7%, 2%, and 0.3%. Adjusted odds ratios for low CD4+ cell count, positive sputum smear, and CXR to positive sputum culture were respectively 3.17, 32.04 and 4.28. Clinical findings alone had poor sensitivity, but combining CD4+ cell count, AFB sputum smear and CXR had a more accurate diagnostic performance. Results suggest that symptom screening had poor clinical performance, and support the routine use of sputum culture to improve the detection of TB disease in HIV-infected individuals in Viet Nam. However, when routine sputum culture is not available, an algorithm combining CD4+ cell count, AFB sputum smear and CXR is recommended for diagnosing PTB.

  13. A Raman spectroscopic study of thermally treated glushinskite--the natural magnesium oxalate dihydrate.

    Science.gov (United States)

    Frost, Ray L; Adebajo, Moses; Weier, Matt L

    2004-02-01

    Raman spectroscopy has been used to study the thermal transformations of natural magnesium oxalate dihydrate known in mineralogy as glushinskite. The data obtained by Raman spectroscopy was supplemented with that of infrared emission spectroscopy. The vibrational spectroscopic data was complimented with high resolution thermogravimetric analysis combined with evolved gas mass spectrometry. TG-MS identified two mass loss steps at 146 and 397 degrees C. In the first mass loss step water is evolved only, in the second step carbon dioxide is evolved. The combination of Raman microscopy and a thermal stage clearly identifies the changes in the molecular structure with thermal treatment. Glushinskite is the dihydrate phase in the temperature range up to the pre-dehydration temperature of 146 degrees C. Above 397 degrees C, magnesium oxide is formed. Infrared emission spectroscopy shows that this mineral decomposes at around 400 degrees C. Changes in the position and intensity of the CO and CC stretching vibrations in the Raman spectra indicate the temperature range at which these phase changes occur.

  14. OPTIMIZATION OF MEDIUM COMPOSITIONS FOR SACCHAROMYCES BOULARDII BY BOX-BEHNKEN DESIGN

    Directory of Open Access Journals (Sweden)

    ZHANGTENG LEI

    2016-12-01

    Full Text Available Based on the previous experimental results, the Box-Behnken design (BBD was employed to study the individual and interactive effects of sucrose, malt extract, calf serum and sodium citrate on the growth of Saccharomyces boulardii, and the optimum medium compositions were obtained. Meanwhile, the optical density (OD in the fermentation suspension was measured at 560 nm after 36 h of incubation. It is shown that the optimized medium compositions were 36.28 g·L-1 sucrose, 6.38 g·L-1 malt extract, 5.69 g·L-1 calf serum and 5.3 g·L-1 sodium citrate. The result indicated that the growth of S. boulardii could increase significantly in the optimized medium, and the OD560nm value reached 1.397 ± 0.013 after 36 h, which increased 18.59 % compared with that of pre-optimized medium. In addition, the OD560nm value 1.397 ± 0.013 in the optimized medium was very closely to the expected value 1.394. This result suggested that optimization of medium compositions for S. boulardii by BBD in this study was reliable and effective.

  15. Oestrogen receptor α gene haplotype and postmenopausal breast cancer risk: a case control study

    International Nuclear Information System (INIS)

    Wedrén, Sara; Stiger, Fredrik; Persson, Ingemar; Baron, John; Weiderpass, Elisabete; Lovmar, Lovisa; Humphreys, Keith; Magnusson, Cecilia; Melhus, Håkan; Syvänen, Ann-Christine; Kindmark, Andreas; Landegren, Ulf; Fermér, Maria Lagerström

    2004-01-01

    Oestrogen receptor α, which mediates the effect of oestrogen in target tissues, is genetically polymorphic. Because breast cancer development is dependent on oestrogenic influence, we have investigated whether polymorphisms in the oestrogen receptor α gene (ESR1) are associated with breast cancer risk. We genotyped breast cancer cases and age-matched population controls for one microsatellite marker and four single-nucleotide polymorphisms (SNPs) in ESR1. The numbers of genotyped cases and controls for each marker were as follows: TA n , 1514 cases and 1514 controls; c.454-397C → T, 1557 cases and 1512 controls; c.454-351A → G, 1556 cases and 1512 controls; c.729C → T, 1562 cases and 1513 controls; c.975C → G, 1562 cases and 1513 controls. Using logistic regression models, we calculated odds ratios (ORs) and 95% confidence intervals (CIs). Haplotype effects were estimated in an exploratory analysis, using expectation-maximisation algorithms for case-control study data. There were no compelling associations between single polymorphic loci and breast cancer risk. In haplotype analyses, a common haplotype of the c.454-351A → G or c.454-397C → T and c.975C → G SNPs appeared to be associated with an increased risk for ductal breast cancer: one copy of the c.454-351A → G and c.975C → G haplotype entailed an OR of 1.19 (95% CI 1.06–1.33) and two copies with an OR of 1.42 (95% CI 1.15–1.77), compared with no copies, under a model of multiplicative penetrance. The association with the c.454-397C → T and c.975C → G haplotypes was similar. Our data indicated that these haplotypes were more influential in women with a high body mass index. Adjustment for multiple comparisons rendered the associations statistically non-significant. We found suggestions of an association between common haplotypes in ESR1 and the risk for ductal breast cancer that is stronger in heavy women

  16. In-beam γ-ray spectroscopy of the neutron rich 39Si

    International Nuclear Information System (INIS)

    Sohler, D.; Dombradi, Zs.; Achouri, N.L.; Angelique, J.C.; Bastin, B.; Azaiez, F.; Baiborodin, D.; Borcea, R.

    2009-01-01

    Complete text of publication follows. In order to clarify the role of proton excitations across the Z = 14 subshell closure in neutron-rich Si isotopes, we investigated the structure of the 14 39 Si 25 isotope, having three neutron-hole configurations with respect to an N = 28 core. The excited states of 39 Si were studied by in-beam γ-ray spectroscopy trough fragmentation of radioactive beams. The experiment was performed at the GANIL facility in France. The radioactive beams were produced by the fragmentation of the stable 48 Ca beam of 60 MeV/u energy and 4μA intensity on a 12 C target in the SISSI device. The cocktail beam produced was impinged onto a 9 Be target. The nuclei produced in the secondary fragmentation reaction were selected and unambiguously identified by the SPEG spectrometer. In the performed experiment the 39 Si nuclei were obtained via 1p, 1p1n, 2p1n and 2p2n knockout reactions from the 40,41 P and 42,43 S secondary beams. To measure the γ rays emitted from the excited states, the secondary target was surrounded by the 4π 'Chateau de Crystal' array consisting of 74 BaF 2 scintillators. The γ-ray spectra were generated by gating event-by-event on the incoming secondary beam particles and the ejectiles after the secondary target. For the γ rays emitted by the fast moving fragments accurate Doppler correction was performed. From the obtained γ spectra of 39 Si displayed in Figure 1, two strong γ transitions at 163 and 397 keV as well as weaker ones at 303, 657, 906, 1143 and 1551 keV have been identified. γγ coincidences were obtained in 39 Si after having added all data from the various reaction channels giving rise to 39 Si. Analysing these data the 163 keV transition was found to be in coincidence with the 657, 1143 and 1551 keV ones, but not with the 397 keV transition. The two lines of the 303+397 keV doublet are in mutual coincidence, and one or both of them are found in coincidence with the 906 keV transition.

  17. Increases in core temperature counterbalance effects of haemoconcentration on blood viscosity during prolonged exercise in the heat.

    Science.gov (United States)

    Buono, Michael J; Krippes, Taylor; Kolkhorst, Fred W; Williams, Alexander T; Cabrales, Pedro

    2016-02-01

    What is the central question of this study? The purpose of the present study was to determine the effects of exercise-induced haemoconcentration and hyperthermia on blood viscosity. What is the main finding and its importance? Exercise-induced haemoconcentration, increased plasma viscosity and increased blood aggregation, all of which increased blood viscosity, were counterbalanced by increased red blood cell (RBC) deformability (e.g. RBC membrane shear elastic modulus and elongation index) caused by the hyperthermia. Thus, blood viscosity remained unchanged following prolonged moderate-intensity exercise in the heat. Previous studies have reported that blood viscosity is significantly increased following exercise. However, these studies measured both pre- and postexercise blood viscosity at 37 °C even though core and blood temperatures would be expected to have increased during the exercise. Consequently, the effect of exercise-induced hyperthermia on mitigating change in blood viscosity may have been missed. The purpose of this study was to isolate the effects of exercise-induced haemoconcentration and hyperthermia and to determine their combined effects on blood viscosity. Nine subjects performed 2 h of moderate-intensity exercise in the heat (37 °C, 40% relative humidity), which resulted in significant increases from pre-exercise values for rectal temperature (from 37.11 ± 0.35 to 38.76 ± 0.13 °C), haemoconcentration (haematocrit increased from 43.6 ± 3.6 to 45.6 ± 3.5%) and dehydration (change in body weight = -3.6 ± 0.7%). Exercise-induced haemoconcentration significantly (P blood viscosity by 9% (from 3.97 to 4.33 cP at 300 s(-1)), whereas exercise-induced hyperthermia significantly decreased blood viscosity by 7% (from 3.97 to 3.69 cP at 300 s(-1)). When both factors were considered together, there was no overall change in blood viscosity (from 3.97 to 4.03 cP at 300 s(-1)). The effects of exercise-induced haemoconcentration, increased plasma

  18. Irradiation mutation techniques combined with biotechnology for soybean breeding

    International Nuclear Information System (INIS)

    Wang Lianzheng; Wang Lan; Zhao Rongjuan; Pei Yanlong; Fu Yuqing; Yan Qingshang; Li Qiang

    2001-01-01

    By using 60 Co γ-irradiation to 30 adapted Chinese cultivars of soybean and selection of high yield, good quality, early maturity resistance to diseases and insects, several lines have been evaluated as good lines over the control, Zhonghuang 4, an important soybean variety in Beijing area. After 10 generations of individual selection, 5 high yield mutants are obtained and l ∼ 2 mutants from these mutants will be released in 2001. 3 mutants selected have the crude oil content of over 22.00%. The crude oil content of 397-2 is 23.52% and the crude protein content of 348-4 is 47.67%. 30 lines were evaluated for their genetic transformation ability and Heinong 35 has been identified as very suitable material for genetic transformation. (authors)

  19. Ontario emissions trading code : emission reduction credit creation, recording and transfer rules, rules for renewable energy projects and conservation projects, and rules for the operation of the Ontario Emissions Trading Registry

    International Nuclear Information System (INIS)

    2001-12-01

    Emissions trading has been an integral part of Ontario's air quality strategy since December 31, 2001. Ontario has adopted the 'cap, credit and trade' type of emissions trading system, a hybrid that takes the best features of pure 'cap-and-trade' and 'baseline-and-credit' type systems. It covers nitric oxide and sulphur dioxide. The Ontario Emissions Trading Code supplements Ontario Regulation 397/01 and sets out rules for renewable energy projects and conservation projects for which applications for emission allowances can be made. This Code describes the rules for the creation and transfer of emission reduction credits (ERCs). It also explains the rules for the operation of the registry that has been established to provide information to the public about the emissions trading program and records decisions about credit creation and credit and allowance retirement. 3 tabs

  20. The Study Of Metalworking Fluids Biodegradability By Indirect Measurement Of Bacterial Inoculum Respiration

    Directory of Open Access Journals (Sweden)

    Gerulová Kristína

    2015-06-01

    Full Text Available An apparatus for measuring biodegradability of metalworking fluids (MWFs was constructed according to (1, based on the Zahn-Wellens test which enables a continuous determination of CO2 production by the change in conductivity of absorption solution. Results obtained from the testing of 8 different MWFs by this modified method were compared to those obtained in standardized OECD 302 B. The comparison showed better description of bacterial inoculum activity in tested solution; lag phase was easy to indicate. Tested emulsion achieved the level of primary degradability 39.7 – 40.8 %, and semi-synthetics 19.1 – 43.5%. The samples of synthetics where the degradation level reached 43.9 - 58.6 % were identified as the most degradable metalworking fluids.

