WorldWideScience

Sample records for alloy-ehi 397

  1. 49 CFR 397.225 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Judicial review. 397.225 Section 397.225... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.225 Judicial review. A party to a proceeding under § 397.205(a), § 397.213(a), or § 397.223(a) may seek review by the appropriate...

  2. 47 CFR 87.397 - Emergency operations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Emergency operations. 87.397 Section 87.397... Emergency Communications § 87.397 Emergency operations. (a) The licensee of any land station in the Aviation services, during a local emergency involving the safety of life and property may communicate in a...

  3. 49 CFR 397.13 - Smoking.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Smoking. 397.13 Section 397.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION...; DRIVING AND PARKING RULES General § 397.13 Smoking. No person may smoke or carry a lighted...

  4. 49 CFR 397.71 - Federal standards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Federal standards. 397.71 Section 397.71... standards. (a) A State or Indian tribe shall comply with the Federal standards under paragraph (b) of this... or may not be transported. (b) The Federal standards are as follows: (1) Enhancement of public...

  5. 33 CFR 117.397 - Wabash River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.397 Section 117... OPERATION REGULATIONS Specific Requirements Illinois § 117.397 Wabash River. The draws of the bridges across the Wabash River need not be opened for the passage of vessels. Indiana...

  6. 49 CFR 397.75 - Dispute resolution.

    Science.gov (United States)

    2010-10-01

    ... first. (e) Hearings; alternative dispute resolution. Upon receipt of a petition filed pursuant to... parties from settling the dispute or seeking other methods of alternative dispute resolution prior to the... 49 Transportation 5 2010-10-01 2010-10-01 false Dispute resolution. 397.75 Section...

  7. 14 CFR 23.397 - Limit control forces and -torques.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit control forces and -torques. 23.397 Section 23.397 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Structure Control Surface and System Loads § 23.397...

  8. 18 CFR 367.3970 - Account 397, Communication equipment.

    Science.gov (United States)

    2010-04-01

    ... GAS ACT Service Company Property Chart of Accounts § 367.3970 Account 397, Communication equipment. (a..., Communication equipment. 367.3970 Section 367.3970 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE PUBLIC UTILITY HOLDING COMPANY ACT OF...

  9. Genotoxicity assessment of the antiepileptic drug AMP397, an Ames-positive aromatic nitro compound.

    Science.gov (United States)

    Suter, Willi; Hartmann, Andreas; Poetter, Franziska; Sagelsdorff, Peter; Hoffmann, Peter; Martus, Hans-Jörg

    2002-07-25

    AMP397 is a novel antiepileptic agent and the first competitive AMPA antagonist with high receptor affinity, good in vivo potency, and oral activity. AMP397 has a structural alert (aromatic nitro group) and was mutagenic in Salmonella typhimurium strains TA97a, TA98 and TA100 without S9, but negative in the nitroreductase-deficient strains TA98NR and TA100NR. The amino derivative of AMP397 was negative in wild-type strains TA98 and TA100. AMP397 was negative in a mouse lymphoma tk assay, which included a 24h treatment without S9. A weak micronucleus induction in vitro was found at the highest concentrations tested in V79 cells with S9. AMP397 was negative in the following in vivo studies, which included the maximum tolerated doses of 320mg/kg in mice and 2000mg/kg in rats: MutaMouse assay in colon and liver (5x320mg/kg) at three sampling times (3, 7 and 31 days after the last administration); DNA binding study in the liver of mice and rats after a single treatment with [14C]-AMP397; comet assay (1x2000mg/kg) in jejunum and liver of rats, sampling times 3 and 24h after administration; micronucleus test (2x320mg/kg) in the bone marrow of mice, sampling 24h after the second administration. Based on these results, it was concluded that AMP397 has no genotoxic potential in vivo. In particular, no genotoxic metabolite is formed in mammalian cells, and, if formed by intestinal bacteria, is unable to exert any genotoxic activity in the adjacent intestinal tissue. These data were considered to provide sufficient safety to initiate clinical development of the compound. PMID:12113769

  10. 14 CFR 135.397 - Small transport category airplane performance operating limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Small transport category airplane... PERSONS ON BOARD SUCH AIRCRAFT Airplane Performance Operating Limitations § 135.397 Small transport category airplane performance operating limitations. (a) No person may operate a reciprocating...

  11. β Integrins Mediate FAK Y397 Autophosphorylation of Resistance Arteries during Eutrophic Inward Remodeling in Hypertension

    OpenAIRE

    Heerkens, Egidius H.J; Quinn, Lisa; Withers, Sarah B.; Heagerty, Anthony M

    2014-01-01

    Human essential hypertension is characterized by eutrophic inward remodeling of the resistance arteries with little evidence of hypertrophy. Upregulation of αVβ3 integrin is crucial during this process. In order to investigate the role of focal adhesion kinase (FAK) activation in this process, the level of FAK Y397 autophosphorylation was studied in small blood vessels from young TGR(mRen2)27 animals as blood pressure rose and eutrophic inward remodeling took place. Between weeks 4 and 5, thi...

  12. Cavity of Molecular Gas Associated with Supernova Remnant 3C 397

    CERN Document Server

    Jiang, Bing; Wang, Junzhi; Su, Yang; Zhou, Xin; Safi-Harb, Samar; DeLaney, Tracey

    2010-01-01

    3C 397 is a radio and X-ray bright Galactic supernova remnant (SNR) with an unusual rectangular morphology. Our CO observation obtained with the Purple Mountain Observatory at Delingha reveals that the remnant is well confined in a cavity of molecular gas, and embedded at the edge of a molecular cloud (MC) at the local standard of rest systemic velocity of ~32 km/s. The cloud has a column density gradient increasing from southeast to northwest, perpendicular to the Galactic plane, in agreement with the elongation direction of the remnant. This systemic velocity places the cloud and SNR 3C 397 at a kinematic distance of ~10.3 kpc. The derived mean molecular density (~10-30 cm^-3) explains the high volume emission measure of the X-ray emitting gas. A 12CO line broadening of the ~32 km/s component is detected at the westmost boundary of the remnant, which provides direct evidence of the SNR-MC interaction and suggests multi-component gas there with dense (~10^4 cm^-3) molecular clumps. We confirm the previous de...

  13. A Broadband X-Ray Study of the Supernova Remnant 3C 397

    CERN Document Server

    Safi-Harb, S; Arnaud, K A; Keohane, J W; Borkowski, K J; Dyer, K K; Reynolds, S P; Hughes, J P

    2000-01-01

    We present an X-ray study of the radio bright supernova remnant (SNR) 3C 397 with ROSAT, ASCA, and RXTE. A central X-ray spot seen with the ROSAT High-Resolution Imager hints at the presence of a pulsar-powered component, and gives this SNR a composite X-ray morphology. Combined ROSAT and ASCA imaging show that the remnant is highly asymmetric, with its hard X-ray emission peaking at the western lobe. The spectrum of 3C 397 is heavily absorbed, and dominated by thermal emission with emission lines evident from Mg, Si, S, Ar and Fe. Single-component models fail to describe the spectrum, and at least two components are required. We use a set of non-equilibrium ionization (NEI) models (Borkowski et al. in preparation). The temperatures from the soft and hard components are 0.2 keV and 1.6 keV respectively. The corresponding ionization time-scales $n_0 t$ ($n_0$ being the pre-shock hydrogen density) are 6 $\\times 10^{12}$ cm$^{-3}$ s and 6 $\\times$ 10$^{10}$ cm$^{-3}$ s, respectively. The spectrum obtained with t...

  14. Diophantine 方程 x3+8=397y2的整数解%On Study of the Diophantine Equation x3 +8 =397y2

    Institute of Scientific and Technical Information of China (English)

    李润琪

    2015-01-01

    That the Diophantine equationx3 +8 =397y2 has only integer solution (x,y)=(-2,0)was proved with the assistance of recurrent sequence,congruence,Maple formality and some properties of the solutions to Pell equation.%利用递归序列、同余式、Maple 小程序、Pell 方程的解的性质证明了 Diophantine 方程 x3+8=397y2仅有整数解(x,y)=(-2,0)。

  15. Comparison and characterization of efficient frequency doubling at 397.5 nm with PPKTP, LBO and BiBO crystals

    CERN Document Server

    Wen, Xin; Wang, Junmin

    2016-01-01

    A continuous-wave Ti:sapphire laser at 795 nm is frequency doubled in a bow-tie type enhancement four-mirror ring cavity with LiB3O5 (LBO), BiB3O6 (BiBO), and periodically polled KTiOPO4 (PPKTP) crystals, respectively. The properties of 397.5 nm ultra-violet (UV) output power, beam quality, stability for these different nonlinear crystals are investigated and compared. For PPKTP crystal, the highest doubling efficiency of 58.1% is achieved from 191 mW of 795 nm mode-matched fundamental power to 111 mW of 397.5 nm UV output. For LBO crystal, with 1.34 W of mode-matched 795 nm power, 770 mW of 397.5 nm UV output is achieved, implying a doubling efficiency of 57.4%. For BiBO crystal, with 323 mW of mode-matched 795 nm power, 116 mW of 397.5 nm UV output is achieved, leading to a doubling efficiency of 35.9%. The generated UV radiation has potential applications in the fields of quantum physics

  16. The applications of VIP 397/418 bulbs in free radical white pigmented coatings: UV curing evaluation for different free radical white pigmented formulations (I)

    International Nuclear Information System (INIS)

    White pigmented coatings have gained commercial success using a Gallium doped microwave F600-V bulb. A novel VIP 397/418 bulb has been made recently, by Fusion UV Systems, to increase UV curing efficiency of white pigmented coatings. Previous research work has shown that the VIP 397/418 bulb can cure cationic white pigmented coatings 40-60% faster than a F600-V bulb. Further evaluations of free radical white pigmented coatings have produced significant data indicating that better physical properties (40-50%) or higher cure speeds (50%) can be obtained by using the VIP 397/418 bulb than a F600-V bulb

  17. Comparison and characterization of efficient frequency doubling at 397.5 nm with PPKTP, LBO and BiBO crystals

    OpenAIRE

    WEN, Xin; Han, Yashuai; Wang, Junmin

    2016-01-01

    A continuous-wave Ti:sapphire laser at 795 nm is frequency doubled in a bow-tie type enhancement four-mirror ring cavity with LiB3O5 (LBO), BiB3O6 (BiBO), and periodically polled KTiOPO4 (PPKTP) crystals, respectively. The properties of 397.5 nm ultra-violet (UV) output power, beam quality, stability for these different nonlinear crystals are investigated and compared. For PPKTP crystal, the highest doubling efficiency of 58.1% is achieved from 191 mW of 795 nm mode-matched fundamental power ...

  18. Multifrequency Studies of Bright Radio Supernova Remnants. III. X-Ray and Radio Observations of 3C 397

    OpenAIRE

    Dyer, K. K.; Reynolds, S. P.

    1999-01-01

    Radio-bright, presumably young supernova remnants offer the opportunity of studying strong-shock physics and the nature of the interaction of ejected material with the surrounding medium. We use VLA and ROSAT images of the radio-bright supernova remnant 3C 397 (G41.1--0.3) to examine the shock structure in both thermal X-ray emission and nonthermal radio emission. The unusual rectangular morphology can be seen in VLA maps at 20 and 6 cm wavelength at a resolution of 6", and in ROSAT HRI image...

  19. Safety Evaluation Report related to the operation of WPPSS Nuclear Project No. 2 (Docket No. 50-397)

    International Nuclear Information System (INIS)

    This report, Supplement No. 5 to the Safety Evaluation Report (SSER 5) on the Washington Public Power Supply System application for a license to operate WNP-2 (Docket No. 50-397), located in Benton County, Washington, approximately 12 miles north of Richland, Washington, has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplements No. 1, 2, 3, and 4

  20. Multifrequency Studies of Bright Radio Supernova Remnants; 3, X-Ray and Radio Observations of 3C 397

    CERN Document Server

    Dyer, K K

    1999-01-01

    Radio-bright, presumably young supernova remnants offer the opportunity of studying strong-shock physics and the nature of the interaction of ejected material with the surrounding medium. We use VLA and ROSAT images of the radio-bright supernova remnant 3C 397 (G41.1--0.3) to examine the shock structure in both thermal X-ray emission and nonthermal radio emission. The unusual rectangular morphology can be seen in VLA maps at 20 and 6 cm wavelength at a resolution of 6", and in ROSAT HRI images. The X-ray images resemble the radio strongly, except for a small, possibly un resolved X-ray hot spot near the center. There is no variation in the X-ray hardness ratio from ROSAT Position Sensitive Proportional Counter data across the remnant, suggesting that at least between 0.4 and 2 keV, the interior emission is not different in character from that in the bright shell regions. Thus 3C 397 is not a member of the ``thermal composite'' or ``mixed-morphology'' class (Rho 1998). The remnant is unpolarized at 20 cm, and ...

  1. Screening of 397 chemicals and development of a quantitative structure-activity relationship model for androgen receptor antagonism

    DEFF Research Database (Denmark)

    Vinggaard, Annemarie; Niemelä, Jay Russell; Wedebye, Eva Bay; Jensen, Gunde Egeskov

    2008-01-01

    We have screened 397 chemicals for human androgen receptor (AR) antagonism by a sensitive reporter gene assay to generate data for the development of a quantitative structure-activity relationship (QSAR) model. A total of 523 chemicals comprising data on 292 chemicals from our laboratory and data...... synthetic androgen R1881. The MultiCASE expert system was used to construct a QSAR model for AR antagonizing potential. A "5 Times, 2-Fold 50% Cross Validation" of the model showed a sensitivity of 64%, a specificity of 84%, and a concordance of 76%. Data for 102 chemicals were generated for an external...... validation of the model resulting in a sensitivity of 57%, a specificity of 98%, and a concordance of 92% of the model. The model was run on a set of 176103 chemicals, and 47% were within the domain of the model. Approximately 8% of chemicals was predicted active for AR antagonism. We conclude that the...

  2. 毛竹miR397和miR1432的克隆及其逆境胁迫响应表达分析

    Institute of Scientific and Technical Information of China (English)

    王丽丽; 赵韩生; 孙化雨; 董丽莉; 娄永峰; 高志民

    2015-01-01

    Objective]Stress is one of the main factors affecting growth,development and formation of biological production and quality of plant. As non-coding genes,miRNAs play important roles in regulating plant growth and the processes of stress resistance. To reveal the function of miR397 and miR1432 in bamboo and provide a basis for molecular design of bamboo resilience breeding in future,the structural features of miR397 and miR1432 precursor sequences from Phyllostachys edulis were analyzed,the tissue-specific expression analysis as well as the expression changes of miR397 and miR1432 under abiotic stresses of drought,temperature,light,NaCl and hormone treatment were carried out.[Method]The precursor sequences of miR397 and miR1432 of P. edulis were isolated using stem-loop primer method and RT-PCR technology,online platform Web LOGO was used for the conservation analysis of mature miRNA. MEGA 6. 0 software was used for the construction of phylogenetic tree with miRNA precursor sequences. The secondary structure of the two precursors was predicted with the online platform RNAfold WebServer. The sequences of 1500 bp upstream of the precursor of phe-miR397 and phe-miR1432 were direct-downloaded respectively from BambooGDB and acting elements analysis was performed using online platform Plant CARE. Real-time quantitative PCR method was used for the tissue-specific expression analysis of phe-miR397 and phe-miR1432 in bamboo roots, stems, leaves and sheaths, and the expression changes in bamboo leaf after 2 h treatments of darkness,high light intensity ( 1 500 μmol·m -2 s -1 ) ,high temperature (42 ℃) ,low temperature ( 4 ℃) ,NaCl ( 250 mmol·L -1 ) ,GA3 solution ( 100 μmol·L -1 ) and ABA solution (100 μmol·L -1 ) respectively.[Result]The isolated precursor sequences of phe-miR397 and phe-miR1432 were all 88 bp,containing 21 bp mature sequences correspondingly. The precursors of phe-miR397 and phe-miR1432 could fold into stable stem-loop structure,and the mature

  3. 毛竹miR397和miR1432的克隆及其逆境胁迫响应表达分析

    Institute of Scientific and Technical Information of China (English)

    王丽丽; 赵韩生; 孙化雨; 董丽莉; 娄永峰; 高志民

    2015-01-01

    【目的】miRNA作为一种非编码基因在植物生长发育以及抗逆等过程中起着重要的调控作用。通过分析毛竹 miR397和 miR1432前体序列的结构特点,研究其组织表达特异性,分析其经光照、温度、干旱、NaCl等非生物胁迫以及激素处理后的表达变化,以期为进一步揭示其功能以及未来竹子抗逆育种的分子设计提供参考。【方法】通过茎环引物法和 RT-PCR技术,以毛竹为材料分离 miR397和 miR1432的前体序列,利用在线平台 Web LOGO分析 miRNA成熟序列的碱基保守性,用 MEGA 6.0软件构建基于 miRNA 前体的系统进化树。借助在线平台 RNAfold WebServer预测二者前体二级结构。直接从 BambooGDB下载 phe-miR397和 phe-miR1432前体上游的1500 bp序列,利用在线平台 Plant CARE 分析其所含作用元件。采用实时定量 PCR 方法分析 phe-miR397和 phe-miR1432在毛竹根、茎、叶和鞘中的表达情况,以及检测经黑暗、强光(1500μmol·m -2 s -1)、高温(42℃)、低温(4℃)、NaCl(250 mmol·L -1)、GA3溶液(100μmol·L -1)、ABA溶液(100μmol·L -1)处理2 h后毛竹叶片中 phe-miR397和 phe-miR1432的表达变化。【结果】从毛竹中分别克隆出 miR397和 miR1432的前体序列,均为88 bp,且分别包含其成熟序列,均为21 bp。前体序列均能形成稳定的茎环结构,且成熟序列均产生于前体茎环结构5'端臂上。miR1432家族成熟序列的碱基保守性整体高于 miR397家族。毛竹二者前体上游调控区均含有启动子基本作用元件,如 TATA-box,CAAT-box;同时存在很多逆境(光、干旱、温度等)胁迫相关响应元件以及激素响应元件等,意味着 phe-miR397和 phe-miR1432可能受到逆境胁迫和激素的调节。phe-miR397和phe-miR1432均在叶鞘中表达丰度最高,最低丰度 phe-miR397出现在幼茎中,而 phe-miR1432则在叶片中。经强光、黑暗、高温、低温、Na

  4. Comparison and characterization of efficient frequency doubling at 397.5 nm with PPKTP, LBO and BiBO crystals

    Science.gov (United States)

    Wen, Xin; Han, Yashuai; Wang, Junmin

    2016-04-01

    A continuous-wave Ti:sapphire laser at 795 nm is frequency doubled in a bow-tie type enhancement four-mirror ring cavity with LiB3O5 (LBO), BiB3O6 (BiBO), and periodically polled KTiOPO4 (PPKTP) crystals, respectively. The properties of 397.5 nm ultra-violet (UV) output power, beam quality, stability for these different nonlinear crystals are investigated and compared. For PPKTP crystal, the highest doubling efficiency of 58.1% is achieved from 191 mW of 795 nm mode-matched fundamental power to 111 mW of 397.5 nm UV output. For LBO crystal, with 1.34 W of mode-matched 795 nm power, 770 mW of 397.5 nm UV output is achieved, implying a doubling efficiency of 57.4%. For BiBO crystal, with 323 mW of mode-matched 795 nm power, 116 mW of 397.5 nm UV output is achieved, leading to a doubling efficiency of 35.9%. The generated UV radiation has potential applications in the fields of quantum physics.

  5. Relationship between carbon catabolite repression and the biosynthesis regulation of the prolidase PepQ from Lactobacillus delbrueckii ssp. bulgaricus CNRZ 397

    OpenAIRE

    Lamarque, Mauld; Morel, Fabienne; Bissardon, Isabelle; Galinier, Anne; Portalier, Raymond; Atlan, Danièle

    2001-01-01

    International audience Lactobacillus delbrueckii ssp. bulgaricus CNRZ 397 (L. bulgaricus) displays several enzymes specific of proline-containing peptides. We focused on the prolidase PepQ which specifically cleaves X-Pro dipeptides. PepQ biosynthesis was previously shown to be independent of the peptide concentration of the culture medium in contrast to the cell surface proteinase PrtB and several aminopeptidases. Regulation of PepQ biosynthesis can be explained by the genetic organizatio...

  6. Characterization of the shape memory properties of a Ni45.3Ti39.7Hf10Pd5 alloy

    International Nuclear Information System (INIS)

    Highlights: •Ni45.3Ti39.7Hf10Pd5 alloys have transformation strain of up to 4.6% and work output of up to 29 J cm−3. •The alloy showed good superelastic behavior at 90 °C with recoverable strain of 4.3%. •The alloy exhibited 1.6% two-way shape memory strain after a simple training procedure. •The formation of 〈0 1 1〉 type II twins in martensite plates results in large transformation strain. -- Abstract: The load-biased shape memory and superelastic responses of a Ni45.3Ti39.7Hf10Pd5 polycrystalline alloy were investigated in compression. Transformation strain of up to 4.6% and work output of up to 29 J cm−3 were determined from load-biased thermal cycling experiments. The alloy showed good superelastic behavior at 90 oC with recoverable strain of over 4%. It was also determined that the Ni45.3Ti39.7Hf10Pd5 alloy could develop two-way shape memory strain of 1.6% without an intense training process. Transmission electron microscopy (TEM) revealed that the internal twins formed in the martensite variants were 〈0 1 1〉 type II twins

  7. CQ-397 and CQ-414: antimicrobial activity and spectrum of two fluoroquinolone---cephalosporin, dual-action compounds with carboxamido bonds.

    Science.gov (United States)

    Johnson, David M.; Jones, Ronald N.

    1997-06-01

    OBJECTIVE: To evaluate the potential spectrum of activity of two novel dual-action compounds with carboxamido bonds (CQ-397 and CQ-414; Laboratorios Aranda, San Rafael, Mexico) against human pathogens. METHODS: Approximately 800 Gram-positive and Gram-negative aerobic clinical bacteria were tested in vitro using the Mueller-Hinton broth microdilution method of the National Committee of Clinical Laboratory Standards. RESULTS: CQ-397 (cefamandole+enrofloxacin) and CQ-414 (cefamandole+norfloxacin) were equally potent against Enterobacteriaceae (MIC90 range, 0.06--0.5 microg/mL and 0.06--1 microg/mL, respectively). Citrobacter freundii (MIC90, 4 microg/mL) and Providencia spp. (MIC90, >32 microg/mL) exhibited elevated study drug MICs. Enterobacteriaceae resistant to fluoroquinolones generally remained resistant. CQ-397 and CQ-414 were active against Stenotrophomonas maltophilia (MIC90, 4 microg/mL) and oxacillin-susceptible staphylococci (MIC90, 0.25 microg/mL), but not oxacillin-resistant Staphylococcus aureus (MIC90, >32 microg/mL), Staphylococcus epidermidis (MIC90, 8 microg/mL), and enterococci (MIC90s, 8 to >32 microg/mL). There was no difference in the dual-action drug activity (MIC90, 2 microg/mL) between penicillin-susceptible and -resistant pneumococci. Haemophilus influenzae and Moraxella catarrhalis were very susceptible (MIC range, less-than-or-equal0.015--0.06 microg/mL) to both compounds. CONCLUSIONS: The activity of these novel dual-action compounds, formed from the bonding of older antimicrobials, warrants further investigation for potential human and/or animal health use, including toxicology and pharmacokinetics. PMID:11864130

  8. Measurement of Charm Production Cross Sections in e^+e^- Annihilation at Energies between 3.97 and 4.26 GeV

    CERN Document Server

    Cronin-Hennessy, D; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; López, A; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Rademacker, J; Asner, D M; Edwards, K W; Naik, P; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K

    2008-01-01

    Using the CLEO-c detector at the Cornell Electron Storage Ring, we have measured inclusive and exclusive cross sections for the production of D+, D0 and Ds+ mesons in e+e- annihilations at thirteen center-of-mass energies between 3.97 and 4.26 GeV. Exclusive cross sections are presented for final states consisting of two charm mesons (DD, D*D, D*D*, Ds+Ds-, Ds*+Ds-, and Ds*+Ds*-) and for processes in which the charm-meson pair is accompanied by a pion. No enhancement in any final state is observed at the energy of the Y(4260).

  9. A Chandrasekhar Mass Progenitor for the Type Ia Supernova Remnant 3C 397 from The Enhanced Abundances of Nickel and Manganese

    CERN Document Server

    Yamaguchi, Hiroya; Foster, Adam R; Bravo, Eduardo; Williams, Brian J; Maeda, Keiichi; Nobukawa, Masayoshi; Eriksen, Kristoffer A; Brickhouse, Nancy S; Petre, Robert; Koyama, Katsuji

    2015-01-01

    Despite decades of intense efforts, many fundamental aspects of Type Ia supernova (SNe Ia) remain elusive. One of the major open questions is whether the mass of the exploding white dwarf (WD) is close to the Chandrasekhar limit. Here we report the detection of strong K-shell emission from stable Fe-peak elements in the Suzaku X-ray spectrum of the Type Ia supernova remnant (SNR) 3C 397. The high Ni/Fe and Mn/Fe mass ratios (0.11-0.24 and 0.018-0.033, respectively) in the hot plasma component that dominates the K-shell emission lines indicate a degree of neutronization in the SN ejecta which can only be achieved by electron captures in the dense cores of exploding WDs with a near-Chandrasekhar mass. This suggests a single-degenerate origin for 3C 397, since Chandrasekhar mass progenitors are expected naturally if the WD accretes mass slowly from a companion. Together with other results supporting the double-degenerate scenario, our work adds to the mounting evidence that both progenitor channels make a signif...

  10. Cavity-enhanced frequency doubling from 795nm to 397.5nm ultra-violet coherent radiation with PPKTP crystals in the low pump power regime.

    Science.gov (United States)

    Wen, Xin; Han, Yashuai; Bai, Jiandong; He, Jun; Wang, Yanhua; Yang, Baodong; Wang, Junmin

    2014-12-29

    We demonstrate a simple, compact and cost-efficient diode laser pumped frequency doubling system at 795 nm in the low power regime. In two configurations, a bow-tie four-mirror ring enhancement cavity with a PPKTP crystal inside and a semi-monolithic PPKTP enhancement cavity, we obtain 397.5nm ultra-violet coherent radiation of 35mW and 47mW respectively with a mode-matched fundamental power of about 110mW, corresponding to a conversion efficiency of 32% and 41%. The low loss semi-monolithic cavity leads to the better results. The constructed ultra-violet coherent radiation has good power stability and beam quality, and the system has huge potential in quantum optics and cold atom physics. PMID:25607194

  11. Non-s-wave behavior of c-axis aligned Pr1.85Ce0.15CuO3.97 superconducting powder

    International Nuclear Information System (INIS)

    The tetragonal c-axis alignment of Tc=23K Pr1.85Ce0.15CuO3.97 superconducting powder was achieved in a 1 T alignment field with rotating powder/epoxy holder perpendicular to the alignment field. The in-plane penetration depth λab for this electron-doped superconductor was derived using zero-field-cooled Meissner diamagnetic data with low applied field (Bac1ab) parallel to the c-axis aligned powder. A small Pr paramagnetic contribution was subtracted. The temperature dependence of Δλab(T)=λab(T)-λab(0) [with λab(0)∼133nm] up to ∼0.5 Tc can be fitted well with a non-s-wave or d-wave-like power law Δλab(T)=AT2+CT4, where the T2 law is dominated at low temperature. The present result agrees with recent phase-sensitive experiment, which indicates d-wave nature for these electron-doped 214 cuprates. [copyright] 2001 American Institute of Physics

  12. Screening for Co-Morbidity in 65,397 Obese Pediatric Patients from Germany, Austria and Switzerland: Adherence to Guidelines Improved from the Year 2000 to 2010

    Directory of Open Access Journals (Sweden)

    Marion Flechtner-Mors

    2013-08-01

    Full Text Available Objective: The aim of the study was to analyze the adherence to current guidelines for co-morbidity screening in overweight and obese pediatric patients participating in the Adipositas-Patienten-Verlaufsdokumentation (APV initiative in three German-speaking countries. Methods: APV database: 181 centers from Germany, Austria and Switzerland, specialized in obesity care, contributed standardized, anonymous data of medical examinations from 65,397 patients performed between 2000 and 2010. Completeness of screening for hypertension, dyslipidemia, and impaired glucose metabolism was analyzed using adjusted means. Results: Mean age of the cohort was 12.5 ± 2.9 years and 46.5% were male. 17.3% were overweight (>90th-97th percentile, 45.1% obese (>97th-99.5th percentile, and 37.7% extremely obese (>99.5th percentile. In 2000, blood pressure was documented for 55.1% of patients, increasing to 88.7% in 2010. The rate of lipid diagnostics also improved from 45.0 to 67.7%, and screening for diabetes rose from 32.7 to 62.3% in the same time period. Blood pressure measurements were performed more often during inpatient care (88.5% compared to outpatient programs (77.5%. Screening was more complete with increasing age and increasing degree of obesity. In boys screening rate was higher than in girls. Conclusion: During the 11-year period, screening for co-morbidity improved significantly in overweight or obese children and adolescents. However, adherence to guidelines is still insufficient in some institutions. Quality control based on benchmarking may improve obesity care and outcome.

  13. Illumina microRNA profiles reveal the involvement of miR397a in Citrus adaptation to long-term boron toxicity via modulating secondary cell-wall biosynthesis.

    Science.gov (United States)

    Huang, Jing-Hao; Qi, Yi-Ping; Wen, Shou-Xing; Guo, Peng; Chen, Xiao-Min; Chen, Li-Song

    2016-01-01

    The mechanisms underlying tolerance to B-toxicity in plants are still controversial. Our previous studies indicated that B-toxicity is mainly limited to leaves in Citrus and that alternations of cell-wall structure in vascular bundles are involved in tolerance to B-toxicity. Here, miRNAs and their expression patterns were first identified in B-treated Citrus sinensis (tolerant) and C. grandis (intolerant) leaves via high-throughput sequencing. Candidate miRNAs were then verified with molecular and anatomical approaches. The results showed that 51 miRNAs in C. grandis and 20 miRNAs in C. sinensis were differentially expressed after B-toxic treatment. MiR395a and miR397a were the most significantly up-regulated miRNAs in B-toxic C. grandis leaves, but both were down-regulated in B-toxic C. sinensis leaves. Four auxin response factor genes and two laccase (LAC) genes were confirmed through 5'-RACE to be real targets of miR160a and miR397a, respectively. Up-regulation of LAC4 resulted in secondary deposition of cell-wall polysaccharides in vessel elements of C. sinensis, whereas down-regulation of both LAC17 and LAC4, led to poorly developed vessel elements in C. grandis. Our findings demonstrated that miR397a plays a pivotal role in woody Citrus tolerance to B-toxicity by targeting LAC17 and LAC4, both of which are responsible for secondary cell-wall synthesis. PMID:26962011

  14. Characterization of the shape memory properties of a Ni{sub 45.3}Ti{sub 39.7}Hf{sub 10}Pd{sub 5} alloy

    Energy Technology Data Exchange (ETDEWEB)

    Acar, E. [Department of Mechanical Engineering, University of Kentucky, Lexington, KY 40506 (United States); Karaca, H.E., E-mail: karaca@engr.uky.edu [Department of Mechanical Engineering, University of Kentucky, Lexington, KY 40506 (United States); Tobe, H. [Department of Mechanical Engineering, University of Kentucky, Lexington, KY 40506 (United States); Noebe, R.D. [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Chumlyakov, Y.I. [Siberian Physical-Technical Institute at Tomsk State University, Tomsk 634050 (Russian Federation)

    2013-11-25

    Highlights: •Ni{sub 45.3}Ti{sub 39.7}Hf{sub 10}Pd{sub 5} alloys have transformation strain of up to 4.6% and work output of up to 29 J cm{sup −3}. •The alloy showed good superelastic behavior at 90 °C with recoverable strain of 4.3%. •The alloy exhibited 1.6% two-way shape memory strain after a simple training procedure. •The formation of 〈0 1 1〉 type II twins in martensite plates results in large transformation strain. -- Abstract: The load-biased shape memory and superelastic responses of a Ni{sub 45.3}Ti{sub 39.7}Hf{sub 10}Pd{sub 5} polycrystalline alloy were investigated in compression. Transformation strain of up to 4.6% and work output of up to 29 J cm{sup −3} were determined from load-biased thermal cycling experiments. The alloy showed good superelastic behavior at 90 {sup o}C with recoverable strain of over 4%. It was also determined that the Ni{sub 45.3}Ti{sub 39.7}Hf{sub 10}Pd{sub 5} alloy could develop two-way shape memory strain of 1.6% without an intense training process. Transmission electron microscopy (TEM) revealed that the internal twins formed in the martensite variants were 〈0 1 1〉 type II twins.

  15. Selective determination of cadmium(II) from divalent metal ions in environmental samples by capillary electrophoresis using in-capillary complexation with a lacunary Keggin-type [PW11O39]7- complex.

    Science.gov (United States)

    Himeno, Sadayuki; Kitano, Eri; Morishita, Kenta

    2007-08-01

    A novel capillary electrophoretic (CE) method, based on in-capillary complexation with [PW(11)O(39)](7-), was developed for the determination of cadmium(II) in natural water samples. When a sample solution is injected into a capillary containing 0.20 mM [PW(11)O(39)](7-) and 0.10 M malonate buffer (pH 3.0), the ternary Keggin-type complex, [P(Cd(II)W(11))O(39)](5-), which possesses high molar absorbtivities in the UV region, is formed in the capillary, and its migration toward the anode gives a well-defined migration peak in the electropherogram. An advantage of this method is that many divalent metal ions do not interfere. The proposed method was successfully applied to the determination of Cd(II) in environmental samples. The detection limits were 1 x 10(-7) and 5 x 10(-7) M for river-water and seawater samples, respectively (signal-to-noise ratio = 3). PMID:17690428

  16. Prevalence of ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms in Brazilian breast cancer-unaffected women

    International Nuclear Information System (INIS)

    Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease

  17. Prevalence of ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms in Brazilian breast cancer-unaffected women

    Energy Technology Data Exchange (ETDEWEB)

    Giacomazzi, J.; Aguiar, E. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Palmero, E.I. [International Agency for Research on Cancer (IARC), Lyon (France); Schmidt, A.V. [Departamento de Estatística, UFRGS, Porto Alegre, RS (Brazil); Skonieski, G.; Filho, D.D. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Bock, H. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Saraiva-Pereira, M.L. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Bioquímica, UFRGS, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Ewald, I.P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Schuler-Faccini, L. [Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Camey, S.A. [Departamento de Estatística, Instituto de Matemática, UFRGS, Porto Alegre, RS (Brazil); Caleffi, M. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Giugliani, R. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Ashton-Prolla, P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (BR); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (BR); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (BR); Serviço de Genética Médica, HCPA, Porto Alegre, RS (BR); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (BR); Departamento de Genética, UFRGS, Porto Alegre, RS (BR)

    2012-05-18

    Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease.

  18. BDML Metadata: 397 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Keller, P.J., Schmidt, A.D., Wittbrodt, J. and Stelzer, E.H.K. Philipp J. Keller, European Molecular Biology Laboratory..., Cell Biology and Biophysics Unit, Stelzer Laboratory See details in

  19. QTL Information Table: 397 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qFLL-1 Morphological trait Culm/leaf first leaf length RFLP C)Interval RIL Zhenshan 97B Milyang ... 2003). QTLs mapping of leaf traits and root vitality i n a recombinant inbred line population of rice. Yi ...

  20. US House of Representatives resolution 397

    Index Scriptorium Estoniae

    2008-01-01

    USA Kongressi Esindajatekoja Eesti teemaline resolutsioon, milles väljendatakse solidaarsust Eestiga ning mõistetakse hukka märatsejate vägivald Tallinnas ning rünnakud Eesti saatkonna vastu Moskvas

  1. Aeronautical Engineering: A Continuing Bibliography with Indexes. Supplement 397

    Science.gov (United States)

    1999-01-01

    This report lists reports, articles and other documents recently announced in the NASA STI Database. The coverage includes documents on the engineering and theoretical aspects of design, construction, evaluation, testing, operation, and performance of aircraft (including aircraft engines) and associated components, equipment, and systems. It also includes research and development in aerodynamics, aeronautics, and ground support equipment for aeronautical vehicles. Each entry in the publication consists of a standard bibliographic citation accompanied, in most cases, by an abstract.

  2. ACOG committee opinion number 397, February 2008: surrogate motherhood.

    Science.gov (United States)

    2008-02-01

    Ethical responsibilities are described for obstetrician-gynecologists who choose to participate in surrogacy arrangements by 1) advising couples who are considering surrogacy, 2) counseling potential surrogate mothers, 3) providing obstetric services for pregnant women participating in surrogacy, or 4) offering assisted reproductive technologies related to surrogacy. Although the obligations of physicians will vary depending on the type and level of their involvement, in all cases physicians should carefully examine all relevant issues related to surrogacy, including medical, ethical, legal, and psychologic aspects. PMID:18238989

  3. 49 CFR 397.67 - Motor carrier responsibility for routing.

    Science.gov (United States)

    2010-10-01

    ... carrying hazardous materials required to be placarded or marked in accordance with 49 CFR 177.823 and not... containing explosives in Class 1, Divisions 1.1, 1.2, 1.3, as defined in 49 CFR 173.50 and 173.53... 49 Transportation 5 2010-10-01 2010-10-01 false Motor carrier responsibility for routing....

  4. OC397L01: WHOI cruise 397 leg 01 aboard the R/V Oceanus from 2003-12-08 - 2003-12-16 (NODC Accession 0054899)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  5. Los Alamos Plutonium Facility newly generated tru waste certification. Final revised version 3/97

    International Nuclear Information System (INIS)

    This paper presents an overview of the activities being planned and implemented to certify newly generated contact handled transuranic (TRU) waste produced by Los Alamos National Laboratory's (LANL's) Plutonium Facility. Certifying waste at the point of generation is the most important cost and labor saving step in the WIPP certification process. The pedigree of a waste item is best known by the originator of the waste and frees a site from many of the expensive characterization activities associated with legacy waste. Through a cooperative agreement with LANLs Waste Management Facility and under the umbrella of LANLs WIPP-related certification and quality assurance documents, the Plutonium Facility will be certifying most of its own newly generated waste. Some of the challenges faced by the Plutonium Facility in preparing to certify TRU waste include the modification and addition of procedures to meet WIPP requirements, standardizing packaging for TRU waste, collecting processing documentation from operations which produce TRU waste, and developing ways to modify waste streams which are not certifiable in their present form

  6. WPPSS Nuclear Project No. 2: Final environmental statement (DOCKET No. 50-397)

    International Nuclear Information System (INIS)

    The proposed action is the issuance of an operating license to the Washington Public Power Supply System (WPPSS) for the startup and operation of the Washington Nuclear Project Number 2 (WNP-2) located on the Columbia River in Benton County, about 19 km (12 mi) north of Richland, Washington. The facility will employ a boiling water reactor to produce 3323 megawatts thermal (MWt). A steam turbine-generator will use this heat to provide a nominal gross electrical output of 1150 megawatts (MWe). The exhaust steam will be condensed by cooled water from six circular mechanical-draft cooling towers with water taken from and returned to the Columbia River. The information in this statement represents the second assessment of the environmental impact associated with the WNP-2 pursuant to the guidelines of the National Environmental Policy Act of 1969 (NEPA) and 10 CRF Part 51 of the Commission's Regulations. After receiving an application to construct this plant, the staff carried out a review of impacts that would occur during its construction and operation. That evaluation was issued as a Final Environmental Statement (construction phase). The construction of Unit 2 about 86% complete. The staff estimated a fuel-loading date of September 1983. In March 1977, the applicant applied for an operating license for the unit and submitted the required safety and environmental reports in support of the application. 20 figs., 19 tabs

  7. 76 FR 397 - iShares Trust, et al.; Notice of Application

    Science.gov (United States)

    2011-01-04

    ... Creation Units will include institutional investors and arbitrageurs (which could include institutional investors). The Specialist, or Market Maker, in providing a fair and orderly secondary market for the Shares... secondary market purchasers of Shares will include both institutional investors and retail...