  1. Confirmatory factor analysis of the Malay version comprehensive feeding practices questionnaire tested among mothers of primary school children in Malaysia.

    Science.gov (United States)

    Shohaimi, Shamarina; Wei, Wong Yoke; Shariff, Zalilah Mohd

    2014-01-01

    Comprehensive feeding practices questionnaire (CFPQ) is an instrument specifically developed to evaluate parental feeding practices. It has been confirmed among children in America and applied to populations in France, Norway, and New Zealand. In order to extend the application of CFPQ, we conducted a factor structure validation of the translated version of CFPQ (CFPQ-M) using confirmatory factor analysis among mothers of primary school children (N = 397) in Malaysia. Several items were modified for cultural adaptation. Of 49 items, 39 items with loading factors >0.40 were retained in the final model. The confirmatory factor analysis revealed that the final model (twelve-factor model with 39 items and 2 error covariances) displayed the best fit for our sample (Chi-square = 1147; df = 634; P Malaysia. The present study extends the usability of the CFPQ and enables researchers and parents to better understand the relationships between parental feeding practices and related problems such as childhood obesity.

  2. [Injury rate and incidence of accidents with biological risk among infirmary students].

    Science.gov (United States)

    Rodríguez Martín, A; Novalbos Ruiz, J P; Costa Alonso, M J; Zafra Mezcua, J A

    2000-09-09

    A study of the incidence and characteristics of biological accidents among infirmary students during their practicals at the hospital. A retrospective study carried out at five centres by means of two questionnaires, one on the duration of the training and the rate of accidents and the other on the characteristics, precautions and ports exposure behaviour. Out of 397 students, 70,5% had accidents at a rate of 64% (CI 95%, 59-68). Of these, 15% were accidents with biological risk, the majority being jabs (39%) and splashes (32,5%). It is worth note that 49,2% occurred while putting away the material and 58% in the absence of any individual protective measures. One out of 8 accidents implied a biological risk. A very high rate of accidents was observed with important deficiencies in security.

  3. Causes of Rabbit Mortality at Mankon Research Station, Cameroon (1983-1987

    Directory of Open Access Journals (Sweden)

    Nfi, AN.

    1996-01-01

    Full Text Available A study was carried out to determine the causes of mortality in rabbits raised at the Institute of Zootechnical and Veterinary Research Station (IRZV Mankon between 1983-1987. Three breeds of rabbits the Californian, the New Zealand White and their crosses with local rabbits were used in the study. Within the period under review, all dead animals were necropsied and faecal and gastro-intestinal tract samples were examined in the laboratory. It was shown that high mortalities in rabbits were due to snuffles, pneumonia, mucoid enteritis, coccidiosis, mange, enterotoxaemia and Tyzzer's disease. 3060 rabbits died of various diseases comprising 1591 (52 % kittens, 1220 (39.7 % fryers and 280 (9.2 % adults. Kitten mortality compared to fryer and adult was highest ail through the period of study.

  4. Mycoremediation. The study of transfer factor for plutonium and americium uptake from the ground

    International Nuclear Information System (INIS)

    Dusan Galanda; Lubomir Matel; Jana Strisovska; Silvia Dulanska

    2014-01-01

    In our scientific research we have monitored mycoremediation's properties of oyster mushrooms in cultivation on the soil what is contaminated by solutions with radioactive isotopes of 239 Pu and 241 Am with known activity. We monitored specific activities of absorbed radionuclides in fruiting bodies and chemical forms of radionuclides which were compared to calculated specific activities of two background samples of oyster mushrooms intended for consumer purpose. We determined distributive coefficients between the ground and the fruiting body of oyster mushrooms. The average value which was obtained for the transfer factor for plutonium was 0.72 and for americium 3.97. To evaluate a quantity of absorbed radionuclides we used a method of liquid extraction. The emitting alpha radiation of alpha radionuclides was detected by spectrometry. For defining individual fractions of plutonium and americium that are contained in mushroom bodies was used the sequential leaching method. (author)

  5. A meta-analytic review of moral licensing.

    Science.gov (United States)

    Blanken, Irene; van de Ven, Niels; Zeelenberg, Marcel

    2015-04-01

    Moral licensing refers to the effect that when people initially behave in a moral way, they are later more likely to display behaviors that are immoral, unethical, or otherwise problematic. We provide a state-of-the-art overview of moral licensing by conducting a meta-analysis of 91 studies (7,397 participants) that compare a licensing condition with a control condition. Based on this analysis, the magnitude of the moral licensing effect is estimated to be a Cohen's d of 0.31. We tested potential moderators and found that published studies tend to have larger moral licensing effects than unpublished studies. We found no empirical evidence for other moderators that were theorized to be of importance. The effect size estimate implies that studies require many more participants to draw solid conclusions about moral licensing and its possible moderators. © 2015 by the Society for Personality and Social Psychology, Inc.

  6. 5-HTTLPR polymorphism is associated with nostalgia proneness: The role of neuroticism.

    Science.gov (United States)

    Luo, Yu L L; Welker, Keith M; Way, Baldwin; DeWall, Nathan; Bushman, Brad J; Wildschut, Tim; Sedikides, Constantine

    2017-12-12

    Nostalgia, a sentimental longing for the past, is a self-relevant and social emotion. Nostalgia proneness is associated with alleviation of distress or instability (e.g., neuroticism). Although nostalgia proneness is heritable, the specific molecular contributors to this heritability are unknown. We focused on a polymorphism in the promoter of the serotonin transporter gene (5-HTTLPR) as a possible biological basis of nostalgia proneness, because the serotonin system has been associated with sensitivity to negative experience. Participants (N = 397 adults) who had reported levels of nostalgia proneness were genotyped. A subsample also completed a measure of neuroticism. Participants with the 5-HTTLPR short allele were higher on nostalgia proneness than those without this allele. Neuroticism mediated the relation between 5-HTTLPR and nostalgia proneness. These findings enrich our understanding of the genetic and personality underpinnings of nostalgia.

  7. Graphene/polyaniline composite sponge of three-dimensional porous network structure as supercapacitor electrode

    International Nuclear Information System (INIS)

    Jiang Jiu-Xing; Zhang Xu-Zhi; Wang Zhen-Hua; Xu Jian-Jun

    2016-01-01

    As a supercapacitor electrode, the graphene/polyaniline (PANI) composite sponge with a three-dimensional (3D) porous network structure is synthesized by a simple three-step method. The three steps include an in situ polymerization, freeze-drying and reduction by hydrazine vapor. The prepared sponge has a large specific surface area and porous network structure, so it is in favor of spreading the electrolyte ion and increasing the charge transfer efficiency of the system. The process of preparation is simple, easy to operate and low cost. The composite sponge shows better electrochemical performance than the pure individual graphene sponge while PANI cannot keep the shape of a sponge. Such a composite sponge exhibits specific capacitances of 487 F·g −1 at 2 mV/s compared to pristine PANI of 397 F·g −1 . (paper)

  8. Fatigue and chills in a 60-year-old hypertensive alcoholic

    International Nuclear Information System (INIS)

    Kosovsky, P.A.; Weinberg, B.; Lewin, B.; Vieux, U.

    1986-01-01

    A 60-year-old woman with a history of alcohol abuse and hypertension presented to the emergency room because of increasing fatigue and shaking chills. Her temperature was 39.7 0 C (103.4 0 F) and her blood pressure was 90/60 mm Hg. Tenderness was present in the left upper and lower quadrants of the abdomen with guarding. Laboratory findings included a white blood cell count of 20 000/mm 3 (20.0x10 9 /L) with a leftward shift, abnormal results on liver function tests, anemia, a serum urea nitrogen concentration of 44 mg/dL (15.5 mmol/L), and a creatinine level of 1.6 mg/dL (140 μmol/L), in addition to a prolonged prothrombin time. Roentgenograms of the abdomen and chest were obtained

  9. Homodimers of Vanillin and Apocynin Decrease the Metastatic Potential of Human Cancer Cells by Inhibiting the FAK/PI3K/Akt Signaling Pathway.

    Science.gov (United States)

    Jantaree, Phatcharida; Lirdprapamongkol, Kriengsak; Kaewsri, Wilailak; Thongsornkleeb, Charnsak; Choowongkomon, Kiattawee; Atjanasuppat, Korakot; Ruchirawat, Somsak; Svasti, Jisnuson

    2017-03-22

    The spread of cancer cells to distant organs, in a process called metastasis, is the main factor that contributes to most death in cancer patients. Vanillin, the vanilla flavoring agent, has been shown to suppress metastasis in a mouse model. Here, we evaluated the antimetastatic potential of the food additive divanillin, the homodimer of vanillin, and their structurally related compounds, apocynin and diapocynin, in hepatocellular carcinoma cells. The Transwell invasion assay showed that the dimeric forms exhibited a potency higher than those of vanillin and apocynin in inhibiting invasion, with IC 50 values of 23.3 ± 7.4 to 41.3 ± 4.2 μM for the dimers, which are 26-34-fold lower than IC 50 values of vanillin and apocynin (p vanillin and apocynin to the Y397 pocket of the FAK FERM domain. Thus, the food additive divanillin has antimetastatic potential greater than that of the flavoring agent vanillin.

  10. Determination of selenium in biological material by instrumental neutron activation analysis using {sup 77m} Se radioisotope; Determinacao de selenio em materiais biologicos por analise por ativacao com neutrons instrumental usando o radioisotopo {sup 77m} Se

    Energy Technology Data Exchange (ETDEWEB)

    Vasconcellos, Maria B.A.; Moreira, Edson G.; Catharino, Marilia G.M.; Tokura, Alexandra M.; Saiki, Mitiko [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Supervisao de Radioquimica

    1999-11-01

    Selenium is an essential element in human diet due to its relation to the protection against carcinogenic substances, heart disease, hypertension, sexual performance enhancement, and others. In this work Se concentration in samples of the biological certificate reference materials Human Hair BCR-CRM 397, Spiked Human Hair IAEA-085, Unspiked Human Hair IAEA-086; Dogfish Liver DOLT-1 and Dogfish Muscle DORM-1 were determined in order to improve the instrumental neutron activation analysis, INAA, method using {sup 77m} Se radioisotope. The application of this method allows the analysis of a large number of samples of samples with reduced time of experimental and cost. the best results were obtained with the reactor operating at 5 MW and time of irradiation between 10 and 20 s. In these experimental conditions the relative standard deviation and error were generally lower than 10%. (author) 5 refs., 7 tabs.

  11. Oil price sinks drilling : exploration activity drops during third quarter

    International Nuclear Information System (INIS)

    Harrington, P.

    1998-01-01

    The decline in oil and gas exploration activity in Western Canada is discussed. In the third quarter of 1998, a total of 397 exploratory tests were reported compared to 768 during the same period in 1997. Low world oil prices are blamed as the cause of this decline. The declining exploration activity in 1998 was led by Alberta, with 289 new pool wildcat (NPW) announcements along with 25 new field wildcat (NFW) locations. Saskatchewan was in second place with 67 exploratory announcements, but compared to 329 in 1997, this represents an 80 per cent drop. British Columbia had a total of 15 exploratory wells resulting in three oil discoveries and 11 gas completions. Geological features, well characteristics and early production figures from several of the new wells in the Killam fields in southwest Saskatchewan were received special attention. 1 tab., 3 figs

  12. Fabrication of Flexible Arrayed Lactate Biosensor Based on Immobilizing LDH-NAD+ on NiO Film Modified by GO and MBs

    Science.gov (United States)

    Yan, Siao-Jie; Liao, Yi-Hung; Lai, Chih-Hsien; Wu, You-Xiang; Wu, Cian-Yi; Chen, Hsiang-Yi; Huang, Hong-Yu; Wu, Tong-Yu

    2017-01-01

    We proposed the flexible arrayed lactate biosensor based on immobilizing l-lactate dehydrogenase (LDH) and nicotinamide adenine dinucleotide (NAD+) on nickel oxide (NiO) film, and which the average sensitivity could be enhanced by using graphene oxide (GO) and magnetic beads (MBs). By using GO and MBs, it exhibits excellent sensitivity (45.397 mV/mM) with a linearity of 0.992 in a range of 0.2 mM to 3 mM. According to the results of electrochemical impedance spectroscopy (EIS), the electron transfer resistance of LDH-NAD+-MBs/GPTS/GO/NiO film was smaller than those of LDH-NAD+/GPTS/GO/NiO film and LDH-NAD+/GPTS/NiO film, and it presented the outstanding electron transfer ability. After that, the limit of detection, anti-interference effect and bending test were also investigated. PMID:28704960

  13. Fabrication of Flexible Arrayed Lactate Biosensor Based on Immobilizing LDH-NAD+ on NiO Film Modified by GO and MBs

    Directory of Open Access Journals (Sweden)

    Jung-Chuan Chou

    2017-07-01

    Full Text Available We proposed the flexible arrayed lactate biosensor based on immobilizing l-lactate dehydrogenase (LDH and nicotinamide adenine dinucleotide ( NAD + on nickel oxide (NiO film, and which the average sensitivity could be enhanced by using graphene oxide (GO and magnetic beads (MBs. By using GO and MBs, it exhibits excellent sensitivity (45.397 mV/mM with a linearity of 0.992 in a range of 0.2 mM to 3 mM. According to the results of electrochemical impedance spectroscopy (EIS, the electron transfer resistance of LDH- NAD + -MBs/GPTS/GO/NiO film was smaller than those of LDH-NAD+/GPTS/GO/NiO film and LDH- NAD + /GPTS/NiO film, and it presented the outstanding electron transfer ability. After that, the limit of detection, anti-interference effect and bending test were also investigated.

  14. The Lexis plot for run-off non-life insurance companies in United Kingdom

    Science.gov (United States)

    Samsudin, Humaida Banu

    2014-06-01

    This study is intended to look at the company's age to be one of the predictor for financially distressed non-life insurance companies in United Kingdom. Financial distress is a condition where a company has difficulty paying off its obligations to its creditors. For this study, Lexis plot is used to identify either younger companies or older companies are in run-off. Run-off is a process where many insurance companies stop underwriting policies long before they reach financial crisis or financial distress. The study utilises financial data of 22 years from year 1985 to year 2006 for 397 companies. From the study, it is identified that younger companies are more in financial distress than older companies.

  15. FeCrO Nanoparticles as Anode Catalyst for Ethane Proton Conducting Fuel Cell Reactors to Coproduce Ethylene and Electricity

    Directory of Open Access Journals (Sweden)

    Jian-Hui Li

    2011-01-01

    Full Text Available Ethylene and electrical power are cogenerated in fuel cell reactors with FeCr2O4 nanoparticles as anode catalyst, La0.7Sr0.3FeO3- (LSF as cathode material, and BaCe0.7Zr0.1Y0.2O3- (BCZY perovskite oxide as proton-conducting ceramic electrolyte. FeCr2O4, BCZY and LSF are synthesized by a sol-gel combustion method. The power density increases from 70 to 240 mW cm−2, and the ethylene yield increases from about 14.1% to 39.7% when the operating temperature of the proton-conducting fuel cell reactor increases from 650∘C to 750∘C. The FeCr2O4 anode catalyst exhibits better catalytic performance than nanosized Cr2O3 anode catalyst.

  16. Quantification of in vivo implant wear in total knee replacement from dynamic single plane radiography

    Science.gov (United States)

    Teeter, Matthew G.; Seslija, Petar; Milner, Jaques S.; Nikolov, Hristo N.; Yuan, Xunhua; Naudie, Douglas D. R.; Holdsworth, David W.

    2013-05-01

    An in vivo method to measure wear in total knee replacements was developed using dynamic single-plane fluoroscopy. A dynamic, anthropomorphic total knee replacement phantom with interchangeable, custom-fabricated components of known wear volume was created, and dynamic imaging was performed. For each frame of the fluoroscopy data, the relative location of the femoral and tibial components were determined, and the apparent intersection of the femoral component with the tibial insert was used to calculate wear volume, wear depth, and frequency of intersection. No difference was found between the measured and true wear volumes. The precision of the measurements was ±39.7 mm3 for volume and ±0.126 mm for wear depth. The results suggest the system is capable of tracking wear volume changes across multiple time points in patients. As a dynamic technique, this method can provide both kinematic and wear measurements that may be useful for evaluating new implant designs for total knee replacements.

  17. Ras-Induced and Extracellular Signal-Regulated Kinase 1 and 2 Phosphorylation-Dependent Isomerization of Protein Tyrosine Phosphatase (PTP)-PEST by PIN1 Promotes FAK Dephosphorylation by PTP-PEST ▿

    Science.gov (United States)

    Zheng, Yanhua; Yang, Weiwei; Xia, Yan; Hawke, David; Liu, David X.; Lu, Zhimin

    2011-01-01

    Protein tyrosine phosphatase (PTP)-PEST is a critical regulator of cell adhesion and migration. However, the mechanism by which PTP-PEST is regulated in response to oncogenic signaling to dephosphorylate its substrates remains unclear. Here, we demonstrate that activated Ras induces extracellular signal-regulated kinase 1 and 2-dependent phosphorylation of PTP-PEST at S571, which recruits PIN1 to bind to PTP-PEST. Isomerization of the phosphorylated PTP-PEST by PIN1 increases the interaction between PTP-PEST and FAK, which leads to the dephosphorylation of FAK Y397 and the promotion of migration, invasion, and metastasis of v-H-Ras-transformed cells. These findings uncover an important mechanism for the regulation of PTP-PEST in activated Ras-induced tumor progression. PMID:21876001

  18. Florida creativity index scores, conservatism, and openness in 268 U.S. regions.

    Science.gov (United States)

    McCann, Stewart J H

    2011-02-01

    This study assessed whether Florida's Creativity Index (2002) scores for 268 U.S. regions were related to levels of conservatism and openness in the states in which the regions were situated. State conservatism was measured as the percentage voting for Bush in 2000. State openness z scores were taken from a survey of 619,397 residents (Rentfrow, Gosling, & Potter, 2008). Creativity scores correlated negatively with conservatism (r = -.22) and positively with openness (r = .23). Regression showed that the two predictors accounted jointly (7%) and separately for significant variance in the Creativity Index. The findings contribute evidence for the construct validity of Florida's composite Creativity Index and some, albeit moderate to weak, support of the Rentfrow, et al. conclusion that state-aggregated openness reflects the unconventionality, tolerance, and creativity of a state.

  19. New trends in increase of efficacy of preoperative irradiation of malignant tumors

    International Nuclear Information System (INIS)

    Berdov, B.A.; Dunchik, V.N.; Firsova, P.P.; Sidorchenkov, V.O.

    1982-01-01

    It was shown the use of preoperative irradiation as a means altering the biologic nature of the tumor before the operation. The main attention is paid to development of methods for preoperative irradiation of malignant tumors, i. e. macrofractionated long-distance irradiation, intracavitary, combined irradiation, as well as to study of the effect of synchronization of tumor cells with 5-fluorouracil, of local heating of the tumor, and of electron-acceptor compounds application in the preoperative period. The results of combined treatment of 1007 patients with cancer of various localization: 121 patients with laryngeal carcinoma, 397 with mammary carcinoma, 100 with pulmonary carcinoma, 258 with gastric carcinoma, 131 with rectal carcinoma, and 114 with carcinoma of the urinary bladder were analyzed

  20. Fish oil supplementation during pregnancy and offspring risk of attention deficit/hyperactivity disorder and depression

    DEFF Research Database (Denmark)

    Strøm, Marin; Maslova, E.; Hansen, S.

    2013-01-01

    . Objective: To examine the effect of fish oil supplementation in pregnancy on offspring risk of attention deficit/ hyperactivity disorder (ADHD) and depression. Methods: We used data from 397 and 654 singleton offspring of mothers who were randomized to fish oil (providing 1 g/day of DHA) or olive oil during...... pregnancy as participants in: the RCT90, a single center trial enrolling normal pregnancies in 1990, and FOTIP, a multicenter trial enrolling high-risk pregnancies during 1990–1996. We used definitions of ADHD and depression based on ICD-10 codes and drug dispensary data, using information on first...... prescription/hospital contact as a proxy for ADHD and depression, respectively. We performed intention-to-treat analysis and report odds ratios (ORs) and 95% CI comparing the two intervention groups. Results: There were 17 and 35 cases of ADHD among offspring to participants in RCT90 and FOTIP, respectively...