  8. 7 CFR 1755.397 - RUS performance specification for line concentrators.

    Science.gov (United States)

    2010-01-01

    ... reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552 (a) and 1 CFR... noise (idle channel at 900 ohm impedance). Steady noise: Measure on terminated call. Noise measurements... using the mu-255 encoding law and D3 encoding format, and arranged to interface with a T1 span...

  9. SU-E-T-397: Include Organ Deformation Into Dose Calculation of Prostate Brachytherapy

    International Nuclear Information System (INIS)

    Purpose: Prostate brachytherapy is an important curative treatment for patients with localized prostate cancer. In brachytherapy, rectal balloon is generally needed to adjust for unfavorable prostate position for seed placement. However, rectal balloon causes prostate deformation, which is not accounted for in dosimetric planning. Therefore, it is possible that brachytherapy dosimetry deviates significantly from initial plan when prostate returns to its non-deformed state (after procedure). The goal of this study is to develop a method to include prostate deformation into the treatment planning of brachytherapy dosimetry. Methods: We prospectively collected ultrasound images of prostate pre- and post- rectal balloon inflation from thirty five consecutive patients undergoing I-125 brachytherapy. Based on the cylinder coordinate systems, we learned the initial coordinate transformation parameters between the manual segmentations of both deformed and non-deformed prostates of each patient in training set. With the nearest-neighbor interpolation, we searched the best transformation between two coordinate systems to maximum the mutual information of deformed and non-deformed images. We then mapped the implanted seeds of five selected patients from the deformed prostate into non-deformed prostate. The seed position is marked on original pre-inflation US image and it is imported into VariSeed software for dose calculation. Results: The accuracy of image registration is 87.5% as quantified by Dice Index. The prostate coverage V100% dropped from 96.5±0.5% of prostate deformed plan to 91.9±2.6% (p<0.05) of non-deformed plan. The rectum V100% decreased from 0.44±0.26 cc to 0.10±0.18 cc (p<0.05). The dosimetry of the urethra showed mild change but not significant: V150% changed from 0.05±0.10 cc to 0.14±0.15 cc (p>0.05) and D1% changed from 212.9±37.3 Gy to 248.4±42.8 Gy (p>0.05). Conclusion: We have developed a deformable image registration method that allows dosimetry calculation in the non-deformed prostate – which may be used to more accurately reflect “true” dosimetry during planning

  10. Community College Partnerships for Student and Career Success: Program Profile of "Carreras en Salud." Fact Sheet #C397

    Science.gov (United States)

    Henrici, Jane

    2012-01-01

    Postsecondary students with children often need an array of supports to succeed in their studies, which can require significant coordination among new and existing services (Conway, Blair, and Helmer 2012; Henrici n.d.; Miller, Gault, and Thorman 2011). Such supports might include financial aid, academic and career counseling, job placement…

  11. Technical specifications WPPSS Nuclear Project No. 2 (Docket No. 50-397). Appendix A to License No. NPF-21

    International Nuclear Information System (INIS)

    The WPPSS Nucelar Project No. 2 Technical Specifications were prepared by the US Nuclear Regulatory Commission to set forth the limits, operating conditions, and other requirements applicable to a nuclear reactor facility as set forth in Section 50.36 of 10 CFR Part 50 for the protection of the health and safety of the public

  12. IVS1 −397T>C Estrogen Receptor α Polymorphism Is Associated with Low-Grade Systemic Inflammatory Response in Type 1 Diabetic Girls

    Directory of Open Access Journals (Sweden)

    Monika Ryba-Stanisławowska

    2014-01-01

    Full Text Available Purpose. The study aimed to investigate the influence of estrogen receptor α (ER-α genotypes on inflammatory response and development of microvascular complications in girls with type 1 diabetes. Methods. 152 young regularly menstruating girls with diagnosed type 1 diabetes and 84 young, healthy menstruating girls were recruited. ER-α genotyping was carried out by PCR. Serum concentrations of 17β-estradiol, as well as IL-6, TNF-α, VEGF, and IL-10, were measured. CD4+Foxp3+ TH17 cells were isolated and analyzed by flow cytometry. Results. Type 1 diabetic girls carrying TT genotype were characterized by the lowest serum estradiol level and IL-10 and highest IL-6, TNF-α , and VEGF. The association between the level of certain cytokine and the genetic variant of estrogen receptor α polymorphism was analyzed. Frequencies of CD4+Foxp3+ TH17 cells were also enhanced in TT bearing girls with type 1 diabetes and correlated with the level of analyzed cytokines. In addition, the correlation between serum estradiol level and cytokine concentrations was observed. Conclusions. We propose that TT variant of estrogen receptor α polymorphism may be associated with enhanced inflammatory response, which in turn may lead to acceleration of diabetic retino- and nephropathy in girls with type 1 diabetes. This finding may help the physicians to predict the onset and progression of diabetic microvascular complications.

  13. Contents & Abstracts(Monthly, Startedin 1960) ISSN 1001-1560 Feb. 2012 Vol.45 No.2 Serial N0.397

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Mlcrostructure and HighTemperature Wear Resistance of Laser Claddln8 Nickel-Based Alloy Coating;Corrosion. Preventlon Performance of 0rganic ComposiCe Coatings on AZ91D Mawaeslum Alloy;Kinetics Model of Comprely Accelerated Aging of Organle Protective Coatings

  14. Comment on Consensus formation on a simplicial complex of opinions (arXiv:1212.1940, Physica A, Vol. 397, pp 111_1201 2014)

    CERN Document Server

    Berec, Vesna

    2014-01-01

    In the commented paper [arXiv:1212.1940], the authors declare an analogy with quantum mechanical pure states established through the application of the high-dimensional combinatorial Laplacian considering that the simplicial complex is in pure state when it is formed by the collection of pure states. In their work, besides giving a completely erroneous analogy for pure quantum mechanical state, which contradicts to very basic postulates of quantum mechanic, the authors clearly fail to provide and explain mathematical formalism behind their claims. Their goal is to rigorously prove that the existence of opinion space in all considered cases consists of pure states using incorrect normalization constant which does not produce trace equal to one. In this comment we prove out that their claims are erroneous. In order to show incorrectness of Maletic & Rajkovic model and conclusions we calculated and examined connections between different combinatorial structures of n dimensional simplicial complexes and their...

  15. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2, (Docket No. 50-397). Supplement No. 4

    International Nuclear Information System (INIS)

    Supplement No. 4 to the Safety Evaluation Report on the application filed by Washington Public Power Supply System for a license to operate the WPPSS Nuclear Project No. 2, located in Richland, Washington, has been prepared by the Division of Licensing, Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and Supplement Nos. 1, 2 and 3

  16. Safety evaluation report related to the operation of WPPSS Nuclear Project No. 2. Docket No. 50-397, Washington Public Power Supply System

    International Nuclear Information System (INIS)

    Information is presented concerning site characteristics; design criteria for structures, systems, and components; engineered safety features; instrumentation and control; auxiliary systems; conduct of operations; and financial qualifications

  17. Final Scientific Report DE-FGO3-97ER62460 Stomatal Responses to CO2: A Comparison of Woody and Herbaceous Species in Arid and Humid Climates

    Energy Technology Data Exchange (ETDEWEB)

    Koch, George W.

    2003-12-19

    OAK-B135 The project involved a study of a fundamental response of terrestrial vegetation to rising atmospheric carbon dioxide (CO2) concentration, namely, the change in leaf conductance to gas diffusion associated with a change in the aperture of the microscopic pores (stomata) on the surface of leaves.

  18. Illumina microRNA profiles reveal the involvement of miR397a in Citrus adaptation to long-term boron toxicity via modulating secondary cell-wall biosynthesis

    OpenAIRE

    Jing-Hao Huang; Yi-Ping Qi; Shou-Xing Wen; Peng Guo; Xiao-Min Chen; Li-Song Chen

    2016-01-01

    The mechanisms underlying tolerance to B-toxicity in plants are still controversial. Our previous studies indicated that B-toxicity is mainly limited to leaves in Citrus and that alternations of cell-wall structure in vascular bundles are involved in tolerance to B-toxicity. Here, miRNAs and their expression patterns were first identified in B-treated Citrus sinensis (tolerant) and C. grandis (intolerant) leaves via high-throughput sequencing. Candidate miRNAs were then verified with molecula...

  19. S. 397: A bill to provide assistance to small communities with ground water radium contamination. Introduced in the Senate of the United States, One Hundredth First Congress, First Session, February 9, 1989

    International Nuclear Information System (INIS)

    A bill was introduced in the Senate to provide assistance to small communities with ground water radium contamination. Assistance will be used for financing the acquisition and installation of ground water treatment technologies needed to remove radium from ground water used as a source of drinking water

  20. "La seguridad vial en la autopista México - Guadalajara" Maravatío - Límite de estados Michoacán/Jalisco del km 165+000 al km 397+000

    OpenAIRE

    López Nava, Jóse Fernando

    2011-01-01

    Es un gran reto de la sociedad mexicana aumentar la seguridad vial en las carreteras, actualmente los costos que se derivan de la frecuencia y severidad de los accidentes que ocurren en la red federal del país, representan un grave problema desde el punto de vista social y de salud pública. La seguridad vial destaca, que los accidentes viales y sus consecuencias como son muertos, lesionados y daños materiales, pueden disminuir mediante una inversión adecuada y creciente para generar mejores ...

  1. Atuação dos fisioterapeutas dos núcleos de apoio à saúde da família entre idosos do município de Arapiraca-Al, Brasil - doi: 10.5020/18061230.2012.p397

    Directory of Open Access Journals (Sweden)

    Almir Vieira Dibai Filho

    2013-07-01

    Full Text Available Objetivo: Analisar a atuação dos fisioterapeutas nos Núcleos de Apoio à Saúde da Família (NASF com indivíduos senescentes residentes no município de Arapiraca-AL, Brasil. Metodos: Estudo caracterizado como descritivo e qualitativo. Os sujeitos da pesquisa foram oito fisioterapeutas realizando intervenções junto aos idosos nos NASF, de ambos os sexos, regularmente inscritos no Conselho Regional de Fisioterapia e Terapia Ocupacional 1 (CREFITO 1. Os dados foram obtidos no mês de outubro de 2010 com a aplicação de um questionário para caracterizar a amostra, sendo coletados dados pessoais e questões relacionadas à formação acadêmica e ao trabalho nos NASF. Além disso, realizou-se uma entrevista abordando opiniões dos fisioterapeutas referentes ao cuidado com o idoso na Estratégia Saúde da Família (ESF e nos NASF, à atuação dos fisioterapeutas dos NASF com idosos, e às dificuldades vivenciadas nesse trabalho. Foi realizada uma análise qualitativa por meio da técnica do discurso do sujeito coletivo. Resultados: Os profissionais incluídos no estudo consideraram regular e positivo o cuidado ao idoso na ESF e nos NASF, respectivamente. As intervenções deles nos NASF se baseiam em ações sustentadas na atenção primária à saúde e as dificuldades encontradas dizem respeito à equipe multidisciplinar e à falta de recursos e infraestrutura. Conclusão: Os fisioterapeutas dos NASF do município em estudo desenvolvem suas ações na população senescente, com ênfase em medidas educativas, preventivas e promotoras de saúde.

  2. Atuação dos fisioterapeutas dos núcleos de apoio à saúde da família entre idosos do município de Arapiraca-Al, Brasil - doi: 10.5020/18061230.2012.p397

    OpenAIRE

    Almir Vieira Dibai Filho; Mariana Chaves Aveiro

    2013-01-01

    Objetivo: Analisar a atuação dos fisioterapeutas nos Núcleos de Apoio à Saúde da Família (NASF) com indivíduos senescentes residentes no município de Arapiraca-AL, Brasil. Metodos: Estudo caracterizado como descritivo e qualitativo. Os sujeitos da pesquisa foram oito fisioterapeutas realizando intervenções junto aos idosos nos NASF, de ambos os sexos, regularmente inscritos no Conselho Regional de Fisioterapia e Terapia Ocupacional 1 (CREFITO 1). Os dados foram obtidos no mês de outubro...

  3. 49 CFR 177.804 - Compliance with Federal Motor Carrier Safety Regulations.

    Science.gov (United States)

    2010-10-01

    ... Carrier Safety Regulations. Motor carriers and other persons subject to this part must comply with 49 CFR part 383 and 49 CFR parts 390 through 397 (excluding §§ 397.3 and 397.9) to the extent those... Regulations. 177.804 Section 177.804 Transportation Other Regulations Relating to Transportation PIPELINE...

  4. History of oceanography of the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sengupta, R.

    stream_size 12 stream_content_type text/plain stream_name New_Trends_Indian_Art_Archaeol_1992_2_397.pdf.txt stream_source_info New_Trends_Indian_Art_Archaeol_1992_2_397.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  5. AcEST: DK955551 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ptio... 30 9.1 sp|P15315|ACE1_YEAST Transcriptional activator protein ACE1 OS=S... 30 9.1 >sp|Q54...A + ++Q P +Q Sbjct: 744 SVKKLEMQQQTPSAAMAIKQEPGAQ 768 >sp|P15315|ACE1_YEAST Transcriptional activator pr... BlastX Result : TrEMBL tr_hit_id A5E397 Definition tr|A5E397|A5E397_LODEL Putative uncharacterized protein OS=Lodderomyces elongisp...9.4 >tr|A5E397|A5E397_LODEL Putative uncharacterized protein OS=Lodderomyces elongisporus GN=LELG_04084 PE=4...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_G11. 5' end sequence. Accession DK955551 Tissue type pr

  6. PDB: CBRC-PHAM-01-0319 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available C BRC -PHAM-01-0319 1OF2,1OGT,3B3I, Region:389-397(Identity=100%) PDB:1OF2 C hain:C ... (X-ray Resoluti ... on=2.20),Region:389-397(Identity=100%) PDB:1OGT C hain:C ... (X-ray Resolution=1.47),Region:389-397(Ident ... ity=100%) PDB:3B3I C hain:C ... (X-ray Resolution=1.86), ...

  7. Mesozoic and Tertiary Anura of Laurasia

    Czech Academy of Sciences Publication Activity Database

    Roček, Zbyněk

    2013-01-01

    Roč. 93, č. 4 (2013), s. 397-439. ISSN 1867-1594 Institutional support: RVO:67985831 Keywords : Anura * Laurasia * taxonomic diagnoses * systematic review * stratigraphy * distribution Subject RIV: EG - Zoology

  8. Pie Graph Data: Number of Americans Dependent on or Abusing Alcohol and Illicit Drugs

    Science.gov (United States)

    ... 1,921 Sedatives / 162 Tranquilizers / 521 Stimulants / 357 Heroin / 359 Hallucinogens / 397 Cocaine / 1,003 Inhalants / 161 Source: Substance Abuse and Mental Health Services Administration, 2005 National Survey on Drug Use ...

  9. Serotype Distribution and Antimicrobial Resistance of Streptococcus pneumoniae prior to Introduction of the 10-Valent Pneumococcal Conjugate Vaccine in Brazil, 2000-2007: Pneumococcal Serotypes Prior to Conjugate Vaccine Introduction

    OpenAIRE

    Menezes, Ana Paula de O.; Campos, Leila C.; dos Santos, Milena S.; Azevedo, Jailton; dos Santos, Renan Cardoso Nery; Carvalho, Maria da Gloria S.; Beall, Bernard W.; Martin, Stacey W.; Salgado, Katia; Reis, Mitermayer G.; Ko, Albert I.; Reis, Joice N

    2010-01-01

    This study describes the serotype distribution and antibiotic resistance patterns among 397 S. pneumoniae meningitis case isolates recovered in Salvador, Brazil, during the period of 2000-2007, before introduction of the 10-valent pneumococcal conjugate vaccine.

  10. Kontextualismus v soudobé architektuře. Reflexe teoretických východisek

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Petr

    Praha : Arte factum, 2002 - (Prix, D.), s. 397-401 ISBN 80-903230-1-4 R&D Projects: GA AV ČR IAA8033203 Keywords : architecture * theory * 20th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. fRNAdb Summary: FR397135 [

    Lifescience Database Archive (English)

    Full Text Available FR397135 AY051292 Hepatitis C virus (HCV) cis-acting replication element (CRE) mature_transcript ... Hepatitis C virus (isolate India ) RF00260 Rfam v8.1 FR397135.jpg FR397135.png FR397 ...

  12. Ohio River Islands National Wildlife Refuge: Examination of Contaminants Using Mussels and Paddlefish and Indicators

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Ohio River Islands National Wildlife Refuge is located along almost 400 miles of the Ohio River from river mile 35 to 397 with headquarters stationed at...

  13. Modulární laboratorní fluorová linka v ÚOCHB AV ČR

    Czech Academy of Sciences Publication Activity Database

    Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef

    2014-01-01

    Roč. 108, č. 4 (2014), s. 394-397. ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  14. ClEST cluster :Cl_singleton0167 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_singleton0167 sugar phosphate ... exchanger 2-like isoform 2 Cimex lectularius nuclear gene 506 C ... TATTCGCATACGCTGCATCAATG fb09027 1 PREDICTED: sugar phosphate ... exchanger 2-like isoform 2 [Apis mellifera] XP_397 ...

  15. Vaccination studies in type 1 diabetes

    Czech Academy of Sciences Publication Activity Database

    Buschard, K.; Funda, David

    2002-01-01

    Roč. 360, - (2002), s. 488-489. ISSN 0140-6736 Institutional research plan: CEZ:AV0Z5020903 Keywords : vaccination * diabetes Subject RIV: EE - Microbiology, Virology Impact factor: 15.397, year: 2002

  16. Disease: H00683 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 51 (description) Al Hawsawi K, Al Aboud K, Alfadley A, Al Aboud D Anonychia congenita totalis: a case report and review of the litera...ture. Int J Dermatol 41:397-9 (2002) PMID:17186469 (gene

  17. AcEST: DK955810 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_B12 612 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_B12. 5' end seq ... .. 397 e-110 sp|P41339|ACTA_LIMPO Actin, acrosomal process ... isoform OS=Limulus... 397 e-110 sp|P41341|ACTY_LIM ... LTERGYS 200 >sp|P41339|ACTA_LIMPO Actin, acrosomal process ... isoform OS=Limulus polyphemus PE=2 SV=1 Length = 3 ...

  18. Drug: D01790 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01790 Drug Oxaliplatin (JAN/USAN/INN); Eloxatin (TN) Pt. C6H14N2. C2O4 397.0601 397.2918 D01790 ... STIC AGENTS L01X OTHER ANTINEOPLASTIC AGENTS L01XA Platinum ... compounds L01XA03 Oxaliplatin D01790 Oxaliplatin ( ... NN) Antineoplastics [BR:br08308] Alkylating agents Platinum ... compounds Oxaliplatin [ATC:L01XA03] D01790 Oxalipl ...

  19. Impact of demographic factors on management competencies of the municipal sport

    Directory of Open Access Journals (Sweden)

    Tripolitsioti Alexandra

    2016-04-01

    Full Text Available The purpose of this study was to define the competencies required for the administration of the sports facilities, of the municipal sport organizations and to compare them with selected variables, such as age, educational level, type of degree and years of employment. In the study participated 401 sport’s facilities managers, of the Municipal sport organizations of the country. They answered in a questionnaire designed for the study purposes, which was sent to them postal. The Multivariate Analysis of Variance (MANOVA between age, educational level, type of degree and years of employment revealed that: a there were statistically significant differences between the different age groups for the facility management factor (F(3, 397= 4.947, p< 0.002 and governance factor (F(3, 397= 3.170, p< 0.024, b there were statistically significant differences between the PhD holders, the Master holders, the Higher Education graduates or any other title for the event management factor (F(3, 397= 3.073, p< 0.028 and first aid/crisis management factor (F(3, 397= 4.311, p< 0.005, c there were statistically significant differences between the different titles for the first aid- crisis management factor (F(3, 397= 10.264, p< 0.000 and governance factor (F(3, 397= 4.104, p< 0.007 and d there were statistically significant differences between the total years of employment for the first aid-crisis management factor (F(3, 397= 6.869, p< 0.000 and governance factor (F(3, 397= 3.779, p< 0.011. It is concluded that the competency factors of the Sport’s Facilities managers of the municipal sport organizations are affected by the age, the educational level, the type of degree and the years of employment.

  20. 78 FR 45213 - Medicaid Program; State Allotments for Payment of Medicare Part B Premiums for Qualifying...

    Science.gov (United States)

    2013-07-26

    ... CONTACT: Richard Strauss, (410) 786-2019. SUPPLEMENTARY INFORMATION: I. Background A. QI Allotments for FY... 598,851 Florida 83 6.22 45,385,768 66,783,222 21,397,454........ 25.9401 Need Need Need 21,397,454............ 0.6585 681,899 NA 379,127 Florida 96 6.66 50,929,265 75,922,288 24,993,023........ 24.1351 Need...

  1. AcEST: DK951755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0012_D24 615 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_D24. 5' end seq ... GMPHKFYHGR 60 Query: 218 TGVVWNVTKRAIGVEMNKQVNTRIVRKRI HVRIEHVQPSRCREDFIERVKKNDXXXXXXX 397 TG +WNVTKRA+GVE ... +NKQ+ RI+RKRI HVR+EHVQ SRC E+F R KKND Sbjct: 61 TGRIWNVTKRAVGVEVN ... KQIGNRIIRKRI HVRVEHVQQSRCAEEFKLRKKKNDELKAAAK 120 Query: 398 XXXX ... GMPHKFYHGR 60 Query: 218 TGVVWNVTKRAIGVEMNKQVNTRIVRKRI HVRIEHVQPSRCREDFIERVKKNDXXXXXXX 397 TG +WNVTKRA+GVE ...

  2. AcEST: DK962600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0014_E22 662 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0014_E22. 5' end seq ... EL-----------LKKQLADSLYGTNRGLS 118 Query: 397 ASSDVRAE IVELISQLEAKNXXXXXXXXXXXXNGKWILAYTSFSELFPLLAAGTLPLVK ... V 576 ASS+ RAE IVELI+QLE+KN NGKWILAYTSFS LFPLL+ G LPLV+V Sbjct: 11 ... 9 ASSETRAE IVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPLLSRGNLPLVR ... EL-----------LKKQLADSLYGTNRGLS 118 Query: 397 ASSDVRAE IVELISQLEAKNXXXXXXXXXXXXNGKWILAYTSFSELFPLLAAGTLPLVK ...

  3. Socioeconomic Status and Overweight: A Population-Based Cross-Sectional Study of Japanese Children and Adolescents

    OpenAIRE

    Kachi, Yuko; Otsuka, Toshiaki; Kawada, Tomoyuki

    2015-01-01

    Background Socioeconomic status (SES) as a determinant of obesity has received scant attention in Japan. This study examined the association between SES and overweight among Japanese children and adolescents. Methods Cross-sectional analyses of a representative sample of Japanese children (6–11 years: n = 397) and adolescents (12–18 years: n = 397) were performed, with measured heights and weights from the 2010 National Health and Nutrition Examination Survey and the 2010 Comprehensive Survey...

  4. AcEST: DK949201 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = 165/224 (73%), Positives = 173/224 (77%) Frame = +1 Query: 1 VTLPNDPDLVDILAMNGVDISVSEGETNNSXXXXX...SG 388 Score = 39.7 bits (91), Expect = 0.017 Identities = 23/34 (67%), Positives...802), Expect = 6e-85 Identities = 166/224 (74%), Positives = 170/224 (75%) Frame ...: 342 APCIVFIDEIDAVGRQRGAGMGGGNDEREQTINQLLTEMDGFSG 385 Score = 39.7 bits (91), Expect = 0.017 Identities = 23/34 (67%), Positives...=2 SV=1 Length = 706 Score = 312 bits (800), Expect = 1e-84 Identities = 165/224 (73%), Positives = 170/224

  5. Aktywność fizyczna a choroby cywilizacyjne osób starszych = Physical activity and older people's civilization diseases

    OpenAIRE

    Kotlarek, Magdalena; Szark-eckardt, Mirosława; Bartik, Pavol; Zukow, Walery

    2015-01-01

    Kotlarek Magdalena, Szark-Eckardt Mirosława, Bartik Pavol, Zukow Walery. Aktywność fizyczna a choroby cywilizacyjne osób starszych = Physical activity and older people's civilization diseases. Journal of Education, Health and Sport. 2015;5(9):397-412. ISSN 2391-8306. DOI 10.5281/zenodo.31000 http://dx.doi.org/10.5281/zenodo.31000 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%289%29%3A397-412 https://pbn.nauka.gov.pl/works/626190 Formerly Journal of Heal...

  6. Boletín Oficial núm. 04

    OpenAIRE

    Universidad Carlos III de Madrid

    1997-01-01

    Contiene: Reglamento de Organización y Funcionamiento del Servicio de Biblioteca, aprobado por Acuerdo de la Junta de Gobierno, en su sesión 3/97, de 17 de junio de 1.997 (pp. 1-7). -- Reglamento de Organización y Funcionamiento del Servicio de Informática, aprobado por Acuerdo de la Junta de Gobierno, en su sesión 3/97, de 17 de junio de 1.997 (pp. 8-14). -- Reglamento por el que se desarrolla el art. 148 de los Estatutos de la Universidad Carlos III de Madrid, aprobado por Acuerdo de la Jun...

  7. Dicty_cDB: Contig-U12753-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Chromosome length - Start point - End point - Strand (PLUS/MINUS) - Number of clones 4 Number of EST 4 Link ...Seq.d Length = 1169 Score = 829 bits (418), Expect = 0.0 Identities = 418/418 (100%) Strand = Plus / Plus Qu...97), Expect = 0.0 Identities = 397/397 (100%) Strand = Plus / Plus Query: 69 atag...5 Score = 375 bits (189), Expect = e-104 Identities = 189/189 (100%) Strand = Plus / Plus Query: 524 gattcaa...), Expect = 6e-12 Identities = 35/35 (100%) Strand = Plus / Plus Query: 1 aaataaacaacaacagcaacaacaaaatggtgct

  8. AcEST: DK951306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0011_A23 690 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_A23. 5' end seq ... ), Gaps = 8/107 (7%) Frame = +1 Query: 394 SRESIDAKKRI EETLERTSPSTSKG-NAREKDRVS-------MVPASTGRRLGSVDLRPT 5 ... 49 SR + +KRI ... + LER SPSTS+ N + K V+ ++ + D R Sbjct: 10 SRPEVVDRK ... %), Gaps = 2/100 (2%) Frame = +1 Query: 397 RESIDAKKRI EETLERTSPSTSKGN-AREKDRVSMVPAST-GRRLGSVDLRPTFDKTKYA ... %), Gaps = 5/103 (4%) Frame = +1 Query: 397 RESIDAKKRI EETLERTSP-STSKGN-AREKDRVSMVPASTGR-RLGSVDLRPTFDKTKY ...

  9. 生椎茸中のプレビタミンD_2およびビタミンD_2の同定

    OpenAIRE

    高村, 一知; 星野, 浩子; 叶多, 謙蔵; タカムラ, カズノリ; ホシノ, ヒロコ; カノウタ, ケンゾウ; Kazunori, Takamura; HIROKO, HOSHINO; KENZO, KANOHTA

    1993-01-01

    Pre-vitamin D_2(pre-D_2)and vitamin D_2(D_2)in raw shiitake mushroom were identified by liquid chromatography-mass spectrometry (LC-MS) with modified plasmaspray. 1. Pre-D_2 and D_2 in raw shiitake mushroom were separated by LC. 2. Pre-D_2 was confirmed parent ion(m/z 397 [M+H]^+)to scan number 259 of total ion chromatogram. 3. D_2 was cofirmed parent ion(m/z 397 [M+H]^+) to scan number 296 of total ion chromatogram. 4. We have succeeded in obtaining mass spectra of pre-D_2 and D_2 that does ...

  10. Dicty_cDB: Contig-U12027-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||||| Sbjct: 381 aaataatgtaaataa 395 Database: CSM Posted date: Jun 9, 2004 7:35 PM Number of letters in database...: 5,674,871 Number of sequences in database: 6905 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Mat... of sequences better than 10.0: 88 length of query: 397 length of database: 5,674,871 ef...fective HSP length: 16 effective length of query: 381 effective length of database...quences better than 10.0: 23 Length of query: 397 Length of database: 95,242,211,685

  11. AcEST: BP911573 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Cellular myelocytomatosis oncogene (Fragment) OS=Pseudobrama simoni Align length 39 Score (bit) 28.5 E-value... myelocytomatosis oncogene (Fragment) OS=Pseudobrama simoni GN=c-myc PE=4 SV=1 Length = 397 Score = 28.5 bit

  12. Hassan Zaoual (1950-2011). Novas Economias Enraizadas em Iniciativas Locais

    OpenAIRE

    Jane Simoni

    2011-01-01

    ZAOUAL, HASSAN. Nova Economia das Iniciativas Locais: uma introdução ao pensamento pós-global. Tradução de Michel Thiollent. Rio de Janeiro: DP&A: Consulado Gerald a França: COPPE/UFRJ, 2006. ISBN: 85-7490-397-3

  13. Hassan Zaoual (1950-2011. Novas Economias Enraizadas em Iniciativas Locais

    Directory of Open Access Journals (Sweden)

    Jane Simoni

    2011-12-01

    Full Text Available ZAOUAL, HASSAN. Nova Economia das Iniciativas Locais: uma introdução ao pensamento pós-global. Tradução de Michel Thiollent. Rio de Janeiro: DP&A: Consulado Gerald a França: COPPE/UFRJ, 2006. ISBN: 85-7490-397-3

  14. I z umění se stává zombie

    Czech Academy of Sciences Publication Activity Database

    Hauser, Michael

    Praha: PageFive, 2014 - (Bartková, A.; Pivoňková, B.; Švadlenková, Z.), s. 390-397 ISBN 978-80-260-5843-4 Institutional support: RVO:67985955 Keywords : postmodernism * art * school * art education Subject RIV: AA - Philosophy ; Religion

  15. Seasonal diet pattern of non-native tubenose goby (Proterorhinus semilunaris) in the lowland reservoir (Mušov, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Adámek, Z.; Jurajda, Pavel; Prášek, Václav; Sukop, I.

    2010-01-01

    Roč. 397, 02 (2010), s. 1-12. ISSN 1961-9502 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : Gobiidae * food * lowland reservoir * rip-rap bank * the Dyje River Subject RIV: EG - Zoology Impact factor: 0.304, year: 2010

  16. 49 CFR 383.121 - Requirements for hazardous materials endorsement.

    Science.gov (United States)

    2010-10-01

    ... vehicle, from information contained in 49 CFR parts 171, 172, 173, 177, 178, and 397 on the following: (a...; (4) Passenger Carrying Buses and Hazardous Materials; (5) Attendance of Motor Vehicles; (6) Parking... materials; (3) Emergency procedures; and (4) Existence of special requirements for transporting Class A...

  17. Empirická sociologie filmu v Československu do roku 1989

    Czech Academy of Sciences Publication Activity Database

    Čížek, Tomáš

    2010-01-01

    Roč. 23, č. 4 (2010), s. 91-105. ISSN 0862-397X R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : cultural consumption * cinema attendance * cultural capital Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Hypoxia affects performance traits and body composition of juvenile hybrid striped bass (Morone chrysops x M. saxatilis)

    Science.gov (United States)

    Performance traits and body composition of juvenile hybrid striped bass (Morone chrysops x M. saxatilis) in response to hypoxia were evaluated in replicate tanks maintained at constant dissolved oxygen concentrations that averaged 23.0 +/- 2.3%, 39.7 +/- 3.0%, and 105.5 +/- 9.5% dissolved oxygen sat...

  19. Parental background and other-regarding preferences in children

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Chytilová, J.; Pertold-Gebicka, B.

    2014-01-01

    Roč. 17, č. 1 (2014), s. 24-46. ISSN 1386-4157 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : other-regarding preferences * altruism * selfishness Subject RIV: AH - Economics Impact factor: 1.397, year: 2014

  20. Hydrobiont animals in floodplain soil: Are they positively or negatively affected by flooding?

    Czech Academy of Sciences Publication Activity Database

    Devetter, Miloslav; Schöll, K.

    2014-01-01

    Roč. 69, February (2014), s. 393-397. ISSN 0038-0717 Grant ostatní: Deutsche Bundesstiftung Umwelt(DE) AZ 24050 Institutional support: RVO:60077344 Keywords : Rotifers * Bdelloids * floodplain * limnoterrestrial communities * species response * variance partitioning Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  1. 41 CFR 50-204.75 - Transportation safety.

    Science.gov (United States)

    2010-07-01

    ... Transportation Safety § 50-204.75 Transportation safety. Any requirements of the U.S. Department of Transportation under 49 CFR Parts 171-179 and Parts 390-397 and 14 CFR Part 103 shall be applied to... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Transportation safety....

  2. Organisational Learning Approaches to School Leadership and Management: Teachers' Values and Perceptions of Practice

    Science.gov (United States)

    Pedder, David; MacBeath, John

    2008-01-01

    In this article, we report results of a survey of 1,397 teachers in 26 primary and 17 secondary schools in England as part of the Learning How to Learn project. We consider how school self-evaluation can be understood within an organisational learning frame. Factor analysis of teachers' responses helped us identify 4 dimensions of organisational…

  3. Control of flowering time and spike development in cereals: the earliness per se Eps-1 region in wheat, rice, and Brachypodium

    Czech Academy of Sciences Publication Activity Database

    Faricelli, M. E.; Valárik, Miroslav; Dubcovsky, J.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 293-306. ISSN 1438-793X Institutional research plan: CEZ:AV0Z50380511 Keywords : Comparative genomics * Earliness per se * Flowering Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.397, year: 2010

  4. Využití/ zneužití náboženských prvků v reklamě

    Czech Academy of Sciences Publication Activity Database

    Grygerková, M.; Lašťovičková, Michaela

    Hildesheim: Olms, 2011 - (Nagórko, A.), s. 397-422 ISBN 978-3-487-14625-6. ISSN 1860-4692. [Sprachliche Säkularisierung. Berlin (DE), 00.06.2010] Institutional research plan: CEZ:AV0Z90610518 Keywords : lexeme * semantics * advertising Subject RIV: AI - Linguistics

  5. Genome Sequence of Arenibacter algicola Strain TG409, a Hydrocarbon-Degrading Bacterium Associated with Marine Eukaryotic Phytoplankton.

    Science.gov (United States)

    Gutierrez, Tony; Whitman, William B; Huntemann, Marcel; Copeland, Alex; Chen, Amy; Kyrpides, Nikos; Markowitz, Victor; Pillay, Manoj; Ivanova, Natalia; Mikhailova, Natalia; Ovchinnikova, Galina; Andersen, Evan; Pati, Amrita; Stamatis, Dimitrios; Reddy, T B K; Ngan, Chew Yee; Chovatia, Mansi; Daum, Chris; Shapiro, Nicole; Cantor, Michael N; Woyke, Tanja

    2016-01-01

    Arenibacter algicola strain TG409 was isolated from Skeletonema costatum and exhibits the ability to utilize polycyclic aromatic hydrocarbons as sole sources of carbon and energy. Here, we present the genome sequence of this strain, which is 5,550,230 bp with 4,722 genes and an average G+C content of 39.7%. PMID:27491994

  6. 77 FR 67015 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2012-11-08

    ... Committee: National Cancer Institute Special Emphasis Panel NCI Omnibus and Cancer Therapy. Date: November... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  7. 78 FR 8157 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2013-02-05

    ... Committee: National Cancer Institute Special Emphasis Panel; Provocative Questions: Cancer Therapy and... Detection and Diagnosis Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  8. 76 FR 576 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2011-01-05

    ...-Therapy Breast Cancer Patients. Date: March 3, 2011. Time: 12 p.m. to 5 p.m. Agenda: To review and....395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  9. 78 FR 20118 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2013-04-03

    ... Committee: National Cancer Institute Special Emphasis Panel; Cancer Biology and Therapy. Date: April 17... Research; 93.395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  10. 78 FR 25459 - National Cancer Institute; Notice of Closed Meeting

    Science.gov (United States)

    2013-05-01

    ... Committee: National Cancer Institute Special Emphasis Panel; Cancer Therapy (Omnibus). Date: June 27-28....395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  11. 78 FR 58321 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2013-09-23

    ... Emphasis Panel, Provocative Questions: Cancer Therapy & Outcomes. Date: November 7-8, 2013. Time: 8:00 a.m..., Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  12. Multilevel Mediation: Cumulative Contextual Risk, Maternal Differential Treatment, and Children's Behavior within Families

    Science.gov (United States)

    Meunier, Jean Christophe; Boyle, Michael; O'Connor, Thomas G.; Jenkins, Jennifer M.

    2013-01-01

    This study tests the hypothesis that links between contextual risk and children's outcomes are partially explained by differential parenting. Using multi-informant measurement and including up to four children per family (M[subscript age] = 3.51, SD = 2.38) in a sample of 397 families, indirect effects (through maternal differential…

  13. The Survey of College Marketing Programs. Volume III: Electronic Advertising and Marketing.

    Science.gov (United States)

    Primary Research Group, Inc., New York, NY.

    This report presents 203 tables detailing findings concerning the use of electronic advertising within marketing programs at 68 colleges and universities. Highlights of this report include: colleges in the sample enroll a mean of 5,450 students; 5.6 percent of the colleges produce a CD-ROM version of the viewbook; 39.7 percent enable applicants to…

  14. Direct Monte Carlo Simulation Methods for Nonreacting and Reacting Systems at Fixed Total Internal Energy or Enthalpy

    Czech Academy of Sciences Publication Activity Database

    Smith, W.; Lísal, Martin

    2002-01-01

    Roč. 66, č. 1 (2002), s. 011104-1 - 011104-1. ISSN 1063-651X R&D Projects: GA ČR GA203/02/0805 Grant ostatní: NSERC(CA) OGP1041 Keywords : MC * simulation * reaction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.397, year: 2002

  15. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal

    2015-01-01

    Roč. 267, 15 September (2015), s. 397-408. ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sums * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.551, year: 2014 http://www.sciencedirect.com/science/article/pii/S0096300315002155

  16. 75 FR 59099 - Cable Television Act of 1992

    Science.gov (United States)

    2010-09-27

    ..., published at 60 FR 52106, October 5, 1995, are effective September 27, 2010. FOR FURTHER INFORMATION CONTACT... September 22, 1995, FCC 95-397, and published in the Federal Register on October 5, 1995, 60 FR 52106, the... COMMISSION 47 CFR Part 76 Cable Television Act of 1992 AGENCY: Federal Communications Commission....

  17. Morphology and SSU rDNA-based Phylogeny of a New Strain of Saccamoeba sp (Saccamoeba Frenzel, 1892, Amoebozoa)

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Kostka, Martin; Pecková, Hana

    2008-01-01

    Roč. 47, č. 4 (2008), s. 397-405. ISSN 0065-1583 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Amoebozoa * Saccamoeba sp. * Phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.013, year: 2008

  18. 77 FR 5280 - Service Contracts Inventory

    Science.gov (United States)

    2012-02-02

    ... Contracts for Services for Fiscal Year (FY) 2011. The inventory includes service contract actions over $25... the NRC's PDR reference staff at 1 (800) 397-4209, (301) 415-4737, or by email to pdr.resource@nrc.gov...) 492-3627, or email: lori.konovitz@nrc.gov . SUPPLEMENTARY INFORMATION: In accordance with Section...