  1. Neurological and cardiac complications in a cohort of children with end-stage renal disease

    Directory of Open Access Journals (Sweden)

    Jumana H Albaramki

    2016-01-01

    Full Text Available Adult patients with chronic kidney disease are at risk of major neurologic and cardiac complications. The purpose of this study is to review the neurological and cardiac complications in children with end-stage renal disease (ESRD. A retrospective review of medical records of children with ESRD at Jordan University Hospital was performed. All neurological and cardiac events were recorded and analyzed. Data of a total of 68 children with ESRD presenting between 2002 and 2013 were reviewed. Neurological complications occurred in 32.4%; seizures were the most common event. Uncontrolled hypertension was the leading cause of neurological events. Cardiac complications occurred in 39.7%, the most common being pericardial effusion. Mortality from neurological complications was 45%. Neurological and cardiac complications occurred in around a third of children with ESRD with a high mortality rate. More effective control of hypertension, anemia, and intensive and gentle dialysis are needed.

  2. LEP Measurements of Vcb using B0 → D*+l-ν

    International Nuclear Information System (INIS)

    Tarem, S.

    2001-01-01

    The magnitude of the CKM matrix element V cb has been measured using B 0 -bar → D *+ l - ν-bar decays recorded on the Z 0 peak using the OPAL, ALEPH and DELPHI detectors at LEP. The D* + → D 0 π + decays were reconstructed both in particular decay modes and via an inclusive technique. The product of vertical bar V cb vertical bar and the decay form factor of the B 0 -bar → D* + l - ν-bar transition at zero recoil F(1) was measured to be F(1) vertical bar V cb vertical bar = (34.9 ± 1.7) x 10 -3 . vertical bar V cb vertical bar = (39.7 ± 1.9 ± 2.2) x 10 -3 is obtained by using Heavy Quark Effective Theory calculations for F(1)

  3. Hydraulic conductivities of fractures and matrix in Slovenian carbonate aquifers

    Directory of Open Access Journals (Sweden)

    Timotej Verbovšek

    2008-12-01

    Full Text Available Hydraulic conductivities and specific storage coefficients of fractures and matrix in Slovenian carbonate aquifers were determined by Barker’s method for pumping test analysis, based on fractional flow dimension. Values are presented for limestones and mainly for dolomites, and additionally for separate aquifers, divided by age andlithology in several groups. Data was obtained from hydrogeological reports for 397 water wells, and among these, 79 pumping tests were reinterpreted. Hydraulic conductivities of fractures are higher than the hydraulic conductivities of matrix, and the differences are highly statistically significant. Likewise, differences are significant for specific storage, and the values of these coefficients are higher in the matrix. Values of all coefficients vary in separate aquifers, and the differences can be explained by diagenetic effects, crystal size, degree of fracturing, andcarbonate purity. Comparison of the methods, used in the reports, and the Barker’s method (being more suitable for karstic and fractured aquifers, shows that the latter fits real data better.

  4. Transcriptome profiling of human pre-implantation development.

    Directory of Open Access Journals (Sweden)

    Pu Zhang

    Full Text Available BACKGROUND: Preimplantation development is a crucial step in early human development. However, the molecular basis of human preimplantation development is not well known. METHODOLOGY: By applying microarray on 397 human oocytes and embryos at six developmental stages, we studied the transcription dynamics during human preimplantation development. PRINCIPAL FINDINGS: We found that the preimplantation development consisted of two main transitions: from metaphase-II oocyte to 4-cell embryo where mainly the maternal genes were expressed, and from 8-cell embryo to blastocyst with down-regulation of the maternal genes and up-regulation of embryonic genes. Human preimplantation development proved relatively autonomous. Genes predominantly expressed in oocytes and embryos are well conserved during evolution. SIGNIFICANCE: Our database and findings provide fundamental resources for understanding

  5. Pore chemistry and size control in hybrid porous materials for acetylene capture from ethylene

    KAUST Repository

    Cui, X.

    2016-05-20

    The trade-off between physical adsorption capacity and selectivity of porous materials is a major barrier for efficient gas separation and purification through physisorption. We report control over pore chemistry and size in metal coordination networks with hexafluorosilicate and organic linkers for the purpose of preferential binding and orderly assembly of acetylene molecules through cooperative host-guest and/or guest-guest interactions. The specific binding sites for acetylene are validated by modeling and neutron powder diffraction studies. The energies associated with these binding interactions afford high adsorption capacity (2.1 millimoles per gram at 0.025 bar) and selectivity (39.7 to 44.8) for acetylene at ambient conditions. Their efficiency for the separation of acetylene/ethylene mixtures is demonstrated by experimental breakthrough curves (0.73 millimoles per gram from a 1/99 mixture).

  6. Surgical outcomes of laparoscopic hysterectomy with concomitant endometriosis without bowel or bladder dissection: a cohort analysis to define a case-mix variable.

    Science.gov (United States)

    Sandberg, Evelien M; Driessen, Sara R C; Bak, Evelien A T; van Geloven, Nan; Berger, Judith P; Smeets, Mathilde J G H; Rhemrev, Johann P T; Jansen, Frank Willem

    2018-01-01

    Pelvic endometriosis is often mentioned as one of the variables influencing surgical outcomes of laparoscopic hysterectomy (LH). However, its additional surgical risks have not been well established. The aim of this study was to analyze to what extent concomitant endometriosis influences surgical outcomes of LH and to determine if it should be considered as case-mix variable. A total of 2655 LH's were analyzed, of which 397 (15.0%) with concomitant endometriosis. For blood loss and operative time, no measurable association was found for stages I ( n  = 106) and II ( n  = 103) endometriosis compared to LH without endometriosis. LH with stages III ( n  = 93) and IV ( n  = 95) endometriosis were associated with more intra-operative blood loss ( p  = case-mix variables in future quality measurement tools.

  7. Measuring Social Capital Investment: Scale Development and Examination of Links to Social Capital and Perceived Stress

    Science.gov (United States)

    Wegner, Rhiana; Gong, Jie; Fang, Xiaoyi; Kaljee, Linda

    2014-01-01

    Individuals with greater social capital have better health outcomes. Investment in social capital likely increases one’s own social capital, bearing great implications for disease prevention and health promotion. In this study, the authors developed and validated the Social Capital Investment Inventory (SCII). Direct effects of social capital investment on perceived stress, and indirect effects through social capital were examined. 397 Participants from Beijing and Wuhan, China completed surveys. Analyses demonstrated that the SCII has a single factor structure and strong internal consistency. Structural equation modeling showed that individuals who invested more in social capital had greater bonding social capital, and subsequently less perceived stress. Results suggest that disease prevention and health promotion programs should consider approaches to encourage social capital investment; individuals may be able to reduce stress by increasing their investment in social capital. Future research is needed to provide additional empirical support for the SCII and observed structural relationships. PMID:25648725

  8. Gender Differences in Depressive Symptom Profile: Results from Nationwide General Population Surveys in Korea.

    Science.gov (United States)

    Kim, Ji-Hyun; Cho, Maeng Je; Hong, Jin Pyo; Bae, Jae Nam; Cho, Seong-Jin; Hahm, Bong-Jin; Lee, Dong-Woo; Park, Jong-Ik; Lee, Jun-Young; Jeon, Hong Jin; Chang, Sung Man

    2015-11-01

    This study investigated gender differences in symptom profiles of major depressive disorder (MDD) in the Korean general population. Data were pooled from the series of nationwide Korean Epidemiologic Catchment Area surveys conducted in 2001, 2006 and 2011, respectively. Of the 18,807 participants, 507 (397 women and 110 men) were diagnosed with MDD within the prior 12 months. In agreement with previous studies, women with MDD appeared to be more vulnerable to experiencing atypical depressive episodes defined as depression with two or more symptoms of fatigue, increased appetite and hypersomnia (P differences in symptomatology of MDD in the general Korean population, and the results are comparable to previous investigations from western societies. Assumingly, the intercultural similarity in female preponderance to atypical depression might reflect the common biological construct underlying the gender difference in mechanism of MDD. In clinical settings, gender differences of MDD should be carefully considered, because these features could be related with treatment response and drug side effects.

  9. The effect of low-speed drilling without irrigation on heat generation: an experimental study.

    Science.gov (United States)

    Oh, Ji-Hyeon; Fang, Yiqin; Jeong, Seung-Mi; Choi, Byung-Ho

    2016-02-01

    In this study we evaluated heat generation during the low-speed drilling procedure without irrigation. Ten artificial bone blocks that were similar to human D1 bone were used in this study. The baseline temperature was 37.0℃. We drilled into 5 artificial bone blocks 60 times at the speed of 50 rpm without irrigation. As a control group, we drilled into an additional 5 artificial bone blocks 60 times at the speed of 1,500 rpm with irrigation. The temperature changes during diameter 2 mm drilling were measured using thermocouples. The mean maximum temperatures during drilling were 40.9℃ in the test group and 39.7℃ in the control group. Even though a statistically significant difference existed between the two groups, the low-speed drilling did not produce overheating. These findings suggest that low-speed drilling without irrigation may not lead to overheating during drilling.

  10. Free radical scavengers from the aerial parts of Grammosciadium platycarpum Boiss. & Hausskn. (Apiaceae and GC-MS analysis of the essential oils from its fruits

    Directory of Open Access Journals (Sweden)

    Hossein Nazemiyeh

    2010-05-01

    Full Text Available Grammosciadium platycarpum Boiss. & Hausskn (Apiaceae is one of three endemic Iranian species of the genus Grammosciadium DC. Consumption of the aerial parts of this plant affects renal function and causes diuresis. In the DPPH assay the methanol extract showed the highest level of free radical scavenging activity (RC50 = 1.196 x 10-2 mg/mL among the extracts. Reversed-phase preparative HPLC analyses of the methanol extract yielded nine flavonoids, which were responsible for the free radical scavenging activity of the MeOH extract. The GC-MS analyses of the essential oils led to the identification of 29 terpenoids, mainly monoterpenes (non-oxygenated 3.97% and oxygenated 77.49% accounting for over 96% of the total oils.

  11. Crystal structure of ethyl (2Z-2-cyano-3-[(3-methyl-1-phenyl-1H-pyrazol-5-ylamino]prop-2-enoate

    Directory of Open Access Journals (Sweden)

    Joel T. Mague

    2014-11-01

    Full Text Available The title compound, C16H16N4O2, crystallizes with two molecules in the asymmetric unit, one of which shows disorder of the acetate group over two sets of sites in a 0.799 (2:0.201 (2 ratio. The phenyl group has a similar but opposite sense of twist relative to the pyrazole ring in the two molecules, as indicated by the syn N—N—Car—Car (ar = aromatic torsion angles of 39.7 (2 and −36.9 (2°. Each molecule features an intramolecular N—H...O hydrogen bond, which closes an S(6 ring. In the crystal, C—H...O and C—H...N interactions direct the packing into a layered structure parallel to (110.