  19. Parasitosis

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    2010293 Preoperative multi-slice spiral CT evaluation of involvement of vessels and biliary ducts in hepatic cystic echinococcosis. WANG Jian(王健),et al. Imaging Center,1st Affil Hosp,Xinjiang Med Univ,Urumuqi 830054. Chin J Radiol 2010;44(4):397-400. Objective To analyze the MSCT imaging of vascular and biliary ducts affected by hepatic cystic

  20. Recovery of tubulin functions after freeze-dying in the presence of trehalose

    Czech Academy of Sciences Publication Activity Database

    Dráberová, Eduarda; Sulimenko, Vadym; Sulimenko, Tetyana; Böhm, K. J.; Dráber, Pavel

    2010-01-01

    Roč. 397, č. 1 (2010), s. 67-72. ISSN 0003-2697 R&D Projects: GA AV ČR KAN200520701; GA MŠk LC545 Institutional research plan: CEZ:AV0Z50520514 Keywords : Tubulin * Freeze - drying * Stability Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.236, year: 2010

  1. Psychiatric Morbidity, Violent Crime, and Suicide among Children and Adolescents Exposed to Parental Death

    Science.gov (United States)

    Wilcox, Holly C.; Kuramoto, Satoko J.; Lichtenstein, Paul; Langstrom, Niklas; Brent, David A.; Runeson, Bo

    2010-01-01

    Objective: This retrospective cohort study examined the risk for suicide, psychiatric hospitalization, and violent criminal convictions among offspring of parents who died from suicide, accidents, and other causes. Method: Population-based data from multiple Swedish national registers were linked from 1969 to 2004. Participants were 44,397

  2. Four-switch three-phase space-vector PWM AC-DC converter

    Czech Academy of Sciences Publication Activity Database

    Klíma, J.; Škramlík, Jiří; Valouch, Viktor

    2008-01-01

    Roč. 95, č. 4 (2008), s. 383-397. ISSN 0020-7217 Institutional research plan: CEZ:AV0Z20570509 Keywords : AC-DC converter * space-vector pulsewidth modulation * rectifier Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.567, year: 2008

  3. Metal nano-film resistivity chemical sensor

    Czech Academy of Sciences Publication Activity Database

    Podešva, Pavel; Foret, František

    2016-01-01

    Roč. 37, č. 3 (2016), s. 392-397. ISSN 0173-0835 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : adsorption * chemiresistor * nano-film * thiol binding * thiol sensing Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.028, year: 2014

  4. Coping Styles with Student Misbehavior as Mediators of Teachers' Classroom Management Strategies

    Science.gov (United States)

    Tran, Van Dat

    2016-01-01

    The purpose of the present study is to identify how teachers' use of various coping styles with student misbehavior, and the extent to which these relate to their classroom management techniques -- punishment, recognition and reward, hinting, discussion, and aggression. It examines data from 397 junior high school teachers in Vietnam. The results…

  5. 76 FR 50487 - National Cancer Institute Notice of Closed Meetings

    Science.gov (United States)

    2011-08-15

    ... Committee: National Cancer Institute Special Emphasis Panel; NCI SPORE in Childhood ALL, Skin, Brain, Lung....395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93... HUMAN SERVICES National Institutes of Health National Cancer Institute Notice of Closed...

  6. Aquatic Environment 2000

    DEFF Research Database (Denmark)

    Svendsen, L. M.; Bijl, L. van der; Boutrup, S.; Iversen, T. M.; Ellermann, T.; Hovmand, M. F.; Bøgestrand, J.; Grant, R.; Hansen, J.; Jensen, J. P.; Stockmarr, J.; Laursen, K. D.

    The report summarizes the results of the Danish Aquatic Monitoring and Assessment Programme 1998-2003. Danish Environmental Protection Agency 2000: NOVA-2003. Programbeskrivelse for det nationale program for overvågning af vandmiljøet 1998-2003. 397 pp. - Redegørelse fra Miljøstyrelsen nr. 1 (in...

  7. Intrapersonal and interpersonal sexual behaviors of Chinese university students: gender differences in prevalence and correlates

    NARCIS (Netherlands)

    X. Chi; D. van de Bongardt; S.T. Hawk

    2015-01-01

    The main aim of the present study was to investigate gender differences among university students in contemporary China regarding (1) the prevalence of various types of intrapersonal and interpersonal sexual behaviors and (2) their sociodemographic and psychosocial predictors. A total of 1,397 unive

  8. Implantation of the biodegradable polymer biolimus-eluting stent in patients with high SYNTAX score is associated with decreased cardiac mortality compared to a permanent polymer sirolimus-eluting stent: Two year follow-up results from the "all-comers" LEADERS trial

    NARCIS (Netherlands)

    J.J. Wykrzykowska (Joanna); S.A. Garg (Scot); Y. Onuma (Yosinobu); T. de Vries (Ton); M-A.M. Morel (Marie-Angèle); G.A. van Es (Gerrit Anne); P. Buszman (Pawel); A. Linke (Axel); T. Ischinger (Thomas); V. Klauss (Volker); R. Corti (Roberto); F.R. Eberli (Franz Robert); W. Wijns (William); M-C. Morice (Marie-Claude); C. di Mario (Carlo); R.J.M. van Geuns (Robert Jan); P. Jùni (Peter); S. Windecker (Stephan); P.W.J.C. Serruys (Patrick)

    2011-01-01

    textabstractBackground: The SYNTAX score (SXscore) has been shown to be an effective predictor of clinical outcomes in patients undergoing percutaneous coronary intervention (PCI). Methods and results: The SXscore was prospectively collected in 1,397 of the 1,707 patients enrolled in the "all-comers

  9. Nachwort

    Czech Academy of Sciences Publication Activity Database

    Dobiáš, Dalibor

    Klagenfurt: Wieser Verlag, 2014 - (Dobiáš, D.), s. 381-397. (Prosa). ISBN 978-3-99029-140-5 Institutional support: RVO:68378068 Keywords : Czech literature * exil prose * Jiří Gruša Subject RIV: AJ - Letters, Mass-media, Audiovision

  10. QTL Information Table: 25 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Ctb1 Resistance or Tolerance Cold tolerance Spikelet fertility SSR A)Physical BCFn ...sical mapping and putative candidate gene identification of a quantitative trait lo...Kirara397 Norin-PL8 AL662970 OSR15 SCAB11 pha Saito, K., Hayano-Saito, Y., Maruyama-Funatsuki, W., Sato, Y., and Kato, A. (2004). Phy

  11. Two New Species of Trypanosomatid Parasites Isolated from Heteroptera

    Czech Academy of Sciences Publication Activity Database

    Maslov, D. A.; Yurchenko, V. Y.; Jirků, Milan; Lukeš, Julius

    2010-01-01

    Roč. 57, č. 2 (2010), s. 177-188. ISSN 1066-5234 Institutional research plan: CEZ:AV0Z60220518 Keywords : Blastocrithidia * kinetoplastid * Largidae * Leptomonas * Miridae * phylogeny * taxonomy * Trypanosomatidae Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2010

  12. The Student Perception of University Support and Structure Scale: Development and Validation

    Science.gov (United States)

    Wintre, Maxine G.; Gates, Shawn K. E.; Pancer, W. Mark; Pratt, Michael S.; Polivy, Janet; Birnie-Lefcovitch, S.; Adams, Gerald

    2009-01-01

    A new scale, the Student Perception of University Support and Structure Scale (SPUSS), was developed for research on the transition to university. The scale was based on concepts derived from Baumrind's (1971) theory of parenting styles. Data were obtained from two separate cohorts of freshmen (n=759 and 397) attending six Canadian universities of…

  13. Isolation and characterization of a novel native Bacillus thuringiensis strain BRC-HZM2 capable of degrading chlorpyrifos

    Czech Academy of Sciences Publication Activity Database

    Wu, S.; Peng, Y.; Huang, Z.; Huang, Z.; Xu, L.; Gelbič, Ivan; Guan, X.; Zhang, L.; Zou, S.

    2015-01-01

    Roč. 55, č. 3 (2015), s. 389-397. ISSN 0233-111X Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * biopesticide * biodegradation Subject RIV: EE - Microbiology, Virology Impact factor: 1.823, year: 2014 http://onlinelibrary.wiley.com/doi/10.1002/jobm.201300501/epdf

  14. Historiografie druhé poloviny 19. století jako pramen pro poznání kolektivní totožnosti moravských Němců

    Czech Academy of Sciences Publication Activity Database

    Řepa, Milan

    Předklášteří : Muzeum Brněnska, 2009 - (Vítová, A.), s. 132-137 ISBN 978-80-904-397-0-2 R&D Projects: GA ČR GA409/08/1374 Institutional research plan: CEZ:AV0Z80150510 Keywords : historiography * Moravian Germans * 19th century Subject RIV: AB - History

  15. Insight into the genetics of hypertension, a core component of the metabolic syndrome

    Czech Academy of Sciences Publication Activity Database

    Pravenec, Michal; Petretto, E.

    2008-01-01

    Roč. 11, - (2008), s. 393-397. ISSN 1363-1950 Grant ostatní: HHMI(US) 55005624; EURATOOLS(XE) LSHG-CT-2005-019015 Institutional research plan: CEZ:AV0Z50110509 Keywords : genetics * hypertension * genome-wide association studies Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.690, year: 2008

  16. Alcohol and Drug Use in Young Apprentices: Effect of Social Control in the Family.

    Science.gov (United States)

    Burcu, Esra

    2003-01-01

    Examined the social control used by families of young apprentices in Turkey in relation to deviant behaviors, such as alcohol and drug use. Data for 397 apprentices show that those who use alcohol are most frequently exposed to stringent controls and oral and physical violence, and those who use drugs frequently were exposed to battering by their…

  17. 75 FR 20370 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-04-19

    ....395, Cancer Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93...@mail.nih.gov . Name of Committee: National Cancer Institute Special Emphasis Panel, Breast Cancer... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  18. 75 FR 3239 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2010-01-20

    ... Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research... Special Emphasis Panel, Basal-like Breast Cancer Assay. Date: March 10, 2010. Time: 8 a.m. to 7 p.m... HUMAN SERVICES National Institutes of Health National Cancer Institute; Notice of Closed...

  19. Interface affected polymer dynamics: NMR, SANS, and DLS study of the influence of shell-core interactions on the core chain mobility of poly(2-ethylhexyl acrylate)-block-poly(acrylic acid) micelles in water

    Czech Academy of Sciences Publication Activity Database

    Kříž, Jaroslav; Pleštil, Josef; Tuzar, Zdeněk; Pospíšil, Herman; Brus, Jiří; Jakeš, Jaromír; Masař, Bohumil; Vlček, Petr; Doskočilová, Danica

    1999-01-01

    Roč. 32, - (1999), s. 397-410. ISSN 0024-9297 R&D Projects: GA ČR GA203/95/1319; GA ČR GA203/96/1388; GA AV ČR KSK2050602 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.534, year: 1999

  20. Drug: D08461 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08461 Drug Quinine dihydrochloride; Quinine (TN) C20H24N2O2. 2HCl 396.1371 397.3386 D08461.gif Antiprotozoa... USP drug classification [BR:br08302] Antiparasitics Antiprotozoals Quinine D08461 Quinine dihydrochloride A

  1. Friend Influence on Achievement during Middle Childhood

    Science.gov (United States)

    DeLay, Dawn

    2013-01-01

    This study was designed to investigate friend influence on academic achievement and task avoidance during middle childhood in a sample of 794 participants in 397 stable same-sex friendship dyads (205 girl dyads and 192 boy dyads) from four municipalities in Finland: two in Central Finland, one in Western Finland, and one in Eastern Finland.…

  2. Transferases and transporters mediate the detoxification and capacity to tolerate trinitrotoluene in Arabidopsis

    Czech Academy of Sciences Publication Activity Database

    Landa, Přemysl; Štorchová, Helena; Hodek, J.; Vaňková, Radomíra; Podlipná, Radka; Maršík, Petr; Ovesná, J.; Vaněk, Tomáš

    2010-01-01

    Roč. 10, č. 4 (2010), s. 547-559. ISSN 1438-793X R&D Projects: GA MŠk 2B06187; GA MŠk 2B08058 Institutional research plan: CEZ:AV0Z50380511 Keywords : Microarrays * Arabidopsis thaliana * TNT Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.397, year: 2010

  3. "Padajushtshaja bashnja" v Pize bolshe ne samaja padajushtshaja

    Index Scriptorium Estoniae

    2008-01-01

    2008. aastal kantakse Guinnessi rekordite raamatusse kõige rohkem kaldu oleva tornina Pisa torni asemele (kalle 3,97 kraadi) Põhja-Saksamaal Suurhuseni külas asuv kirikutorn kaldega 5,19 kraadi. Pisa tornist viltusem on ka Bad Frankenhauseni kirku torn kaldega 4,3 kraadi

  4. AcEST: DK961832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0011_D21 564 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_D21. 5' end seq ... VSDAVAKSGTTPLSPAIAFIL 122 Query: 397 EKTSSFL-VEEPLPEPA RE------TRVIIIE*G*PSQVKETKEPDVAPDSTTAEPTLP 552 EK + ... 123 EKVAPFVPKEEPKPEPEAEAAAETTSREVAVE----EEKKEEEAAPAEPA AAAAEAAAP 177 >sp|A2WMG6|SRS1_ORYSI Salt stress roo ...

  5. On White’s Expansion of Lukasiewicz Logic

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    2010-01-01

    Roč. 20, č. 2 (2010), s. 389-397. ISSN 0955-792X R&D Projects: GA ČR GEICC/08/E018 Institutional research plan: CEZ:AV0Z10300504 Keywords : Lukasiewicz fuzzy logic * Cantor-Lukasiewicz set theory * full comprehension Subject RIV: BA - General Mathematics Impact factor: 0.586, year: 2010

  6. Draft Genome Sequence of "Halomonas chromatireducens" Strain AGD 8-3, a Haloalkaliphilic Chromate- and Selenite-Reducing Gammaproteobacterium.

    Science.gov (United States)

    Sharko, Fedor S; Shapovalova, Anna A; Tsygankova, Svetlana V; Komova, Anastasia V; Boulygina, Eugenia S; Teslyuk, Anton B; Gotovtsev, Pavel M; Namsaraev, Zorigto B; Khijniak, Tatiana V; Nedoluzhko, Artem V; Vasilov, Raif G

    2016-01-01

    Here, we report the complete genome sequence (3.97 Mb) of "Halomonas chromatireducens" AGD 8-3, a denitrifying bacterium capable of chromate and selenite reduction under extreme haloalkaline conditions. This strain was isolated from soda solonchak soils of the Kulunda steppe, Russian Federation. PMID:26988058

  7. Draft Genome Sequence of “Halomonas chromatireducens” Strain AGD 8-3, a Haloalkaliphilic Chromate- and Selenite-Reducing Gammaproteobacterium

    OpenAIRE

    Sharko, Fedor S.; Shapovalova, Anna A.; Svetlana V. Tsygankova; Komova, Anastasia V.; Boulygina, Eugenia S; Teslyuk, Anton B.; Gotovtsev, Pavel M.; Namsaraev, Zorigto B.; Khijniak, Tatiana V.; Nedoluzhko, Artem V; Vasilov, Raif G.

    2016-01-01

    Here, we report the complete genome sequence (3.97 Mb) of “Halomonas chromatireducens” AGD 8-3, a denitrifying bacterium capable of chromate and selenite reduction under extreme haloalkaline conditions. This strain was isolated from soda solonchak soils of the Kulunda steppe, Russian Federation.

  8. JAVA CLASSES FOR NONPROCEDURAL VARIOGRAM MONITORING. JOURNAL OF COMPUTERS AND GEOSCIENCE

    Science.gov (United States)

    NRMRL-ADA-00229 Faulkner*, B.P. Java Classes for Nonprocedural Variogram Monitoring. Journal of Computers and Geosciences ( Elsevier Science, Ltd.) 28:387-397 (2002). EPA/600/J-02/235. A set of Java classes was written for variogram modeling to support research for US EPA's Reg...

  9. Pamětní místa na komunismus v České republice. Dokumentace a interpretace

    Czech Academy of Sciences Publication Activity Database

    Tůma, Oldřich

    2015-01-01

    Roč. 22, 3/4 (2015), s. 366-397. ISSN 1210-7050 R&D Projects: GA MK(CZ) DF11P01OVV034 Institutional support: RVO:68378114 Keywords : Federal Assembly * velvet revolution 1989 * Czechoslovakia Subject RIV: AB - History

  10. Estrogen receptor alpha polymorphism and risk of cardiovascular disease, cancer, and hip fracture

    DEFF Research Database (Denmark)

    Kjaergaard, Alisa D; Ellervik, Christina; Tybjaerg-Hansen, Anne;

    2007-01-01

    Background- We hypothesized that the estrogen receptor (ESR1) IVS1-397T/C polymorphism affects high-density lipoprotein cholesterol response to hormone replacement therapy and risk of cardiovascular disease (CVD), cancer of reproductive organs, and hip fracture. Methods and Results- We studied cr...

  11. Actinorhodopsin genes discovered in diverse freshwater habitats and among cultivated freshwater .i.Actinobacteria./i

    Czech Academy of Sciences Publication Activity Database

    Sharma, A. K.; Sommerfeld, K.; Bullerjahn, G. S.; Matteson, A. R.; Wilhelm, S. W.; Jezbera, Jan; Brandt, U.; Doolittle, W.F.; Hahn, M.W.

    2009-01-01

    Roč. 3, č. 6 (2009), s. 726-737. ISSN 1751-7362 Institutional research plan: CEZ:AV0Z60170517 Keywords : rhodopsins * actinorhodopsin * freshwater * Actinobacteria * Superior * Erie Subject RIV: EE - Microbiology, Virology Impact factor: 6.397, year: 2009

  12. Architekt František Kalivoda a hraběnka Hélène de Mandrot. "Několik poznámek nejen k ose Brno – La Sarraz"

    Czech Academy of Sciences Publication Activity Database

    Chatrný, Jindřich

    2012-01-01

    Roč. 25, č. 0 (2012), s. 397-470. ISSN 0524-689X R&D Projects: GA AV ČR KJB800330601 Institutional research plan: CEZ:AV0Z80330511 Keywords : Hélène de Mandrot * František Kalivoda * correspondence * congresses CIAM * architecture * film * art Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. Nevada Bouguer Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Bouguer anomaly grid for the state of Nevada. Number of columns is 282 and number of rows is 397. The order of the data is from the lower left to the...

  14. AcEST: BP912004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H08 340 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H08. BP912004 CL875Co ... rase family OS=Yersinia pestis bv. Antiqua (strain Angola ) GN=YpAngola _A4153 PE=4 SV=1 Length = 397 Score = ...

  15. X-ray diffuse scattering in SrTiO.sub.3./sub. and model of atomic displacements

    Czech Academy of Sciences Publication Activity Database

    Kopecký, Miloš; Fábry, Jan; Kub, Jiří

    2012-01-01

    Roč. 45, č. 3 (2012), s. 393-397. ISSN 0021-8898 R&D Projects: GA AV ČR IAA100100915 Institutional research plan: CEZ:AV0Z10100520 Keywords : diffuse scattering * SrTiO 3 * perovskites * synchrotron radiation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.343, year: 2012

  16. Finnish Doctoral Theses on Pedagogical Themes in a Production-Time Perspective.

    Science.gov (United States)

    Heinonen, Veikko; Kari, Jouko

    1990-01-01

    A questionnaire completed by 119 researchers defending doctoral theses in Finland before 1986 shows that the average age for women defending a thesis was 39.7, an average of 2.4 years older than for men. An average of 3.5 years was required for doctoral studies, with about 13.6 months spent in final thesis revision. (SLD)

  17. Výzkum kriminality

    Czech Academy of Sciences Publication Activity Database

    Podaná, Zuzana

    Praha: SLON, 2012 - (Krejčí, J.; Leontiyeva, Y.), s. 377-397 ISBN 978-80-7419-111-4; ISBN 978-80-7330-204-7 R&D Projects: GA MŠk LA09010 Institutional support: RVO:68378025 Keywords : criminology * survey research * research on victims and offenders Subject RIV: AO - Sociology, Demography

  18. Household Structure and Short-Run Economic Change in Nicaragua

    Science.gov (United States)

    Winters, Paul; Stecklov, Guy; Todd, Jessica

    2009-01-01

    During the economic crises Nicaragua suffered between 2000 and 2002, a conditional cash transfer program targeting poor households began operating. Using panel data on 1,397 households from the program's experimentally designed evaluation, we examined the impact of the program on household structure. Our findings suggest that the program enabled…

  19. AcEST: DK955992 [AcEST

    Lifescience Database Archive (English)

    Full Text Available DIG1_YEAST Down-regulator of invasive growth 1 OS=Sacc... 31 5.2 sp|Q8IZC4|RTKN2_HUMAN Rhotekin-2 OS=Homo sa... +C++++ P ++ R I Sbjct: 376 SSTDSCKDLQTCTDPSIISREI 397 >sp|Q03063|DIG1_YEAST Down-regulator of invasive grow

  20. AcEST: DK950228 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bid... 31 4.8 sp|Q03063|DIG1_YEAST Down-regulator of invasive growth 1 OS=Sacc... 31 6.2 >sp|O76011|KRT34_HU...CTDPSIISREI 397 >sp|Q03063|DIG1_YEAST Down-regulator of invasive growth 1 OS=Saccharomyces cerevisiae GN=DIG

  1. The Career Indecision of Managers and Professionals: An Examination of Multiple Subtypes [and] Comments [and] Rejoinder.

    Science.gov (United States)

    Callanan, Gerard A.; And Others

    1992-01-01

    Cluster analysis of data from 397 banking managers and professionals revealed 4 subtypes: chronic and developmental career-undecided employees and vigilant and hypervigilant career-decided employees. (Reactions from Tiedeman, Krumboltz, and Hall and rejoinder from Greenhaus and Callanan are provided.) (SK)

  2. Evaluation of the novel passive sampler for cyanobacterial toxins microcystins under various conditions including field sampling

    Czech Academy of Sciences Publication Activity Database

    Kohoutek, J.; Maršálek, Blahoslav; Bláha, Luděk

    2010-01-01

    Roč. 397, č. 2 (2010), s. 823-828. ISSN 1618-2642 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : passive sampler * microcystin * POCIS Subject RIV: EF - Botanics Impact factor: 3.841, year: 2010

  3. The effect of the first dynode`s geometry on the detection efficiency of a 119EM electron multiplier used as a highly charged ion detector

    Czech Academy of Sciences Publication Activity Database

    Krása, Josef; Pfeifer, Miroslav; Stöckli, M. P.; Lehnert, U.; Fry, D.

    1999-01-01

    Roč. 152, - (1999), s. 397-402. ISSN 0168-583X R&D Projects: GA AV ČR IAA1010819; GA ČR GA202/97/0918 Institutional research plan: CEZ:AV0Z1010921 Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.118, year: 1999

  4. Drug: D03135 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03135 Drug Bithionolate sodium (USAN); Sodium bitionolate (INN) C12H4Cl4O2S. 2Na 397.8481 400.0 ... sification [BR:br08303] D DERMATOLOGICALS D10 ANTI-ACNE ... PREPARATIONS D10A ANTI-ACNE ... PREPARATIONS FOR TOPIC ...

  5. Economic costs of abdominal obesity

    DEFF Research Database (Denmark)

    Højgaard, Betina; Olsen, Kim Rose; Søgaard, Jes;

    2008-01-01

    added future cost of approximately USD 397.- per annum compared to a woman in the normal waist circumference group, corresponding to 22% higher health care costs. CONCLUSIONS: Future health care costs are higher for persons who have an increased waist circumference, which suggests that there may be a...

  6. Notes on disentangling of spectra II. Intrinsic line-profile variability due to Cepheid pulsations

    Czech Academy of Sciences Publication Activity Database

    Hadrava, Petr; Šlechta, Miroslav; Škoda, Petr

    2009-01-01

    Roč. 507, č. 1 (2009), s. 397-404. ISSN 0004-6361 R&D Projects: GA MŠk LC06014; GA ČR GA202/09/0772 Institutional research plan: CEZ:AV0Z10030501 Keywords : variable stars * spectroscopic * Cepheids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.179, year: 2009

  7. Plio-Pleistocene basanitic and melilititic series of the Bohemian Massif: K-Ar ages, major/trace element and Sr–Nd isotopic data

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Ackerman, Lukáš; Balogh, K.; Hegner, E.; Jelínek, E.; Pécskay, Z.; Přichystal, A.; Upton, B. G. J.; Zimák, J.; Foltýnová, R.

    2013-01-01

    Roč. 73, č. 4 (2013), s. 429-450. ISSN 0009-2819 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Plio-Pleistocene * Basanite * Melilitite * K-Ar age * Magmatism * Sr–Nd isotopes Subject RIV: DD - Geochemistry Impact factor: 1.397, year: 2013

  8. Molecular epidemiology studies of carcinogenic environmental pollutants. Effects of polycyclic aromatic hydrocarbons (PAHs) in environmental pollution on exogenous and oxidative DNA damage

    Czech Academy of Sciences Publication Activity Database

    Farmer, P. B.; Singh, R.; Kaur, B.; Šrám, Radim; Binková, Blanka; Kalina, I.; Popov, T. A.; Garte, S.; Taioli, E.; Gabelova, A.; Cebulska-Wasilewska, A.

    2003-01-01

    Roč. 544, 2-3 (2003), s. 397-402. ISSN 1383-5742 Institutional research plan: CEZ:AV0Z5039906 Keywords : molecular epidemiology Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 5.783, year: 2003

  9. Transcriptional regulation of the operon encoding stress-responsive ECF sigma factor SigH and its anti-sigma factor RshA, and control of its regulatory network in Corynebacterium glutamicum

    Czech Academy of Sciences Publication Activity Database

    Busche, T.; Šilar, Radoslav; Pičmanová, Martina; Pátek, Miroslav; Kalinowski, J.

    2012-01-01

    Roč. 13, č. 445 (2012), s. 445-464. ISSN 1471-2164 R&D Projects: GA ČR GC204/09/J015 Institutional research plan: CEZ:AV0Z50200510 Keywords : Corynebacterium glutamicum * ECF sigma factor * Anti-sigma factor Subject RIV: EE - Microbiology, Virology Impact factor: 4.397, year: 2012

  10. Motor Skill Abilities in Toddlers with Autistic Disorder, Pervasive Developmental Disorder-Not Otherwise Specified, and Atypical Development

    Science.gov (United States)

    Matson, Johnny L.; Mahan, Sara; Fodstad, Jill C.; Hess, Julie A.; Neal, Daniene

    2010-01-01

    Motor skills were assessed in 397 toddlers, and it was demonstrated that atypically developing toddlers exhibited significantly greater motor skill abilities than toddlers with autistic disorder. No significant difference on gross or fine motor skill abilities were found between atypically developing toddlers and toddlers with pervasive…

  11. Assessment of the relationship between geologic origin of soil, rhizobacterial community composition and soil receptivity to tobacco black root rot in Savoie region (France)

    Czech Academy of Sciences Publication Activity Database

    Almario, J.; Kyselková, Martina; Kopecký, J.; Ságová-Marečková, M.; Muller, D.; Grundmann, G.L.; Moënne-Loccoz, Y.

    2013-01-01

    Roč. 371, 1/2 (2013), s. 397-408. ISSN 0032-079X Grant ostatní: MŚMT(CZ) ME09077 Institutional support: RVO:60077344 Keywords : suppressive soils * Thielaviopsis basicola * black root rot Subject RIV: EE - Microbiology, Virology Impact factor: 3.235, year: 2013

  12. Characterization of eight Bacillus thuringiensis isolates originated from fecal samples of Fuzhou Zoo and Fuzhou Panda Center

    Czech Academy of Sciences Publication Activity Database

    Wu, Ch.; Wu, L.; Zhang, L.; Gelbič, Ivan; Xu, L.; Guan, X.

    2014-01-01

    Roč. 17, č. 3 (2014), s. 395-397. ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * faeces * microscophy Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.946, year: 2014 http://www.sciencedirect.com/science/article/pii/S122686151400034X

  13. Data Mining in Atherosclerosis Risk Factor Data. Chapter XVIII

    Czech Academy of Sciences Publication Activity Database

    Berka, Petr; Rauch, Jan; Tomečková, Marie

    Hershey: Information Science Reference, 2009 - (Berka, P.; Rauch, J.; Zighed, D.), s. 376-397 ISBN 978-1-60566-218-3 R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : atherosclerosis * association rules * decision rules Subject RIV: IN - Informatics, Computer Science

  14. Histopathological aspects of liver under variable food restriction: Has the intense one-week food restriction a protective effect on non-alcoholic-fatty-liver-disease (NAFLD) development?

    Czech Academy of Sciences Publication Activity Database

    Makovický, P.; Tůmová, E.; Volek, Z.; Makovický, P.; Vodičková, Ludmila; Slyšková, Jana; Svoboda, Miroslav; Rejhová, Alexandra; Vodička, Pavel; Samasca, G.; Králová, A.; Nagy, M.; Mydlarova-Blascakova, M.; Poracova, J.

    2014-01-01

    Roč. 210, č. 12 (2014), s. 855-862. ISSN 0344-0338 R&D Projects: GA MZd(CZ) NT14329 Grant ostatní: GA MZE(CZ) 0002701404 Institutional support: RVO:68378041 Keywords : fasting * liver * starvation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.397, year: 2014

  15. Single crystal study of the layered heavy fermion compounds Ce.sub.2./sub.PdIn.sub.8./sub., Ce.sub.3./sub.PdIn.sub.11./sub., Ce.sub.2./sub.PtIn.sub.8./sub. and Ce.sub.3./sub.PtIn.sub.11./sub

    Czech Academy of Sciences Publication Activity Database

    Kratochvílová, M.; Dušek, Michal; Uhlířová, K.; Rudajevová, A.; Prokleška, J.; Vondráčková, B.; Custers, J.; Sechovský, V.

    2014-01-01

    Roč. 397, Jul (2014), s. 47-52. ISSN 0022-0248 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional support: RVO:68378271 Keywords : crystal structure * X-ray diffraction * single crystal growth * rare earth compounds * magnetic materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

  16. 76 FR 58165 - Petitions for Rulemaking Submitted by the Natural Resources Defense Council, Inc.

    Science.gov (United States)

    2011-09-20

    ..., PRM-50-102; NRC-2011-0189] Petitions for Rulemaking Submitted by the Natural Resources Defense Council... rulemaking (PRM), dated July 26, 2011, from the Natural Resources Defense Council, Inc. (NRDC or the... staff at 1-800-397-4209, 301-415-4737, or by e-mail to pdr.resource@nrc.gov . For the ADAMS...

  17. The .nu.(10)= 1 Level of Propyne, H3C-C=CH, and Its Interactions with .nu.(9)=1 and .nu.(10)=2

    Czech Academy of Sciences Publication Activity Database

    Müller, H. S. P.; Pracna, Petr; Hornemam, V. M.

    2002-01-01

    Roč. 216, - (2002), s. 397-407. ISSN 0022-2852 R&D Projects: GA ČR GA203/01/1274; GA MŠk ME 445 Institutional research plan: CEZ:AV0Z4040901 Keywords : methylacetylene * high resolution * FTIR spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.251, year: 2002

  18. Soil formation and mineralogy of a Rhodic Luvisol - insights from magnetic and geochemical studies

    Czech Academy of Sciences Publication Activity Database

    Jordanova, N.; Jordanova, D.; Liu, Q.-Z.; Hu, P.; Petrov, P.; Petrovský, Eduard

    2013-01-01

    Roč. 110, Part C - November (2013), s. 397-413. ISSN 0921-8181 Institutional support: RVO:67985530 Keywords : red soil * magnetism * hematite * pedogenesis * REE * Sahara dust Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.707, year: 2013

  19. AcEST: DK954859 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0021_J03 665 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_J03. 5' end seq ... YFLALIYLYLVHERYVMRLKRKLQFEERKQA 60 Query: 218 SQARPLSD FESADWINQALLKIWPQFLEEFISKEVLKPILPWFIDKHKPWTVKKATLQQ ... L 397 +Q R LSD ... ES W+N A+ KIWP +E+ S+++L PI+PWF++K++PWT KKA +Q L S ...

  20. 33 CFR 117.403 - Wabash River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.403 Section 117.403 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Indiana § 117.403 Wabash River. See § 117.397, Wabash...

  1. Phylogenetic composition and properties of bacteria coexisting with the fungus Hypholoma fasciculare in decaying wood

    Czech Academy of Sciences Publication Activity Database

    Valášková, Vendula; de Boer, W.; Klein Gunnewiek, P.; Pospíšek, M.; Baldrian, Petr

    2009-01-01

    Roč. 3, č. 10 (2009), s. 1218-1221. ISSN 1751-7362 R&D Projects: GA MŠk LC06066 Institutional research plan: CEZ:AV0Z50200510 Keywords : wood-inhabiting bacteria * phylogeny * white-rot Subject RIV: EE - Microbiology, Virology Impact factor: 6.397, year: 2009

  2. "Kdo neokrádá stát, okrádá rodinu". Rodina v komunistickém Československu

    Czech Academy of Sciences Publication Activity Database

    Schindler-Wisten, Petra

    Praha : Academia, 2009 - (Vaněk, M.), s. 357-397 ISBN 978-80-200-1791-8 R&D Projects: GA ČR GA409/06/0878 Institutional research plan: CEZ:AV0Z80630520 Keywords : family * Czechoslovakia * memories Subject RIV: AB - History

  3. On the Theme of Homeland in the Works of Comenius and in the Official Baroque Literature of the Czech Lands

    Czech Academy of Sciences Publication Activity Database

    Soleiman pour Hashemi, Michaela

    Wiesbaden: Springer VS, 2016 - (Goris, W.; Meyer, M.; Urbánek, V.), s. 397-405 ISBN 978-3-658-08260-4 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Homeland * Comenius, s. c. Official literature Subject RIV: AA - Philosophy ; Religion

  4. Worry as a Predictor of Nutrition Behaviors: Results from a Nationally Representative Survey

    Science.gov (United States)

    Ferrer, Rebecca A.; Bergman, Hannah E.; Klein, William M. P.

    2013-01-01

    Worry has been shown to predict a variety of health behaviors, such as cancer screening, yet there are few studies linking worry and nutrition. This study used nationally representative data from National Cancer Institute's Food Attitudes and Behavior Survey ("n" = 3,397) to examine the association between health-related worry and a variety of…

  5. Do Children Who Bully Their Peers Also Play Violent Video Games? A Canadian National Study

    Science.gov (United States)

    Dittrick, Crystal J.; Beran, Tanya N.; Mishna, Faye; Hetherington, Ross; Shariff, Shaheen

    2013-01-01

    The study examined whether children who bully others are likely to prefer playing video games that are rated high in maturity and violence. A stratified random sample of Canadian children ages 10 to 17 years from the provinces of Canada was obtained. Parents (n = 397) and their children (n = 492) completed an online survey of children's…

  6. Isolated peat bog habitats and their food connections: parasitoids (Hymenoptera: Ichneumonoidea) and their lepidopteran hosts

    Czech Academy of Sciences Publication Activity Database

    Lozan, Aurel; Spitzer, Karel; Jaroš, Josef

    2012-01-01

    Roč. 16, č. 3 (2012), s. 391-397. ISSN 1366-638X Institutional research plan: CEZ:AV0Z50070508 Keywords : Paleorefugia * relict peat bogs * specific Lepidoptera Subject RIV: EH - Ecology, Behaviour Impact factor: 1.801, year: 2012 http://www.springerlink.com/content/78u173hn60701033/

  7. Simulace struktury a mechanické vlastnosti TOZ svaru duplexní feriticko-austenitické oceli

    Czech Academy of Sciences Publication Activity Database

    Kouřil, M.; Bezděk, P.; Dlouhý, Ivo

    Praha : ECOSOND, 1996, s. 391-397. [Dny tepelného zpracování s mezinárodní účastí (16.). Brno (CZ), 26.11.1996-28.11.1996] R&D Projects: GA ČR GA101/94/0304 Subject RIV: JL - Materials Fatigue, Friction Mechanics

  8. Das Festspiel Sub olea pacis im Kontext der kulturellen Aktivitaeten der Prager Jesuiten

    Czech Academy of Sciences Publication Activity Database

    Kroupa, Jiří K.

    Sankt Augustin : Academia Verlag, 1997 - (Reich, W.; Gattermann , G.), s. 397-407 - (3-89665-035-1. Bd. 12). [Internationale Fachkonferenz Jan Dismas Zelenka /2./. Prag - Dresden (CZ, DE), 00.00.1995] R&D Projects: GA ČR GA405/93/2137

  9. Provenance of Wurmian loess and loess-like sediments of Moravia and Silesia (Czech Republic): a study of zircon typology and cathodoluminiscence

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Uher, P.

    2006-01-01

    Roč. 57, č. 5 (2006), s. 397-403. ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Keywords : Pleistocene * Würmian * Czech Republic * Moravia * cathodoluminiscence * loess sediments * zircon typology * zircon Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.364, year: 2006 http://www.geologicacarpathica.sk/src/main.php

  10. Factor Structure and Reliability of the Childhood Trauma Questionnaire and Prevalence Estimates of Trauma for Male and Female Street Youth

    Science.gov (United States)

    Forde, David R.; Baron, Stephen W.; Scher, Christine D.; Stein, Murray B.

    2012-01-01

    This study examines the psychometric properties of the Childhood Trauma Questionnaire short form (CTQ-SF) with street youth who have run away or been expelled from their homes (N = 397). Internal reliability coefficients for the five clinical scales ranged from 0.65 to 0.95. Confirmatory Factor Analysis (CFA) was used to test the five-factor…

  11. Sex and Aggression: The Relationship between Gender and Abuse Experience in Youngsters Referred to Residential Treatment

    Science.gov (United States)

    Doerfler, Leonard A.; Toscano, Peter F., Jr.; Connor, Daniel F.

    2009-01-01

    We examined the relationship of gender and different forms of abuse experience on internalizing symptoms, externalizing symptoms, and IQ in a sample of 397 youngsters who were admitted to a residential treatment program. Three types of abuse experience were examined in this study: sexual abuse only, physical abuse only, and "both" sexual and…

  12. Child Abuse and Aggression among Seriously Emotionally Disturbed Children

    Science.gov (United States)

    Ford, Julian D.; Fraleigh, Lisa A.; Connor, Daniel F.

    2010-01-01

    Abused children may be at risk for problems with aggression. In a sample of 397 seriously emotionally disturbed children, reactive aggression was associated with documented history of physical abuse but not sexual abuse. Girls were equally likely to be classified as reactively aggressive regardless of physical abuse history, but boys with physical…

  13. Mollusc trace fossils Ptychoplasma Fenton and Fenton, 1937 and Oravaichnium Plička and Uhrová, 1990: Their type material and ichnospecies

    Czech Academy of Sciences Publication Activity Database

    Uchman, A.; Mikuláš, Radek; Rindsberg, A. K.

    2011-01-01

    Roč. 44, č. 4 (2011), s. 387-397. ISSN 0016-6995 R&D Projects: GA ČR GA205/05/0917 Institutional research plan: CEZ:AV0Z30130516 Keywords : locomotion trace fossils * Bivalves * flysch * Carboniferous * Cretaceous * Paleogene Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.010, year: 2011

  14. Situace standardizovaného dotazování z hlediska kognitivních přístupů

    Czech Academy of Sciences Publication Activity Database

    Vinopal, Jiří

    2009-01-01

    Roč. 45, č. 2 (2009), s. 397-420. ISSN 0038-0288 Institutional research plan: CEZ:AV0Z70280505 Keywords : survey methodology * survey interview * questionnaire Subject RIV: AO - Sociology, Demography Impact factor: 0.562, year: 2009

  15. Corn starch: properties and processing. January 1972-December 1987 (citations from the Food Science and Technology Abstracts data base). Report for January 1972-December 1987

    International Nuclear Information System (INIS)

    This bibliography contains citations concerning corn starch processing. The physical and chemical properties, and nutritive value of corn starch and corn starch products are considered. Studies of gamma-irradiated corn starch are included. (This updated bibliography contains 397 citations, 123 of which are new entries to the previous edition.)

  16. Multi-component titanium–copper–cobalt- and niobium nanostructured oxides as catalysts for ethyl acetate oxidation

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Henych, Jiří; Ivanova, R.; Kovacheva, D.; Štengl, Václav

    2015-01-01

    Roč. 116, č. 2 (2015), s. 397-408. ISSN 1878-5190 Institutional support: RVO:61388980 Keywords : Copper and cobalt oxides * Effect of support * Ethyl acetate combustion * Multicomponent oxides * Titania doped with niobium Subject RIV: CA - Inorganic Chemistry Impact factor: 1.170, year: 2014

  17. Some Remarks on Exp-Function Method and Its Applications-A Supplement

    International Nuclear Information System (INIS)

    Recently, the authors of [Commun. Theor. Phys. 56 (2011) 397] made a number of useful observations on Exp-function method. In this study, we focus on another vital issue, namely, the misleading results of double Exp-function method. (general)

  18. Gclust Server: 201249 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201249 Vvy_VV1063 Cluster Sequences - 397 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 2012...49 Cluster ID 201249 Sequence ID Vvy_VV1063 Link to cluster sequences Cluster Seque

  19. Mutuality as an Aspect of Family Functioning in Predicting Eating Disorder Symptoms in College Women

    Science.gov (United States)

    Sanftner, Jennifer L.; Cameron, Rebecca P.; Tantillo, Mary; Heigel, Caron P.; Martin, David Myron; Sippel-Silowash, Julie Ann; Taggart, Jane M.