  12. Relational conflict and outcomes from an online divorce education program.

    Science.gov (United States)

    Cronin, Sarah; Becher, Emily H; McCann, Ellie; McGuire, Jenifer; Powell, Sharon

    2017-06-01

    The impact of conflict on co-parenting outcomes of divorce education programs is not widely explored in the literature despite the prevalence of conflict in divorce. This study used outcome data from a sample of participants (N=272) who took the online Parents Forever™ course between 2012 and 2014. Participants were asked questions about positive and negative co-parenting behaviors as well their levels of conflict before and after the divorce or separation. There was on average a slight increase in conflict from post to follow-up (M=-0.397, SD=1.54). Simple linear regression analyses indicated that change in conflict explained a significant proportion of the variance in positive co-parenting scores, R 2 =0.07, F(1, 270)=19.98, pimpacts co-parenting behaviors targeted in the Parents Forever ™ course. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Effect of hydrophobicity of pharmaceuticals and personal care products for adsorption on activated carbon: Adsorption isotherms, kinetics and mechanism.

    Science.gov (United States)

    Kaur, Harkirat; Bansiwal, Amit; Hippargi, Girivyankatesh; Pophali, Girish R

    2017-09-11

    Adsorption of three pharmaceuticals and personal care products (PPCPs), namely caffeine, ibuprofen and triclosan on commercial powdered activated carbon was examined in aqueous medium. The contaminants were chosen based on their diverse log K ow (octanol-water partition coefficient) viz. - 0.07 for caffeine, 3.97 for ibuprofen and 4.76 for triclosan to examine the role of hydrophobicity on adsorption process. The adsorbent characterisation was achieved using BET surface area, SEM, pore size distribution studies and FTIR. Influence of mass of PAC, contact time, solution pH and initial concentration on adsorption capacity of PAC was studied. Adsorption isotherms and kinetics were applied to establish the mechanism of adsorption. The kinetics followed pseudo-second order with physisorption occurring through particle diffusion. The Freundlich model fitted best among the isotherm models. The adsorption capacity increased in the order CFN activated carbon.

  14. Modality shift effects mimic multisensory interactions

    DEFF Research Database (Denmark)

    Gondan, Matthias; Vorberg, D.; Greenlee, M.W.

    2007-01-01

    be avoided using an additional tactile stimulus (T) and evaluating the ERP difference (T + TAV) - (TA + TV). A second possible confound is the modality shift effect (MSE): for example, the auditory N1 is increased if an auditory stimulus follows a visual stimulus, whereas it is smaller if the modality......A frequent approach to study interactions of the auditory and the visual system is to measure event-related potentials (ERPs) to auditory, visual, and auditory-visual stimuli (A, V, AV). A nonzero result of the AV - (A + V) comparison indicates that the sensory systems interact at a specific...... processing stage. Two possible biases weaken the conclusions drawn by this approach: first, subtracting two ERPs from one requires that A, V, and AV do not share any common activity. We have shown before (Gondan and Röder in Brain Res 1073-1074:389-397, 2006) that the problem of common activity can...

  15. Hypoxia compounds exercise-induced free radical formation in humans; partitioning contributions from the cerebral and femoral circulation

    DEFF Research Database (Denmark)

    Bailey, Damian M; Rasmussen, Peter; Evans, Kevin A

    2018-01-01

    This study examined to what extent the human cerebral and femoral circulation contribute to free radical formation during basal and exercise-induced responses to hypoxia. Healthy participants (5♂, 5♀) were randomly assigned single-blinded to normoxic (21% O2) and hypoxic (10% O2) trials...... hypoxia (P free radical-mediated lipid peroxidation subsequent to inadequate antioxidant defense. This was pronounced during exercise across the femoral circulation in proportion to the increase in local O2 uptake (r = -0.397 to -0.459, P = 0.037 to 0...... with measurements taken at rest and 30min after cycling at 70% of maximal power output in hypoxia and equivalent relative and absolute intensities in normoxia. Blood was sampled from the brachial artery (a), internal jugular and femoral veins (v) for non-enzymatic antioxidants (HPLC), ascorbate radical (A...

  16. Cooperative medical insurance and the cost of care in Shandong, PR China: perspectives of patients and community members.

    Science.gov (United States)

    Mahmood, Mohammad Afzal; Raulli, Alexandra; Yan, Wang; Dong, Han; Aiguo, Zhang; Ping, Dong

    2015-03-01

    This research was conducted to identify the cost of care associated with utilization of village clinics and membership of the New Cooperative Medical Scheme (NCMS) in 2 counties of Shandong province, PR China. A total of 397 community members and 297 patients who used the village clinics were interviewed. The average cost for primary care treatment of 1 episode of illness was about 55 yuan (about US$8). Although more than 50% of people had NCMS membership, many consider the monetary reimbursements as insufficient. The low insurance reimbursement rates and inability to pay out-of-pocket expenses compromise access to care. Delays can cause more serious illnesses with potential to overburden the secondary care at the township and county hospitals. Those rural people who have not yet enjoyed the benefits of China's economic development may not benefit from recent health care reform and finance mechanisms unless schemes such as the NCMS provide more substantial subsidies. © 2010 APJPH.

  17. [Ursodeoxycholic acid induced apoptosis of human hepatoma cells HepG2 and SMMC-7721 bymitochondrial-mediated pathway].

    Science.gov (United States)

    Wu, Duan; Zhou, Jianyin; Yin, Zhenyu; Liu, Pingguo; Zhao, Yilin; Liu, Jianming; Wang, Xiaomin

    2014-12-02

    To explore the effects and underlying mechanisms of ursodeoxycholic acid on human hepatoma cells. HepG2 and SMMC-7721 HCC cell lines were respectively treated with ursodeoxycholic acid. And cell proliferation, apoptosis and the expression of Bax/Bcl-2 gene were detected by methyl thiazolyl tetrazolium (MTT), inverted microscopy, fluorescent microscopy, flow cytometry and Western blot. Ursodeoxycholic acid significantly inhibited the proliferation of human hepatoma cells in a concentration- and time-dependent manner. The half maximal inhibitory concentrations (IC50) of HepG2 and SMMC-7721 were 397.3 and 387.7 µg/ml respectively after a 48-hour treatment of 400 µg /ml ursodeoxycholic acid. And it also induced the apoptosis of HepG2 and SMMC-7721 cells, up-regulated Bax gene and down-regulated Bcl-2 gene. Ursodeoxycholic acid inhibits the proliferation of hepatoma cells and induce apoptosis by mitochondrial-mediated pathway.

  18. Sugammadex

    Science.gov (United States)

    Cada, Dennis J.; Levien, Terri L.; Baker, Danial E.

    2016-01-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, contact Wolters Kluwer customer service at 866-397-3433. The July 2016 monograph topics are pimavanserin, venetoclax, defibrotide, lifitegrast ophthalmic solution 5%, and atezolizumab. The Safety MUE is on pimavanserin. PMID:27559192

  19. Avaliação da concentração de alguns íons metálicos em diferentes espécies de líquens do cerrado Sul-Mato-Grossense Evaluation of concentration of some metal ions in different lichen species of the Sul-Mato-Grossensse cerrado

    Directory of Open Access Journals (Sweden)

    Jorge Luiz Raposo Junior

    2007-06-01

    Full Text Available Concentrations of Fe, Mn, Co, Cr, Zn and Cu were determinated using flame atomic absorption spectrometry in nine lichen species of the Sul-Mato-Grossense cerrado. The average metal ion concentrations varied in the following ranges: Fe, 248.41-1568.01; Mn, 98.50-397.33; Co, 10.08-24.81; Cr, 18.24-44.26; Zn, 14.62-34.79 and Cu, 3.23-7.57 mg kg-1. Statistical analysis (Pearson and Cluster applied to the metal ion concentrations indicated that the accumulation of these ions can be due to several anthropogenic sources including agricultural activities, mineral exploration, biomass burning, soil mineral composition and leather tanning processes by chromium.

  20. Plasma concentration of asymmetric dimethylarginine (ADMA) predicts cardiovascular morbidity and mortality in type 1 diabetic patients with diabetic nephropathy

    DEFF Research Database (Denmark)

    Lajer, Maria Stenkil; Tarnow, Lise; Jorsal, Anders

    2008-01-01

    OBJECTIVE: To investigate whether circulating asymmetric dimethylarginine (ADMA) levels are predictive of cardiovascular events, decline in glomerular filtration rate (GFR), end-stage renal disease (ESRD), and all-cause mortality in type 1 diabetic patients. RESEARCH DESIGN AND METHODS: We...... performed a prospective observational follow-up study including 397 type 1 diabetic patients with overt diabetic nephropathy (243 men aged 42.1 +/- 10.5 years, GFR 76 +/- 34 ml/min per 1.73 m(2)) and a control group of 175 patients with longstanding type 1 diabetes and persistent normoalbuminuria (104 men...... aged 42.7 +/- 9.7 years, duration of diabetes 27.7 +/- 8.3 years). Patients were followed for a median 11.3 years (range 0.0-12.9) with yearly measurements of GFR ((51)Cr-EDTA plasma clearance) in patients with diabetic nephropathy. Endpoints were fatal and nonfatal cardiovascular disease (CVD...

  1. Langevin equation in effective theory of interacting QCD pomerons in the limit of large Nc

    International Nuclear Information System (INIS)

    Bondarenko, S.

    2007-01-01

    Effective field theory of interacting BFKL pomerons is investigated and Langevin equation for the theory, which arises after the introduction of additional auxiliary field, is obtained. The Langevin equations are considered for the case of interacting BFKL pomerons with both splitting and merging vertexes and for the interaction which includes additional 'toy' four pomeron interaction vertex. In the latest case an analogy with the Regge field theory in zero dimensions (RFT-0) was used in order to obtain this 'toy' vertex, which coincided with the four point function of two-dimensional conformal field theory obtained in [G.P. Korchemsky, Nucl. Phys. B 550 (1999) 397]. The comparison between the Langevin equations obtained in the frameworks of dipole and RFT approaches is performed, the interpretation of results is given and possible application of obtained equations is discussed

  2. Assessment of DSM-5 Section II Personality Disorders With the MMPI-2-RF in a Nonclinical Sample.

    Science.gov (United States)

    Sellbom, Martin; Smith, Alexander

    2017-01-01

    The Minnesota Multiphasic Personality Inventory-2-Restructured Form (MMPI-2-RF; Ben-Porath & Tellegen, 2008 / 2011 ) is frequently used in clinical practice. However, there has been a dearth of literature on how well this instrument can assess symptoms associated with personality disorders (PDs). This investigation examined a range of hypothesized MMPI-2-RF scales in predicting PD symptoms. We evaluated these associations in a sample of 397 university students who had been administered the MMPI-2-RF and the Structured Clinical Interview for DSM-IV Axis II Disorders-Personality Questionnaire (First, Gibbon, Spitzer, Williams, & Benjamin, 1997 ). Zero-order correlation analyses and negative binomial regression models indicated that a wide range of MMPI-2-RF scale hypotheses were supported; however, the least support was available for predicting schizoid and obsessive-compulsive PDs. Implications for MMPI-2-RF interpretation and PD diagnosis are discussed.