    2006-01-01

    We examined mutuality, an aspect of Relational Cultural Theory, in an ethnically diverse sample of 397 college women from Midwestern and Western universities. We hypothesized that mutuality would predict scores on an eating disorder scale after controlling for traditional family variables, such as expressed emotion. As predicted, mutuality, as…

  20. Corn starch: Properties and processing. January 1972-December 1987 (a Bibliography from the Food Science and Technology Abstracts data base). Report for January 1972-December 1987

    International Nuclear Information System (INIS)

    This bibliography contains citations concerning corn-starch processing. The physical and chemical properties, and nutritive value of corn starch and corn starch products are considered. Studies of gamma-irradiated corn starch are included. (This updated bibliography contains 397 citations, none of which are new entries to the previous edition.)

  1. Situational Judgment Test Research: Informing the Debate on Practical Intelligence Theory

    Science.gov (United States)

    McDaniel, Michael A.; Whetzel, Deborah L.

    2005-01-01

    [Gottfredson, L. S. (2003). Dissecting practical intelligence theory: Its claims and evidence. Intelligence, 31, 343-397.] provided a detailed critique of Sternberg's [Sternberg, R. J., Fotsythe, G. B., Hedlund, J., Horvath, J. A., Wagner, R. K., Williams, W. M., Snook, S. A., Grigorenko, E. L. (2000). Practical intelligence in everyday life. New…

  2. Alterations in synaptic curvature in the dentate gyrus following induction of long-term potentiation, long-term depression, and treatment with the N-methyl-D-aspartate receptor antagonist CPP

    Czech Academy of Sciences Publication Activity Database

    Medvedev, N. I.; Popov, V. I.; Dallerac, G.; Davies, H.A.; Laroche, S.; Kraev, I. V.; Rodríguez Arellano, Jose Julio; Doyere, V.; Stewart, M.G.

    2010-01-01

    Roč. 171, č. 2 (2010), s. 390-397. ISSN 0306-4522 Institutional research plan: CEZ:AV0Z50390703 Keywords : D synaptic ultrastructure * hippocampus * long term potentiation and depression Subject RIV: FH - Neurology Impact factor: 3.215, year: 2010

  3. Rhizosphere effect of colonizer plant species on the development of soil microbial community during primary succession on postmining sites

    Czech Academy of Sciences Publication Activity Database

    Elhottová, Dana; Krištůfek, Václav; Malý, S.; Frouz, Jan

    2009-01-01

    Roč. 40, 1-6 (2009), s. 758-770. ISSN 0010-3624 R&D Projects: GA MŠk LC06066; GA ČR GA526/03/1259 Institutional research plan: CEZ:AV0Z60660521 Keywords : colonizer plant * colliery spoil substrate * rhizosphere effect Subject RIV: EH - Ecology, Behaviour Impact factor: 0.397, year: 2009

  4. Quantitative changes in focal adhesion kinase and its inhibitor, FRNK, drive load-dependent expression of costamere components.

    Science.gov (United States)

    Klossner, Stephan; Li, Ruowei; Ruoss, Severin; Durieux, Anne-Cécile; Flück, Martin

    2013-09-15

    Costameres are mechanosensory sites of focal adhesion in the sarcolemma that reinforce the muscle-fiber composite and provide an anchor for myofibrillogenesis. We hypothesized that elevated content of the integrin-associated regulator of costamere turnover in culture, focal adhesion kinase (FAK), drives changes in costamere component content in antigravity muscle in a load-dependent way in correspondence with altered muscle weight. The content of FAK in soleus muscle being phosphorylated at autoregulatory tyrosine 397 (FAK-pY397) was increased after 20 s of stretch. FAK-pY397 content remained elevated after 24 h of stretch-overload due to upregulated FAK content. Overexpression of FAK in soleus muscle fibers by means of gene electrotransfer increased the β1-integrin (+56%) and meta-vinculin (+88%) content. α7-Integrin (P = 0.46) and γ-vinculin (P = 0.18) content was not altered after FAK overexpression. Co-overexpression of the FAK inhibitor FAK-related nonkinase (FRNK) reduced FAK-pY397 content by 33% and increased the percentage of fast-type fibers that arose in connection with hybrid fibers with gene transfer. Transplantation experiments confirmed the association of FRNK expression with slow-to-fast fiber transformation. Seven days of unloading blunted the elevation of FAK-pY397, β1-integrin, and meta-vinculin content with FAK overexpression, and this was reversed by 1 day of reloading. The results highlight that the expression of components for costameric attachment sites of myofibrils is under load- and fiber type-related control via FAK and its inhibitor FRNK. PMID:23904105

  5. PENGOLAHAN LIMBAH LOGAM BERAT INDUSTRI TEKSTIL MENGGUNAKAN FOTOKATALIS TiO2/ARANG AKTIF

    Directory of Open Access Journals (Sweden)

    Kapti Riyani

    2008-05-01

    Full Text Available Study about the use of active charcoal rice straws (AAJP was done in order to decrease heavy metal ion on textile waste water by using photocatalyst AAJP/TiO2. Rice straws were gained from the Banyumas Regency and samples textile waste water from one of textile industry in Pemalang. This study was begun by the making of active charcoal from the rice straws, and then the modification of photocatalyst AAJP/TiO2 was done with the comparison 1:99, 2:98, 3:97, 4:96, 5:95. The test of heavy metal ion photoreduction was done with some parameters such as weight comparison (1:99, 2:98, 3:97, 4:96, 5:95, pH effect (2, 5, 7, 9, 13 and the effect of ray source (sun light and the UV lamp. Analysis of photocatalyst material used SEM and heavy metal ion concentration used AAS. Results show that optimum photocatalyst activity in weight comparison AAJP300oC / TiO2 (1:99 with decrease concentration was 65.02% for heavy metal ion, mean while AAJP700oC / TiO2 (3:97 with decreased concentration of heavy metal ion is 94.50%. Optimal process for heavy metal ion reduction occur at pH 2 with decreased concentration of heavy metal ion for AAJP300oC / TiO2 (1:99 is 99.87% and for AAJP700oC /TiO2 (3:97 is 100%. The source of UV lamp was good for heavy metal ion photoreduction (AAJP300oC/TiO2(1:99 was 99.87% and AAJP700oC/TiO2 (3:97 was 100%

  6. Brilliant Green Dye Elimination from Water Using Psidium guajava Leaves and Solanum tuberosum Peels as Adsorbents in Environmentally Benign Way

    Directory of Open Access Journals (Sweden)

    Rabia Rehman

    2015-01-01

    Full Text Available The aim of this study is to check the feasibility of Psidium guajava (Guava leaves and peels of Solanum tuberosum (Potato as biosorbents in removal of Brilliant Green (BG in batch mode. Surface analysis of biosorbents was done by FT-IR and quantitatively analyzed by Boehm titration. The removal of dye was confirmed by UV-VIS spectroscopy. Isothermal modeling was studied by using Langmuir, Freundlich, and Temkin isotherms. Various isothermal parameters for adsorption of Brilliant Green such as qm=1.075 mg/g, 1.173 mg/g ΔG°=-3.397, and −2.397 KJ/mol were noted for Solanum tuberosum peels (PP and Psidium guajava leaves (GL, respectively. Similarly pH, moisture content, and various metals were quantitatively analyzed. Results showed that leaves of Psidium guajava were more effective for removal of Brilliant Green.

  7. The Domain of δ Scuti Stars: First CoRoT IRa01 Results

    Science.gov (United States)

    Kaiser, Alexander; Weiss, Werner; Guenther, Eike; Balaguer, Lola; Maceroni, Carla; Ribas, Ignasi

    2009-09-01

    We present the first results of determing the δ Scuti population observed with CoRoT during the Initial Run (IRa01). From more than 10000 stars observed continuously in the exoplanet-channel during 58 days, 397 stars show pulsation in the δ Scuti domain. For 39 of the 397 stars low resolution classification spectra and Strömgren uvby photometry were available; thus fundamental parameters like effective temperature and surface gravity could be derived. Classical Fourier techniques and least squares multi-sine fits were applied to identify the pulsation frequencies. For additional 90 stars a pair of radial modes were found and by comparing with pulsation models it was possible to estimate the corresponding fundamental parameters.

  8. AcEST: DK947880 [AcEST

    Lifescience Database Archive (English)

    Full Text Available E4_9STRA NADH dehydrogenase subunit 7 OS=Thraustoc... 68 2e-10 tr|Q8M1F6|Q8M1F6_CHAGL NADH dehydrogenase subunit 7 OS=Chaetos...=Pylaiella... 64 3e-09 tr|A8DWI3|A8DWI3_NEMVE Predicted protein (Fragment) OS=Nematoste... 64 3e-09 tr|Q7PBK...63 FSHLQGLDFMSKGHLIADVVTIIGTQDIVFGEVDR 397 >tr|Q8M1F6|Q8M1F6_CHAGL NADH dehydrogenase subunit 7 OS=Chaetosphaeridium globos...|Q9G6N7|Q9G6N7_PHYPA NADH dehydrogenase (NADH dehydrogenase subunit 7) OS=Physcomitrella patens GN=n...E4|Q9G4E4_9STRA NADH dehydrogenase subunit 7 OS=Thraustochytrium aureum GN=nad7 PE=3 SV=1 Length = 397 Score = 68.2 bit

  9. Geometric orbit datum and orbit covers

    Institute of Scientific and Technical Information of China (English)

    LIANG; Ke(

    2001-01-01

    [1]Vogan, D. , Dixmier algebras, sheets and representation theory (in Actes du colloque en I' honneur de Jacques Dixmier),Progress in Math. 92, Boston: Birkhauser Verlag, 1990, 333-397.[2]McGovern, W., Dixmier Algebras and Orbit Method, Operator Algebras, Unitary Representations and Invariant Theory,Boston: Birkhauser, 1990, 397-416.[3]Liang, K. , Parabolic inductions of nilpotent geometric orbit datum, Chinese Science Bulletin (in Chinese) , 1996, 41 (23):2116-2118.[4]Vogan, D., Representations of Real Reductive Lie Groups, Boston-Basel-Stuttgart: Birkhauser, 1981.[5]Lustig, G., Spaltenstein, N., Induced unipotent class, J. London Math. Soc., 1997, 19. 41-52.[6]Collingwood, D. H. , McGovern, W. M. , Nilpotent Orbits in Semisimple Lie Algebras, New York: Van Nostremt Reinhold,1993.

  10. CONSUMO DE ALCOHOL Y FACTORES DE RIESGO EN ESTUDIANTES DE DOS UNIVERSIDADES COLOMBIANAS. (ALCOHOL CONSUMPTION AND RISK FACTORS IN STUDENTS OF TWO COLOMBIAN UNIVERSITIES

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Cano Bedoya

    2012-06-01

    Full Text Available El objetivo fue identificar factores de riesgo del consumo de alcohol en estudiantes universitarios colombianos. Participaron 397 mujeres y 312 hombres, estudiantes de dos universidades privadas y católicas de la ciudad de Medellín (Colombia. Los resultados identificaron como factores de riesgo las dificultades para decir “no” a la gente (p=0.012 y el consumo de sustancias psicoactivas por miembros de la familia (p=0.022.Abstract:The objective of the current research was to identify the risk factors associated to alcohol consumption of Colombian University students. 397 women and 312 men, students from two private and Catholic universities in the city of Medellín (Colombia took part in it. The results identified as risk factors the difficulties to say 'no' to the people (p=0.012 and the consumption of psychoactive substances by members of the family (p=0.022.

  11. The relationship between the rate of melatonin excretion and sleep consolidation for locomotive engineers in natural sleep settings

    OpenAIRE

    Roach, Gregory D.; Reid, Kathryn J.; Ferguson, Sally; Dawson, Drew

    2006-01-01

    Background: The aim of the study was to examine the role that melatonin production plays in the regulation of sleep consolidation in a population of shiftworkers working and sleeping in their natural environments.Methods: 253 locomotive engineers (249 male, 4 female, mean age = 39.7 years) participated in the study for a 2-week period whilst working their normal roster patterns. Participants recorded details for all sleep periods in a sleep diary and collected urine samples during each day's ...

  12. American State Gun Law Strength and State Resident Differences in Neuroticism Levels

    OpenAIRE

    Stewart J. H. McCann; Chantelle Zawila

    2016-01-01

    Relations between state gun law strength and state-aggregated levels of Republican leaning, gun ownership, and resident Big Five neuroticism (based on 619,397 residents nationally) were determined in a state-level analysis of the 50 American states using multiple regression strategies with state socioeconomic status, white population percent, and urban population percent statistically controlled. In a standard hierarchical model with state gun law strength as the criterion, the three demograp...

  13. Confirmatory Factor Analysis of the Malay Version Comprehensive Feeding Practices Questionnaire Tested among Mothers of Primary School Children in Malaysia

    OpenAIRE

    Shamarina Shohaimi; Wong Yoke Wei; Zalilah Mohd Shariff

    2014-01-01

    Comprehensive feeding practices questionnaire (CFPQ) is an instrument specifically developed to evaluate parental feeding practices. It has been confirmed among children in America and applied to populations in France, Norway, and New Zealand. In order to extend the application of CFPQ, we conducted a factor structure validation of the translated version of CFPQ (CFPQ-M) using confirmatory factor analysis among mothers of primary school children (N = 397) in Malaysia. Several items were modif...

  14. Perspectives of the czech agriculture in "less favoured areas".

    Czech Academy of Sciences Publication Activity Database

    Kužel, S.; Kolář, L.; Tříska, Jan; Štindl, P.

    Vol. 3. Maďarsko: Continent-Ph Ltd, 2005 - ( Páy , G.), s. 397-402 ISBN 9638691808. [Innovation and utility in the visegrad fours. Nyíregyháza (HU), 13.10.2005-15.10.2005] Institutional research plan: CEZ:AV0Z60870520 Keywords : agriculture * energy * biomass * utilization Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use

  15. Disease: H00759 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00759 Waardenburg syndrome (WS) Waardenburg syndrome (WS) is a rare autosomal domi...inese patients with type I or type II Waardenburg syndrome. Biochem Biophys Res Commun 397:70-4 (2010) PMID:...MID:20127975 Pingault V, Ente D, Dastot-Le Moal F, Goossens M, Marlin S, Bondurand N Review and update of mutations causing Waardenbu...rg syndrome. Hum Mutat 31:391-406 (2010) PMID:20478267 C

  16. Study on Physical and Mechanical Properties of Poplar Modified by Phenol-formaldehyde Resin

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Impregnation method can effectively improve physical and mechanical properties of wood. In this study, plantation poplar lumbers are impregnated by a low molecular weight phenol-formaldehyde resin solution with concentration of 30% under vacuum-pressure process, and then dried and machined according to the related standards. The results show that the physical and mechanical properties of poplar can be improved by the treatment, except for toughness. The average density of poplar increases from 0.397 to 0.71...

  17. Sexuality-related work discrimination and its association with the health of sexual minority emerging and young adult men in the Detroit Metro Area

    OpenAIRE

    Bauermeister, José A.; Meanley, Steven; Hickok, Andrew; Pingel, Emily; VanHemert, William; Loveluck, Jimena

    2013-01-01

    Discrimination has been linked to negative health outcomes among minority populations. The increasing evidence regarding health disparities among sexual minorities has underscored the importance of addressing sexuality discrimination as a public health issue. We conducted a web-based survey between May and September of 2012 in order to obtain a diverse sample of young men who have sex with men (ages 18–29; N = 397; 83% gay; 49% Black, 27% White, 15% Latino) living in the Detroit Metro Area (M...

  18. AcEST: DK953837 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0018_N11 584 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_N11. 5' end seq ... IEDEVDDIILMKTIQQIYQTWQTFNGS 134 Query: 397 LKALLSNNPSG DIARSCLHAFLPDYL-------ADLLTGKKIADDVLSFCPSRKRV 543 + ... QEEE 126 Query: 349 -------AVLREAHGLFTLFYGSLKALLSNNPSG DIARSCLHAFLPDYLADLLTGKKIAD 507 AV+R+ + ++ LF G+ + + ... EEELLDKVY 128 Query: 346 QAVLREAHGLFTLFYGS-LKALLSNNPSG DIARSCLHAFLPDYLADLLTGKKIADDV--- 513 +VL++ + ++ LF G ... QEDELLDKVYSSVLQQCYRMY 134 Query: 379 TLFYGSLKALLSNNPSG DIARSCLHAFLPDYLADLLTGKKIADDV---LSFCPSRKRVSP 549 LF ...

  19. Measuring Social Capital Investment: Scale Development and Examination of Links to Social Capital and Perceived Stress

    OpenAIRE

    Chen, Xinguang; Wang, Peigang; Wegner, Rhiana; Gong, Jie; FANG, XIAOYI; Kaljee, Linda

    2015-01-01

    Individuals with greater social capital have better health outcomes. Investment in social capital likely increases one’s own social capital, bearing great implications for disease prevention and health promotion. In this study, the authors developed and validated the Social Capital Investment Inventory (SCII). Direct effects of social capital investment on perceived stress, and indirect effects through social capital were examined. 397 Participants from Beijing and Wuhan, China completed surv...

  20. Robot-Assisted Repair of Right Partial Anomalous Pulmonary Venous Return.

    Science.gov (United States)

    Onan, Burak; Aydin, Unal; Turkvatan, Aysel; Bakir, Ihsan

    2016-06-01

    Partial anomalous venous return from the right lung to the right atrium is a rare congenital heart anomaly in adults. We report a 20-year-old female, who presented with right partial anomalous pulmonary venous return and an associated inferior atrial septal defect. A complex repair was successfully done through a right atriotomy approach using a robotic surgical system. doi: 10.1111/jocs.12753 (J Card Surg 2016;31:394-397). PMID:27098377

  1. Alpha-Tocopheryl succinate causes mitochondrial permeabilization by preferential formation of Bak channels

    Czech Academy of Sciences Publication Activity Database

    Procházka, L.; Dong, L.F.; Vališ, Karel; Freeman, R.; Ralph, S.J.; Turánek, J.; Neužil, Jiří

    2010-01-01

    Roč. 15, č. 7 (2010), s. 782-794. ISSN 1360-8185 R&D Projects: GA AV ČR(CZ) KAN200520703; GA AV ČR(CZ) IAA500520702; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Vitamin E succinate * apoptosis * Noxa-Bak Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.397, year: 2010

  2. Comparative analysis of dose rates in bricks determined by neutron activation analysis, alpha counting and X-ray fluorescence analysis for the thermoluminescence fine grain dating method

    Czech Academy of Sciences Publication Activity Database

    Bártová, H.; Kučera, Jan; Musílek, L.; Trojek, T.

    2014-01-01

    Roč. 104, NOV (2014), s. 393-397. ISSN 0969-806X. [1st International Conference on Dosimetry and its Applications (ICDA). Prague, 23.6.2013-28.6.2013] R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : Alpha coutning * neutron activation analysis * X-ray fluorescence * thermoluminescence dating * dose rate Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.380, year: 2014

  3. Palaeoceanographic implications of abundance and mean proloculus diameter of benthic foraminiferal species Epistominella exigua in sub-surface sediments from distal Bay of Bengal fan

    Digital Repository Service at National Institute of Oceanography (India)

    Saraswat, R.; Nigam, R.; Barreto, L.

    surface (Murray 1991). E. exigua is a sporadically epifaunal detri- tivore, usually associated with a pulsed supply of phytodetritus and elevated oxygen concentrations (Gooday 1993; Mackensen et al 1995; Schmiedl et al 1997; Nees and Struck 1999; Gupta...?358. Murray J W 1991 Ecology and Paleoecology of Benthic Foraminifera. John Wiley, New York and Longman Sci- entific and Technical, Harlow, UK 1?397. Nees S and Struck U 1999 Benthic foraminiferal response to major paloeceanographic changes. In: Reconstructing...

  4. Myocardial bridging: retrospective analysis and scintigraphic testing of patients with no angiographically significant atherosclerotic coronary disease.

    OpenAIRE

    Luz, A.C.; J. Silveira; P. Palma; Cyrne-Carvalho, H.; Albuquerque, A.; I. Amorim; Gomes, L.

    2006-01-01

    Rev Port Cardiol. 2006 Apr;25(4):397-406. Myocardial bridging: retrospective analysis and scintigraphic testing of patients with no angiographically significant atherosclerotic coronary disease. [Article in English, Portuguese] Luz A, Silveira J, Palma P, Carvalho HC, Albuquerque A, Amorim I, Gomes L. SourceServiço de Cardiologia, Hospital Geral de Santo António, Porto, Portugal. Abstract INTRODUCTION AND OBJECTIVE: The clinical relevance of myocardial bri...

  5. Selection of reference genes for real-time polymerase chain reaction analysis in tissues from Bombus terrestris and Bombus lucorum of different ages

    Czech Academy of Sciences Publication Activity Database

    Horňáková, Darina; Matoušková, Petra; Kindl, Jiří; Valterová, Irena; Pichová, Iva

    2010-01-01

    Roč. 397, č. 1 (2010), s. 118-120. ISSN 0003-2697 R&D Projects: GA ČR GA203/09/1446; GA MŠk(CZ) LC531; GA MŠk 2B06007 Institutional research plan: CEZ:AV0Z40550506 Keywords : real-time PCR * reference genes * Bombus * bumblebees Subject RIV: CE - Biochemistry Impact factor: 3.236, year: 2010

  6. Viscosity prediction of refrigerants under subcritical/supercritical conditions

    Directory of Open Access Journals (Sweden)

    Yue Hong-Ya

    2015-01-01

    Full Text Available Viscosity is an important thermophysical property of fluids. Viscosities of refrigerants were predicted based on friction theory combined with the Lemmon and Span short reference equation of state. This model is valid for the temperature up to 397 K and pressure up to 40 MPa, which cover both the subcritical and supercritical regions. Experimental data were further used to validate the model. Under all test conditions, the accuracy is better than 6%, which is acceptable in most practical applications.

  7. Progress and challenges to control malaria in a remote area of Chittagong hill tracts, Bangladesh

    OpenAIRE

    Haque Rashidul; Ahmed Syed; Hossain Shahed; Sunahara Toshihiko; Hashizume Masahiro; Haque Ubydul; Yamamoto Taro; Glass Gregory E

    2010-01-01

    Abstract Background Malaria is endemic in 13 eastern districts where the overall infection prevalence is 3.97%. In 2006, Bangladesh received US$ 36.9 million from the Global Fund to Fight AIDS, Tuberculosis and Malaria (GFATM) to support the national malaria control programme of Bangladesh. Objectives The objective of this study was to i) clarify factors associated with treatment seeking behaviours of malaria ii) distribution of LLIN, and iii) re-treatment of ITN in remote area of a CHT distr...

  8. Drug: D00832 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00832 Drug Melarsoprol (INN); Mel B (TN) C12H15AsN6OS2 397.9965 398.3387 D00832.gif Antiprotozo ... TS AGAINST LEISHMANIASIS AND TRYPANOSOMIASIS P01CD Arsenic ... compounds P01CD01 Melarsoprol D00832 Melarsoprol ( ... s Agents against Leishmaniasis and Trypanosomiasis Arsenic ... compounds Melarsoprol [ATC:P01CD01] D00832 Melarso ...

  9. New Radiometric Ages for the BH-1 Hominin from Balanica (Serbia): Implications for Understanding the Role of the Balkans in Middle Pleistocene Human Evolution

    OpenAIRE

    William J Rink; Mercier, Norbert; Mihailović, Dušan; Mike W Morley; Thompson, Jeroen W.; Roksandic, Mirjana

    2013-01-01

    Newly obtained ages, based on electron spin resonance combined with uranium series isotopic analysis, and infrared/post-infrared luminescence dating, provide a minimum age that lies between 397 and 525 ka for the hominin mandible BH-1 from Mala Balanica cave, Serbia. This confirms it as the easternmost hominin specimen in Europe dated to the Middle Pleistocene. Inferences drawn from the morphology of the mandible BH-1 place it outside currently observed variation of European Homo heidelbergen...

  10. The power of negative thinking: corruption, perception and willingness to bribe in Ukraine

    Czech Academy of Sciences Publication Activity Database

    Čábelková, I.; Hanousek, Jan

    2004-01-01

    Roč. 36, č. 4 (2004), s. 383-397. ISSN 0003-6846 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : corruption, perception and willingness to bribe * Ukraine Subject RIV: AH - Economics Impact factor: 0.211, year: 2004 http://search.ebscohost.com/login.aspx?direct=true&db=bth&AN=12453997&site=ehost-live

  11. Non-ordered lower and upper functions in second order impulsive periodic problems

    Czech Academy of Sciences Publication Activity Database

    Rachůnková, I.; Tvrdý, Milan

    2005-01-01

    Roč. 12, 3-4 (2005), s. 397-415. ISSN 1201-3390 R&D Projects: GA ČR(CZ) GA201/01/1199 Institutional research plan: CEZ:AV0Z10190503 Keywords : second order nonlinear ordinary differential equation with impulses * periodic solutions * lower and upper functions Subject RIV: BA - General Mathematics Impact factor: 0.235, year: 2005

  12. Evaluation of Mechanisms of Alteration and Humification of PAHs for Water Quality Management

    OpenAIRE

    Sims, Ronald C.; Abbott, Carolyn K.

    1992-01-01

    Introduction: Creosote-pentachlorophenol (PCP) is a mixture commonly used as a wood preservative in the U.S. (1). A 1988 survey (2) indicated that 1,397 wood preserving waste contaminated sites exist in the United States consisting of 555 active wood treatment plants and 842 inactive plants. Stinson (3) indentifed 58 wood preserving sites on the National Priorities List, of which 51 have PCP and/or creosote or po...

  13. Vlijanije električeskoj anizotropiji na magnitotelluričeskije dannyje: modelirovanije i eksperimentalnyje nabljudenija

    Czech Academy of Sciences Publication Activity Database

    Pek, Josef

    Moskva: Knižnyj dom LIBROKOM, 2009 - (Spičak, V.), s. 110-135 ISBN 978-5-397-00577-7 R&D Projects: GA AV ČR IAA3012401; GA AV ČR IAA300120703; GA ČR(CZ) GA205/06/0557 Institutional research plan: CEZ:AV0Z30120515 Keywords : anisotropic conductivities * magnetotelluric data * magnetotelluric model Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  14. HETDEX pilot survey for emission-line galaxies - I. Survey design, performance, and catalog

    OpenAIRE

    Adams, Joshua J.; Blanc, Guillermo A.; Hill, Gary J.; Gebhardt, Karl; Drory, Niv; Hao, Lei; Bender, Ralf; Byun, Joyce; Ciardullo, Robin; Cornell, Mark E.; Finkelstein, Steven L.; Fry, Alex; Gawiser, Eric; Gronwall, Caryl; Hopp, Ulrich

    2010-01-01

    We present a catalog of emission-line galaxies selected solely by their emission-line fluxes using a wide-field integral field spectrograph. This work is partially motivated as a pilot survey for the upcoming Hobby-Eberly Telescope Dark Energy Experiment (HETDEX). We describe the observations, reductions, detections, redshift classifications, line fluxes, and counterpart information for 397 emission-line galaxies detected over 169 sq.arcmin with a 3500-5800 Ang. bandpass under 5 Ang. full-wid...

  15. Effect of the particle size and surface area of tungstated zirconia on the WOx nuclearity and n-heptane isomerization over Pt/WO3–ZrO2

    Czech Academy of Sciences Publication Activity Database

    Kaucký, Dalibor; Wichterlová, Blanka; Dědeček, Jiří; Sobalík, Zdeněk; Jakubec, Ivo

    2011-01-01

    Roč. 397, 1-2 (2011), s. 82-93. ISSN 0926-860X R&D Projects: GA AV ČR KAN100400702 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z40400503 Keywords : n-heptane isomeration * Pt/WO3-ZrO2 * nano ZrO2 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.903, year: 2011

  16. Group acceptance and emotional competence of preadolescent children

    OpenAIRE

    Petrović Jelica; Zotović Marija

    2007-01-01

    This study examines contribution of emotional competence on socially competent behavior of preadolescents. The following emotional competencies were registered in 397 children: emotion recognition, emotional regulation, empathy and style of coping with aversive emotions. Discriminant analysis was conducted in order to identify emotional competencies that differentiate among the groups of participants with different levels of social preference. The data showed that groups of popular children, ...

  17. On mean reward variance in semi-Markov processes

    Czech Academy of Sciences Publication Activity Database

    Sladký, Karel

    2005-01-01

    Roč. 62, č. 3 (2005), s. 387-397. ISSN 1432-2994 R&D Projects: GA ČR(CZ) GA402/05/0115; GA ČR(CZ) GA402/04/1294 Institutional research plan: CEZ:AV0Z10750506 Keywords : Markov and semi- Markov processes with rewards * variance of cumulative reward * asymptotic behaviour Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.259, year: 2005

  18. Dicty_cDB: Contig-U13607-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13607-1 no gap 630 6 1422335 1421715 MINUS 1 1 U13607 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show C ... g_GS-30-02-01-1... 52 0.025 1 ( EC763901 ) EST 397 Guarana ... fruits cDNA library Paullinia cup... 52 0.025 1 ( ...

  19. Waterfowl: potential environmental reservoirs of the chytrid fungus Batrachochytrium dendrobatidis

    OpenAIRE

    Garmyn, An; Van Rooij, Pascale; Pasmans, Frank; Hellebuyck, Tom; Van den Broeck, Wim; Haesebrouck, Freddy; Martel, An

    2012-01-01

    Infections with Batrachochytrium dendrobatidis (B. dendrobatidis), the causal agent of chytridiomycosis, have been shown to play an important role in the decline of amphibians worldwide. Spread of the fungus is poorly understood. Bird movement might possibly contribute to the spread of B. dendrobatidis in the environment. Therefore, 397 wild geese in Belgium were screened for presence of B. dendrobatidis on their toes using real-time quantitative PCR (qPCR). In addition, chemotaxis towards, a...

  20. Prostaglandin E2 gel for cervical ripening and labour induction: a multicentre placebo-controlled trial.

    OpenAIRE

    Bernstein, P.

    1991-01-01

    OBJECTIVE: To determine the effect of a single intracervical dose of prostaglandin E2 (PGE2) gel on cervical ripening and the need for subsequent labour induction with oxytocin. DESIGN: Multicentre randomized, double-blind, placebo-controlled study. SETTING: Tertiary care hospitals. PATIENTS: A total of 397 women met the inclusion criteria: gestational age of at least 36 weeks, parity of 3 or less, a Bishop score of 4 or less, intact membranes, an indication for induction, no contraindication...

  1. Theorie und Empirie in der diachronen Sprachwissenschaft: Einige Bemerkungen zum Begriff der genetischen Sprachverwandtschaft

    Czech Academy of Sciences Publication Activity Database

    Vykypěl, Bohumil

    Praha: Nakladatelství Lidové noviny, 2009 - (Janyšková, I.; Karlíková, H.), s. 397-401. (Studia etymologica Brunensia. 6). ISBN 978-80-7106-209-7. [Etymologické symposion Brno 2008. Brno (CZ), 26.05.2008-28.05.2008] R&D Projects: GA ČR GA405/07/1092 Institutional research plan: CEZ:AV0Z90610518 Keywords : linguistics Subject RIV: AI - Linguistics

  2. Precision calculation of elasticity for percolation

    International Nuclear Information System (INIS)

    Monte Carlo transfer matrix evaluation of the elastic constants at the percolation threshold of the random-bond honeycomb lattice, with widths of up to 96 and lengths of about two million lattice constants (roughly 200 hours CDC Cyber 205 vector computer time) gave a critical exponent T=3.96+/-0.04 with a logarithmic correction term. This exponent agrees well with the scaling hypothesis T=t + 2v=3.97, relating T to the two-dimensional conductivity exponent

  3. Precision calculation of elasticity for percolation

    Energy Technology Data Exchange (ETDEWEB)

    Zabolitzky, J.G.; Bergman, D.J.; Stauffer, D.

    1986-07-01

    Monte Carlo transfer matrix evaluation of the elastic constants at the percolation threshold of the random-bond honeycomb lattice, with widths of up to 96 and lengths of about two million lattice constants (roughly 200 hours CDC Cyber 205 vector computer time) gave a critical exponent T=3.96+/-0.04 with a logarithmic correction term. This exponent agrees well with the scaling hypothesis T=t + 2v=3.97, relating T to the two-dimensional conductivity exponent.

  4. AcEST: BP913078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LE D + N L+ Sbjct: 233 SLQLFYQLMEDNVVPDGYILSTVLSACSILPFLEGGKQIHAHILRYG-LEMDASLMNVLI 291 Query: 235 DMYASCGLIANAHETFCGLGIRSIISWSSLI... D+I+WT + GY+++ EA+ VF + Sbjct: 218 EKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFYK 277 Query: 394 MQHEG...AWNTMIGGLAEGGYWEEASEVYN 317 Query: 397 EMQHEGFAPSMVTHVCMLSACGNLGALEMGIEIHAEMARKGLLEQDLTAGNALLDMYASC 218 +MQ EG... G A G + +A+ +F +MQ Sbjct: 566 DVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQ 625 Query: 388 HEG...A +G +E Sbjct: 56 IIQSGF-QSDVRVETALVNMYVKCGSIDDAQLIFDKMVERNVISWTVMIGGLAHYGRGQE 114 Query: 415 ALCVFKEMQHEGFA

  5. Digoxin use and risk of mortality in hypertensive patients with atrial fibrillation

    DEFF Research Database (Denmark)

    Okin, Peter M; Hille, Darcy A; Wachtell, Kristian;

    2015-01-01

    follow-up (n = 803), randomly assigned to losartan or atenolol-based treatment, in post-hoc analysis of a substudy of the Losartan Intervention For Endpoint Reduction in hypertension (LIFE) trial. During 4.7 ± 1.1 years of mean follow-up, 167 patients died (17.8%) and 372 (39.7%) were treated with...

  6. Nové sídlištní nálezy z doby římské v Praze-Kbelích

    Czech Academy of Sciences Publication Activity Database

    Malyková, Drahomíra; Bursák, D.; Pecinovská, Monika

    Olomouc : Univerzita Palackého v Olomouci, 2011 - (Droberjar, E.), s. 397-413 ISBN 978-80-244-2987-8. - (Studia archaeologica suebica. 1). [Protohistorická konference /6./. Hradec Králové (CZ), 06.09.2010-09.09.2010] Institutional research plan: CEZ:AV0Z80020508 Keywords : Roman Period * settlement * pottery Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Electron Transport Studies of Disorder and Dimensionality in Nano-Crystalline Diamond

    Czech Academy of Sciences Publication Activity Database

    Hubík, Pavel; Mareš, Jiří J.

    Dordrecht : Springer, 2013 - (Šesták, J.; Šimon, P.), s. 371-397 ISBN 978-90-481-3149-5. - (Hot Topics in Thermal Analysis and Calorimetry. 9) R&D Projects: GA ČR GAP204/10/0212 Institutional support: RVO:68378271 Keywords : nano-crystalline diamond * electron transport * grain boundary Subject RIV: BM - Solid Matter Physics ; Magnetism http://ntc.zcu.cz/download/Sestak_knihy/BOOKS_Contents/Vol9.pdf

  8. Children and youth perceive smoking messages in an unbranded advertisement from a NIKE marketing campaign: a cluster randomised controlled trial

    OpenAIRE

    Daniel Mark; Auger Nathalie; Knäuper Bärbel; Raynault Marie-France; Pless Barry

    2011-01-01

    Abstract Background How youth perceive marketing messages in sports is poorly understood. We evaluated whether youth perceive that the imagery of a specific sports marketing advertisement contained smoking-related messages. Methods Twenty grade 7 to 11 classes (397 students) from two high schools in Montréal, Canada were recruited to participate in a cluster randomised single-blind controlled trial. Classes were randomly allocated to either a NIKE advertisement containing the phrase 'LIGHT IT...

  9. High Cycle Fatigue Damage Mechanisms of MAR-M 247 Superalloy at High Temperatures

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Horník, Vít; Hutař, Pavel; Hrbáček, K.; Kunz, Ludvík

    2016-01-01

    Roč. 69, č. 2 (2016), s. 393-397. ISSN 0972-2815 R&D Projects: GA TA ČR(CZ) TA04011525; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : High cycle fatigue * S-N curves * Fractography * High temperature * EBSD analysis Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.615, year: 2014

  10. Fatigue behaviour of AZ91 magnesium alloy in as-cast and severe plastic deformed conditions

    Czech Academy of Sciences Publication Activity Database

    Kunz, Ludvík; Fintová, Stanislava

    Zurich : Trans Tech Publications, 2014 - (Clark, G.; Wang, C.), s. 397-402 ISBN 978-3-03835-008-8. ISSN 1022-6680. - (Advanced Materials Research. 891-892). [Fatigue 2014 - International Fatigue Congress /11./. Melbourne (AU), 02.03.2014-07.03.2014] R&D Projects: GA ČR GAP108/10/2001 Institutional support: RVO:68081723 Keywords : AZ91 * ECAP * microstructure * mechanical properties * cyclic plastic deformation * fatigue crack initiation Subject RIV: JL - Materials Fatigue, Friction Mechanics

  11. Stent for Life in Portugal: This initiative is here to stay

    OpenAIRE

    Pereira, H.; Pinto, FJ; Calé, R; Pereira, E.; J. MARQUES; De Almeida, M.; Mello, S.; Dias Martins, L; behalf of the participating centres in the Stent for Life Initiative in Portugal

    2014-01-01

    AIMS: Portugal has one of the lowest rates of primary percutaneous coronary intervention (p-PCI) in Western Europe. This study assessed the progress of Portuguese p-PCI performance indicators one year after Portugal joined the Stent for Life (SFL) initiative. METHODS AND RESULTS: Two national surveys were carried out, each covering a period of one month: the first when Portugal joined the SFL in 2011 (Moment Zero), and the second one year later (Moment One). A total of 397 consecutiv...

  12. Development of porcine rotavirus vp6 protein based ELISA for differentiation of this virus and other viruses

    OpenAIRE

    ZHU, JIAYI; Yang, Qing; Cao, Liyan; Dou, Xiujing; Zhao, Jianguo; Zhu, Weijuan; Ding, Fan; Bu, Ri-e; Suo, Siqingaowa; Ren, Yudong; Li, Guangxing; Ren, Xiaofeng

    2013-01-01

    Background The context and purpose of the study included 1) bacterial expression of viral protein 6 (VP6) of porcine rotavirus (PRV) and generation of rabbit polyclonal antiserum to the VP6 protein; 3) establishment of a discrimination ELISA to distinguish PRV from a panel of other porcine viruses. Results The VP6 gene of PRV isolate DN30209 amplified by reverse transcription-PCR was 1356 bp containing a complete open reading frame (ORF) encoding 397 amino acids. Sequence comparison and phylo...

  13. Determination of butoxyacetic acid (biomarker of ethylene glycol monobutyl ether exposure) in human urine candidate reference material

    Czech Academy of Sciences Publication Activity Database

    Sperlingova, I.; Dabrowská, L.; Stránský, V.; Duskova, S.; Kučera, Jan; Tvrdíková, M.; Tichý, M.

    2010-01-01

    Roč. 397, č. 2 (2010), s. 433-438. ISSN 1618-2642. [12th International Symposium on Biological and Environmental Reference Materials Keble Coll. Oxford, 07.07.2009-10.07.2009] Institutional research plan: CEZ:AV0Z10480505 Keywords : Candidate reference material * Ethylene glycol monobutyl ether * Metabolite Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.841, year: 2010

  14. Consumer Empowerment Profile in Rural and Urban Area

    OpenAIRE

    Megawati Simanjuntak; Siti Amanah; Herien Puspitawati; Pang. S. Asngari

    2014-01-01

    The purpose of this research was to analyze the profile of consumer empowerment and the influence of demographic characteristics, socio-economic status and cosmopoliteness on consumer empowerment in rural and urban area. The research finding indicated a low consumer empowerment in urban and rural area. In general, most respondents who were not categorized as empowered consumer were aged >37 years old, working in rural areas, included in income category ranged IDR 397,874.57/capita/month both ...

  15. Crystallization and crystallographic analysis of the Rhodococcus rhodochrous NCIMB 13064 DhaA mutant DhaA31 and its complex with 1,2,3-trichloropropane

    Czech Academy of Sciences Publication Activity Database

    Lahoda, M.; Chaloupková, R.; Stsiapanava, A.; Damborský, J.; Kutá-Smatanová, Ivana

    2011-01-01

    Roč. 67, Part 3 (2011), s. 397-400. ISSN 1744-3091 R&D Projects: GA MŠk(CZ) LC06010; GA MŠk(CZ) ED1.1.00/02.0073 Institutional research plan: CEZ:AV0Z60870520 Keywords : haloalkane dehalogenases * DhaA * Rhodococcus rhodochrous Subject RIV: CE - Biochemistry Impact factor: 0.506, year: 2011

  16. Does self-esteem affect body dissatisfaction levels in female adolescents?☆

    OpenAIRE

    Leonardo de Sousa FORTES; Cipriani, Flávia Marcele; Coelho, Fernanda Dias; Paes, Santiago Tavares; Maria Elisa Caputo FERREIRA

    2014-01-01

    Objective: To evaluate the influence of self-esteem on levels of body dissatisfaction among adolescent females. Methods: A group of 397 adolescents aged 12 to 17 years were enrolled in the study. The Body Shape Questionnaire (BSQ) was applied to assess body dissatisfaction. The Rosenberg Self-Esteem Scale was used to assess self-esteem. Weight, height, and skinfold thickness were also measured. These anthropometric data were controlled in the statistical analyses. Results: The multiple regres...

  17. 78 FR 28235 - National Cancer Institute; Notice of Closed Meetings

    Science.gov (United States)

    2013-05-14

    ... Toolkit for Cancer Diagnosis, Staging, and Treatment. Date: May 29, 2013. Time: 12:00 p.m. to 2:00 p.m... Treatment Research; 93.396, Cancer Biology Research; 93.397, Cancer Centers Support; 93.398, Cancer Research... Diagnostic Assay to Detect Basal- like Breast Cancer. Date: June 13, 2013. Time: 12:00 p.m. to 1:00...

  18. Implications of dam obstruction for global freshwater fish diversity

    OpenAIRE

    Reidy Liermann, Catherine; Nilsson, Christer; Robertson, James; Ng, Rebecca

    2012-01-01

    Dams are obstructing rivers worldwide, impairing habitat and migration opportunities for many freshwater fish species; however, global data linking dam and fish distributions have been limited. Here, we quantify dam obstruction at the biogeographic scale of freshwater ecoregion, which provides the spatial framework necessary to assess the risk of fish species loss due to dams and allows us to identify both ecoregions and genera at risk. Nearly 50% of the 397 assessed freshwater ecoregions are...

  19. 78 FR 12648 - Airworthiness Directives; Robinson Helicopter Company

    Science.gov (United States)

    2013-02-25

    ..., 2011, we issued AD 2011-12-10, amendment 39-16717 (76 FR 35330, June 17, 2011) (AD 2011-12-10) for... typographical error in AD 2011-12-10 on March 5, 2012 (77 FR 12991). AD 2011-12-10 requires a pilot check of the..., Amendment 39-15314 (73 FR 397, January 3, 2008) (AD 2007-26-12) which requires a one-time visual...

  20. AcEST: BP913187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_E03 540 Adiantum capillus-veneris mRNA. clone: YMU001_000027_E03. BP913187 CL397Co ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptid... 30 5.8 sp|A2T195|LEP4_AERS4 Type 4 prepi ... lin-like proteins leader ... peptid... 30 5.8 sp|P62285|ASPM_BOVIN Abnormal spi ...

  1. AcEST: BP913566 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_F09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000031_F09. BP913566 CL397Co ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptid... 30 6.3 sp|A2T195|LEP4_AERS4 Type 4 prepi ... lin-like proteins leader ... peptid... 30 6.3 sp|P62285|ASPM_BOVIN Abnormal spi ...

  2. Relationship between Teacher Motivation and Transformational Leadership Characteristics of School Principals

    OpenAIRE

    Figen Eres

    2011-01-01

    The aim of the study was to determine the motivation levels of teachers working in primary school and the level of transformational leadership qualities of school principals based on the perceptions of teachers; and then the investigate of the relationship between teacher motivation and the transformational leadership qualities of school principals. The sample consists of 397 class teachers and subject matter teachers who were chosen randomly and work at the central boroughs of Ankara. As a r...

  3. The effects of working time in the organization and job change frequency of employees on the organizational commitment levels

    OpenAIRE

    Kara, Derya

    2012-01-01

    In this research, it is aimed to determine the effects of working time in the organization and the job change frequency on organizational commitment levels of employees working in hotel establishments. Application field of the research consists of 397 employees working in 5 star hotel establishments in Ankara. In order to point out employees' organizational commitment, “Organizational Commitment Scale” has been used as a means of data collection. Employees' organizational commitment has been ...

  4. A Study Analyzing the Association between Post-Traumatic Embitterment Disorder and Workplace Bullying

    OpenAIRE

    KARATUNA, Işıl; GÖK, Sibel

    2014-01-01

    The aim of this study was to investigate the association between perceived victimization from workplace bullying and self-reported embitterment reactions. Data were obtained through anonymous questionnaires from 397 participants working in the public sector. Among the participants, 23.9% were labeled as victims of bullying. Significant differences were observed in the mean scores of posttraumatic embitterment disorder between victims and nonvictims and experiencing bullying was found to be...

  5. Mortality Risks Associated with Average Drinking Level and Episodic Heavy Drinking

    OpenAIRE

    Schoenborn, CA; Stommel, V.; Ward, B

    2014-01-01

    Data from the 1997–2004 National Health Interview Survey Sample Adult questionnaires were linked to the National Death Index (N=242,397) to examine mortality risks associated with average and episodic heavy drinking. Cox proportional hazard models (Stata 12.0) revealed that (average) heavier drinkers and episodic heavy drinkers (5+ in a day) had increased mortality risks but when examined together, episodic heavy drinking added only modest to the mortality risks of light and moderate drinkers...

  6. Draft Genome Assemblies of Proteus mirabilis ATCC 7002 and Proteus vulgaris ATCC 49132

    OpenAIRE

    Minogue, T. D.; Daligault, H. E.; Davenport, K. W.; Bishop-Lilly, K. A.; Bruce, D. C.; Chain, P. S.; Coyne, S. R.; Chertkov, O.; Freitas, T.; Frey, K. G.; Jaissle, J.; Koroleva, G. I.; Ladner, J. T.; Palacios, G. F.; Redden, C. L.

    2014-01-01

    The pleomorphic swarming bacilli of the genus Proteus are common human gut commensal organisms but also the causative agents of recurrent urinary tract infections and bacteremia. We sequenced and assembled the 3.99-Mbp genome of Proteus mirabilis ATCC 7002 (accession no. JOVJ00000000) and the 3.97-Mbp genome of Proteus vulgaris ATCC 49132 (accession no. JPIX00000000), both of which are commonly used reference strains.

  7. Evidence of long-term change in zonal wind in the tropical lower mesosphere: Observations and model simulations

    Czech Academy of Sciences Publication Activity Database

    Ratnam, M. V.; Kumar, G. K.; Rao, N. V.; Murthy, B. V. K.; Laštovička, Jan; Qian, L.

    2013-01-01

    Roč. 40, č. 2 (2013), s. 397-401. ISSN 0094-8276 R&D Projects: GA ČR GAP209/10/1792 Institutional support: RVO:68378289 Keywords : mesosphere * zonal wind * long-term trends * TIME-GCM * climate change Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 4.456, year: 2013 http://onlinelibrary.wiley.com/doi/10.1002/grl.50158/abstract

  8. Production, purification and oxidative folding of the mouse recombinant prion protein

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, A.; Bednárová, Lucie; Holada, K.

    2007-01-01

    Roč. 52, č. 4 (2007), s. 391-397. ISSN 0015-5632 R&D Projects: GA ČR GD310/05/H533 Grant ostatní: GA ČR(CZ) GA310/04/0419 Institutional research plan: CEZ:AV0Z40550506 Keywords : recombinant prion protein * production * purification * folding Subject RIV: CE - Biochemistry Impact factor: 0.989, year: 2007 http://www.biomed.cas.cz/mbu/folia/

  9. A QSPR Study of Sweetness Potency Using the CODESSA Program

    OpenAIRE

    Alan R. Katritzky; Petrukhin, Ruslan; Perumal, Subbu; Karelson, Mati; Prakash, Indra; Desai, Nitin

    2002-01-01

    A total of 397 natural and artificial comprehensively referenced sweeteners were classified by their structures into nine sets. The sweetness potencies were correlated with quantum Chemical and other molecular descriptors using the heuristic and the best multi-linear regression methods of the CODESSA software package. QSPR models (two-parameter unless otherwise indicated) emerged for each subclass of sweeteners with R2 values of 0.835 for 47 aldoximes, 0.959 for 8 acesulfamates, 0.919 for 9 s...

  10. The PHLAME (Promoting Healthy Lifestyles: Alternative Models’ Effects) Firefighter Study: Testing Mediating Mechanisms

    OpenAIRE

    Ranby, Krista W.; MacKinnon, David P.; Fairchild, Amanda J.; Elliot, Diane L.; Kuehl, Kerry S.; Goldberg, Linn

    2011-01-01

    This paper examines the mechanisms by which PHLAME (Promoting Healthy Lifestyles: Alternative Models’ Effects), a health promotion intervention, improved healthy eating and exercise behavior among firefighters, a population at high risk for health problems due to occupational hazards. In a randomized trial, 397 firefighters participated in either the PHLAME team intervention with their work shift or a control condition. Intervention sessions taught benefits of a healthy diet and regular exerc...

  11. Detection of subclinical peste des petits ruminants virus infection in experimental cattle

    OpenAIRE

    Sen, A; Saravanan, P; V. Balamurugan; Bhanuprakash, V.; G. Venkatesan; Sarkar, J.; Rajak, K. K.; Ahuja, A.; Yadav, V; Sudhakar, S. B.; Parida, S.; Singh, R. K.

    2014-01-01

    The present study was undertaken to investigate the possible involvement of cattle in the epidemiology of peste des petits ruminants (PPR) as subclinical carriers. Cattle were exposed experimentally to PPR virus (PPRV) infection or placed in contact with PPR infected goats. Clinical samples including heparinized/EDTA blood, plasma, peripheral blood monocyte cells (PBMCs) and clotted blood (for serum) were collected periodically from 21 days post infection (dpi) to 397 dpi (21, 45, 50, 57, 65,...

  12. Assessing Eating Disorder Risk: The Pivotal Role of Achievement Anxiety, Depression and Female Gender in Non-Clinical Samples

    OpenAIRE

    Christos C. Frangos; Fragkos, Konstantinos C.

    2013-01-01

    The objective of the present study was to assess factors predicting eating disorder risk in a sample of undergraduate students. A structured questionnaire was employed on a random sample (n = 1865) consisting of the following sections: demographics, SCOFF (Sick, Control, One stone, Fat, Food) questionnaire for screening eating disorders and the Achievement Anxiety Test and the Depression, Anxiety and Stress Scale. The students at risk for eating disorders (SCOFF score ≥2) were 39.7%. Eating d...

  13. MicroRNA characterize genetic diversity and drug resistance in pediatric acute lymphoblastic leukemia

    OpenAIRE

    Schotte, Diana; Menezes, Renee; Akbari Moqadam, Farhad; Khankahdani, Leila Mohammadi; Lange-Turenhout, Ellen; Chen, Caifu; Pieters, Rob; de Boer, Monique

    2011-01-01

    textabstractBackground MicroRNA regulate the activity of protein-coding genes including those involved in hematopoietic cancers. The aim of the current study was to explore which microRNA are unique for seven different subtypes of pediatric acute lymphoblastic leukemia. Design and Methods Expression levels of 397 microRNA (including novel microRNA) were measured by quantitative real-time polymerase chain reaction in 81 cases of pediatric leukemia and 17 normal hematopoietic control cases. Res...

  14. PHYSICAL ACTIVITY LEVEL AMONG UNIVERSITY STUDENTS: A CROSS SECTIONAL SURVEY

    OpenAIRE

    Roshini Rajappan; Karthikeyan Selvaganapathy; Lola Liew

    2015-01-01

    Background and Objective: Physical inactivity is the fourth leading risk factor for global mortality. Physical inactivity levels are rising in developing countries and Malaysia is of no exception. Malaysian Adult Nutrition Survey 2003 reported that the prevalence of physical inactivity was 39.7% and the prevalence was higher for women (42.6%) than men (36.7%). In Malaysia, the National Health and Morbidity Survey 2006 reported that 43.7% (5.5 million) of Malaysian adults were physically inact...

  15. Dislocation glide velocity in creep of Mg alloys derived from dip tests

    Czech Academy of Sciences Publication Activity Database

    Eisenlohr, P.; Blum, W.; Milička, Karel

    510-511, Sp. Iss. (2009), s. 393-397. ISSN 0921-5093. [Creep 2008. Bayreuth, 04.05.2008-09.05.2008] R&D Projects: GA ČR GA106/06/1354 Institutional research plan: CEZ:AV0Z20410507 Keywords : Dislocation glide velocity * Temperature dependence * Solute drag * Forest cutting * Prismatic glide Subject RIV: JG - Metallurgy Impact factor: 1.901, year: 2009

  16. Low tobacco-related cancer incidence in offspring of long-lived siblings

    DEFF Research Database (Denmark)

    Pedersen, Jacob K; Skytthe, Axel; McGue, Matt;

    2015-01-01

    , observed numbers of cancers were compared with expected numbers based on gender-, calendar period-, and age-specific incidence rates in the general population. RESULTS: During the 41-year-follow-up period, a total of 423 cancers occurred in 397 individuals. The standardized incidence ratios (95% confidence......-lived families compared with non-tobacco-related cancers suggests that health behavior plays a central role in lower early cancer incidence in offspring of long-lived siblings in Denmark....

  17. Supersymmetric quantum mechanics living on topologically non-trivial Riemann surfaces

    Czech Academy of Sciences Publication Activity Database

    Znojil, Miloslav; Jakubský, Vít

    2009-01-01

    Roč. 73, č. 2 (2009), s. 397-404. ISSN 0304-4289. [8th Conference on Non-Hermitian Hamiltonians in Quantum Physics. Mumbai, 13.01.2009-16.01.2009] R&D Projects: GA MŠk LC06002; GA ČR GA202/07/1307 Institutional research plan: CEZ:AV0Z10480505 Keywords : Supersymmetry * Schrodinger equation * complexified coordinates Subject RIV: BE - Theoretical Physics Impact factor: 0.349, year: 2009

  18. Epidemiological aspects of enteroparasitosis at daycare centers in the city of Botucatu, State of São Paulo, Brazil Aspectos epidemiológicos das enteroparasitoses em creches na cidade de Botucatu, Estado de São Paulo, Brasil

    OpenAIRE

    Luciene Maura Mascarini; Maria Rita Donalisio

    2006-01-01

    OBJECTIVE: To estimate the prevalence and incidence of intestinal parasites in children and staff members of 5 municipal daycare centers in Botucatu/SP. Two cross-sectional studies were carried out in 2002 (N=379) and 2003 (N=397) and a longitudinal observational experiment in which the children from 2002 and 2003 were evaluated for a year. Questionnaires were given to staff members and parents of the children, where the following variables were recorded: socioeconomic status, sanitary habits...

  19. Polymorphisms in stromal genes and susceptibility to serous epithelial ovarian cancer: a report from the Ovarian Cancer Association Consortium

    OpenAIRE

    Amankwah, E.K.; Wang, Q; Schildkraut, J.M.; Tsai, Y.Y.; Ramus, S.J.; Fridley, B L; Beesley, J.; Johnatty, S E; Webb, P. M.; Chenevix-Trench, G; Dale, L.C.; D. Lambrechts; Amant, F.; Despierre, E.; Vergote, I.

    2011-01-01

    Alterations in stromal tissue components can inhibit or promote epithelial tumorigenesis. Decorin (DCN) and lumican (LUM) show reduced stromal expression in serous epithelial ovarian cancer (sEOC). We hypothesized that common variants in these genes associate with risk. Associations with sEOC among Caucasians were estimated with odds ratios (OR) among 397 cases and 920 controls in two U.S.-based studies (discovery set), 436 cases and 1,098 controls in Australia (replication set 1) and a conso...

  20. ZFHX4 Interacts with the NuRD Core Member CHD4 and Regulates the Glioblastoma Tumor-Initiating Cell State

    OpenAIRE

    Yakov Chudnovsky; Dohoon Kim; Siyuan Zheng; Warren A. Whyte; Mukesh Bansal; Mark-Anthony Bray; Shuba Gopal; Matthew A. Theisen; Steve Bilodeau; Prathapan Thiru; Julien Muffat; Omer H. Yilmaz; Maya Mitalipova; Kevin Woolard; Jeongwu Lee

    2014-01-01

    Glioblastoma (GBM) harbors subpopulations of therapy-resistant tumor-initiating cells (TICs) that are self-renewing and multipotent. To understand the regulation of the TIC state, we performed an image-based screen for genes regulating GBM TIC maintenance and identified ZFHX4, a 397 kDa transcription factor. ZFHX4 is required to maintain TIC-associated and normal human neural precursor cell phenotypes in vitro, suggesting that ZFHX4 regulates differentiation, and its suppression increases gli...

  1. The posterior medial cortex is involved in visual but not in verbal memory encoding processing: an intracerebral recording study

    Czech Academy of Sciences Publication Activity Database

    Štillová, K.; Jurák, Pavel; Chládek, Jan; Halámek, Josef; Telecká, S.; Rektor, I.

    2013-01-01

    Roč. 120, č. 3 (2013), s. 391-397. ISSN 0300-9564 R&D Projects: GA ČR GAP103/11/0933; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : Event-related potential (ERP) * Memory * Posterior medial cortex (PMC) – SEEG Subject RIV: BD - Theory of Information Impact factor: 2.871, year: 2013

  2. CLAVATA3 is a specific regulator of shoot and floral meristem development affecting the same processes as CLAVATA1

    OpenAIRE

    Clark, Steven M.; Running, Mark P; Meyerowitz, Elliot M.

    1995-01-01

    We have previously described the phenotype of Arabidopsis thaliana plants with mutations at the CLAVATA1 (CLV1) locus (Clark, S. E., Running, M. P. and Meyerowitz, E. M. (1993) Development 119, 397-418). Our investigations demonstrated that clv1 plants develop enlarged vegetative and inflorescence apical meristems, and enlarged and indeterminate floral meristems. Here, we present an analysis of mutations at a separate locus, CLAVATA3(CLV3), that disrupt meristem development in a manner similar ...

  3. Complete Genome Sequence of Streptococcus pneumoniae Serotype 19A, a Blood Clinical Isolate from Northeast Mexico

    Science.gov (United States)

    Hinojosa-Robles, Rosa Maria; Barcenas-Walls, Jose Ramon; Vignau-Cantu, Armando; Barrera-Saldaña, Hugo A.

    2016-01-01

    We report here the draft genome sequence of a Streptococcus pneumoniae strain isolated in Monterrey, Mexico, MTY1662SN214, from a man with purpura fulminans. The strain belongs to the invasive and multidrug-resistant serogroup 19A, sequence type 320 (ST320). The draft genome sequence consists of 60 large contigs, a total of 2,069,474 bp, and has a G+C content of 39.7%. PMID:27034499

  4. Genetic Algorithm for Graph Colouring: Exploration of Galinier and Hao's algorithm

    OpenAIRE

    Celia A. Glass; Prügel-Bennett, Adam

    2003-01-01

    This paper examines the best current algorithm for solving the Chromatic Number Problem, due to Galinier and Hao (Journal of Combinatorial Optimization,1999, 3(4), pp 379-397). The algorithm combines a Genetic Algorithm with Tabu Search. We show that the algorithm remains powerful even if the Tabu Search component is eliminated, and explore the reasons for its success where other Genetic Algorithms have failed. In addition we propose a generalized algorithm for the Frequency Assignment Problem.

  5. Chromosomes in the flow to simplify genome analysis

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jaroslav; Vrána, Jan; Šafář, Jan; Bartoš, Jan; Kubaláková, Marie; Šimková, Hana

    2012-01-01

    Roč. 12, č. 3 (2012), s. 397-416. ISSN 1438-793X R&D Projects: GA ČR GAP501/10/1740; GA ČR GAP501/10/1778 Institutional research plan: CEZ:AV0Z50380511 Keywords : Chromosome sorting * Chromosome-specific BAC libraries * Chromosome sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.292, year: 2012

  6. Membrane ion transport in erythrocytes of salt hypertensive Dahl rats and their F2 hybrids: the importance of cholesterol

    Czech Academy of Sciences Publication Activity Database

    Vokurková, Martina; Dobešová, Zdenka; Kuneš, Jaroslav; Zicha, Josef

    2003-01-01

    Roč. 26, č. 5 (2003), s. 397-404. ISSN 0916-9636 R&D Projects: GA ČR GA305/00/1638; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : ion transport * salt hypertension * plasma lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 2.013, year: 2003

  7. A new entodiniomorphid ciliate, Troglocorys cava n. g., n. sp., from the wild eastern chimpanzee (Pan troglodytes schweinfurthii) from Uganda

    Czech Academy of Sciences Publication Activity Database

    Tokiwa, T.; Modrý, David; Ito, A.; Pomajbíková, K.; Petrželková, Klára Judita; Imai, S.

    2010-01-01

    Roč. 57, č. 2 (2010), s. 115-120. ISSN 1066-5234 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Infraciliature * Kalinzu Forest * protozoa * scanning electron microscopy Subject RIV: EG - Zoology Impact factor: 2.397, year: 2010

  8. K-shellspectroscopy of an independently diagnosed uniaxially expanding laser-produced aluminium plasma

    Czech Academy of Sciences Publication Activity Database

    Chambers, D. M.; Pinto, P. A.; Hawreliak, J.; Al'Miev, I. R.; Gouveia, A.; Sondhauss, P.; Wolfrum, E.; Wark, J. S.; Glenzer, S. H.; Renner, Oldřich; Marjoribanks, R. S.; Topping, S.

    2002-01-01

    Roč. 66, - (2002), s. 026410-1 - 026410-16. ISSN 1063-651X R&D Projects: GA ČR GA202/01/0755 Institutional research plan: CEZ:AV0Z1010921 Keywords : laser produced plasma * x-ray emission * Thomson scattering * hydrodynamic simulations Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.397, year: 2002

  9. Heritability and whole genome linkage of pulse pressure in Chinese twin pairs

    DEFF Research Database (Denmark)

    Jiang, Wengjie; Zhang, Dongfeng; Pang, Zengchang; Li, Shuxia; Duan, Haiping; Wang, Shaojie; Tan, Qihua

    2012-01-01

    heritability estimate of 0.45. Genome-wide non-parametric linkage analysis identified three significant linkage peaks on chromosome 11 (lod score 4.06 at 30.5 cM), chromosome 12 (lod score 3.97 at 100.7 cM), and chromosome 18 (lod score 4.01 at 70.7 cM) with the last two peaks closely overlapping with linkage...

  10. Desain Dan Pabrikasi Helmet Industri Yang Ergonomik

    OpenAIRE

    Hasrin

    2009-01-01

    Tesis ini melaporkan hasil desain dan pabrikasi model helm industri dari bahan komposit polimer GFRP tipe polyester (resin unsaturated), dengan serat E-Glass jenis Choped Strand Mat. Pada proses pabrikasi helm komposit ini, dengan susunan dua lapisan serat E-Glass jenis CSM, yang dibentuk mengikuti bentuk cetakan helm standard AS/NZS 1801 EN 397 SS 98 dengan metode hand lay up. Sistem pencetakan helmet dilakukan secara terpisah, dan empat sisi dinding helmet dibuat saluran angin. Hasil penguj...

  11. Kidney volume and function in autosomal dominant polycystic kidney disease

    OpenAIRE

    Higashihara, Eiji; Nutahara, Kikuo; Okegawa, Takatsugu; Shishido, Toshihide; Tanbo, Mitsuhiro; Kobayasi, Kuninori; Nitadori, Toshiaki

    2013-01-01

    Background The significance of total kidney volume (TKV) as a biomarker of kidney function in autosomal dominant polycystic kidney disease (ADPKD) is controversial and has been reappraised. Methods Between 2007 and 2012, 64 patients were followed with a mean 39.7-month observation period. TKV measurements by magnetic resonance imaging and estimation of renal function with estimated glomerular filtration rate (eGFR) using the Modification of Diet in Renal Disease equation and 24-h urine creati...

  12. Association of Breastfeeding and the Federal Poverty Level: National Survey of Family Growth, 2011–2013

    OpenAIRE

    R. Constance Wiener; Usha Sambamoorthi; Hayes, Sarah E.; Ilana R. Azulay Chertok

    2016-01-01

    Breastfeeding is strongly endorsed in the Healthy People 2020 goals; however, there remain many disparities in breastfeeding prevalence. The purpose of this study was to examine the association between breastfeeding and the Federal Poverty Level in the United States. Data from 5,397 women in the National Survey of Family Growth 2011–2013 survey were included in this study. The data were analyzed for descriptive features and logistic regressions of the Federal Poverty Level on breastfeeding. T...

  13. Integrating Systems Thinking Into Nursing Education.

    Science.gov (United States)

    Phillips, Janet M; Stalter, Ann M

    2016-09-01

    A critical need exists for nursing leadership in current complex health care settings. Systems thinking can be incorporated into nursing education at all levels by using evidence-based principles in education. Teaching tips are provided using a systems awareness model to guide nurse educators in the assessment and integration of systems thinking and engaging learners in interprofessional education and practice. J Contin Educ Nurs. 2016;47(9):395-397. PMID:27580505

  14. Determination of insoluble avian eggshell matrix proteins

    Czech Academy of Sciences Publication Activity Database

    Mikšík, Ivan; Sedláková, Pavla; Lacinová, Kateřina; Pataridis, Statis; Eckhardt, Adam

    2010-01-01

    Roč. 397, č. 1 (2010), s. 205-214. ISSN 1618-2642 R&D Projects: GA MŠk(CZ) 1M0510; GA ČR(CZ) GA203/09/0675; GA ČR(CZ) GA203/08/1428 Institutional research plan: CEZ:AV0Z50110509 Keywords : eggshell proteins * insoluble proteins * matrix proteins Subject RIV: CE - Biochemistry Impact factor: 3.841, year: 2010

  15. AcEST: BP920584 [AcEST

    Lifescience Database Archive (English)

    Full Text Available lici... 39 6e-05 tr|Q9SP93|Q9SP93_9ASTR Thiol protease OS=Matricaria chamomilla G... 40 1e-04 tr|A9PHQ3|A9PH...Q9SP93_9ASTR Thiol protease OS=Matricaria chamomilla GN=ctp PE=2 SV=1 Length = 501 Score = 39.7 bits (91), E

  16. The effect of elevated ambient CO2 and temperature increase on rhizosphere of perennial ryegrass (Lolium perenne L.)

    Czech Academy of Sciences Publication Activity Database

    Šantrůčková, Hana; Elhottová, Dana; Loiseau, P.; Soussana, F.

    2000-01-01

    Roč. 46, č. 9 (2000), s. 397-403. ISSN 0370-663X R&D Projects: GA ČR GA206/99/1410 Grant ostatní: -(EV) EV5V-CT92-0169 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 123100004 Subject RIV: EF - Botanics Impact factor: 0.256, year: 2000

  17. Edueufooriast tekkinud eelarvekriis / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-

    2008-01-01

    Kui 1997. a. pandi riigieelarvesse 39,7% SKT-st, siis 2005. a. 35,7%. Neljaprotsendine ühisraha osatähtsuse langus tähendab 2009. aastal, et valitsussektori käsutuses on 12 mld. krooni vähem kui olnuks 1997. a. osalusmäära korral. Autori sõnul on inimareng õhukese riigi poliitikaga lepitamatus vastuolus kogu maailmas

  18. Fertility of a spontaneous hexaploid male Siberian sturgeon, Acipenser baerii

    Czech Academy of Sciences Publication Activity Database

    Havelka, M.; Hulák, M.; Ráb, Petr; Rábová, Marie; Lieckfeldt, D.; Ludwig, A.; Rodina, M.; Gela, D.; Pšenička, M.; Bytyutskyy, D.; Flajšhans, M.

    2014-01-01

    Roč. 15, č. 5 (2014). ISSN 1471-2156 Grant ostatní: GA MŠk(CZ) EE2.3.30.0049; GA MŠk(CZ) ED2.1.00/01.0024; GA ČR(CZ) GA523/08/0824 Institutional support: RVO:67985904 Keywords : Acipenseridae * polyploidy determination * sperm quality Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2014

  19. How to interpret Methylation Sensitive Amplified Polymorphism (MSAP) profiles?

    Czech Academy of Sciences Publication Activity Database

    Fulneček, Jaroslav; Kovařík, Aleš

    2014-01-01

    Roč. 15, JAN 2014 (2014). ISSN 1471-2156 R&D Projects: GA ČR(CZ) GBP501/12/G090; GA ČR(CZ) GA13-10057S; GA ČR(CZ) GA206/09/1751 Institutional support: RVO:68081707 Keywords : MSAP * DNA methylation * Methylcytosine Subject RIV: BO - Biophysics Impact factor: 2.397, year: 2014

  20. Nutritional performance of cattle grazing on low-quality tropical forage supplemented with nitrogenous compounds and/or starch

    OpenAIRE

    Ísis Lazzarini; Edenio Detmann; Mário Fonseca Paulino; Sebastião de Campos Valadares Filho; Rilene Ferreira Diniz Valadares; Fabrício Albani Oliveira; Poliana Teixeira da Silva; William Lima Santiago dos Reis

    2013-01-01

    The objective of this work was to evaluate the effects of protein and/or starch supplementation on the nutritional performance of cattle grazing on low-quality tropical forage. Five crossbred steers (Holstein × Gyr) with an average body weight (BW) of 397 kg that were fitted with ruminal and abomasal cannulae were used. The animals were kept in individual signal-grass (Bracharia decumbens) paddocks. Five treatments were evaluated: 1 - control (without supplementation); 2 - supplementation wit...

  1. Terorismus a jeho důsledky v oblasti ochrany lidských práv

    Czech Academy of Sciences Publication Activity Database

    Stočesová, Simona

    Praha : Vysoká škola aplikovaného práva, s.r.o, 2008 - (Blahož, J.), s. 397-403 ISBN 978-80-86775-20-3 R&D Projects: GA AV ČR IAA700680702 Institutional research plan: CEZ:AV0Z70680506 Keywords : terrorism * Human Rights * fight against terrorism Subject RIV: AG - Legal Sciences

  2. The Impact of Irrigation on the Nutritional Status of Children in the Sissala West District of Ghana

    OpenAIRE

    Anderson, A. K.; Asiedu, D. K.; J. Setorglo; B.A.Z. Abu; M. Steiner-Asiedu

    2012-01-01

    According to the Food and Agriculture Organization (FAO, 2006) the most sustainable way to reduce hunger effectively is to improve agriculture and rural development simultaneously. The study investigated the impact of irrigation dam projects on child nutritional status. A total of 397 mother-child pair from three communities (control, 1 year and 2 year intervention with introduction of irrigation dam) with and without irrigation dams participated in the study. Nutritional status was assessed ...

  3. Detection and counting of Nitrobacter populations in soil by PCR.

    OpenAIRE

    Degrange, V; Bardin, R

    1995-01-01

    Although the biological conversion of nitrite to nitrate is a well-known process, studies of Nitrobacter populations are hindered by their physiological characteristics. This report describes a new method for detecting and counting Nitrobacter populations in situ with the PCR. Two primers from the 16S rRNA gene were used to generate a 397-bp fragment by amplification of Nitrobacter species DNA. No signal was detected from their phylogenetic neighbors or the common soil bacteria tested. Extrac...

  4. Coexisting Miocene Alkaline Volcanic Series Associated with the Cheb-Domažlice Graben (W Bohemia): Geochemical Characteristics

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Štěpánková, Jana; Lloyd, F. E.; Balogh, K.

    2003-01-01

    Roč. 54, č. 1 (2003), s. 53-64. ISSN 1335-0552 R&D Projects: GA ČR GA205/99/0907 Grant ostatní: Hungarian Academy of Sciences Foundation(HU) T 014961 Institutional research plan: CEZ:AV0Z3013912 Keywords : W Bohemia * Miocene volkanism * geochemistry Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  5. Roztoky intrusive centre in the České středohoří Mts.: Differentiation, emplacement, distribution, orientation and age of dyke series

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Balogh, K.

    2000-01-01

    Roč. 51, č. 6 (2000), s. 383-397. ISSN 1335-0552 R&D Projects: GA MK RK99P03OMG035 Grant ostatní: Hungarian Science Foundation(HU) T014961 Institutional research plan: CEZ:AV0Z3013912 Keywords : geochemistry * structural setting * volcanic center Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.156, year: 2000 http://www.geologicacarpathica.sk/src/main.php

  6. De diversis quaestionibus ad Augustinum: Simpliciano e l'origenismo milanese

    OpenAIRE

    Belcastro, Mauro

    2013-01-01

    The aim of the article is an overview of the reasons who led in 397 Simplicianus of Milan to request to Augustine a clarification about Origenian theological and scriptural interpretation on freedom and grace. The principal hypothesis is that Simplicianus was waiting for a response from Augustine in support of Milan’s ‘Origenism’: the Ambrosian purpose was in fact the creation of a local strong church, both politically and theologically, supported by ‘exportable’ rational principles (Milan, c...

  7. Host specificity and experimental assessment of the early establishment of the mistletoe Phoradendron crassifolium (Pohl ex DC.) Eichler (Santalaceae) in a fragment of Atlantic Forest in southeast Brazil

    OpenAIRE

    Patrícia Aparecida Messias; João de Deus Vidal Jr.; Ingrid Koch; Alexander V. Christianini

    2014-01-01

    Mistletoe establishment relies heavily on a seed reaching a proper host plant. Small frugivorous birds usually disperse large numbers of mistletoe seeds. However, in the field, mistletoes are absent from some potential available hosts. We investigated whether the mistletoe Phoradendron crassifolium has some preferences for specific host trees in a fragment of Atlantic Forest in southeast Brazil. We surveyed 397 tree individuals of 50 species within 25 families. Seven of those species (14%) bo...

  8. Efficacy and safety of brinzolamide/timolol fixed combination compared with timolol in Japanese patients with open-angle glaucoma or ocular hypertension [Erratum

    OpenAIRE

    Yoshikawa K; Kozaki J; Maeda H

    2014-01-01

     Yoshikawa K, Kozaki J, Maeda H. Efficacy and safety of brinzolamide/timolol fixed combination compared with timolol in Japanese patients with open-angle glaucoma or ocular hypertension. Clin Ophthalmol. 2014;8:389–399.The Acknowledgments on page 397 contains an error: "Hidehito Kawabata (Kusakari Eye Clinic, Chiba, Japan)" should be "Hidehito Kawabata (Kawabata Eye Clinic, Chiba, Japan)".Read the original article

  9. Efficacy and safety of brinzolamide/timolol fixed combination compared with timolol in Japanese patients with open-angle glaucoma or ocular hypertension [Erratum

    Directory of Open Access Journals (Sweden)

    Yoshikawa K

    2014-05-01

    Full Text Available  Yoshikawa K, Kozaki J, Maeda H. Efficacy and safety of brinzolamide/timolol fixed combination compared with timolol in Japanese patients with open-angle glaucoma or ocular hypertension. Clin Ophthalmol. 2014;8:389–399.The Acknowledgments on page 397 contains an error: "Hidehito Kawabata (Kusakari Eye Clinic, Chiba, Japan" should be "Hidehito Kawabata (Kawabata Eye Clinic, Chiba, Japan".Read the original article

  10. A new approach to classifying altered and newly formed particles as a result of self-heating and self-combustion processes

    Czech Academy of Sciences Publication Activity Database

    Misz-Kennan, M.; Kus, J.; Flores, D.; Avila, C.; Christianis, K.; Hower, J.; Kalaitzidis, S.; O´Keefe, J.; Marques, M.; Pusz, S.; Ribeiro, J.; Suarez-Ruiz, I.; Sýkorová, Ivana; Wagner, N.; Životář, D.

    Freiberg: TU Bergakademie, 2010 - (Drebenstedt, C.; Fischer, C.; Meyer, U.), s. 406 ISBN 978-3-86012-397-3. [International Conference on Coal Fire Research /2./. Berlin (DE), 19.05.2010-21.05.2010] R&D Projects: GA AV ČR IAA300460804 Institutional research plan: CEZ:AV0Z30460519 Keywords : coal * coal waste * minerals thermal alteration Subject RIV: DB - Geology ; Mineralogy

  11. Inorganic Matter in Coal Particles of Coal Waste Piles

    Czech Academy of Sciences Publication Activity Database

    Klika, Z.; Fojtíková, M.; Matějka, V.; Kolomazník, I.; Sýkorová, Ivana; Havelcová, Martina; Trejtnarová, Hana; Martinec, Petr; Šulc, Alexandr

    Freiberg: TU Bergakademie Freiberg, 2010, s. 404-405. ISBN 978-3-86012-397-3. [Second International Conference on Coal Fire Research ICCFR2. Berlin (DE), 19.05.2010-21.05.2010] R&D Projects: GA AV ČR IAA300460804 Institutional research plan: CEZ:AV0Z30460519; CEZ:AV0Z30860518 Keywords : coal waste s * inorganic matter * phase analysis Subject RIV: DM - Solid Waste and Recycling

  12. Carbon Particles and Organic Compounds in Hard Coal Waste

    Czech Academy of Sciences Publication Activity Database

    Sýkorová, Ivana; Havelcová, Martina; Klika, Z.; Trejtnarová, Hana; Fojtíková, M.; Martinec, Petr; Šulc, Alexandr

    Freiberg: TU Bergakademie Freiberg, 2010, s. 418-419. ISBN 978-3-86012-397-3. [Second International Conference on Coal Fire Research ICCFR2. Berlin (DE), 19.05.2010-21.05.2010] R&D Projects: GA AV ČR IAA300460804 Institutional research plan: CEZ:AV0Z30460519; CEZ:AV0Z30860518 Keywords : coal waste s * organic matter * PAHs Subject RIV: DM - Solid Waste and Recycling

  13. Canadian oncology nurse work environments: part II.

    Science.gov (United States)

    Bakker, Debra; Conlon, Michael; Fitch, Margaret; Green, Esther; Butler, Lorna; Olson, Karin; Cummings, Greta

    2012-03-01

    In the aftermath of healthcare restructuring, it is important to pay attention to nurses' perceptions of workplace and professional practice factors that attract nurses and influence their retention. Continuing constraints on cancer care systems make the issue of health human resources an ongoing priority. This paper presents the findings of a follow-up study of a cohort of Canadian oncology nurses that aimed to compare nurses' perceptions of their work environment, job satisfaction and retention over a two-year period. Participants of the follow-up survey represented 65% (397/615) of the initial cohort. Many similar perceptions about the work environment were found over two years; however, at follow-up a larger proportion of nurses reported an absence of enough RNs to provide quality care and a lack of support for innovative ideas. With respect to career status, only 6% (25/397) of the follow-up sample had left oncology nursing. However, the proportion of nurses declaring an intention to leave their current job increased from 6.4% (39/615) on the initial survey to 26% (102/397) on the follow-up survey. Findings suggest that decision-makers need to use both the growing body of workplace knowledge and the input from staff nurses to implement changes that positively influence nurse recruitment and retention. Future research should focus on the implementation and evaluation of strategies that address workplace issues such as nurse staffing adequacy, leadership and organizational commitment. PMID:22469763

  14. A Co-Dominant Marker BoE332 Applied to Marker-Assisted Selection of Homozygous Male-Sterile Plants in Cabbage (Brassica oleracea var. capitata L.)