  3. Inequivalent topologies of chaos in simple equations

    International Nuclear Information System (INIS)

    Letellier, Christophe; Roulin, Elise; Roessler, Otto E.

    2006-01-01

    In the 1970, one of us introduced a few simple sets of ordinary differential equations as examples showing different types of chaos. Most of them are now more or less forgotten with the exception of the so-called Roessler system published in [Roessler OE. An equation for continuous chaos. Phys Lett A 1976;57(5):397-8]. In the present paper, we review most of the original systems and classify them using the tools of modern topological analysis, that is, using the templates and the bounding tori recently introduced by Tsankov and Gilmore in [Tsankov TD, Gilmore R. Strange attractors are classified by bounding tori. Phys Rev Lett 2003;91(13):134104]. Thus, examples of inequivalent topologies of chaotic attractors are provided in modern spirit

  4. Neighborhoods, Social and Cultural Correlates of Obesity Risk among Latinos living on the U.S.-Mexico border in Southern California.

    Science.gov (United States)

    Baquero, Barbara; Molina, Marisa; Elder, John P; Norman, Gregory J; Ayala, Guadalupe X

    2016-01-01

    We explored the relationship between obesity and neighborhood-related, social, and cultural variables and possible moderation by acculturation and cross-national practices. We obtained data from the 2009 San Diego Prevention Research Center's community survey, which used multistage sampling methods to recruit 397 adult respondents and conducted multilevel logistic analytic methods. Nearly half of the respondents were obese. Respondents had low acculturation scores and reported crossing the U.S.-Mexico border about three times per month, mostly to visit family and friends. Neighborhoods where respondents lived were predominantly Latino and had 27% home ownership. A significant cross-level interaction emerged: those who reported crossing the border and reported higher levels of collective efficacy were more likely to be obese than those who had not crossed. Study findings provide evidence of the complex relationship among obesity risk factors in a U.S.-Mexico border community that warrant further examination to prevent and control obesity.

  5. Flood-inundation maps and wetland restoration suitability index for the Blue River and selected tributaries, Kansas City, Missouri, and vicinity, 2012

    Science.gov (United States)

    Heimann, David C.; Kelly, Brian P.; Studley, Seth E.

    2015-01-01

    Digital flood-inundation maps for a 39.7-mile reach of the Blue River and selected tributaries (Brush Creek, Indian Creek, and Dyke Branch) at Kansas City, Missouri, and vicinity, were created by the U.S. Geological Survey (USGS) in cooperation with the City of Kansas City, Missouri. The flood-inundation maps, accessed through the USGS Flood-Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the spatial extent and depth of flooding corresponding to selected water levels (stages) at 15 reference streamgages and associated stream reaches in the Blue River Basin. Near-real-time stage data from the streamgages may be obtained from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service (AHPS) at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at selected sites.

  6. A population-based study of the prevalence of HPV in three districts of Tamil Nadu, India.

    Science.gov (United States)

    Sureshkumar, Belli T; Shanmughapriya, Santhanam; Das, Bhudev C; Natarajaseenivasan, Kalimuthusamy

    2015-04-01

    To evaluate the prevalence of HPV infection among women from three districts of Tamil Nadu (Erode, Salem, and Namakkal). Between January 27, 2007, and December 15, 2009, 1800 women aged 20-70years who had normal cervical cytology were enrolled into a cross-sectional study. Participants completed interviews and provided first void urine samples for assessment of HPV infection. Among 1699 eligible samples, 179 (10.5%) were HPV positive. HPV16 was the most common type (affecting 68 [4.0%] women), followed by HPV6 (58 [3.4%]). Among the 179 HPV-positive women, 71 (39.7%) were aged 36-45years. An annual income of less than 25 000 INR was significantly associated with HPV infection in all three districts (PTamil Nadu. Copyright © 2014 International Federation of Gynecology and Obstetrics. Published by Elsevier Ireland Ltd. All rights reserved.

  7. High prevalence of parental delivery of plastic debris in Cory's shearwaters (Calonectris diomedea).

    Science.gov (United States)

    Rodríguez, Airam; Rodríguez, Beneharo; Nazaret Carrasco, María

    2012-10-01

    Plastic ingestion by adult Procellariiformes has been widely recorded, but few studies have evaluated intergenerational transfer. We assessed the prevalence of plastic particles, as well as their basic characteristics, in the gut content of dead Cory's shearwater fledglings stranded by light pollution on Canary Islands. Eighty-three percent of birds were affected, containing on average 8.0 plastic pieces per bird. The average plastic weight per bird was low (2.97±3.97mg) compared with other petrel species. We found no relationships between plastic loads and body condition or body size, but negative effects may be hidden or delayed. We propose to use the fledglings stranded by light pollution to carry out more precise studies to understand the potential hidden costs of plastic ingestion; and to monitor in a long-term the marine debris to develop management actions for the control of pollution at the marine environment. Copyright © 2012 Elsevier Ltd. All rights reserved.

  8. Características familiares y apoyo percibido entre adolescentes brasileños con y sin experiencia de embarazo

    Directory of Open Access Journals (Sweden)

    Eva Diniz Bensaja dei Schiro

    2012-06-01

    Full Text Available The present paper aimed to investigate how adolescents with pregnancy experience evaluate received support from their families in comparison with an adolescent group without pregnancy experience. 452 low income adolescents, both sex, aged 14 to 19 years old answered to a questionnaire. The results revealed that more girls (64.2 % than boys (35.8 % declared pregnancy experience, χ2 (2, n = 2617 = 48.32, p < .001. Moreover, it was observed that the group with pregnancy experience, in comparison with other group, revealed more perception on the family relationships safety, t (408 = -3.0, p < .01; mutual respect among family members in their homes, t (392 = -2.3, p < .05; and received stronger general support from their family, t (397 = -1,3, p < .05. These results are discussed.

  9. PENGARUH KONSENTRASI PENAMBAHAN TEPUNG TEMPE TERHADAP KARAKTERISTIK TORTILLA LABU KUNING (The Effect of Tempe Flour Addition Concentration on Pumpkin Tortilla Characteristics

    Directory of Open Access Journals (Sweden)

    Merynda Indriyani Syafutri

    2014-10-01

    Full Text Available The objective of this research was to observe the physical and chemical characteristics of pumpkin tortilla with tempe flour addition. The experiment was designed using non Factorial Randomized Design with six treatments and each treatment was replicated three times.  The treatments were 5%, 10%, 15%, 20%, 25% and 30% addition of tempe flour per 90 g of tapioca. Texture, moisture content, ash content, and protein content were analyzed.  The results showed that the addition of tempe flour had significant effect on protein content. Pumpkin tortilla with tempe flour addition had 830.70 mm/s to 1316 mm/s of texture, 3.97% to 4.92% of moisture content, 1.22% to 1.48% of ash content, and 8.96% to 13.22% of protein content. Key words : pumpkin, tempe flour, tortilla

  10. Estrogen receptor alpha polymorphism and risk of cardiovascular disease, cancer, and hip fracture

    DEFF Research Database (Denmark)

    Kjaergaard, AD; Ellervik, C; Tybjaerg-Hansen, A

    2007-01-01

    controls. The CC, CT, and TT genotypes had general population frequencies of 21%, 50%, and 29%, respectively. Cross-sectionally, genotype did not influence high-density lipoprotein cholesterol response to hormone replacement therapy. In the cohort study, there were no differences in risks of CVD, cancer...... 4799 cases and 12 190 controls, showed odds ratios in CC versus CT and TT genotypes for fatal and nonfatal myocardial infarction of 0.81 (95% CI, 0.59 to 1.12) and 1.08 (95% CI, 0.97 to 1.21). Conclusions- ESR1 IVS1-397T/C polymorphism does not influence high-density lipoprotein cholesterol response...

  11. Land use management: A dryland salinity mitigation measure (Western Cape, South Africa)

    CSIR Research Space (South Africa)

    Bugan, Richard DH

    2013-06-01

    Full Text Available separation techniques Model Results (cont) Simulated and Observed Annual Totals of Various Components of the Hydrological Cycle and Salt Balance Year Simulated Observed Precipitation (mm a-1) Actual Evapotranspiration (mm a-1) Runoff (mm a-1) Salt... Output (t a-1) Precipitation (mm a-1) Runoff (mm a-1) Salt Output (t a-1) 2009 410.68 374.36 32.67 22 106 454.44 36.87 21 409 2010 409.78 388.57 30.07 7 279 424.17 15.88 14 599 2011 411.18 343.87 36.61 8 702 397.70 2.50 3 259 • The simulated...

  12. Antianginal efficacy of the combination of felodipine-metoprolol 10/100 mg compared with each drug alone in patients with stable effort-induced angina pectoris

    DEFF Research Database (Denmark)

    Emanuelsson, H; Egstrup, K; Nikus, K

    1999-01-01

    OBJECTIVE: The primary objective of this randomized, double-blind, parallel group trial was to compare the antianginal and antiischemic efficacy of a combination tablet of felodipine-metoprolol 10/100 mg once daily with both drugs given separately once daily in patients with stable effort......-daily treatment with either felodipine-metoprolol 10/100 mg, felodipine 10 mg, or metoprolol 100 mg. The duration of active double-blind treatment was 4 weeks. There were 3 primary efficacy variables in the study; time until end of exercise, time until onset of chest discomfort, and time until 1-mm ST depression...... during a standardized exercise test. RESULTS: The number of patients randomized was 397. There was a statistically significant improvement in time until end of exercise with felodipine-metoprolol 10/100 mg compared with metoprolol 100 mg (P =.04) and felodipine 10 mg compared with metoprolol 100 mg ( P...

  13. Determining the Separation and Position Angles of Orbiting Binary Stars: Comparison of Three Methods

    Science.gov (United States)

    Walsh, Ryan; Boule, Cory; Andrews, Katelyn; Penfield, Andrew; Ross, Ian; Lucas, Gaylon; Braught, Trisha; Harfenist, Steven; Goodale, Keith

    2015-07-01

    To initiate a long term binary star research program, undergraduate students compared the accuracy and ease of measuring the separations and position angles of three long period binary pairs using three different measurement techniques. It was found that digital image capture using BackyardEOS software and subsequent analysis in Adobe Photoshop was the most accurate and easiest to use of our three methods. The systems WDS J17419+7209 (STF 2241AB), WDS 19418+5032 (STFA 46AB), and WDS 16362+5255 (STF 2087AB) were found to have separations and position angles of: 30", 16°; 39.7", 133°; and 3.1", 104°, respectively. This method produced separation values within 1.3" and position angle values within 1.3° of the most recently observed values found in the Washington Double Star Catalog.

  14. Seroprevalence of West Nile Virus in feral horses on Sheldon National Wildlife Refuge, Nevada, United States

    Science.gov (United States)

    Franson, J. Christian; Hofmeister, Erik K.; Collins, Gail H.; Dusek, Robert J.