    Institute of Scientific and Technical Information of China (English)

    CHEN Chen; ZHUANG Mu; FANG Zhi-yuan; WANG Qing-biao; ZHANG Yang-yong; LIU Yu-mei; YANG Li-mei; CHENG Fei

    2013-01-01

    The dominant genic male sterility (DGMS) gene CDMs399-3 derived from a spontaneous mutation in the line 79-399-3 of spring cabbage (Brassica oleracea var. capitata L.), has been successfully applied in hybrid seed production of several cabbage cultivars in China. During the development of dominant male sterility lines in cabbage, the conventional identification of homozygous male-sterile plants (CDMs399-3/CDMs399-3) is a laborious and time-consuming process. For marker-assisted selection (MAS) of the gene CDMs399-3 transferred into key spring cabbage line 397, expressed sequence tag-simple sequence repeats (EST-SSR) and SSR technology were used to identify markers that were linked to CDMs399-3 based on method of bulked segregant analysis (BSA). By screening a set of 978 EST-SSRs and 395 SSRs, a marker BoE332 linked to the CDMs399-3 at a distance of 3.6 cM in the genetic background of cabbage line 397 were identified. 7 homozygous male-sterile plants in population P1170 with 20 plants were obtained finally via MAS of BoE332. Thus, BoE332 will greatly facilitate the transferring of the gene CDMs399-3 into the key spring cabbage line 397 and improve the application of DGMS in cabbage hybrid breeding.

  15. Measurement of observables sensitive to coherence effects in hadronic Z decays with the OPAL detector at LEP

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, N., E-mail: nadine.fischer@monash.edu [Institute for Theoretical Physics, Karlsruhe Institute of Technology, Karlsruhe (Germany); School of Physics and Astronomy, Monash University, Melbourne (Australia); Gieseke, S. [Institute for Theoretical Physics, Karlsruhe Institute of Technology, Karlsruhe (Germany); Kluth, S. [Max-Planck-Institute for Physics, Munich (Germany); Plätzer, S. [Institute for Particle Physics Phenomenology, Durham University, Durham (United Kingdom); School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Skands, P. [School of Physics and Astronomy, Monash University, Melbourne (Australia); Theoretical Physics, CERN, Geneva (Switzerland); Collaboration: OPAL Collaboration

    2015-11-30

    A study of QCD coherence is presented based on a sample of about 397,000 e{sup +}e{sup -} hadronic annihilation events collected at √s=91 GeV with the OPAL detector at LEP. The study is based on four recently proposed observables that are sensitive to coherence effects in the perturbative regime. The measurement of these observables is presented, along with a comparison with the predictions of different parton shower models. The models include both conventional parton shower models and dipole antenna models. Different ordering variables are used to investigate their influence on the predictions.

  16. Measurement of observables sensitive to coherence effects in hadronic Z decays with the OPAL detector at LEP

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, N. [Institute for Theoretical Physics, Karlsruhe Institute of Technology, Karlsruhe (Germany); Monash University, School of Physics and Astronomy, Melbourne (Australia); Gieseke, S. [Institute for Theoretical Physics, Karlsruhe Institute of Technology, Karlsruhe (Germany); Kluth, S. [Max-Planck-Institute for Physics, Munich (Germany); Plaetzer, S. [Durham University, Institute for Particle Physics Phenomenology, Durham (United Kingdom); University of Manchester, School of Physics and Astronomy, Manchester (United Kingdom); Skands, P. [Monash University, School of Physics and Astronomy, Melbourne (Australia); Theoretical Physics, CERN, Geneva (Switzerland); Collaboration: OPAL Collaboration

    2015-12-15

    A study of QCD coherence is presented based on a sample of about 397,000 e{sup +}e{sup -} hadronic annihilation events collected at √(s) = 91 GeV with the OPAL detector at LEP. The study is based on four recently proposed observables that are sensitive to coherence effects in the perturbative regime. The measurement of these observables is presented, along with a comparison with the predictions of different parton shower models. The models include both conventional parton shower models and dipole antenna models. Different ordering variables are used to investigate their influence on the predictions. (orig.)

  17. Development of a high-resolution bathymetry dataset for the Columbia River through the Hanford Reach

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, Andre M.; Ward, Duane L.; Larson, Kyle B.; Lettrick, Joseph W.

    2010-10-08

    A bathymetric and topographic data collection and processing effort involving existing and newly collected data has been performed for the Columbia River through the Hanford Reach in central Washington State, extending 60-miles from the tailrace of Priest Rapids Dam (river mile 397) to near the vicinity of the Interstate 182 bridge just upstream of the Yakima River confluence (river mile 337). The contents of this report provide a description of the data collections, data inputs, processing methodology, and final data quality assessment used to develop a comprehensive and continuous merged 1m resolution bathymetric and topographic surface dataset for the Columbia River through the Hanford Reach.

  18. Consumo de alcohol y factores de riesgo en estudiantes de dos universidades Colombianas

    OpenAIRE

    Arias Zapata, Francisco Javier; Calderon Vallejo, Gustavo; Cano Bedoya, Victor Hugo; Castaño Perez, Guillermo Alonso

    2012-01-01

    The objective of the current research was to identify the risk factors associated to alcohol consumption of Colombian University students. 397 women and 312 men, students from two private and Catholic universities in the city of Medellín (Colombia) took part in it. The results identified as risk factors the difficulties to say 'no' to the people (p=0.012) and the consumption of psychoactive substances by members of the family (p=0.022). El objetivo fue identificar factores de riesgo del co...

  19. MicroRNA Expression Profiling of the Porcine Developing Hypothalamus and Pituitary Tissue

    OpenAIRE

    Xiaoling Jiang; Hongmei Zhou; Huiyun Zhou; Shengjuan Wei; Zhaowei Cai; Lifan Zhang; Ningying Xu

    2013-01-01

    MicroRNAs (miRNAs), a class of small non-coding RNA molecules, play important roles in gene expressions at transcriptional and post-transcriptional stages in mammalian brain. So far, a growing number of porcine miRNAs and their function have been identified, but little is known regarding the porcine developing hypothalamus and pituitary. In the present study, Solexa sequencing analysis showed 14,129,397 yielded reads, 6,680,678 of which were related to 674 unique miRNAs. After a microarray as...

  20. Inclusive π0 and η meson production in electron positron interactions at √s = 10 GeV

    International Nuclear Information System (INIS)

    We report on a high statistics study of π0 and η production in continuum events and in direct decays of the Υ(1S) and Υ(2S) resonances. The measured production rates per event are 0)>=3.22±0.07±0.31 (3.97±0.23±0.38) and η>=0.19±0.04±0.04 (0.40±0.14±0.09) for continuum events (direct Υ(1S) decays). (orig.)

  1. X-ray emission studies in relativistic collisions of Li-like uranium ions with gaseous target

    Energy Technology Data Exchange (ETDEWEB)

    Banas, D. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany) and Institute of Physics, Swietokrzyska Academy, 25-406 Kielce (Poland)]. E-mail: dariusz.banas@pu.kielce.pl; Stoehlker, Th. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institut fuer Kernphysik, University of Frankfurt, 60486 Frankfurt (Germany); Ionescu, D.C. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Beyer, H.F. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Bosch, F. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Braeuning-Demian, A. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Gumberidze, A. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institut fuer Kernphysik, University of Frankfurt, 60486 Frankfurt (Germany); Tbilisi State University, 380128 Tbilisi, Georgia (United States); Hagmann, S. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Kozhuharov, C. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Ma, X. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institute of Modern Physics, 730000 Lanzhou (China); Mokler, P.H. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Mann, R. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Sierpowski, D. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institute of Physics, Jagiellonian University, 30-059 Cracow (Poland); Tachenov, S. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institut fuer Kernphysik, University of Frankfurt, 60486 Frankfurt (Germany); Stachura, Z. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institute of Nuclear Physics, 31-342 Cracow (Poland); Warczak, A. [Gesellschaft fuer Schwerionenforschung, 64291 Darmstadt (Germany); Institute of Physics, Jagiellonian University, 30-059 Cracow (Poland)

    2005-07-01

    The X-ray spectra produced by K-shell ionization in collisions of Li-like (U{sup 89+}) uranium ions at an energy of 397 MeV/u with gaseous N{sub 2} target have been measured. The very high level selectivity during such collision has been found. The effect allows us to measure undistorted two-photon energy distribution from a decay of the 1s2s{sup 1}S{sub 0} state in He-like uranium.

  2. Separation and Purification of Flavonoids from Black Currant Leaves by High-Speed Countercurrent Chromatography and Preparative HPLC

    OpenAIRE

    He, Dajun; Huang, Yun; Ayupbek, Amatjan; Gu, Dongyu; Yi YANG; Aisa, Haji Akber; Ito, Yoichiro

    2010-01-01

    High-speed countercurrent chromatography (HSCCC) has been successfully used for the preparative isolation of flavonoids from the ethyl acetate extracts of black currant leaves. The HSCCC separation was performed with a two-phase solvent system composed of n-hexane/EtOAc/MeOH/H2O (1:10:1:10, v/v) at a flow rate of 1.5 mL/min. When the flow rate was increased from 1.0 to 3.0 mL/min, the retention of stationary phase decreased from 60.3% to 39.7% resulting in loss of peak resolution, while the s...

  3. The roads of decentralisation. The history of rural road construction in Ethiopia

    OpenAIRE

    Emmenegger, Rony

    2012-01-01

    Roads, in particular rural roads, play a major role in deve- lopment. In Ethiopia, where the vast majority of the popula- tion depends on agricultural production, this is even more so, and the country’s road network has become a major po- licy issue with significant consequences for the population. An extensive network of 114,397 km of different roads has been constructed, maintained, and classified to date. Alt- hough community roads account for nearly two-thirds of the country’s total road ...

  4. Orthorhombic BN: A novel superhard sp{sup 3} boron nitride allotrope

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhiguo [College of Physics, Beihua University, Jilin 132013 (China); Lu, Mingchun [Department of Aeronautical Engineering Professional Technology, Jilin Institute of Chemical Technology, Jilin 132102 (China); Zhu, Li; Zhu, Lili; Li, Yadan [College of Physics, Beihua University, Jilin 132013 (China); Zhang, Miao, E-mail: zhangmiaolmc@126.com [College of Physics, Beihua University, Jilin 132013 (China); College of Materials Science and Engineering, National Laboratory of Superhard Materials, Jilin University, Changchun 130012 (China); Li, Quan, E-mail: liquan777@jlu.edu.cn [College of Materials Science and Engineering, National Laboratory of Superhard Materials, Jilin University, Changchun 130012 (China)

    2014-02-07

    Here, a novel superhard orthorhombic allotrope of boron nitride (O-BN) with the space group of Pbam has been predicted using first-principles calculations. Our results revealed that O-BN simultaneously posses incompressible with a high bulk modulus of 397.38 GPa, and superhard properties with a high Vickers hardness of 65 GPa. Further phonon calculations show O-BN structure is dynamically stable. Moreover, it is thermodynamics energetically more preferable than previous proposed BN allotropes and a transparent insulator with an indirect band gap of about 4.85 eV. Our researches represent a significant step toward the exploration of superhard materials.

  5. Bol d'Or success for all-women crew from CERN

    CERN Document Server

    2001-01-01

    The boat 'Mic Mac' and its CERN's all-woman crew (left to right), Christine Theurillat, Ursula Haenger , Paola Catapano, Petra Riedler, and skipper Cristina Morone. Spectacular highlight of the Lake Leman sailing calendar is the annual Bol d'Or race. Held this year on 16 and 17 June, the event attracted nearly 500 teams who competed under extreme weather conditions for the honours. Among the competitors was an all-woman crew from the CERN Yachting Club, sailing their Surprise boat, Mic Mac. The team was not only among the 397 boats to finish, but also the first all-woman crewed single hull boat to cross the line.

  6. Investigation into the Thin Layer Drying Models of Nigerian Popcorn Varieties

    OpenAIRE

    Taiwo ADEMILUYI; E.O. OBOHO; Michael OWUDOGU

    2008-01-01

    Drying kinetics of three popcorn varieties (Pin, Deep and Light yellow) was investigated. The popcorn kernels initially conditioned to 25% moisture content were dried in a bench scale rotary drier to 14% moisture content at various air flow rates (0.83, 1.397, 2.79 m/s) and temperatures (50oC, 60oC, 70oC and 80oC). Falling rate drying period was observed for the three popcorn varieties with Pin popcorn having the highest drying rate. Eight drying models were used to determine the thin layer d...

  7. Dicty_cDB: Contig-U03104-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available membrane-associated antigen (cl... 34 6.5 FN357475_5( FN357475 |pid:none) Schistosoma manso...parum 3D7 chromoso... 35 2.9 A45605( A45605 ;A54517)mature-parasite-infected erythrocyte surfac...80,959 est3= SSB118F ,397,613 Translated Amino Acid sequence ilrfniinskpit*ihfnsilk*nqflv*k*LYIISIIIIMIAITRL...MGLLYGL MGKNNTIYVDLAPKGNKLHDFIADIQELICVSNXX*lki*rknspn**nntkvkkhl*ti yivl*lxqhtikk*knyt Translated Amino Aci...caattttt 23 Database: CSM Posted date: Jun 9, 2004 7:35 PM Number of letters in databas

  8. On the Radiological Character of a Coal-Fired Power Plant at the Town of Çatalağzı, Turkey

    OpenAIRE

    BALDIK, Hüseyin AYTEKIN and Rıdvan

    2008-01-01

    This paper presents a study performed on the radiological character of the Çatalağzı Thermal Power Plant (ÇTPP/ÇATES), on the west Black Sea coast of Turkey. Natural radioactivity distribution of the terrestrial radionuclides 238U, 232Th, and 40K of surface soil samples around the ÇTPP was analyzed. The average radioactivity concentrations for 232Th, 238U, and 40K for soil samples were 39.7, 30.5, and 378.7 Bq kg-1, respectively. 238U and 40K concentrations are lower than the world ...

  9. AcEST: DK954966 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0021_N15 610 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_N15. 5' end seq ... peat protein At5g43190 OS=Ar... 44 6e-04 sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... TESWIEVETLPDIVCRKFTSVCYHNYEHVYCLWHK 350 >sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... thaliana GN=UFO ... PE=1 SV=2 Length = 442 Score = 39.7 bits (91), Exp ...

  10. Mitochondrial DNA sequence evolution in the Arctoidea.

    OpenAIRE

    Zhang, Y P; Ryder, O. A.

    1993-01-01

    Some taxa in the superfamily Arctoidea, such as the giant panda and the lesser panda, have presented puzzles to taxonomists. In the present study, approximately 397 bases of the cytochrome b gene, 364 bases of the 12S rRNA gene, and 74 bases of the tRNA(Thr) and tRNA(Pro) genes from the giant panda, lesser panda, kinkajou, raccoon, coatimundi, and all species of the Ursidae were sequenced. The high transition/transversion ratios in cytochrome b and RNA genes prior to saturation suggest that t...

  11. Prevalencia de obesidad infantil en Cantabria

    OpenAIRE

    Pesquera Cabezas, Raúl

    2010-01-01

    ABSTRACT: The aim of this study was to report the prevalence of obesity and overweight in children aged between 2 to 14 years in Cantabria. We also describe the children grow pattern, the prevalence geographical distribution and the prevalence secular trend between 2002 -2008. The study design was a cross-sectional study (60.015 children) and a longitudinal study (21.397 children). We use the information collected by "The healthy child program" and recoded in the Primary Care history of each ...

  12. Comparison of Soxhlet and Shake Extraction of Polycyclic Aromatic Hydrocarbons from Coal Tar Polluted Soils Sampled in the Field

    DEFF Research Database (Denmark)

    Lindhardt, Bo; Holst, Helle; Christensen, Thomas Højlund

    1994-01-01

    This study compares three extraction methods for PAHs in coal tar polluted soil: 3-times repeated shaking of the soil with dichloromethane-methanol (1:1), Soxhlet extraction with dichloromethane, and Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol. The...... extraction efficiencies were determined for ten selected PAHs in triplicate samples of six soils sampled at former gasworks sites. The samples covered a wide range of PAH concentrations, from 0.6 to 397 mg/kg soil. Soxhlet extraction with dichloromethane followed by Soxhlet extraction with methanol, in...

  13. Male-Biased Autosomal Effect of 16p13.11 Copy Number Variation in Neurodevelopmental Disorders

    OpenAIRE

    Maria Tropeano; Joo Wook Ahn; Dobson, Richard J. B.; Gerome Breen; James Rucker; Abhishek Dixit; Pal, Deb K; Peter McGuffin; Anne Farmer; White, Peter S.; Joris Andrieux; Evangelos Vassos; Caroline Mackie Ogilvie; Sarah Curran; Collier, David A

    2013-01-01

    Copy number variants (CNVs) at chromosome 16p13.11 have been associated with a range of neurodevelopmental disorders including autism, ADHD, intellectual disability and schizophrenia. Significant sex differences in prevalence, course and severity have been described for a number of these conditions but the biological and environmental factors underlying such sex-specific features remain unclear. We tested the burden and the possible sex-biased effect of CNVs at 16p13.11 in a sample of 10,397 ...

  14. Dicty_cDB: Contig-U09104-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 co... 105 2e-30 CP000880_2775( CP000880 |pid:none) Salmonella enterica subsp. a...riz... 100 2e-30 CP001113_124( CP001113 |pid:none) Salmonella enterica subsp. enter... 100 2e-30 CP001083_14...osyl-L-methionine-dependent methylt... 114 8e-35 CP000930_1983( CP000930 |pid:none) Heliobacterium modestical... methylt... 108 6e-32 CP000148_397( CP000148 |pid:none) Geobacter metallireducen...3e-40 AE016830_910( AE016830 |pid:none) Enterococcus faecalis V583, comp... 138 3

  15. Chronique des Archives 2010-2011

    OpenAIRE

    Eichenlaub, Jean-Luc

    2012-01-01

    La Chronique des Archives rendant compte des activités 2009 est parue dans la Revue d’Alsace no136, 2010, p. 391‑397. Le lecteur a pu avoir un aperçu des activités des Archives départementales (Bas‑Rhin, Haut‑Rhin, Territoire de Belfort) et des archives municipales de Belfort, Colmar, Erstein, Guebwiller, Illkirch, Illzach, Ingersheim, Mulhouse, Munster, Saint-Louis, Turckheim, Strasbourg. Il n’y a pas eu de Chronique des Archives complète dans la Revue d’Alsace no137, 2011, mais une page con...

  16. Primal Interior-Point Method for Large Sparse Minimax Optimization

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    2009-01-01

    Roč. 45, č. 5 (2009), s. 841-864. ISSN 0023-5954 R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : unconstrained optimization * large-scale optimization * minimax optimization * nonsmooth optimization * interior-point methods * modified Newton methods * variable metric methods * computational experiments Subject RIV: BA - General Mathematics Impact factor: 0.445, year: 2009 http://dml.cz/handle/10338.dmlcz/140034

  17. Is project management a required competency for the hotel industry

    OpenAIRE

    Harnett, Lloyd John

    2013-01-01

    non-peer-reviewed The hotel industry in Ireland has suffered major turmoil over the last 5 years, and is constantly evolving and reshaping in order to survive (Bacon 2009). The industry comprises of 903 hotels with a total of 60,138 rooms. This is a 35% increase from 2005. That year saw €3.97 Billion in tourism revenue, with this increasing to €4.4 billion in 2007 and dropping to €3.4 billion in 2011 (Ireland 2012). The work of hotel managers involves many projects, from new menu concepts ...

  18. Disposición a la donación voluntaria de sangre en estudiantes de Ciencias de la Salud

    OpenAIRE

    María Galíndez; Stefania Di Pascuale; Harold Guevara; Marcos Hernández

    2008-01-01

    Disposition toward voluntary blood donation of health science students was analyzed in a descriptive study. 397 students answered a validated questionnaire. 76.6% were female, aged 22.45 ± 4.95 years. Disposition to donate blood was 30% for Medical students, and 40.2% for Nursing students (P=0.04). 32.4% were willing to donate blood. 20.7% (Medicine) and 8.1% (Nursing) had been blood donors (P=0.0033), and 7.8% said they would never donate blood. Myths referred: extreme fatigue (30.1%), irrev...

  19. Sociální koheze – teorie a výzkum. Názory české veřejnosti na společenskou soudržnost

    Czech Academy of Sciences Publication Activity Database

    Sedláčková, Markéta; Šafr, Jiří

    Brno : Institut mezioborových studií Brno, 2005, s. 374-397. ISBN 80-902936-7-0. [Mezinárodní sympozium na téma Osobnost člověka a jeho socializace v evropské společnosti. Brno (CZ), 22.09.2005-23.09.2005] R&D Projects: GA MPS(CZ) 1J028/04-DP2 Institutional research plan: CEZ:AV0Z70280505 Keywords : social cohesion * public opinion * interpersonal trust Subject RIV: AO - Sociology, Demography

  20. On using the coherent far IR radiation produced by a charged particle bunch to determine its shape - II Measurement with synchrotron and transition radiation

    International Nuclear Information System (INIS)

    For pt.I see ibid., vol.397, p.221-31, 1997. The coherent radiation spectrum from mm long relativistic electron bunches perturbed in different ways is investigated with a large aperture Michelson spectrometer. From these data we are able to determine the structure and asymmetric shape of the longitudinal electron density of short relativistic electron bunches on a submillimeter length scale by utilizing the Kramers-Kronig analysis technique described previously. Both synchrotron and transition radiation have been used successfully to determine the bunch shape. We further demonstrate how the influence of the LINAC tuning on bunch width and bunch asymmetry can be determined by using this technique. (orig.)

  1. Physical performance parameters during standing up in patients with unilateral and bilateral total knee arthroplasty

    OpenAIRE

    Bakirhan, Serkan; Salih ANGIN; Karatosun, Vasfi; Unver, Bayram; Gunal, Izge

    2012-01-01

    Objective: The aim of this study was to compare quadriceps femoris muscle performance parameters of patients who underwent unilateral and bilateral total knee arthroplasty (TKA). Methods: The study included 80 patients. Thirty-five underwent unilateral primary TKA (35 females; mean age: 67.11±3.97 years) and 45 underwent bilateral primary TKA (2 males, 43 females; mean age: 67.12±7.32 years). Patients were evaluated in terms of performance parameters including stand-up time, rising index,...

  2. Group acceptance and emotional competence of preadolescent children

    Directory of Open Access Journals (Sweden)

    Petrović Jelica

    2007-01-01

    Full Text Available This study examines contribution of emotional competence on socially competent behavior of preadolescents. The following emotional competencies were registered in 397 children: emotion recognition, emotional regulation, empathy and style of coping with aversive emotions. Discriminant analysis was conducted in order to identify emotional competencies that differentiate among the groups of participants with different levels of social preference. The data showed that groups of popular children, rejected children, and children of average sociometric status significantly differ with respect to their emotional competence. Children rejected by their peers displayed the lowest level of emotional competence. .

  3. Measurement of observables sensitive to coherence effects in hadronic Z decays with the OPAL detector at LEP

    International Nuclear Information System (INIS)

    A study of QCD coherence is presented based on a sample of about 397,000 e+e- hadronic annihilation events collected at √(s) = 91 GeV with the OPAL detector at LEP. The study is based on four recently proposed observables that are sensitive to coherence effects in the perturbative regime. The measurement of these observables is presented, along with a comparison with the predictions of different parton shower models. The models include both conventional parton shower models and dipole antenna models. Different ordering variables are used to investigate their influence on the predictions. (orig.)

  4. Measurement of observables sensitive to coherence effects in hadronic Z decays with the OPAL detector at LEP

    International Nuclear Information System (INIS)

    A study of QCD coherence is presented based on a sample of about 397,000 e+e- hadronic annihilation events collected at √s=91 GeV with the OPAL detector at LEP. The study is based on four recently proposed observables that are sensitive to coherence effects in the perturbative regime. The measurement of these observables is presented, along with a comparison with the predictions of different parton shower models. The models include both conventional parton shower models and dipole antenna models. Different ordering variables are used to investigate their influence on the predictions

  5. Mental health predicts better academic outcomes: A longitudinal study of elementary school students in Chile

    OpenAIRE

    Murphy, J. Michael; Guzmán, Javier; McCarthy, Alyssa; Squicciarini, Ana María; George, Myriam; Canenguez, Katia; DUNN, ERIN C.; Baer, Lee; Simonsohn, Ariela; Smoller, Jordan W; Jellinek, Michael

    2015-01-01

    The world’s largest school-based mental health program, Habilidades para la Vida [Skills for Life, SFL], has been operating at a national scale in Chile for fifteen years. SFL’s activities include using standardized measures to screen elementary school students and providing preventive workshops to students at risk for mental health problems. This paper used SFL’s data on 37,397 students who were in first grade in 2009 and third grade in 2011 to ascertain whether first grade mental health pre...

  6. Thrombin promotes platelet-mediated melanoma cell adhesion to endothelial cells under flow conditions: role of platelet glycoproteins P-selectin and GPIIb-IIIA.

    OpenAIRE

    Dardik, R.; Savion, N; Kaufmann, Y; D. Varon

    1998-01-01

    We investigated the role of platelets in human melanoma cell (line 397) interaction with vascular endothelial cells (ECs) under flow conditions. The ability of the tumour cells to adhere to the EC monolayer was significantly reduced by application of flow at a shear rate of 250 s(-1). A 2.2-fold increase in tumour cell adhesion to ECs under flow was observed upon addition of thrombin receptor agonist peptide (TRAP)-activated platelets but not resting platelets. A similar increase (2.5-fold) i...

  7. AcEST: DK949401 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0005_O08 590 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_O08. 5' end seq ... DL 60 Query: 397 TKALEIEPVDYKKVDAYVHQFKGSSSSIGAQRIKAVC VDFRAYAEAENREGCRQALQQIK 576 + +L+ + VD+KKVD +VHQ KG ... MAR 64 Query: 403 ALEIE-PVDYKKVDAYVHQFKGSSSSIGAQRIKAVC VDFRAYAEAENREGCRQALQQIKQ 579 AL+ VD+ +V A VHQ KGSSS ... E 60 Query: 394 LTKALEIEPVDYKKVDAYVHQFKGSSSSIGAQRIKAVC VDFRAYAEAENREGCRQALQQI 573 + LE V++ KVDAYVHQ KGSS+S ... MSI 65 Query: 403 ALEI-EPVDYKKVDAYVHQFKGSSSSIGAQRIKAVC VDFRAYAEAENREGCRQALQQIKQ 579 +LE + VD+K+VD+ VHQ KGS ...

  8. A cognitive-behavioural therapeutic program for patients with obesity and binge eating disorder: short- and long term follow-up data of a prospective study

    OpenAIRE

    Vanderlinden, Johan; Adriaensen, An; Vancampfort, Davy; Pieters, Guido; Probst, Michel; Vansteelandt, Kristof

    2012-01-01

    The goal of this study is to investigate the efficacy of a manualized cognitive-behavioral therapeutic (CBT) approach for patients with obesity and binge eating disorder (BED) on the short and longer term. A prospective study without a control group consisting of three measurements (a baseline measurement and two follow-up assessments up to 5 years after the start of the CBT treatment) was used. A total of 56 patients with obesity and BED (age = 39.7 ± 10-9 years; body mass index [BMI] = 38.5...

  9. A New Overview of The Trilinos Project

    Directory of Open Access Journals (Sweden)

    Michael A. Heroux

    2012-01-01

    Full Text Available Since An Overview of the Trilinos Project [ACM Trans. Math. Softw. 31(3 (2005, 397–423] was published in 2005, Trilinos has grown significantly. It now supports the development of a broad collection of libraries for scalable computational science and engineering applications, and a full-featured software infrastructure for rigorous lean/agile software engineering. This growth has created significant opportunities and challenges. This paper focuses on some of the most notable changes to the Trilinos project in the last few years. At the time of the writing of this article, the current release version of Trilinos was 10.12.2.

  10. AcEST: DK948226 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0002_M04 693 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_M04. 5' end seq ... G VG+ + Sbjct: 91 KNRMIVEARNVFELMPER----NVVSWTAMVKGYM QEGMVGEAE 130 Score = 39.7 bits (91), Expect = 0.01 ... bjct: 77 RNVVSWNGLVSGYIKNRMIVEARNVFELMPERNVVSWTAMVKGYM QEGMVGEAESLFWRM 136 Query: 588 QQQ 596 ++ Sbjct: 13 ... F + N V+W M GG + Sbjct: 95 IVEARNVFELMPERNVVSWTAMVKGYM QEGMVGEAESLFWRMPERNEVSWTVMFGGLIDD 154 Query: 549 GR ... FD + N+V+W ++ GYV +G+ + A F M Sbjct: 77 RNIISWNGLVSGYM KNGEIDEARKVFDLMPERNVVSWTALVKGYVHNGKVDVAESLFWKM 136 ...

  11. Prevalência e fatores associados à obesidade abdominal em adolescentes Prevalencia y factores asociados a la obesidad abdominal en adolescentes Prevalence of abdominal obesity and associated factors in adolescents

    OpenAIRE

    Marcelo Romanzini; Andreia Pelegrini; Edio Luiz Petroski

    2011-01-01

    OBJETIVO: Verificar a prevalência de obesidade abdominal e sua associação com fatores demográficos, econômicos e estilo de vida em adolescentes. MÉTODOS: Estudo transversal conduzido em 644 adolescentes (397 do sexo feminino e 247 do masculino), de 15 a 19 anos. Foram coletadas informações demográficas (sexo e idade), econômicas (nível econômico) e comportamentais (atividade física, alimentação, tabagismo e etilismo). A obesidade abdominal (desfecho) foi determinada com base em pontos de cort...

  12. MIMO-OFDM WDM PON with DM-VCSEL for femtocells application

    OpenAIRE

    Binti Othman, Maisara; Deng, Lei; Pang, Xiaodan; Caminos, J. (José); Kozuch, W.; Prince, Kamau; Yu, Xianbin; Jensen, Jesper Bevensee; Tafur Monroy, Idelfonso

    2011-01-01

    We report on experimental demonstration of 2x2 MIMO-OFDM 5.6-GHz radio over fiber signaling over 20 km WDM-PON with directly modulated (DM) VCSELs for femtocells application. MIMO-OFDM algorithms effectively compensate for impairments in the wireless link. Error-free signal demodulation of 64 subcarrier 4-QAM signals modulated at 198.5 Mb/s net data rate is achieved after fiber and 2 m indoor wireless transmission. We report BER of 7x10−3 at the receiver for 16-QAM signals modulated at 397 Mb...

  13. Origine des tétrapodes, scénarios, théories erronées et évènements évolutifs

    OpenAIRE

    Blieck, Alain

    2010-01-01

    En accès libre : http://iris.univ-lille1.fr/handle/1908/3300 International audience A renewal of interest has been led to the problem of origin of tetrapods for several years. It is concerned, among other topics, with the age of their oldest representative and the life environment of their Devonian species. After the most recent discoveries (Eifelian tracks and traces from Poland), it seems that we can date the most ancient tetrapod at ca. – 397 My, or even older when taking into accoun...

  14. N2(A3u+) detection in N2/O2 atmospheric pressure surface dielectric barrier discharge by OODR-LIF

    Czech Academy of Sciences Publication Activity Database

    Ambrico, P. F.; DeBenedictis, S.; Dilecce, G.; Šimek, Milan

    Praha, 2006 - (Cacciatore, M.; DeBenedictis, S.; Ambrico, P.; Rutigliano, M.). s. 397-398 ISBN 2-914771-38-X. [The 18th European Conference on Atomic and Molecular Physics of Ionised Gases (ESCAMPIG XVIII )/18th./. 12.7.2006-16.7.2006, Lecce, Italy] R&D Projects: GA AV ČR(CZ) IAA1043403 Institutional research plan: CEZ:AV0Z20430508 Keywords : DBD * streamer * LIF * OODR-LIF * emission * nitrogen Subject RIV: BL - Plasma and Gas Discharge Physics

  15. Reaction of cobalt molybdophosphate with alcoholic solutions of tetraethoxysilane and oxozirconium(IV) chloride

    International Nuclear Information System (INIS)

    Interaction of cobalt molybdophosphate with alcohol solutions of tetraethoxysilane and oxozirconium chloride was studied using the methods of IR spectroscopy and thermal analysis with an aim of ascertaining the potentiality of the reagents application for production of thermochrome materials. It was ascertained that as a results of interaction between cobalt molybdophosphate and tetraethoxysilane solution the heteropolyanion [PMo12O40]3- was transformed into lacunar form [HxPMo11O39]7-x. The hydrolysis processes occurring in compositions with oxozirconium chloride does not permit stabilizing the structure of the heteropolycompound responsible for thermochrome transitions

  16. Some remarks in regard to the fatigue analysis of steel plate girders with breathing webs

    Czech Academy of Sciences Publication Activity Database

    Maquoi, R.; Škaloud, Miroslav

    Praha : České Vysoké Učení technické v Praze, 2003 - (Studnička, J.), s. 397-402 ISBN 80-01-02747-3. [Česko-slovenská konference s mezinárodní účastí - Ocelové konstrukce a mosty /20./. Praha (CZ), 17.09.2003-20.09.2003] R&D Projects: GA AV ČR IAA2071102 Institutional research plan: CEZ:AV0Z2071913 Keywords : steel plate girders * fatigue limit state * fatigue crack Subject RIV: JM - Building Engineering

  17. AcEST: BP913572 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_G04 459 Adiantum capillus-veneris mRNA. clone: YMU001_000031_G04. BP913572 CL397Co ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptide-processing enzyme OS=Aeromonas salmonicida ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptid... 30 3.8 sp|A2T195|LEP4_AERS4 Type 4 prepi ...

  18. Long-term creep behaviour of 9-12

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Svoboda, Milan; Kloc, Luboš; Buršík, Jiří; Kroupa, Aleš

    Sheffield : EMAS Publishing Ltd., 2003 - (Penny, R.), s. 379-397 ISBN 0 9543454 1 X. [International Colloquium on Asset Management of Aged Plant and Materials :CAPE 2003 /7./. Cape Town (ZA), 07.04.2003-11.04.2003] R&D Projects: GA AV ČR IPP1050128; GA ČR GA106/02/0608; GA AV ČR IBS2041001; GA MŠk OC 522.40 Institutional research plan: CEZ:AV0Z2041904 Keywords : creep strength * high temperature steelsc * creep life Subject RIV: JG - Metallurgy

  19. Induced Proton Polarization for pi0 Electroproduction at Q2 = 0.126 GeV2/c2 Around the Delta(1232) Resonance

    Energy Technology Data Exchange (ETDEWEB)

    Glen Warren; Ricardo Alarcon; Christopher Armstrong; Burin Asavapibhop; David Barkhuff; William Bertozzi; Volker Burkert; J. Chen; Jian-Ping Chen; Joseph Comfort; Daniel Dale; George Dodson; S. Dolfini; K. Dow; Martin Epstein; Manouchehr Farkhondeh; John Finn; Shalev Gilad; Ralf Gothe; Xiaodong Jiang; Mark Jones; Kyungseon Joo; A. Karabarbounis; James Kelly; Stanley Kowalski; C. Kunz; D. Liu; R.W. Lourie; Richard Madey; Demetrius Margaziotis; Pete Markowitz; Justin McIntyre; C. Mertz; Brian Milbrath; Rory Miskimen; Joseph Mitchell; S. Mukhopadhyay; Costas Papanicolas; Charles Perdrisat; Vina Punjabi; Liming Qin; Paul Rutt; Adam Sarty; Jeffrey Shaw; S.B. Soong; D. Tieger; Christoph Tschalaer; William Turchinetz; Paul Ulmer; Scott Van Verst; C. Vellidis; Lawrence Weinstein; Steven Williamson; Rhett Woo; Alaen Young

    1998-12-01

    We present a measurement of the induced proton polarization P{sub n} in {pi}{sup 0} electroproduction on the proton around the {Delta} resonance. The measurement was made at a central invariant mass and a squared four-momentum transfer of W = 1231 MeV and Q{sup 2} = 0.126 GeV{sup 2}/c{sup 2}, respectively. We measured a large induced polarization, P{sub n} = -0.397 {+-} 0.055 {+-} 0.009. The data suggest that the scalar background is larger than expected from a recent effective Hamiltonian model.

  20. Induced Proton Polarization for pi0 Electroproduction at Q2 = 0.126 GeV2/c2 Around the Delta(1232) Resonance

    International Nuclear Information System (INIS)

    We present a measurement of the induced proton polarization Pn in π0 electroproduction on the proton around the Δ resonance. The measurement was made at a central invariant mass and a squared four-momentum transfer of W = 1231 MeV and Q2 = 0.126 GeV2/c2, respectively. We measured a large induced polarization, Pn = -0.397 ± 0.055 ± 0.009. The data suggest that the scalar background is larger than expected from a recent effective Hamiltonian model

  1. An integrated procedure for the structural design of a composite rotor-hydrofoil of a Water Current Turbine (WCT)

    OpenAIRE

    Oller Aramayo, Sergio A.; Liz G. Nallim; Oller Martínez, Sergio Horacio

    2013-01-01

    This paper shows an integrated structural design optimization of a composite rotor-hydrofoil of a water current turbine by means the finite elements method (FEM), using a Serial/Parallel mixing theory (Rastellini et al. Comput. Struct. 86:879–896, 2008, Martinez et al., 2007, Martinez and Oller Arch. Comput. Methods. 16(4):357–397, 2009, Martinez et al. Compos. Part B Eng. 42(2011):134–144, 2010) coupled with a fluid-dynamic formulation and multi-objective optimization algorithm (Gen and Chen...

  2. Sediment pathways and emergence of Himalayan source material in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Krishna, K.S.; Ismaiel, M.; Srinivas, K.; Gopala Rao, D.; Mishra, J.; Saha, D.

    Station, Texas, 1990, pp. 397– 414. 7. Amano, K. and Taira, A., Two-phase uplift of Higher Himalayas since 17 Ma. Geology, 1992, 20, 391–394. 8. France-Lanord, C., Derry, L. and Michard, A., Evolution of the Himalaya since Miocene time: isotopic... the Cretaceous. J. Geophys. Res., 1997, 102, 17,747–17,768. 11. Michael, L. and Krishna, K. S., Dating of the 85E Ridge (north- eastern Indian Ocean) using marine magnetic anomalies. Curr. Sci., 2011, 100, 1314–1322. 12. France-Lanord, C., Spiess, V., Klaus...

  3. Chemistry of Carbon Rich Star IRAS 15194–5115

    Indian Academy of Sciences (India)

    A. Ali

    2006-12-01

    We have constructed two gas-phase models to study the chemistry of circumstellar envelope surrounding the carbon-rich variable star IRAS 15194–5115. The network used consists of 3893 reactions involving 397 gas-phase species. The derived fractional abundances for many molecules are in excellent agreement with values obtained from observations. The predicted column densities from the two models go well with the observed values of carbon star IRC + 10216. The dominant formation routes for three groups of species are discussed through the inner and outer envelopes.

  4. Free-roaming dogs and cats in central Italy: public perceptions of the problem.

    Science.gov (United States)

    Slater, Margaret R; Di Nardo, Antonio; Pediconi, Ombretta; Villa, Paolo Dalla; Candeloro, Luca; Alessandrini, Barbara; Del Papa, Stefania

    2008-04-17

    A cross-sectional telephone survey of randomly selected households examined the extent and types of problems associated with free-roaming dogs and cats in the Teramo province of Italy. The households were sampled randomly within each municipality; municipalities were combined into coastal, central hills and mountain regions for analysis. The survey was conducted in May and June of 2004 with a response rate of 74% (397/536). Ninety percent of respondents (N=356) believed that free-roaming dogs and cats were a problem. They were most commonly concerned about personal safety, followed by animal welfare, public health and environmental sanitation. Sixty-nine percent of respondents (274) actually saw free-roaming dogs or cats where they live. While dogs were most commonly seen, cats were seen in greater numbers. Overall, 10% (39/297) and 5% (21/397) of respondents cared for free-roaming cats and dogs, respectively. Two-thirds of the respondents (251/397) believed that animals were abandoned because the owners lost interest. About 2/3 of respondents (251/397) reported that the community government should have the responsibility for dealing with free-roaming dogs and cats. The respondents supported the idea of building more shelters and controlling the birth rate as control measures rather than euthanizing dogs and cats. The results suggest that free-roaming dogs and cats are a very common sight in this part of Italy with substantial concerns by the residents. However, concerns about the animals' welfare were clearly raised, supporting the laws that make it illegal to euthanize a healthy dog or cat in Italy. Using the information from this study, research on the underlying causes of abandonment of dogs and cats or failing to sterilize them should be undertaken to begin to address this problem. Further, national and regional funding must be provided to support existing laws which should help protect and eventually decrease the numbers of free-roaming and homeless dogs and

  5. Redefinition of cell size classification of phytoplankton – a potential tool for improving the quality and assurance of data interpretation

    OpenAIRE

    L. IGNATIADES

    2014-01-01

    To date, phytoplankton cell size classification is based on linear metrics (nano: 2-20 μm; micro: 20-200 μm; macro: >200 μm) although three-dimensional metrics are used for cell or body size descriptions of all terrestrial and aquatic organisms. This study proposes a redefinition of phytoplankton size classification expressed in terms of cell volume (μm3) metrics by analyzing statistically a data set of 397 species from three major groups of eukaryotic taxa (diatoms, dinoflagellates, cocc...

  6. Cytogenetic Analysis of 584 Cases with Clinical Diagnosis of Down Syndrome

    OpenAIRE

    M. Nail Alp; Diclehan Oral; Turgay Budak

    2007-01-01

    The cytogenetic types of Down syndrome, which is a widespread disease and the most common cause of mental retardation among live-borne babies, vary according to the risk of recurrance and has been a guide for the genetic counseling. This study was conducted between January 1996 and December 2006 in our department. The study included 584 patients with clinical diagnosis of Down syndrome. There were 232 (39.7%) female and 352 (60.3%) male patients. The aim of the study was to investigate the...

  7. Determining Recoverable and Irrecoverable Contributions to Accumulated Strain in a NiTiPd High-Temperature Shape Memory Alloy During Thermomechanical Cycling

    Science.gov (United States)

    Monroe, J. A.; Karaman, I.; Lagoudas, D. C.; Bigelow, G.; Noebe, R. D.; Padula, S., II

    2011-01-01

    When Ni(29.5)Ti(50.5)Pd30 shape memory alloy is thermally cycled under stress, significant strain can accumulate due to elasticity, remnant oriented martensite and plasticity. The strain due to remnant martensite can be recovered by further thermal cycling under 0 MPa until the original transformation-induced volume change and martensite coefficient of thermal expansion are obtained. Using this technique, it was determined that the 8.15% total accumulated strain after cycling under 200 MPa consisted of 0.38%, 3.97% and 3.87% for elasticity, remnant oriented martensite and creep/plasticity, respectively.

  8. PENGOLAHAN LIMBAH LOGAM BERAT INDUSTRI TEKSTIL MENGGUNAKAN FOTOKATALIS TiO2/ARANG AKTIF

    OpenAIRE

    Kapti Riyani; Tien Setyaningtyas; Roy Andreas

    2008-01-01

    Study about the use of active charcoal rice straws (AAJP) was done in order to decrease heavy metal ion on textile waste water by using photocatalyst AAJP/TiO2. Rice straws were gained from the Banyumas Regency and samples textile waste water from one of textile industry in Pemalang. This study was begun by the making of active charcoal from the rice straws, and then the modification of photocatalyst AAJP/TiO2 was done with the comparison 1:99, 2:98, 3:97, 4:96, 5:95. The test of heavy metal ...

  9. Ablation Plume Induced by Laser Euv Radiation

    Czech Academy of Sciences Publication Activity Database

    Frolov, Oleksandr; Koláček, Karel; Schmidt, Jiří; Štraus, Jaroslav

    Dordrecht: Springer International Publishing, 2015 - (Rocca, J.; Menoni, C.; Marconi, M.), s. 397-403. (Springer Proceedings in Physics. 169). ISBN 978-3-319-19521-6. [International Conference on X-Ray Laser s/14./. Fort Collins, Colorado (US), 26.05.2014-30.05.2014] R&D Projects: GA ČR(CZ) GA14-29772S; GA MŠk(CZ) LG13029 Institutional support: RVO:61389021 Keywords : EUV laser * laser ablation * plume * Au * Al * Si * Cu * energy measurements Subject RIV: BL - Plasma and Gas Discharge Physics http://link.springer.com/chapter/10.1007/978-3-319-19521-6_52

  10. Analysis of surface powered haulage accidents, January 1990--July 1996

    Energy Technology Data Exchange (ETDEWEB)

    Fesak, G.M.; Breland, R.M.; Spadaro, J. [Dept. of Labor, Arlington, VA (United States)

    1996-12-31

    This report addresses surface haulage accidents that occurred between January 1990 and July 1996 involving haulage trucks (including over-the-road trucks), front-end-loaders, scrapers, utility trucks, water trucks, and other mobile haulage equipment. The study includes quarries, open pits and surface coal mines utilizing self-propelled mobile equipment to transport personnel, supplies, rock, overburden material, ore, mine waste, or coal for processing. A total of 4,397 accidents were considered. This report summarizes the major factors that led to the accidents and recommends accident prevention methods to reduce the frequency of these accidents.

  11. Dicty_cDB: SSF664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF664 (Link to dictyBase) - - - Contig-U15612-1 SSF664E (Link... to Original site) - - - - - - SSF664E 397 Show SSF664 Library SS (Link to library) Clone ID SSF664 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSF6-C/SSF664Q.Seq.d/ Representative seq. ID SSF66...4E (Link to Original site) Representative DNA sequence >SSF664 (SSF664Q) /CSM/SS/SSF6-C/SSF664Q.Seq.d/ ATCAC...ce update 1997.11. 6 Translated Amino Acid sequence ITMSSSEAVTREYTINLHKRLYGTTFKDR

  12. Using the Job-Demands-Resources model to predict turnover in the information technology workforce – General effects and gender

    OpenAIRE

    Peter Hoonakker; Pascale Carayon; Christian Korunka

    2014-01-01

    High employee turnover has always been a major issue for Information Technology (IT). In particular, turnover of women is very high. In this study, we used the Job Demand/Resources (JD-R) model to examine the relationship between job demands and job resources, stress/burnout and job satisfaction/commitment, and turnover intention and tested the model for gender differences. Data were collected in five IT companies. A sample of 624 respondents (return rate: 56%; 54% males; mean age: 39.7 year...

  13. Pressure Induced Ferromagnetism in Cubic Perovskite SrFeO3 and BaFeO3

    OpenAIRE

    Li, Zhi; Iitaka, Toshiaki; Tohyama, Takami

    2012-01-01

    The spin order in cubic perovskite SrFeO3 and BaFeO3 under high pressure is studied by density functional theory (DFT) calculation with local spin density approximation plus Hubbard U (LSDA+U). At ambient pressure, A-type and G-type helical spin orders are almost degenerate in BaFeO3 whose lattice constant is 3.97{\\AA} . When the lattice constant is reduced to 3.85 {\\AA} which is same as the lattice constant of SrFeO3 at ambient pressure, G-type helical spin order becomes stable, being consis...

  14. Dicty_cDB: Contig-U09865-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ome 8, clone RP24-180I19, com... 44 6.8 1 ( U14951 ) Schizosaccharomyces pombe polyA+ RNA export (rae1) ...... 44 6.8 1 ( CU329671 ) Schizosaccharomyces pombe chromosome II. 44 6.8 1 ( EA397... CU928176_40( CU928176 |pid:none) Zygosaccharomyces rouxii strain C... 56 9e-07 A...... 53 7e-06 AM989989_35( AM989989 |pid:none) Zygosaccharomyces rouxii strain C.....anize... 50 8e-05 CU928175_123( CU928175 |pid:none) Zygosaccharomyces rouxii strain ... 50 8e-05 ( P62883 )

  15. Vespignani, Giorgio, Iппoδρoμoς. Il circo di Costantinopoli nuova Roma dalla realtà alla storiografia, Fondazione Centro Italiano di Studi sull"Alto Medioevo, Spoleto, 2010, 303 páginas. ISBN: 978 88-7988-197-5

    OpenAIRE

    Jiménez Sánchez, Juan Antonio

    2010-01-01

    "El Circo Máximo es su templo, su hogar, su asamblea y la esperanza de todos sus deseos" (AmmiAnvs mArc., Res gest., XXVIII, 4, 29: eisque templum et habitaculum et contio et cupitorum spes omnis Circus est maximus). De este modo describió el historiador Amiano Marcelino, hacia el 382/397, la pasión que la plebe de Roma sentía hacia los espectáculos, especialmente hacia los ludi circenses. Se trata de una afición que se fue incrementando a lo largo de toda la historia del Imperio Romano, hast...

  16. Statistické principy klinických studií

    Czech Academy of Sciences Publication Activity Database

    Valenta, Zdeněk

    Praha: Portál, 2014 - (Hendl, J.), s. 377-397 ISBN 978-80-262-0700-9 Institutional support: RVO:67985807 Keywords : randomizovaný kontrolovaný klinický pokus * vstupní kritéria * primární a sekundární cíle * zaslepení pokusu * etické problémy * typy plánuů výzkumu * fáze klinických pokusů Subject RIV: BB - Applied Statistics, Operational Research

  17. Organic Reference Materials for Hydrogen, Carbon, and Nitrogen Stable Isotope-Ratio Measurements: Caffeines, n-Alkanes, Fatty Acid Methyl Esters, Glycines, L-Valines, Polyethylenes, and Oils

    OpenAIRE

    Schimmelmann, Arndt; Qi, Haiping; Coplen, Tyler B.; Brand, Willi A.; Fong, Jon; Meier-Augenstein, Wolfram; Kemp, Helen F.; Toman, Blaza; Ackermann, Annika; Assonov, Sergey; Aerts-Bijma, Anita T.; Brejcha, Ramona; Chikaraishi, Yoshito; Darwish, Tamim; Elsner, Martin

    2016-01-01

    An international project developed, quality-tested, and determined isotope−δ values of 19 new organic reference materials (RMs) for hydrogen, carbon, and nitrogen stable isotope-ratio measurements, in addition to analyzing pre-existing RMs NBS 22 (oil), IAEA-CH-7 (polyethylene foil), and IAEA-600 (caffeine). These new RMs enable users to normalize measurements of samples to isotope−δ scales. The RMs span a range of δ^2H_(VSMOW-SLAP) values from −210.8 to +397.0 mUr or ‰, for δ^(13)C_(VPDB-LSV...

  18. HIV Risk Perception, Sexual Behavior, and HIV Prevalence among Men-Who-Have-Sex-with-Men at a Community-Based Voluntary Counseling and Testing Center in Kuala Lumpur, Malaysia

    OpenAIRE

    Kwee Choy Koh; Lit Sin Yong

    2014-01-01

    We describe the HIV risk perception, sexual behavior, and HIV prevalence among 423 men-who-have-sex-with-men (MSM) clients who received voluntary counseling and testing (VCT) services at a community-based center in Kuala Lumpur, Malaysia. The mean age was 29 years old. One hundred one (23.9%) clients rated themselves as low risk, 118 (27.9%) as medium risk, 36 (8.5%) as high risk, and 168 (39.7%) were unsure of their risk. Twenty-four (9.4%) clients tested HIV positive (4 (4%) low risk, 9 (7....

  19. Acute Mesenteric Venous Thrombosis with a Vaginal Contraceptive Ring

    Directory of Open Access Journals (Sweden)

    Wesley Eilbert

    2014-07-01

    Full Text Available Mesenteric venous thrombosis is a rare cause of abdominal pain, which if left untreated may result in bowel infarction, peritonitis and death. The majority of patients with this illness have a recognizable, predisposing prothrombotic condition. Oral contraceptives have been identified as a predisposing factor for mesenteric venous thrombosis in reproductive-aged women. In the last fifteen years new methods of hormonal birth control have been introduced, including a transdermal patch and an intravaginal ring. In this report, we describe a case of mesenteric venous thrombosis in a young woman caused by a vaginal contraceptive ring. [West J Emerg Med. 2014;15(4:395-397.

  20. AcEST: DK955458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_C10 559 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_C10. 5' end seq ... , Gaps = 2/70 (2%) Frame = +2 Query: 356 KPGVR-TLNCRAE L-EWLDHLMLAVGVGLPCTVMECGDVVYRSTLPRSNALNITPPGVLL 529 ... Gaps = 9/76 (11%) Frame = +2 Query: 356 KPGVRT-LNCRAE LEWLDHLMLAVG------VGLPCTVMECGDVVYRSTLPRS--NALNI 508 ... +PG R + RA E ++D L V + PC VM+CGD+VYRSTL S N Sbjct: 33 RPGQRRGVP ... SSNPCKNYERLRRLAKSWVEGEGVSLRKAVDSKAYETLHGVMKPGVRTLNCRAE LE 397 +R++ P +YE LRR A W E EG A + T G +PGV RAE ... E S ...

  1. Pace studying worldwide coke production

    International Nuclear Information System (INIS)

    Pace Consultants Inc., Houston, has started a multiclient study of world-wide petroleum coke production, examining environmental initiatives and eventually forecasting prices of fuel grade coke. Pace expects coker expansions, increased operating severity, and reduced cycle times to boost coke supply to more than 50 million metric tons/year in 2000, compared with 39.7 million metric tons in 1992. Increased supply and tightened environmental rules in countries consuming large amounts of petroleum coke will be the main factors affecting coke markets. The paper discusses coke quality and the Japanese market

  2. Association Between Diagnosed Diabetes and Self-Reported Cancer Among U.S. Adults

    OpenAIRE

    Li, Chaoyang; Balluz, Lina S; Ford, Earl S.; Okoro, Catherine A; Tsai, James; Zhao, Guixiang

    2011-01-01

    OBJECTIVE To assess the association between diagnosed diabetes and self-reported cancer among U.S. adults. RESEARCH DESIGN AND METHODS We analyzed data for 397,783 adults who participated in the 2009 Behavioral Risk Factor Surveillance System and had valid data on diabetes and cancer. RESULTS After adjustment for potential confounders, diabetic men had higher adjusted prevalence ratios for cancers of the prostate (1.1 [95% CI 1.0–1.3]), colon (1.3 [1.0–1.7]), pancreas (4.6 [1.8–11.7]), rectum...

  3. Latent and Asymptomatic Toxocara Infection among Young Population in Northwest Iran: The Necessity of Informing People as a Potential Health Risk

    OpenAIRE

    Tina Momeni; Mahmoud Mahami-Oskouei; Esmaeil Fallah; Abdolrasoul Safaiyan; Leyla Mahami-Oskouei

    2016-01-01

    Objectives. This study was designed to determine the frequency of anti-Toxocara antibodies in youngsters aging from 2 to 20 years in northwest Iran. Materials and Methods. 397 samples were taken randomly almost equally from four locations in Urmia, west Azerbaijan, during August 2014 to September 2015. Anti-Toxocara IgG antibody assays were done on sera by using ELISA kit (IBL, Germany). In order to prevent cross-reaction, the samples of the patients who are infected with other parasites in s...

  4. Schmallenberg virus in Germany 2011–2014: searching for the vectors

    OpenAIRE

    Kameke, Daniela; Werner, Doreen; Hoffmann, Bernd; Lutz, Walburga; Kampen, Helge

    2015-01-01

    Following the emergence of Schmallenberg virus (SBV) in 2011, 21,397 culicoid biting midges (Diptera: Ceratopogonidae) from targeted and non-targeted sampling activities carried out during the summer months of 2011 to 2013 and in late 2014 in various regions in Germany were analyzed for the virus by real-time RT-PCR. While no SBV was found in biting midges collected during 2011 and 2013, 2 out of 334 pools including 20 and 22 non-engorged females of the Obsoletus complex sampled in 2012 teste...

  5. Algorithm 896: LSA: Algorithms for Large-Scale Optimization

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    2009-01-01

    Roč. 36, č. 3 (2009), 16-1-16-29. ISSN 0098-3500 R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : algorithms * design * large-scale optimization * large-scale nonsmooth optimization * large-scale nonlinear least squares * large-scale nonlinear minimax * large-scale systems of nonlinear equations * sparse problems * partially separable problems * limited-memory methods * discrete Newton methods * quasi-Newton methods * primal interior-point methods Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.904, year: 2009

  6. Development of a Progressive Failure Finite Element Analysis For a Braided Composite Fuselage Frame

    OpenAIRE

    Hart, Daniel Constantine

    2002-01-01

    Short, J-section columns fabricated from a textile composite are tested in axial compression to study the modes of failure with and without local buckling occuring.The textile preform architecture is a 2x2, 2-D triaxial braid with a yarn layup of [0 deg 18k/+-64 deg 6k] 39.7% axial. The preform was resin transfer molded with 3M PR500 epoxy resin. Finite element analyses (FEA) of the test specimens are conducted to assess intra- and inter- laminar progressive failure models. These progressive...

  7. Fatores de risco para doença diarréica no lactente: um estudo caso-controle

    OpenAIRE

    Silva Gisélia Alves Pontes da; Lira Pedro I. C.; Lima Marilia de Carvalho

    2004-01-01

    O objetivo deste estudo foi identificar os fatores de risco associados à presença de episódios diarréicos em lactentes menores de seis meses, residentes na Zona da Mata Meridional do Estado de Pernambuco, Brasil. O desenho do estudo foi do tipo caso-controle, aninhado numa coorte. Foi estudado um total de 397 crianças, sendo 239 casos e 158 controles (1,5:1). Foi calculado o odds ratio(OR), intervalo de confiança (IC) de 95%, e realizada análise de regressão logística para identificar fatores...

  8. IDENTITIES INVOLVING RATIONAL SUMS BY INVERSION AND PARTIAL FRACTION DECOMPOSITION

    Directory of Open Access Journals (Sweden)

    Helmut Prodinger

    2008-03-01

    Full Text Available Identities appearing recentlyin: {sc J. L. D'{i}az-Barrero, J. Gibergans-B'agu-ena, P. G. Popescu:}{it Some identities involving rational sums}. Appl. Anal. Discrete Math., {f 1} (2007, 397--402, aretreated by inverting them; the resulting sums areevaluated using partial fraction decomposition, following{sc Wenchang Chu:} {it A binomial coefficient identity associated with {B}eukers' conjectureon {A}p'ery numbers.} Electron. J. Combin., {f 11} (1: Note 15, 3 pp. (electronic, 2004.This approach produces a general formula, not only special cases.

  9. Fish oil supplementation during pregnancy and offspring risk of attention deficit/hyperactivity disorder and depression

    DEFF Research Database (Denmark)

    Strøm, Marin; Maslova, E.; Hansen, S.;

    2013-01-01

    . Objective: To examine the effect of fish oil supplementation in pregnancy on offspring risk of attention deficit/ hyperactivity disorder (ADHD) and depression. Methods: We used data from 397 and 654 singleton offspring of mothers who were randomized to fish oil (providing 1 g/day of DHA) or olive oil during...... of 14–20. However, the results regarding ADHD point in the direction of a beneficial effect. The next step will be to pool the two trials in a random effects model to test this in a population with better statistical power....

  10. Effects of Financial Training on Financial Performance of Schools in Kenya: a survey of Administrators of Secondary Schools in Trans-Nzoia County

    OpenAIRE

    Humphrey Nabiswa Chetambe; Maurice Sakwa

    2013-01-01

    The ever increasing cost of education to Governments and to citizens calls for effective management of school resources by administrators. When the Government of Kenya (GOK) introduced free secondary education, the national budgetary allocation for the program was between Ksh.25 billion and Ksh.39.7 billion in the financial year 2007/08 and this figure was projected to increase to between Ksh.28.3 billion and Ksh.74.3 billion in 2011 due to increasing demand for secondary education (Republic ...

  11. Mapping of single-copy genes by TSA-FISH in th codling moth, Cydia pomonella

    Czech Academy of Sciences Publication Activity Database

    Carabajal Paladino, Leonela Z.; Nguyen, Petr; Šíchová, Jindra; Marec, František

    2014-01-01

    Roč. 15, Supplement 2 (2014), S15. ISSN 1471-2156 R&D Projects: GA ČR(CZ) GA14-22765S; GA ČR(CZ) GP14-35819P; GA MŠk(CZ) EE2.3.30.0032 Grant ostatní: GA JU(CZ) 052/2013/P; IAEA, Vienna(AT) 15838 Institutional support: RVO:60077344 Keywords : Cydia pomonella Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.397, year: 2014 http://www.biomedcentral.com/content/pdf/1471-2156-15-S2-S15.pdf

  12. Uzundere Vadisi Tarimsal Faaliyetlerinin Peyzaj Çesitliligine Etkileri/EtTects on Landscape Diversity of Agricultural Activites Of Uzundere District and Its Surroundings

    OpenAIRE

    Karahan, Faris; Orhan, Tuba

    2012-01-01

    Özet: Uzundere ilçesi ve vadisi cografi yapi ve rakiminin düsük olmasi nedeniyle Erzurum'agöre ilik bir iklime sahip ilçenin güney ve batisinda karasaL, kuzey ve dogusundaDogu Karadeniz iklimi hakimdir. Vadi içlerindeki mikroklima iklim özelligiyle ilçedenarenciye üretimi disinda tüm sebze ve meyve üretimi yapilmaktadir. Ilçe alan kullanimlarinin%39,7'si çayir ve meraya, %12'si orman ve fundaliga ve % 9,8'i...

  13. Development and Implementation of the National Cancer Institute’s Food Attitudes and Behaviors Survey to Assess Correlates of Fruit and Vegetable Intake in Adults

    OpenAIRE

    Erinosho, Temitope O.; Pinard, Courtney A.; Nebeling, Linda C.; Moser, Richard P.; Shaikh, Abdul R; Resnicow, Ken; Oh, April Y.; Yaroch, Amy L.

    2015-01-01

    Background Low fruit and vegetable (FV) intake is a leading risk factor for chronic disease globally as well as in the United States. Much of the population does not consume the recommended servings of FV daily. This paper describes the development of psychosocial measures of FV intake for inclusion in the U.S. National Cancer Institute’s 2007 Food Attitudes and Behaviors Survey. Methods This was a cross-sectional study among 3,397 adults from the United States. Scales included conventional c...

  14. Batch production of L(+) lactic acid from whey by Lactobacillus casei (NRRL B-441)

    OpenAIRE

    Büyükkileci, Ali Oğuz; Harsa, Hayriye Şebnem

    2004-01-01

    The effects of temperature, pH, and medium composition on lactic acid production by Lactobacillus casei were investigated. The highest lactic acid productivity values were obtained at 37 °C and pH 5.5. The productivity was 1.87 g dm-3 h-1 at 37 °C in shake flasks. In the fermenter, a productivity of 3.97 g dm-3 h-1 was obtained at pH 5.5. The most appropriate yeast extract concentration was 5.0 g dm-3. Whey yielded a higher productivity value than the analytical lactose and glucose. Initial w...

  15. A multiwavelength study of superoutbursts in dwarf novae

    International Nuclear Information System (INIS)

    Dwarf novae are stellar systems consisting of two stars which orbit around each other within a few hours. In dwarf novae one of the stars, which is a bit smaller and less massive than our sun, loses matter to a very compact and degenerated star: a white dwarf. This white dwarf has nearly the same mass as our sun but its radius is about a hundred times smaller. The process of mass transport was studied on the basis of observations with the Exosat-satelite (European X-ray Observatory satelite). 397 refs.; 50 figs.; 21 tabs

  16. Dicty_cDB: Contig-U05965-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Number of Hits to DB: 33,362 Number of Sequences: 6905 Number of extensions: 33362 Number of successful extension...s: 96152515 Number of successful extensions: 12083703 Number of sequences better than 10.0: 902 Length of... nucleotide-binding protein subuni... 134 4e-30 CU928169_531( CU928169 |pid:none) Kluyveromyces...s: 3204285 Number of Hits to DB: 1,664,731,397 Number of extensions: 32802102 Number of successful extension...lear distribution protein PAC1; AltNam... 160 1e-37 CP000393_1925( CP000393 |pid:none) Trichodes

  17. Observations favor the crossing of phantom divide lines

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Using three different parameterized dark energy models, we reconstruct the properties of dark energy from the latest 397 Sne Ia, CMB and BAO with the present matter density, Ωm0, given prior. We find that, when Ωm0 is not small, for example, Ωm0 = 0.28 or 0.32, an evolving dark energy with a crossing of phantom divide line is favored and this conclusion seems to be model independent. We also find that the evolving properties of dark energy become more and more evident with the increase of Ωm0 given prior.

  18. 49 CFR Appendix A to Part 593 - List of Vehicles Determined To Be Eligible for Importation

    Science.gov (United States)

    2010-10-01

    ... 397 Bimota (MC) SB6 1994-1999 523 BMW 316 1986 25 BMW 3 Series 1998 462 BMW 3 Series 1999 379 BMW 3 Series 2000 356 BMW 3 Series 2001 379 BMW 3 Series 1995-1997 248 BMW 3 Series 2003-2004 487 BMW 318i, 318iA 1986 23 BMW 318i, 318iA 1987-1989 23 BMW 320i 1990-1991 283 BMW 325, 325i, 325iA, 325E 1986...

  19. Factores determinantes de la competitividad empresarial en la región de La Plata, Berisso y Ensenada

    OpenAIRE

    Saravia, Ezequiel

    2015-01-01

    El Sector “Textil y Cuero” está por debajo del Indicador Global Regional (el cual es de 3,97), ya que tiene un nivel de 3,40, al igual que el sector “Imprentas y Editoriales” que es de 3,27. Todos los sectores parecen verse afectados en forma similar respecto de determinadas condiciones del escenario económico. Mirando puertas adentro de las empresas en cada uno de los sectores, es en los factores propios del desempeño de las mismas donde se aprecia las mayores diferencias en el nivel de comp...

  20. High prevalence of parental delivery of plastic debris in Cory’s shearwaters (Calonectris diomedea)

    OpenAIRE

    Rodríguez, Airam; Rodríguez, Beneharo; Carrasco, María Nazaret

    2012-01-01

    Plastic ingestion by adult Procellariiformes has been widely recorded, but few studies have evaluated intergenerational transfer. We assessed the prevalence of plastic particles, as well as their basic character- istics, in the gut content of dead Cory’s shearwater fledglings stranded by light pollution on Canary Islands. Eighty-three percent of birds were affected, containing on average 8.0 plastic pieces per bird. The average plastic weight per bird was low (2.97 ± 3.97 mg) compared with ...

  1. Dicty_cDB: Contig-U02677-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available da31f09, 3' ... 36 0.19 2 ( CU797285 ) A BAC library has been constructed from PN...e 2 map complement(3527391-3470188) strain AX4, complete sequence. Length = 397 Score = 343 bits (881), Expect...... 38 0.18 2 ( AQ652014 ) Sheared DNA-17F24.TF Sheared DNA Trypanosoma bruc... 46 0.18 2 ( BJ330366 ) Dictyost...us subsp. aureus COL, complete... 48 0.95 1 ( BX571857 ) Staphylococcus aureus strai...n MSSA476, complete ge... 48 0.95 1 ( BX571856 ) Staphylococcus aureus subsp. aureus strain MRSA25... 48 0.9

  2. Subclinical Vitamin D Insufficiency in Korean School-aged Children

    OpenAIRE

    Han, Sang Woo; Kang, Ha Ra; Kim, Han Gyum; Kim, Joo Hyun; Uhm, Ji Hyun; Seo, Ji Young

    2013-01-01

    Purpose Recently, vitamin D insufficiency has increased and has been correlated to growth and puberty in children. This study was conducted to find the prevalence of subclinical vitamin D insufficiency and its influence on school-aged children in Korea. Methods The subjects of this study were 397 children aged 7 to 15 years who had been tested for 25-OH vitamin D3 among the outpatients of the Department of Pediatrics in Eulji General Hospital from March 2007 to February 2011. Data for age, se...

  3. Metal-rich or misclassified? The case of four RR Lyrae stars

    CERN Document Server

    Molnár, L; Plachy, E; Szabó, R

    2016-01-01

    We analysed the light curve of four, apparently extremely metal-rich fundamental-mode RR Lyrae stars. We identified two stars, MT Tel and ASAS J091803-3022.6 as RRc (first-overtone) pulsators that were misclassified as RRab ones in the ASAS survey. In the case of the other two stars, V397 Gem and ASAS J075127-4136.3, we could not decide conclusively, as they are outliers in the period-Fourier-coefficient space from the loci of both classes, but their photometric metallicities also favour the RRc classification.

  4. Precise measurement of total cross sections for the process e+e--> multihadrons in the CM energy range between 12.0 and 36.4 GeV

    International Nuclear Information System (INIS)

    The total cross section for the process e+e- -> hadrons has been measured in the CM energy range between 12.0 and 36.4 GeV using the JADE detector with a typical systematic error of +- 3%. The ratio R (sigma(ee -> hadrons)/sigmasub(pt)) is found to be constant over this range with an average value of 3.97 +- 0.05 (statistical and point-to-point systematic error) +- 0.10 (normalization error). The data were compared with the standard electro-weak interaction model including QCD corrections. (orig.)

  5. The association between violence victimisation and common symptoms in Swedish women

    OpenAIRE

    Krantz, G.; Ostergren, P.

    2000-01-01

    STUDY OBJECTIVE—To investigate the association between violence and abuse suffered by women during childhood or adult life, and the manifestation of a high level of common physical and mental symptoms.
DESIGN, SETTING AND PARTICIPANTS—A questionnaire was sent to a random population of women, 40 to 50 years of age, living in a rural Swedish community. The response rate was 81.7 per cent (397 women). Odds ratios were used to estimate bivariate associations between the experience of violence/abu...

  6. Reproductive health and quality of life of young Burmese refugees in Thailand.

    OpenAIRE

    Hunnangkul Saowalak; Htwe Kyi; Naranichakul Nantarat; Kaloi Wiphan; Townsend Joy; Benner Marie T; Carrara Verena I; Sondorp Egbert

    2010-01-01

    Abstract Background Of the 140 000 Burmese* refugees living in camps in Thailand, 30% are youths aged 15-24. Health services in these camps do not specifically target young people and their problems and needs are poorly understood. This study aimed to assess their reproductive health issues and quality of life, and identifies appropriate service needs. Methods We used a stratified two-stage random sample questionnaire survey of 397 young people 15-24 years from 5,183 households, and 19 semi-s...

  7. Legal abortions among teenagers in Canada, 1974 through 1978.

    OpenAIRE

    Wadhera, A.; Nair, C.(Argonne National Laboratory, Argonne, IL, 60439, USA)

    1980-01-01

    Between August 1969, when the amendment to the Criminal Code went into effect, and December 1978 about 397 000 legal abortions were performed in hospitals with therapeutic abortion committees in Canada. During the 5-year period 1974-78 abortions in females under 20 years of age accounted for 30.9% of all the legal abortions performed in Canada on Canadian residents, and the abortion rate per 1000 women aged 15 to 19 years increased from 13.6 to 16.3. During 1974-77 the proportion of women in ...

  8. Polyunsaturated fatty acids of marine origin induce adiponectin in mice fed a high-fat diet

    Czech Academy of Sciences Publication Activity Database

    Flachs, Pavel; Mohamed-Ali, V.; Horáková, Olga; Rossmeisl, Martin; Hosseinzadeh-Attar, M. J.; Hensler, Michal; Růžičková, Jana; Kopecký, Jan

    2006-01-01

    Roč. 49, č. 2 (2006), s. 394-397. ISSN 0012-186X R&D Projects: GA AV ČR(CZ) KJB5011410; GA ČR(CZ) GA303/05/2580; GA MŠk(CZ) 1M0520 Grant ostatní: Wellcome Trust(GB) 070821/Z/03/Z; GA-(NO) Pronova Biocare; European Commission(XE) LSHM-CT-2004-005272 Institutional research plan: CEZ:AV0Z50110509 Keywords : insulin * fatty acids * adiponektin Subject RIV: CE - Biochemistry Impact factor: 5.247, year: 2006

  9. Use of routine computed tomography brain scanning of psychiatry patients

    International Nuclear Information System (INIS)

    The aim of this study was to evaluate the usefulness of CT of the brain in patients presenting with a psychiatric condition without focal neurological signs. The reports of 397 consecutive CT brain scans of patients presenting to two acute tertiary hospital psychiatric services over a 2-year period were assessed retrospectively. Of the 397 patients, 241 had psychosis, 87 had depression, 44 had bipolar affective disorder, seven had alcohol dependence, five had dementia, and the remaining 13 had a variety of diagnoses including personality disorder and transient ischaemic attack. Findings on 377 (95%) of the CT scans showed no abnormality. Specific abnormalities were described in 20 (5%) of the CT scans. Three scans showed non-specific minor abnormalities, which, when followed up by MRI, showed no relevant abnormality. All the abnormalities shown on CT were considered to be clinically unrelated to the patient's psychiatric condition. In conclusion, the pretest probability of finding a space-occupying lesion or other pertinent abnormality in patients presenting with psychiatric illnesses in this retrospective study appears not to be greater than that of the general population. The outcome of this study could be implemented to develop a clinical pathway for limiting assessment by CT for possible organic pathology in acute psychiatric illness. Copyright (2006) Blackwell Science Pty Ltd

  10. Temperature-controlled ionic liquid-based ultrasound-assisted microextraction for preconcentration of trace quantity of cadmium and nickel by using organic ligand in artificial saliva extract of smokeless tobacco products

    Science.gov (United States)

    Arain, Sadaf Sadia; Kazi, Tasneem Gul; Arain, Asma Jabeen; Afridi, Hassan Imran; Baig, Jameel Ahmed; Brahman, Kapil Dev; Naeemullah; Arain, Salma Aslam

    2015-03-01

    A new approach was developed for the preconcentration of cadmium (Cd) and nickel (Ni) in artificial saliva extract of dry snuff (brown and black) products using temperature-controlled ionic liquid-based ultrasound-assisted dispersive liquid-liquid microextraction (TIL-UDLLμE) followed by electrothermal atomic absorption spectrometry (ETAAS). The Cd and Ni were complexed with ammonium pyrrolidinedithiocarbamate (APDC), extracted in ionic liquid drops, 1-butyl-3-methylimidazolium hexafluorophosphate [C4MIM][PF6]. The multivariate strategy was applied to estimate the optimum values of experimental variables influence the % recovery of analytes by TIL-UDLLμE method. At optimum experimental conditions, the limit of detection (3s) were 0.05 and 0.14 μg L-1 while relative standard deviations (% RSD) were 3.97 and 3.55 for Cd and Ni respectively. After extraction, the enhancement factors (EF) were 87 and 79 for Cd and Ni, respectively. The RSD for six replicates of 10 μg L-1 Cd and Ni were 3.97% and 3.55% respectively. To validate the proposed method, certified reference material (CRM) of Virginia tobacco leaves was analyzed, and the determined values of Cd and Ni were in good agreement with the certified values. The concentration of Cd and Ni in artificial saliva extracts corresponds to 39-52% and 21-32%, respectively, of the total contents of both elements in dry brown and black snuff products.

  11. Giardíase e criptosporidiose em crianças institucionalizadas em creches no estado de São Paulo Giardiasis and cryptosporidiosis in children institutionalized at daycare centers in the state of São Paulo

    Directory of Open Access Journals (Sweden)

    Luciene Maura Mascarini

    2006-12-01

    Full Text Available Realizou-se dois estudos transversais em 2002 (N=379 e 2003 (N=397 onde estimou-se a prevalência de enteroparasitas em crianças de cinco creches municipais de Botucatu, SP. Coletou-se variáveis socioeconômicas, sanitárias e educacionais e realizou-se exames coproparasitológicos. Giardia duodenalis apresentou prevalência de 23,7% (2002 e 21,4% (2003 seguido por Cryptosporidium sp com 15,5% (2002 e 3,7% (2003.Two cross-sectional studies were conducted, in 2002 (N=379 and 2003 (N=397, to estimate the prevalence of intestinal parasites among children at five municipal daycare centers in Botucatu, State of São Paulo. Socioeconomic, sanitary and educational data were collected and parasitological tests were performed on feces. Giardia duodenalis presented prevalence of 23.7% (2002 and 21.4% (2003 followed by Cryptosporidium sp with 15.5% (2002 and 3.7% (2003.

  12. Estudo epidemiológico de fontes de alimentação sangüínea dos triatomíneos da fazenda aroeira (Catolé do Rocha, Paraíba e circunvizinhanças

    Directory of Open Access Journals (Sweden)

    Carlos Brisola Marcondes

    1991-09-01

    Full Text Available Analisamos a fonte de alimentação sangüínea de 94 triatomíneos (51 Triatoma brasiliensis, 42 T. pseudomaculata e um Rhodnius neglectus da Fazenda Aroeira, no Município de Catolé do Rocha, no Estado da Paraíba, e de quatro localidades próximas. Observamos positividade para marsupial, homem e ave, respectivamente, de 39,7 , 6,2 e 23,0%. Três insetos da Fazenda Aroeira, positivos para Trypanosoma cruzi, foram positivos para marsupial, só um deles também para outro mamífero. Os marsupiais são a mais importante fonte de T. cruzi para os insetos da área e estes têm pouco contato com o homem.We have analysed the blood feeding sources of 94 triatomine bugs (51 T. brasiliensis, 42 T. pseudomaculata and one R. neglectus from Fazenda Aroeira, in Catolé do Rocha Municipality, Paraíba State, and four neighbouring localities. The positivity for marsupial, man and bird blood were, respectively, 39.7, 6.2 and 23.0%. Three insects from Fazenda Aroeira were positive both forT. cruzi and marsupial blood while only one of the three was positive for another mammal. Marsupials are the most important source of T. cruzi for the insects of the area, which have litte contact with man.

  13. Narrow resonances in the system of two π--mesons

    International Nuclear Information System (INIS)

    The study of the production of exotic 4-quark resonances with isotopic spin I=2 in the π-π--systems from the reaction np→ppπ+π-π- was carried out using the data obtained in the irradiation of 1m H2 bubble chambers of LHE, JINR by neutrons at the momentum Pn=5.20±0.13 GeV/c. A number of enhancements was found at the masses of 0.330; 0.354; 0.397; 0.447; 0.510; 0.569; 0.650; 0.736; 0.822, and 0.920 GeV/c2. Experimental widths of resonances are comparable with the resolution that is linearly increasing from 1.4 to 15.0 MeV/c2 (σres) under alteration of masses from the sum of masses of pions to ≅1 GeV/c2. An attempt was made to determine the spins of resonances. For the resonances at the mass of 0.397 GeV/c2, the most probable value of spin was proved to be equal to J≥6. 3 refs., 3 figs. 1 tab

  14. The Protrusive Phase and Full Development of Integrin-Dependent Adhesions in Colon Epithelial Cells Require FAK- and ERKMediated Actin Spike Formation: Deregulation in Cancer Cells

    Directory of Open Access Journals (Sweden)

    Valerie G. Brunton

    2001-01-01

    Full Text Available Integrins play an important role in tumour progression by influencing cellular responses and matrix-dependent adhesion. However, the regulation of matrix-dependent adhesion assembly in epithelial cells is poorly understood. We have investigated the integrin and signalling requirements of cell-matrix adhesion assembly in colon carcinoma cells after plating on fibronectin. Adhesion assembly in these, and in the adenoma cells from which they were derived, was largely dependent on αvβ6 integrin and required phosphorylation of FAK on tyrosine-397. The rate of fibronectin-induced adhesion assembly and the expression of both αvβ6 integrin and FAK were increased during the adenoma-to-carcinoma transition. The matrix-dependent adhesion assembly process, particularly the final stages of complex protrusion that is required for optimal cell spreading, required the activity of extracellular signal-regulated kinase (ERK. Furthermore, phosphorylated ERK was targeted to newly forming cell-matrix adhesions in the carcinoma cells but not the adenoma cells, and inhibition of FAK-tyrosine-397 phosphorylation or MEK suppressed the appearance of phosphorylated ERK at peripheral sites. In addition, inhibition of MEK-ERK activation blocked the formation of peripheral actin microspikes that were necessary for the protrusive phase of cell-matrix adhesion assembly. Thus, MEK-ERK-dependent peripheral actin re-organization is required for the full development of integrin-induced adhesions and this pathway is stimulated in an in vitro model of colon cancer progression.