    2011-01-01

    We screened 1,397 feral horses (Equus caballus) on Sheldon National Wildlife Refuge, Nevada, United States, for IgM and IgG against flavivirus during 2004–2006, 2008, and 2009. Positive serum samples were tested for neutralizing antibodies to West Nile virus (WNV) and St. Louis encephalitis virus (SLEV). One animal was positive for antibody against WNV in 2004, but all others tested in 2004–2006 were negative. In 2008 and 2009, we found evidence of increasing seropositive horses with age, whereas seroprevalence of WNV decreased from 19% in 2008 to 7.2% in 2009. No horses were positive for antibody against SLEV. Being unvaccinated, feral horses can be useful for WNV surveillance.

  15. Optical and magnetic resonance measurements of a segmented poly(ester urethane)

    International Nuclear Information System (INIS)

    Cooke, D.W.; Muenchausen, R.E.; Bennett, B.L.; Orler, E.B.; Wrobleski, D.A.; Smith, M.E.; Jahan, M.S.; Thomas, D.E.

    1999-01-01

    X-ray-induced damage in Estane(registered trademark)5703 has been studied by luminescence, optical absorption and electron spin resonance techniques in the temperature interval ∼10-300 K. Molecular motion of the polymer soft segment, as determined by viscoelastic measurements, is correlated with features in the glow curve, indicating charge detrapping via thermal destruction of cavity traps. Spectral emission is characterized by four Lorentzian bands with maxima at 2.38, 2.55, 2.74 and 2.93 eV, which are attributed to triplet-to-singlet electronic transitions of the phenyl group in the polymer hard segment. Absorption peaks at 3.97, 4.29 and 4.46 eV are also assigned to transitions within this group. Several radicals with overlapping resonances are induced at 35 K, which, with increasing temperature, evolve into the relatively stable peroxy free-radical at room temperature

  16. Estrogen receptor alpha polymorphism and risk of cardiovascular disease, cancer, and hip fracture

    DEFF Research Database (Denmark)

    Kjaergaard, Alisa D; Ellervik, Christina; Tybjaerg-Hansen, Anne

    2007-01-01

    Background- We hypothesized that the estrogen receptor (ESR1) IVS1-397T/C polymorphism affects high-density lipoprotein cholesterol response to hormone replacement therapy and risk of cardiovascular disease (CVD), cancer of reproductive organs, and hip fracture. Methods and Results- We studied...... thromboembolism, deep vein thrombosis, and pulmonary embolism), cancer of reproductive organs (breasts, ovaries, uterus, and prostate), and hip fracture. We also studied patients with ischemic heart disease (n=2495), ischemic cerebrovascular disease (n=856), and breast cancer (n=1256) versus general population...... controls. The CC, CT, and TT genotypes had general population frequencies of 21%, 50%, and 29%, respectively. Cross-sectionally, genotype did not influence high-density lipoprotein cholesterol response to hormone replacement therapy. In the cohort study, there were no differences in risks of CVD, cancer...

  17. Enhanced luminescence in SrMgAl(x)O(17±δ):yMn4+ composite phosphors.

    Science.gov (United States)

    Cao, Renping; Sharafudeen, Kaniyarakkal N; Qiu, Jianrong

    2014-01-03

    Red-emitting SrMgAlxO17±δ:yMn(4+) composite phosphors (x=10-100; y=0.05-4.0 mol%) are synthesized by solid-state reaction method in air. Addition of Al2O3 leads to the formation of two concomitant phases, i.e., SrMgAl10O17 and Al2O3 phases in the composite phosphor. Red emission from Mn(4+) ions in the composite phosphors is greatly enhanced due to multiple scattering and absorption of excitation light between SrMgAl10O17 and Al2O3 phases. SrMgAlxO17±δ:yMn(4+) composite phosphors would be a promising candidate as red phosphor in the application of a 397 nm near UV-based W-LED. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Electrical Equipment of Electrical Stations and Substations,

    Science.gov (United States)

    1979-10-25

    flocronthoro ’roka "rNUSPONUS reuepa’rop Tpexzaamor TOKA 6C. so, iso ynpomxeuuoe 63aeg (O#cms1poHM reHepaTop C ObiBeleHnbumH WeCTblo KoimaUU itA3...currents during short circuit on the terminals/grippers: the turbogenerators 12): .I1’ 1.5; the hydraulic generators 0a:I. ,-0 (.PA >3) ISO ---01...330TATl 111-31500/110 BC- 17,5 (10,5) 6800 5600 7600 123 397 Bll - 10,5 (17) C11 - 6.3 (6) TJATI 11-000/I10 - 8583 5275 7700 129 474 TLI, 11’--I.U500/I 1o

  19. Functional adaptation of tendon and skeletal muscle to resistance training in three patients with genetically verified classic Ehlers Danlos Syndrome

    DEFF Research Database (Denmark)

    Møller, Mathias Bech; Kjær, Michael; Svensson, René Brüggebusch

    2014-01-01

    undergoing muscle strength training. We investigated patients with classical Ehlers Danlos Syndrome (EDS) (collagen type V defect) who display articular hypermobility, skin extensibility and tissue fragility. METHODS: subjects underwent strength training 3 times a week for 4 months and were tested before...... and after intervention in regards to muscle strength, tendon mechanical properties, and muscle function. RESULTS: three subjects completed the scheduled 48 sessions and had no major adverse events. Mean isometric leg extension force and leg extensor power both increased by 8 and 11% respectively (358 to 397...... sway-area of the participants decreased by 26% (0.144 to 0.108 m(2)). On the subscale of CIS20 the participants lowered their average subjective fatigue score from 33 to 25. CONCLUSION: in this small pilot study, heavy resistance training was both feasible and effective in classic Ehlers Danlos...

  20. Management of fresh water weeds (macrophytes) by vermicomposting using Eisenia fetida.

    Science.gov (United States)

    Najar, Ishtiyaq Ahmed; Khan, Anisa B

    2013-09-01

    In the present study, potential of Eisenia fetida to recycle the different types of fresh water weeds (macrophytes) used as substrate in different reactors (Azolla pinnata reactor, Trapa natans reactor, Ceratophyllum demersum reactor, free-floating macrophytes mixture reactor, and submerged macrophytes mixture reactor) during 2 months experiment is investigated. E. fetida showed significant variation in number and weight among the reactors and during the different fortnights (P macrophytes mixture reactor (number 105 ± 5.77 %; weight 41.07 ± 3.97 % ). ANOVA showed significant variation in cocoon production (F4 = 15.67, P macrophyte affects the growth and reproduction pattern of E. fetida among the different reactors, further the addition of A. pinnata in other macrophytes reactors can improve their recycling by E. fetida.

  1. Phenolic polyketides from the co-cultivation of marine-derived Penicillium sp. WC-29-5 and Streptomyces fradiae 007.

    Science.gov (United States)

    Wang, Yi; Wang, Liping; Zhuang, Yibin; Kong, Fandong; Zhang, Cuixian; Zhu, Weiming

    2014-04-04

    Penicillium sp. WC-29-5 was co-cultured with Streptomyces fradiae 007 to produce five natural products (1-3, 4a and 4b) that were isolated and characterized by spectroscopic analysis. Interestingly, these compounds were found to be different from those produced in discrete fungal and bacterial controls. Among these compounds, the absolute configurations of compounds 4a and 4b were determined for the first time by X-ray single crystal diffraction experiments and electronic circular dichroism (ECD) calculations. An evaluation of the cytotoxic activities of these compounds revealed that 4b was moderately cytotoxic towards HL-60 and H1975 tumor cells with IC₅₀ values of 3.73 and 5.73 µM, respectively, whereas compound 4a was only moderately cytotoxic towards H1975 cells with an IC₅₀ value of 3.97 µM.

  2. Phenolic Polyketides from the Co-Cultivation of Marine-Derived Penicillium sp. WC-29-5 and Streptomyces fradiae 007

    Directory of Open Access Journals (Sweden)

    Yi Wang

    2014-04-01

    Full Text Available Penicillium sp. WC-29-5 was co-cultured with Streptomyces fradiae 007 to produce five natural products (1–3, 4a and 4b that were isolated and characterized by spectroscopic analysis. Interestingly, these compounds were found to be different from those produced in discrete fungal and bacterial controls. Among these compounds, the absolute configurations of compounds 4a and 4b were determined for the first time by X-ray single crystal diffraction experiments and electronic circular dichroism (ECD calculations. An evaluation of the cytotoxic activities of these compounds revealed that 4b was moderately cytotoxic towards HL-60 and H1975 tumor cells with IC50 values of 3.73 and 5.73 µM, respectively, whereas compound 4a was only moderately cytotoxic towards H1975 cells with an IC50 value of 3.97 µM.

  3. Content of trace metals in surface sediments of Lac Sud de Tunis before development

    International Nuclear Information System (INIS)

    Ben Souissi, J.; Zaouali, J.; Aouij, S.; Orlando, E.; Mazghouni, M.; Rezig, M.

    1999-01-01

    The analysis of metal (Hg, Cd, Pb, Cu, Cr, Ni, Mn, Zn, Fe) concentrations in the surface sediments of the South Lake of Tunis before its restoration showed a high level of contamination. The values for mercury, cadmium and lead oscillate respectively between (0,17 and 2,6 μg/g d.w), (0,13 and 13,3 μg/g d. w); (3,97 and 698 μg/g d. w). This pollution is generated by the intensive industrial activity situated on south banks of the Lake. This environment constitutes since more of the millennium a outfall of urban used waters and since one century an outfall of industrial waste waters strongly charged with nutrients and heavy metals. (author)

  4. An exploration study to find important factors influencing on expert systems

    Directory of Open Access Journals (Sweden)

    Naser Azad

    2013-09-01

    Full Text Available Knowledge management plays an important role in modern management systems since many existing systems move towards learning organizations. Expert systems, on the other hand, are considered as the most popular techniques for adapting recent developments on knowledge management. This paper presents an empirical investigation to find important factors influencing adaptation of expert systems. The proposed study designs a questionnaire in Likert scale consists of 25 questions, distributes it among 258 people who have recently graduated from computer science and they are familiar with implementation of expert systems. Cronbach alpha is calculated as 0.730 and Kaiser-Meyer-Olkin Measure of Sampling Adequacy and Approx. Chi-Square are 0.748 and 1377.397, respectively. The study has implemented principal component analysis and the results have indicated that there were four factors influencing expert systems including systems management, intelligence systems, system analysis and specialized analysis.

  5. Prevalence of paratuberculosis in the dairy goat and dairy sheep industries in Ontario, Canada

    DEFF Research Database (Denmark)

    Bauman, Cathy A.; Jones-Bitton, Andria; Menzies, Paula

    2016-01-01

    ). Using 3-test latent class Bayesian models, true farm-level prevalence was estimated to be 83.0% [95% probability interval (PI): 62.6% to 98.1%] for dairy goats and 66.8% (95% PI: 41.6% to 91.4%) for dairy sheep. The within-farm true prevalence for dairy goats was 35.2% (95% PI: 23.0% to 49......A cross-sectional study was undertaken (October 2010 to August 2011) to estimate the prevalence of paratuberculosis in the small ruminant dairy industries in Ontario, Canada. Blood and feces were sampled from 580 goats and 397 sheep (lactating and 2 y of age or older) that were randomly selected...... from 29 randomly selected dairy goat herds and 21 convenience -selected dairy sheep flocks. Fecal samples were analyzed using bacterial culture (BD BACTEC MGIT 960) and polymerase chain reaction (Tetracore); serum samples were tested with the Prionics Parachek enzyme-linked immunosorbent assay (ELISA...

  6. CCR 20th Anniversary Commentary: RAS as a Biomarker for EGFR--Targeted Therapy for Colorectal Cancer-From Concept to Practice.

    Science.gov (United States)

    Camp, E Ramsay; Ellis, Lee M

    2015-08-15

    Clinical data support the use of EGFR mAbs in patients with metastatic colorectal cancer (mCRC) with wild-type RAS status. This notion, hypothesized in the review article by Camp, Ellis, and colleagues in the January 1, 2005, issue of Clinical Cancer Research, serves as an example of the successful application of basic science principles to clinical practice. The exclusion of patients with mCRC with Ras-mutated tumors from therapy with EGFR mAbs has led to improved outcomes while sparing patients unnecessary and potentially harmful therapy. See related article by Camp et al., Clin Cancer Res 2005;11(1): January 1, 2005;397-405. ©2015 American Association for Cancer Research.

  7. Implementation of a robust hybrid rotary-translational vibration energy harvester for autonomous self-powered acceleration measurement

    Science.gov (United States)

    Payne, Owen R.; Vandewater, Luke A.; Ung, Chandarin; Moss, Scott D.

    2015-04-01

    In this paper, a self-powered wireless sensor node utilising ambient vibrations for power is described. The device consists of a vibration energy harvester, power management system, microcontroller, accelerometer, RF transmitter/receiver and external LED indicators. The vibration energy harvester is adapted from a previously reported hybrid rotary-translational device and uses a pair of copper coil transducers to convert the mechanical energy of a magnetic sphere into usable electricity. The device requires less than 0.8 mW of power to operate continuously in its present setup (with LED indicators off) while measuring acceleration at a sample rate of 200 Hz, with the power source providing 39.7 mW of power from 500 mg excitations at 5.5 Hz. When usable input energy is removed, the device will continue to transmit data for more than 5 minutes.

  8. [Female homicide victims in Recife, Pernambuco State, Brazil, 2009-2010: a descriptive study].

    Science.gov (United States)

    Silva, Maria Arleide da; Cabral Filho, José Eulálio; Amorim, Melania Maria Ramos; Falbo Neto, Gilliatt Hanois

    2013-02-01

    This study investigated the epidemiological profile of female homicide victims in Recife, Pernambuco State, Northeast Brazil. An observational descriptive and prospective study included all homicides from March 2009 to February 2010 with female victims from Recife, 10 to 49 years of age. A questionnaire was used to record socioeconomic, demographic, and biological risk factors. Relatives of the victims were interviewed, and data were collected from death certificates. We identified 60 homicides during the study period. Most victims were adult women with brown skin color and low schooling and low income. Other characteristics included smoking in 39.7%, alcohol and illicit drugs in 48.3% and 24.1%, respectively, and physical and/or sexual violence in the 12 months prior to the murder in 29.3%. Firearms were used in 69% of these homicides.

  9. Mental health predicts better academic outcomes: a longitudinal study of elementary school students in Chile.

    Science.gov (United States)

    Murphy, J Michael; Guzmán, Javier; McCarthy, Alyssa E; Squicciarini, Ana María; George, Myriam; Canenguez, Katia M; Dunn, Erin C; Baer, Lee; Simonsohn, Ariela; Smoller, Jordan W; Jellinek, Michael S

    2015-04-01

    The world's largest school-based mental health program, Habilidades para la Vida [Skills for Life (SFL)], has been operating on a national scale in Chile for 15 years. SFL's activities include using standardized measures to screen elementary school students and providing preventive workshops to students at risk for mental health problems. This paper used SFL's data on 37,397 students who were in first grade in 2009 and third grade in 2011 to ascertain whether first grade mental health predicted subsequent academic achievement and whether remission of mental health problems predicted improved academic outcomes. Results showed that mental health was a significant predictor of future academic performance and that, overall, students whose mental health improved between first and third grade made better academic progress than students whose mental health did not improve or worsened. Our findings suggest that school-based mental health programs like SFL may help improve students' academic outcomes.

  10. Clinical analysis of 503 cases of hyperthyroidism related hepatic damage

    International Nuclear Information System (INIS)

    Zhang Xiaoxia

    2004-01-01

    The clinical characteristics and the therapeutic method of 503 hyperthyroidism related hepatic damage in the paper was discussed. The incidence of the disease of hyperthyroidism related hepatic damage was 39.7%, the rate increases with the increase in age of the patients and the increase of the course of hyperthy-roidism (P 3 and FT 4 . The state of the illness may be get better with the treatment, and ALT and AST were all resumed; The hyperthyroidism was easy to lead to hepatic damage. Treatment was given priority to controlling of hyperthyroidism and put the protection of liver to the second place: the degree of hepatic damage was closely related to age, the course of disease and the state of illness. A timely diagnoses and proper therapy may be lead to desirable result. (author)

  11. Stark parameters of some asymmetrical Si II lines

    International Nuclear Information System (INIS)

    Ferhat, B; Azzouz, Y; Redon, R; Ripert, M; Lesage, A

    2012-01-01

    Six lines of SiII are experimentally studied in pulsed plasma generated by Nd :Yag laser breakdown on pure solid silicon target. A set of experimental Stark parameters of asymmetrical lines are measured in temperature range from 14 000 K to 18 000 K (using Boltzmann plot). Calculated values of the electron density (using Griem's formula) vary from 1.7 to 6.1 × 10 23 m −3 . Processed spectral lines are 333.982 nm (3s 2 4p -3s 2 6s) and 397.746 nm, 399.177 nm, 399.801 nm, 401.622 nm (3d' 2 F 0 -4f' 4 G) and (3d' 2 F 0 - 4f' 2 G) of astrophysical interest. Asymmetrical line shapes are synthesized by a sum of two semi-Lorentzian distributions. The obtained fit is in good agreement with the measured spectra.

  12. Trial Characteristics as Contextual Factors when Evaluating Targeted Therapies in Patients with Psoriatic Disease

    DEFF Research Database (Denmark)

    Ballegaard, Christine; Jørgensen, Tanja S; Skougaard, Marie

    2018-01-01

    (PsA) and psoriasis (8 biologics and apremilast). The effect of targeted therapies was analyzed in the two psoriatic conditions combined by using drug retention as common outcome, and separately by using ACR20 for PsA and PASI75 for psoriasis. We explored potential effect modification of trial...... characteristics in stratified and meta-regression analyses. Odds ratios (OR) were calculated and compared among the trial eligibility criteria via the Ratio of Odds Ratios (ROR). RESULTS: Forty-eight PsA and psoriasis trials (51 comparisons, 17,737 patients) were eligible. Overall retention was OR 2.16 (1.70 to 2.......75) with higher odds for PsA trials compared with psoriasis trials (ROR = 2.55 [1.64 to 3.97]). The eligibility criteria "targeted therapy history", "minimum required disease duration", "required negative rheumatoid factor", and "required CASPAR criteria" were of importance for achieving ACR20 in PsA...

  13. Biological data for water in Lake Powell and from Glen Canyon Dam releases, Utah and Arizona, 1990–2009

    Science.gov (United States)

    Vernieu, William S.

    2015-10-06

    Biological samples from various locations on Lake Powell and in the Colorado River in the tail water downstream of Glen Canyon Dam were collected by the Bureau of Reclamation and U.S. Geological Survey from December 1990 through December 2009 as part of a long-term water-quality monitoring program that began in 1964. These samples consisted of discrete (1-m deep) chlorophyll samples, discrete (1-m deep) wholewater phytoplankton samples, and 30-m vertically composited zooplankton samples filtered through an 80-µm plankton net. Chlorophyll concentration was determined by acetone extraction followed by trichromatic spectroscopy on 2,051 samples. Phytoplankton analysis consisted of identification to the genus or species level, enumeration, and estimation of biovolume on 1,397 samples. Phytoplankton analysis identified 646 different phytoplankton taxa. Zooplankton analysis consisted of identification to the genus or species level, enumeration, and estimation of biomass from 1,898 samples. Zooplankton analysis identified 114 different zooplankton taxa.

  14. Formulary Drug Reviews: Glecaprevir/Pibrentasvir.

    Science.gov (United States)

    Levien, Terri L; Baker, Danial E

    2018-04-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service , contact Wolters Kluwer customer service at 866-397-3433.

  15. Formulary Drug Review: Naldemedine.

    Science.gov (United States)

    Baker, Danial E

    2017-07-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, contact Wolters Kluwer customer service at 866-397-3433. The September 2017 monograph topics are brigatinib, durvalumab, edaravone, midostaurin, and sarilumab. The MUE is on sarilumab.

  16. Formulary Drug Review: Betrixaban.

    Science.gov (United States)

    Baker, Danial E

    2018-02-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service , contact Wolters Kluwer customer service at 866-397-3433.

  17. Formulary Drug Review: Ocrelizumab.

    Science.gov (United States)

    Ali, Zaynah K; Baker, Danial E

    2017-10-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service , contact Wolters Kluwer customer service at 866-397-3433.

  18. Formulary Drug Review: Etelcalcetide.

    Science.gov (United States)

    Baker, Danial E

    2017-11-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service , contact Wolters Kluwer customer service at 866-397-3433. The November 2017 monograph topics are Ertugliflozin, Glecaprevir / pibrentasvir, Neratinib, Sofosbuvir, velpatasvir, voxilaprevir and SQ C1 esterase inhibitor. The MUE is on glecaprevir, pibrentasvir.

  19. Formulary Drug Review: Edaravone.

    Science.gov (United States)

    Ali, Zaynah K; Baker, Danial E

    2017-12-01

    Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are available online to subscribers. Monographs can be customized to meet the needs of a facility. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service , contact Wolters Kluwer customer service at 866-397-3433.

  20. Thermophysical properties of a highly superheated and undercooled Ni-Si alloy melt

    Science.gov (United States)

    Wang, H. P.; Cao, C. D.; Wei, B.

    2004-05-01

    The surface tension of superheated and undercooled liquid Ni-5 wt % Si alloy was measured by an electromagnetic oscillating drop method over a wide temperature range from 1417 to 1994 K. The maximum undercooling of 206 K (0.13TL) was achieved. The surface tension of liquid Ni-5 wt % Si alloy is 1.697 N m-1 at the liquidus temperature 1623 K, and its temperature coefficient is -3.97×10-4 N m-1 K-1. On the basis of the experimental data of surface tension, the other thermophysical properties such as the viscosity, the solute diffusion coefficient, and the density of liquid Ni-5 wt % Si alloy were also derived.