  15. Hydriding and dehydriding kinetics of RbH-doped 2LiNH2/MgH2 hydrogen storage system

    International Nuclear Information System (INIS)

    Highlights: • The amount of hysteresis in RbH doped 2LiNH2/MgH2 increases with cycling. • The absorption enthalpy is less than the desorption enthalpy (39.7 vs 43 kJ mol−1). • The rate of H2 absorption is approximately twice as fast as desorption. • Diffusion is the rate-limiting process for both H2 absorption and desorption. - Abstract: In this study, thermodynamic and kinetic properties of RbH doped 2LiNH2/MgH2 were measured and compared for hydrogen absorption and desorption. Pressure–composition–temperature isotherms were obtained in the 150–180 °C temperature range and were used to construct van’t Hoff plots. The results showed that the absorption enthalpy, 39.7 kJ mol−1, was less than the desorption enthalpy, 43 kJ mol−1. Kinetics measurements, done at 160 °C using constant pressure thermodynamic driving forces, show that under the same conditions, absorption is approximately twice as fast as desorption. Modeling studies, based on a shrinking core model, show that diffusion is the rate-limiting process for both absorption and desorption. Cycling studies were also done to determine if any changes would occur in the sample upon repeated hydriding/dehydriding at 200 °C. It was found that the amount of hysteresis increased and there was also about a 30% decrease in the hydrogen capacity after 70 cycles

  16. Study of formation constant of molybdophosphate and it's application in the product of xenotime sand, tooth and bone

    International Nuclear Information System (INIS)

    The formation constant of molybdophosphate complex and it's application in the product of xenotime sand, tooth and bone have been studied by spectrophotometric method. The molybdophosphate complex were formed from reaction between phosphate and molybdate on several of pH in the strong acid condition (pH = 0.45 - 0.71) and several of phosphate mole fraction (0.01 - 0.08). The several of complex formation reactions were determined by matrix disintegration technique. Molybdophosphate complex were founded three forms i.e. (P2Mo18O62)6- or 9 MPA, (PMo11O39)7- or 11 MPA and (PMo12O40)3- or 12 MPA. The formation constant of (PMo12O40)3- complex was found β = 1046.95 ± 103.7, while for (P2Mo18O62)6- and (PMo11O39)7- were not detected. The application in samples were found the concentration of P in product of xenotime sand : 5.37±0.08 μg/ml, in canine-tooth: 10.40 - 19.49 % in cutting-tooth : 11.08 - 18.05 % and in bone 10.94 - 14.29 %. (author)

  17. Prevalência de anticorpos anti-Babesia equi em eqüinos no Planalto Catarinense Prevalence of Babesia equi antibodies in horses in the Santa Catarina Plateau, Brazil

    Directory of Open Access Journals (Sweden)

    Antonio Pereira de Souza

    2000-03-01

    Full Text Available Para avaliar a prevalência de anticorpos anti- Babesia equi, através da técnica de imunofluorescência indireta (IFI, foram examinados 397 amostras de soro. As amostras de sangue, para obtenção dos soros, foram coletadas de eqüinos de diferentes idades, raças, sexos, nascidos e criados no Planalto Catarinense, dos municípios de Lages, São Joaquim, Bom Jardim da Serra, Campos Novos, Anita Garibaldi, Curitibanos e Correia Pinto. Os resultados obtidos indicaram a existência de 50,38% de animais sorologicamente reativos para B. equi, na diluição de 1:40. Entre os municípios, os percentuais de animais soropositivos variaram de 18,51% a 64,70%.Serum samples from 397 horses were examined by the indirect immunofluorescence technique. The blood samples were taken from horses of various ages, breeds and both sexes, bred and born in the Santa Catarina State, Brazil, in the counties of Lages, São Joaquim, Bom Jardim da Serra, Campos Novos, Anita Garibaldi, Curitibanos e Correia Pinto. The results indicated a prevalence of 50.38% of positive animals for B. equi at the 1:40 serum dilution. In different counties studied, the prevalence positive animals varied from 18.51% to 64.70%.

  18. Molecular Characteristics of S1 Gene of Infectious Bronchitis Virus Isolated from Chicken Proventriculus

    Institute of Scientific and Technical Information of China (English)

    CHENG Li-qin; ZHOU Ji-yong; John Dikki; SHEN Xing-yan; CHEN Ji-gang; ZHANG De-yong

    2003-01-01

    Infectious bronchitis virus was isolated from swollen proventriculi of clinically ill chicken. Thesuspected virus samples (2/97, 3/97, 1/98) were adapted in SPF chicken embryos for virus isolation andidentification. All the virus isolates were able to agglutinate chicken erythrocytes after treatment with trypsin,and interfer with the reproduction of Newcastle disease virus in chicken embryos, and have low antigenic relat-edness values with reference positive IBV. The isolates 2/97, 3/97, 1/98 RNAs extracted from the allantoicfluid of inoculated embryonated eggs were converted to cDNA by reverse transcription with 3'-primer of S1gene of (IBV). Polymerase chain reaction (PCR) was performed with two primers which span the S1 gene.Amplified product of 1.93 kb was subjected to EcoR Ⅰ and BamH Ⅰ digestion and the fragments obtainedwere the same as expected size. The PCR product was ligated to pBlueScript-SK (+) vector, and its nucleotidesequence was determined by the dideoxy-mediated chain termination method. Nucleotide sequence analysisshowed 73.6 - 99.7 % homology between the isolated IBV and the IBV strains in GenBank. The homology ofamino acid was 71.4 - 99.4 %.

  19. Integrin activation and focal complex formation in cardiac hypertrophy

    Science.gov (United States)

    Laser, M.; Willey, C. D.; Jiang, W.; Cooper, G. 4th; Menick, D. R.; Zile, M. R.; Kuppuswamy, D.

    2000-01-01

    Cardiac hypertrophy is characterized by both remodeling of the extracellular matrix (ECM) and hypertrophic growth of the cardiocytes. Here we show increased expression and cytoskeletal association of the ECM proteins fibronectin and vitronectin in pressure-overloaded feline myocardium. These changes are accompanied by cytoskeletal binding and phosphorylation of focal adhesion kinase (FAK) at Tyr-397 and Tyr-925, c-Src at Tyr-416, recruitment of the adapter proteins p130(Cas), Shc, and Nck, and activation of the extracellular-regulated kinases ERK1/2. A synthetic peptide containing the Arg-Gly-Asp (RGD) motif of fibronectin and vitronectin was used to stimulate adult feline cardiomyocytes cultured on laminin or within a type-I collagen matrix. Whereas cardiocytes under both conditions showed RGD-stimulated ERK1/2 activation, only collagen-embedded cells exhibited cytoskeletal assembly of FAK, c-Src, Nck, and Shc. In RGD-stimulated collagen-embedded cells, FAK was phosphorylated only at Tyr-397 and c-Src association occurred without Tyr-416 phosphorylation and p130(Cas) association. Therefore, c-Src activation is not required for its cytoskeletal binding but may be important for additional phosphorylation of FAK. Overall, our study suggests that multiple signaling pathways originate in pressure-overloaded heart following integrin engagement with ECM proteins, including focal complex formation and ERK1/2 activation, and many of these pathways can be activated in cardiomyocytes via RGD-stimulated integrin activation.

  20. High temperature vapor pressure of pure plutonium

    International Nuclear Information System (INIS)

    High temperature vapor pressure measurements have been made on pure plutonium metal by the Knudsen effusion technique. The reported experimental results extend into the transition region between molecular and viscous or hydrodynamic flow. Under the conditions used, linearity was observed up to temperatures in excess of 2200 K where pressures approaching 100 Pa were measured. The results over the temperature range 1724--2219 K yield log10P/sub Pu/(Pa) = (9.735 +- 0.105) -17066 +- 208/T and the enthalpy and entropy of vaporization and the standard deviations therein are ΔH0/sub v/(Pu,1975 K) =326.78 +- 3.97 kJ mol-1, ΔS0/sub v/(Pu,1975 K) =90.54 +- 2.01 J K-1 mol-1. Based on the most recently available free energy functions for plutonium liquid and gas, the values of the standard enthalpy of vaporization calculated via second- and third-law methods are ΔH0/sub v/(II, Pu,298 K) =344.14 +- 3.97 kJ mol-1, ΔH0/sub v/(III, Pu,298 K) =341.67 +- 1.26 kJ mol-1. Single crystal tungsten containers were used to hold the charge of plutonium and proved to be very satisfactory in alleviating problems of liquid metal creep and liquid/cell interactions normally encountered with actinides held at high temperatures for long periods

  1. Ecología humana y acción pro-ambiental: alteridades recíprocas aula-escuela-comunidad para el manejo sustentable de residuos

    Directory of Open Access Journals (Sweden)

    Javier Guevara Martínez

    2013-01-01

    Full Text Available Se reporta el cambio cultural que substituye la cultura de la basura por una cultura de acopio y entrega diferenciada de residuos sólidos municipales. La investigación interviene en el cien por ciento de la población: los sujetos colectivos son 397 grupos académicos de 60 escuelas, reuniendo a una cantidad de 397 profesoras(es y 8266 escolares. Se interviene estratégicamente en tres entornos: aula, escuela, comunidad, que alcanzan el rol de instrumento a partir de sus interconexiones ambientales. La metodología considera la estrategia de los experimentos ecológicos lewinianos para investigar empíricamente las interdependencias de los contextos, el interés son los entornos de poder (fuerza, posición y potencia en la relación del estudiante con su realidad, induciendo la conexión directa de los entornos, bajo un proceso de alteridad recíproca aunque asimétrica. Con la escala de Ossgod se reportan los cambios actitudinales sin embargo, el “dato duro” es la reunión del 42% de residuos diferenciados, en un contexto latinoamericano en el que solo se reúne del 3 al 6%.

  2. Foodstuff analyses show that seafood and water are major perfluoroalkyl acids (PFAAs) sources to humans in Korea

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • 16 PFAAs in 397 samples of 66 food types and 34 tap water samples were analyzed. • Dietary exposure to PFAAs was estimated by using the PFAAs measured concentrations. • The major contributors of PFAAs dietary exposure were confirmed. - Abstract: We measured concentrations of PFAAs in 397 foods, of 66 types, in Korea, and determined the daily human dietary PFAAs intake and the contribution of each foodstuff to that intake. The PFAAs concentration in the 66 different food types ranged from below the detection limit to 48.3 ng/g. Perfluorooctane sulfonate (PFOS) and long-chain perfluorocarboxylic acids (PFCAs) were the dominant PFAAs in fish, shellfish, and processed foods, while perfluorooctanoic acid (PFOA) and short-chain PFCAs dominated dairy foodstuffs and beverages. The Korean adult dietary intake ranges, estimated for a range of scenarios, were 0.60–3.03 and 0.17–1.68 ng kg−1 bw d−1 for PFOS and PFOA, respectively, which were lower than the total daily intake limits suggested by European Food Safety Authority (PFOS: 150 ng kg−1 bw d−1; PFOA: 1500 ng kg−1 bw d−1). The major contributors to PFAAs dietary exposure varied with subject age and PFAAs. For example, fish was a major contributor of PFOS but dairy foods were major contributors of PFOA. However, tap water was a major contributor to PFOA intake when it was the main source of drinking water (rather than bottled water)

  3. Temperature-controlled ionic liquid-based ultrasound-assisted microextraction for preconcentration of trace quantity of cadmium and nickel by using organic ligand in artificial saliva extract of smokeless tobacco products.

    Science.gov (United States)

    Arain, Sadaf Sadia; Kazi, Tasneem Gul; Arain, Asma Jabeen; Afridi, Hassan Imran; Baig, Jameel Ahmed; Brahman, Kapil Dev; Naeemullah; Arain, Salma Aslam

    2015-03-01

    A new approach was developed for the preconcentration of cadmium (Cd) and nickel (Ni) in artificial saliva extract of dry snuff (brown and black) products using temperature-controlled ionic liquid-based ultrasound-assisted dispersive liquid-liquid microextraction (TIL-UDLLμE) followed by electrothermal atomic absorption spectrometry (ETAAS). The Cd and Ni were complexed with ammonium pyrrolidinedithiocarbamate (APDC), extracted in ionic liquid drops, 1-butyl-3-methylimidazolium hexafluorophosphate [C4MIM][PF6]. The multivariate strategy was applied to estimate the optimum values of experimental variables influence the % recovery of analytes by TIL-UDLLμE method. At optimum experimental conditions, the limit of detection (3s) were 0.05 and 0.14μgL(-1) while relative standard deviations (% RSD) were 3.97 and 3.55 for Cd and Ni respectively. After extraction, the enhancement factors (EF) were 87 and 79 for Cd and Ni, respectively. The RSD for six replicates of 10μgL(-1) Cd and Ni were 3.97% and 3.55% respectively. To validate the proposed method, certified reference material (CRM) of Virginia tobacco leaves was analyzed, and the determined values of Cd and Ni were in good agreement with the certified values. The concentration of Cd and Ni in artificial saliva extracts corresponds to 39-52% and 21-32%, respectively, of the total contents of both elements in dry brown and black snuff products. PMID:25523044

  4. Host specificity and experimental assessment of the early establishment of the mistletoe Phoradendron crassifolium (Pohl ex DC. Eichler (Santalaceae in a fragment of Atlantic Forest in southeast Brazil

    Directory of Open Access Journals (Sweden)

    Patrícia Aparecida Messias

    2014-12-01

    Full Text Available Mistletoe establishment relies heavily on a seed reaching a proper host plant. Small frugivorous birds usually disperse large numbers of mistletoe seeds. However, in the field, mistletoes are absent from some potential available hosts. We investigated whether the mistletoe Phoradendron crassifolium has some preferences for specific host trees in a fragment of Atlantic Forest in southeast Brazil. We surveyed 397 tree individuals of 50 species within 25 families. Seven of those species (14% bore P. crassifolium infections. Although prevalence at the individual level was low (11.6%, there were marked deviations in infection levels among species and families. Most (87% of the infections (40 of 46 occurred in species belonging to the families Anacardiaceae (Lithraea molleoides and Tapirira guianensis and Siparunaceae (Siparuna guianensis, which nevertheless accounted for only 26% of the potential individual hosts (103 of 397. We also performed an experiment simulating bird behavior. We inoculated 480 mistletoe seeds to the bark of four potential hosts in field, following the fate of the seeds for five months. No differences in host preference were observed. The low specificity detected at the local level was confirmed by a survey of exsiccata collected over the geographical distribution of the mistletoe, suggesting that P. crassifolium prevalence is more dependent on dispersal limitation than on mistletoe-host compatibility.

  5. Cholinesterase inhibition and behavioral toxicity of carbofuran on Oreochromis niloticus early life stages.

    Science.gov (United States)

    Pessoa, P C; Luchmann, K H; Ribeiro, A B; Veras, M M; Correa, J R M B; Nogueira, A J; Bainy, A C D; Carvalho, P S M

    2011-10-01

    Nile tilapia Oreochromis niloticus at 9 days post-hatch were exposed in semi-static experiments to the carbamate insecticide carbofuran, which is applied in agricultural systems in Brazil. Although the molecular mechanism of carbofuran toxicity is well known, a detailed understanding of the ecological mechanisms through which carbofuran effects can propagate towards higher levels of biological organization in fish is incomplete. Mortality rates were quantified for larvae exposed for 96 h to 8.3, 40.6, 69.9, 140, 297 and 397 μg/L carbofuran, and the LC(50) 96 h was 214.7 μg/L. In addition, the biochemical biomarker cholinesterase inhibition and behavioral biomarkers related to vision, swimming, prey capture and predator avoidance were quantified in individual larvae, as well as their growth in weight. The behavioral parameters were quantified by analysis of digitally recorded videos of individual larvae within appropriate experimental setups. The activity of the enzyme cholinesterase decreased after exposure to carbofuran with a lowest observed effects concentration (LOEC) of 69.9 μg/L. Visual acuity deficits were detected after carbofuran exposure with a LOEC of 40.6 μg/L. Swimming speed decreased with carbofuran exposure, with a LOEC of 397.6 μg/L. The number of attacks to prey (Daphnia magna nauplii) decreased in larvae exposed to carbofuran, with a LOEC of 397.6 μg/L. Growth in weight was significantly reduced in a dose dependent manner, and all carbofuran groups exhibited a statistically significant decrease in growth when compared to controls (plarvae decreased after exposure to carbofuran, and the LOEC was 69.9 μg/L. These results show that exposure of sensitive early life stages of tilapia O. niloticus to sublethal concentrations of carbofuran can affect fundamental aspects of fish larval ecology that are relevant to recruitment of fish populations, and that can be better understood by the application of behavioral biomarkers. PMID:21794226

  6. Oestrogen receptor α gene haplotype and postmenopausal breast cancer risk: a case control study

    International Nuclear Information System (INIS)

    Oestrogen receptor α, which mediates the effect of oestrogen in target tissues, is genetically polymorphic. Because breast cancer development is dependent on oestrogenic influence, we have investigated whether polymorphisms in the oestrogen receptor α gene (ESR1) are associated with breast cancer risk. We genotyped breast cancer cases and age-matched population controls for one microsatellite marker and four single-nucleotide polymorphisms (SNPs) in ESR1. The numbers of genotyped cases and controls for each marker were as follows: TAn, 1514 cases and 1514 controls; c.454-397C → T, 1557 cases and 1512 controls; c.454-351A → G, 1556 cases and 1512 controls; c.729C → T, 1562 cases and 1513 controls; c.975C → G, 1562 cases and 1513 controls. Using logistic regression models, we calculated odds ratios (ORs) and 95% confidence intervals (CIs). Haplotype effects were estimated in an exploratory analysis, using expectation-maximisation algorithms for case-control study data. There were no compelling associations between single polymorphic loci and breast cancer risk. In haplotype analyses, a common haplotype of the c.454-351A → G or c.454-397C → T and c.975C → G SNPs appeared to be associated with an increased risk for ductal breast cancer: one copy of the c.454-351A → G and c.975C → G haplotype entailed an OR of 1.19 (95% CI 1.06–1.33) and two copies with an OR of 1.42 (95% CI 1.15–1.77), compared with no copies, under a model of multiplicative penetrance. The association with the c.454-397C → T and c.975C → G haplotypes was similar. Our data indicated that these haplotypes were more influential in women with a high body mass index. Adjustment for multiple comparisons rendered the associations statistically non-significant. We found suggestions of an association between common haplotypes in ESR1 and the risk for ductal breast cancer that is stronger in heavy women

  7. Associated HI Absorption in the = 3.4 Radio Galaxy B2 0902 + 343 Observed with the GMRT

    Indian Academy of Sciences (India)

    Poonam Chandra; Govind Swarup; Vasant K. Kulkarni; Nimisha G. Kantharia

    2004-03-01

    We have made observations of the associated HI absorption of a high redshift radio galaxy 0902+34 at = 3.395 with the Giant Meterwave Radio Telescope in the 323+1 MHz band. We find a narrow absorption line with a flux density of 11.5 mJy at a redshift of 3.397 consistent with that observed by Uson et al. (1991), Briggs et al. (1993) and de Bruyn (1996). A weak broad absorption feature reported by de Bruyn (1996) has not been detected in our observations. We also place an upper limit of 4 mJy (2) on emission line strength at the position where Uson et al. (1991) claimed to have found a narrow emission line.

  8. Crystal structure of ethyl (2Z-2-cyano-3-[(3-methyl-1-phenyl-1H-pyrazol-5-ylamino]prop-2-enoate

    Directory of Open Access Journals (Sweden)

    Joel T. Mague

    2014-11-01

    Full Text Available The title compound, C16H16N4O2, crystallizes with two molecules in the asymmetric unit, one of which shows disorder of the acetate group over two sets of sites in a 0.799 (2:0.201 (2 ratio. The phenyl group has a similar but opposite sense of twist relative to the pyrazole ring in the two molecules, as indicated by the syn N—N—Car—Car (ar = aromatic torsion angles of 39.7 (2 and −36.9 (2°. Each molecule features an intramolecular N—H...O hydrogen bond, which closes an S(6 ring. In the crystal, C—H...O and C—H...N interactions direct the packing into a layered structure parallel to (110.

  9. Confirmatory factor analysis of the Malay version comprehensive feeding practices questionnaire tested among mothers of primary school children in Malaysia.

    Science.gov (United States)

    Shohaimi, Shamarina; Wei, Wong Yoke; Shariff, Zalilah Mohd

    2014-01-01

    Comprehensive feeding practices questionnaire (CFPQ) is an instrument specifically developed to evaluate parental feeding practices. It has been confirmed among children in America and applied to populations in France, Norway, and New Zealand. In order to extend the application of CFPQ, we conducted a factor structure validation of the translated version of CFPQ (CFPQ-M) using confirmatory factor analysis among mothers of primary school children (N = 397) in Malaysia. Several items were modified for cultural adaptation. Of 49 items, 39 items with loading factors >0.40 were retained in the final model. The confirmatory factor analysis revealed that the final model (twelve-factor model with 39 items and 2 error covariances) displayed the best fit for our sample (Chi-square = 1147; df = 634; P children in Malaysia. The present study extends the usability of the CFPQ and enables researchers and parents to better understand the relationships between parental feeding practices and related problems such as childhood obesity. PMID:25538958

  10. Modelling phase equilibria for acid gas mixtures using the CPA equation of state. Part V: Multicomponent mixtures containing CO2 and alcohols

    DEFF Research Database (Denmark)

    Tsivintzelis, Ioannis; Kontogeorgis, Georgios M.

    2015-01-01

    of studies [Tsivintzelis et al. Fluid Phase Equilib. 306 (2011) 38-56, J. Chem. Eng. Data 59 (2014) 2955-2972, Fluid Phase Equilib. 397 (2015) 1-17], reveals that the best approaches are those where the cross-association (solvation) of CO2 with alcohols and water is explicitly accounted for or......The Cubic plus association (CPA) equation of state has been previously applied to a variety of binary systems containing CO2 with alkanes, water, alcohols and glycols as well as a few multicomponent mixtures (with triethylene glycol, water and methane). In this study, we evaluate the performance of...... CPA for ternary and multicomponent CO2 mixtures containing alcohols (methanol, ethanol or propanol) water and hydrocarbons. This work belongs to a series of studies aiming to arrive in a single "engineering approach" for applying CPA to acid gas mixtures, without introducing significant changes to the...

  11. TIT创意园红色工厂的重生

    Institute of Scientific and Technical Information of China (English)

    范琛

    2011-01-01

    如果你不经意路过新港东路397号大院,必定会被一扇红砖砌成的大门所散发的怀旧气息所吸引。大门背后九万多平米的区域本是建于1956年的广州纺织机械厂旧址,经过设计改造,老厂区如今巳蜕变为TIT创意同,成为广州继信义会馆、太古仓、红专厂之后又一文化地标。

  12. NuTEC annual report (April 1, 2000 - March 31, 2001)

    International Nuclear Information System (INIS)

    This report summarizes the educational activities and related management of the Nuclear Technology and Education Center (NuTEC) during the 1999 fiscal year. Both Tokyo and Tokai Education Centers have successfully conducted almost all the planned domestic and international training courses. In addition Tokai Education Center has performed the 2nd nuclear supervisor training course and introduced a new course for special nuclear emergency preparedness in response to the legal amendment after the criticality accident. The sum total number of participants was 1,397. The International Technology Transfer Division has not only planned and organized the international training courses, but also taken charge of the 2nd workshop on Human Resource Development in Nuclear Field in Asian Region. Furthermore, various researches have been made to improve the educational programs. (author)

  13. Dicty_cDB: Contig-U09794-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 50 0.11 1 ( FE826962 ) CCAG40652.g1 CCAG Petrolisthes cinctipes heart, g... 50 0.11 1 ( EY498161 ) CBBP397...illar-asso... 45 0.002 EF364555_1( EF364555 |pid:none) Macrobrachium rosenbergii clone MA....iolaris isolate PetNM2_1 cellulose ... 48 0.43 1 ( CR382139 ) Debaryomyces hansenii chromosome G of stra...148685 ) CV03077A2H02.f1 CV03-normalized library Euphorbia... 54 0.007 1 ( AC019853 ) Drosophila melanogaste...UEN... 52 0.027 1 ( DX899037 ) KBrH030K23F KBrH, Brassica rapa HindIII BAC libra... 52 0.027 1 ( DX898947 ) KBrH030I23F KBrH, Bras

  14. Twin's Birth-Order Differences in Height and Body Mass Index From Birth to Old Age

    DEFF Research Database (Denmark)

    Yokoyama, Yoshie; Jelenkovic, Aline; Sund, Reijo;

    2016-01-01

    We analyzed birth order differences in means and variances of height and body mass index (BMI) in monozygotic (MZ) and dizygotic (DZ) twins from infancy to old age. The data were derived from the international CODATwins database. The total number of height and BMI measures from 0.5 to 79.5 years of...... age was 397,466. As expected, first-born twins had greater birth weight than second-born twins. With respect to height, first-born twins were slightly taller than second-born twins in childhood. After adjusting the results for birth weight, the birth order differences decreased and were no longer...... statistically significant. First-born twins had greater BMI than the second-born twins over childhood and adolescence. After adjusting the results for birth weight, birth order was still associated with BMI until 12 years of age. No interaction effect between birth order and zygosity was found. Only limited...

  15. AcEST: DK948654 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 397 ISLAQYRSLES 407 >sp|A1A3C7|ATPA_BIFAA ATP synthase subunit alpha OS=Bifidobacterium adolescent...ers Searching..................................................done Score E Sequences producing significant alignments: (bits...hase subunit alpha OS=Bifidobacterium longum GN=atpA PE=3 SV=1 Length = 543 Score = 32.7 bits (73), Expect = 2.0 Identities... producing significant alignments: (bits) Value tr|A9S1F3|A9S1F3_PHYPA Predicted protein OS=Physcomitrella paten...is (strain ATCC 15703 / DSM 20083) GN=atpA PE=3 SV=1 Length = 542 Score = 32.7 bits (73), Expect = 2.0 Identities

  16. Recognition of amino acids and anions by a Zn(Ⅱ)-methylazacalix[4]pyridine complex

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    As a powerful macrocyclic host molecule with unique conformation and cavity structure that are fine-tuned by the bridging nitrogen atoms, methylazacalix[4]pyridine (MACP-4) has been shown to selectively recognize Zn2+ and form stable Zn(Ⅱ)-MACP-4 complexes both in solid state and solution with an association constant up to 5.97 (logKs). The molecular recognition of Zn(Ⅱ)-MACP-4 complexes towards various amino acids and anions with different geometry was investigated by using the spectral titration methods and X-ray analysis. The Zn(Ⅱ)-MACP-4 complex was found to recognize the 17 amino acids tested with the association constant up to 3.97 (logKs). On the other hand, the Zn(Ⅱ)-MACP-4 complex selectively interacted with anions and the maximum association constant of 3.9 (logKs) was obtained.

  17. Exceptional gravimetric and volumetric CO2 uptake in a palladated NbO-type MOF utilizing cooperative acidic and basic, metal-CO2 interactions.

    Science.gov (United States)

    Spanopoulos, I; Bratsos, I; Tampaxis, C; Vourloumis, D; Klontzas, E; Froudakis, G E; Charalambopoulou, G; Steriotis, T A; Trikalitis, P N

    2016-08-18

    A novel NbO-type MOF is reported based on a palladated organic linker, showing a remarkable gravimetric and volumetric CO2 uptake, reaching 201.8 cm(3) g(-1) (9.0 mmol g(-1), 39.7 wt%) and 187.8 cm(3) cm(-3) at 273 K and 1 bar, respectively. Accurate theoretical calculations revealed that the exceptional CO2 uptake is due to the combination of Lewis base Pd(ii)-CO2 (24.3 kJ mol(-1)) and Lewis acid Cu(ii)-CO2 (30.3 kJ mol(-1)) interactions, as well as synergistic pore size effects. PMID:27498783

  18. Conceptions of Adolescence: Implications for Differences in Engagement in School Over Early Adolescence in the United States and China.

    Science.gov (United States)

    Qu, Yang; Pomerantz, Eva M; Wang, Meifang; Cheung, Cecilia; Cimpian, Andrei

    2016-07-01

    American youth are more prone to storm and stress during adolescence than are Chinese youth (e.g., American youth's engagement in school declines more). However, it is unclear why. This research examined differences in conceptions of adolescence in the United States and China. Using both open- and closed-ended measures, youth (N = 397; 50 % female; mean age = 13.19 years) reported on their views of teens. American (vs. Chinese) youth were more likely to see adolescence as a time of decreased family responsibility along with increased individuation from parents, school disengagement, and peer orientation. Conceptions of adolescence as a time of dampened family responsibility and heightened school disengagement contributed to American (vs. Chinese) youth being less engaged in school over the seventh and eighth grades. The findings suggest that culture shapes ideas about adolescence, which contribute to differences in American and Chinese youth's engagement in school over this phase. PMID:27160846

  19. Efficacy of gaseous chlorine dioxide as a sanitizer against Cryptosporidium parvum, Cyclospora cayetanensis, and Encephalitozoon intestinalis on produce.

    Science.gov (United States)

    Ortega, Ynes R; Mann, Amy; Torres, Maria P; Cama, Vitaliano

    2008-12-01

    The efficacy of gaseous chlorine dioxide to reduce parasite and bacterial burden in produce was studied. Basil and lettuce leaves were inoculated with Cryptosporidium parvum and Cyclospora cayetanensis oocysts, Encephalitozoon intestinalis spores, and a cocktail of two isolates of nalidixic acid-resistant Escherichia coli O157:H7. The inoculated samples were then treated for 20 min with gaseous chlorine dioxide at 4.1 mg/liter. Cryptosporidium had a 2.6 and 3.31 most-probable-number log reduction in basil and lettuce, respectively. Reduction of Encephalitozoon in basil and lettuce was 3.58 and 4.58 CFU/g respectively. E. coli loads were significantly reduced (2.45 to 3.97 log), whereas Cyclospora sporulation was not affected by this treatment. PMID:19244892

  20. Hydraulic conductivities of fractures and matrix in Slovenian carbonate aquifers

    Directory of Open Access Journals (Sweden)

    Timotej Verbovšek

    2008-12-01

    Full Text Available Hydraulic conductivities and specific storage coefficients of fractures and matrix in Slovenian carbonate aquifers were determined by Barker’s method for pumping test analysis, based on fractional flow dimension. Values are presented for limestones and mainly for dolomites, and additionally for separate aquifers, divided by age andlithology in several groups. Data was obtained from hydrogeological reports for 397 water wells, and among these, 79 pumping tests were reinterpreted. Hydraulic conductivities of fractures are higher than the hydraulic conductivities of matrix, and the differences are highly statistically significant. Likewise, differences are significant for specific storage, and the values of these coefficients are higher in the matrix. Values of all coefficients vary in separate aquifers, and the differences can be explained by diagenetic effects, crystal size, degree of fracturing, andcarbonate purity. Comparison of the methods, used in the reports, and the Barker’s method (being more suitable for karstic and fractured aquifers, shows that the latter fits real data better.

  1. [Ichthyofauna fisheries in Bahía de Navidad, Jalisco, Mexico, associated to the El Niño event 1997-1998].

    Science.gov (United States)

    Rojo-Vázquez, J A; Aguilar-Palomino, B; Galván-Piña, V H; Godínez-Domínguez, E; Hernández-Vázquez, S; Ruiz-Ramírez, S; Lucano-Ramírez, G

    2001-01-01

    The ichthyofauna fished in Bahía de Navidad, Jalisco, Mexico in the Central Pacific was surveyed during 1998. Six thousand nine hundred and fourty-four organisms of 130 species were caught which weighted 3,231 kg. Nearly 30% of the species belonged to Carangidae. Haemulidae and Sciaenidae. The most important species in number and biomass were Microlepidotus brevipinnins, Caranx caninus and C. caballus. Species number, abundance and biomass fluctuated during the year. The largest number of species was caught in June (61), the minimum in March (33). January had the maximum abundance (1,397 organisms), while the minimum was obtained during August (251). The maximum biomass values were from January (556.5 kg), and the lowest from August (114.7 kg). Eighteen species accumulated 87% of the total abundance, while 20 species represented 86.3% of the biomass. There were large in differences species number, abundance and biomass nets of different mesh size. PMID:12189823

  2. Red luminescence from hydrothermally synthesized Eu-doped ZnO nanoparticles under visible excitation

    Indian Academy of Sciences (India)

    P M Aneesh; M K Jayaraj

    2010-06-01

    Eu-doped ZnO nanoparticles were synthesized by hydrothermal method. The Eu-dopant concentration has been varied by varying the amount of Eu-dopant concentration. These nanoparticles were structurally characterized by X-ray diffraction, transmission electron microscopy and selected area electron diffraction and it confirms the formation of nanoparticles having standard wurtzite structure. Photoluminescence studies show that these nanoparticles exhibit a sharp red luminescence due to the intra-4 transitions of Eu3+ ions at an excitation of 397 nm and 466 nm. Luminescence quenching is observed in the nanoparticles as the Eu-dopant concentration increases. Incorporation of Eu in the nanoparticles was confirmed by the energy dispersive X-ray studies.

  3. 4-Chloro-N-(2,3-dimethylphenyl-2-methylbenzenesulfonamide

    Directory of Open Access Journals (Sweden)

    K. Shakuntala

    2011-10-01

    Full Text Available The asymmetric unit of the title compound, C15H16ClNO2S, contains two independent moleules. The conformation of the N—H bonds are anti to the ortho-methyl groups in the sulfonyl benzene rings of both the molecules, while the N—H bonds are anti to the ortho- and meta-methyl groups in the aniline ring of one of the molecules and syn in the other. Furthermore, the torsion angles of the C—SO2—NH—C segments in the two molecules of are −66.8 (3 and 70.3 (3°. The sulfonyl and the aniline benzene rings are oriented at angles of 44.1 (1 and 39.7 (1° in the two molecules. In the crystal, pairs of N—H...O hydrogen bonds link the molecules into dimers.

  4. Activity Enhancement of Pt/Ba/Al2O3 Mixed with Mn/Ba/Al2O3 for NOx Storage-reduction by Hydrogen

    Institute of Scientific and Technical Information of China (English)

    Jian Hua XIAO; Xue Hui LI; Sha DENG; Fu Rong WANG; Le Fu WANG

    2006-01-01

    Mn/Ba/Al2O3 catalyst for NO oxidation-storage and Pt/Ba/Al2O3 catalyst mixed with Mn/Ba/Al2O3 for NOx storage-reduction by hydrogen were investigated. The results showed that Mn/Ba/Al2O3 had large nitrogen oxides storage capacity (397.9 μmolg-1) under lean bum condition.When Pt/Ba/Al2O3 catalyst was mixed with Mn/Ba/Al2O3 in equal weight proportion, the NOx conversion increased between 250 ℃ and 500 ℃ under the dynamic lean-rich bum conditions, and the maximum NOx conversion increased from 95.4% to 98.2%. Mn/Ba/Al2O3 has promoted NOx storing in the lean stage and improved NOx reduction efficiency in the rich stage, these might result in higher NOx conversion over the low Pt loading content catalyst.

  5. Estimating Additive and Non-Additive Genetic Variances and Predicting Genetic Merits Using Genome-Wide Dense Single Nucleotide Polymorphism Markers

    DEFF Research Database (Denmark)

    Su, Guosheng; Christensen, Ole Fredslund; Ostersen, Tage; Henryon, Mark; Lund, Mogens Sandø

    2012-01-01

    of genomic predictions for daily gain in pigs. In the analysis of daily gain, four linear models were used: 1) a simple additive genetic model (MA), 2) a model including both additive and additive by additive epistatic genetic effects (MAE), 3) a model including both additive and dominance genetic...... effects (MAD), and 4) a full model including all three genetic components (MAED). Estimates of narrowsense heritability were 0.397, 0.373, 0.379 and 0.357 for models MA, MAE, MAD and MAED, respectively. Estimated dominance variance and additive by additive epistatic variance accounted for 5.6% and 9.5% of...... the total phenotypic variance, respectively. Based on model MAED, the estimate of broad-sense heritability was 0.506. Reliabilities of genomic predicted breeding values for the animals without performance records were 28.5%, 28.8%, 29.2% and 29.5% for models MA, MAE, MAD and MAED, respectively. In...

  6. AcEST: DK954756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ia with plantlets Developmental stage gametophytes with sporophytes...556 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_E16. 5' end sequence. Accession DK954756 Tissue type prothall...Sbjct: 250 GLKVL 254 >sp|Q5HZ36|GAT24_ARATH GATA transcription factor 24 OS=Arabidopsis thaliana GN=At5g56860 PE=2 SV=2 Length...: 376 VFPQDEKEAAVLLMALSYGMVH 397 >sp|Q9SZI6|GAT20_ARATH Putative GATA transcription factor 20 OS=Arabidopsis thal...sp_hit_id Q6NXE6 Definition sp|Q6NXE6|ARMC6_HUMAN Armadillo repeat-containing protein 6 OS=Homo sapiens Align length

  7. Investigation of molybdenum pentachloride interaction with chlorine

    International Nuclear Information System (INIS)

    In Raman spectra of molybdenum pentachloride solutions in liquid chlorine lines were recorded in case of 397, 312, 410, 217 and 180 cm-1 vibrations of ν1(A1'), ν2(A1'), ν5(E'), ν6(E') and ν8(E'') monomer (symmetry D3h) molecules of MoCl5. Interaction of molten molybdenum pentachloride with chlorine at increased (up to 6 MPa) pressures of Cl2 was studied. In Raman spectra of its vapour distillation in liquid chlorine alongside with MoCl5 lines appearance of new lines at 363 and 272 cm-1, similar in their frequency to the ones calculated for the vibrations ν1(A1g) and ν2(Eg) of MoCl6 molecules (symmetry Oh), was observed

  8. AcEST: DK961233 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0009_I22 677 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_I22. 5' end seq ... protein At1g47730 OS=Arabido... 40 0.009 sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... S---SLPLDLTSEIFSRLPAKSVVRFRCVSKLWSSI 55 >sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... thaliana GN=UFO ... PE=1 SV=2 Length = 442 Score = 39.7 bits (91), Exp ... |Q84UE8_LOTJA Proliferating floral organs protein (UFO -... 45 0.003 tr|A9TZQ0|A9TZQ0_PHYPA Predicted prot ...

  9. Migration of Florida sub-adult Bald Eagles

    Science.gov (United States)

    Mojica, E.K.; Meyers, J.M.; Millsap, B.A.; Haley, K.L.

    2008-01-01

    We used satellite telemetry locations accurate within 1 km to identify migration routes and stopover sites of 54 migratory sub-adult Bald Eagles (Haliaeetus leucocephalus) hatched in Florida from 1997 to 2001. We measured number of days traveled during migration, path of migration, stopover time and locations, and distance traveled to and from winter and summer areas for each eagle (1?5 years old). Eagles used both Coastal Plain (n = 24) and Appalachian Mountain (n = 26) routes on their first migration north. Mountain migrants traveled farther (X = 2,112 km; 95% CI: 1,815-2,410) than coastal migrants (X = 1,397 km; 95% CI: 1,087?1,706). Eagles changed between migration routes less often on northbound and southbound movements as they matured (X2 = 13.22, df = 2, P Bald Eagles in the eastern United States.

  10. The mediated influence of a traceability label on consumer’s willingness to buy the labelled product

    DEFF Research Database (Denmark)

    Bradu, Cosmina; Orquin, Jacob Lund; Thøgersen, John

    2014-01-01

    This paper investigates the effectiveness of a new traceability label on consumer willingness to buy the labelled product and whether the effect is mediated by moral affective evaluations of the product. A betweensubjects factorial design was used to test (a) the effect of a new traceability label...... from the panel of an online sample provider (667 women, 397 men), age range 18–80 (M = 46.39, SD = 13.17). We found that the traceability label has a significant impact on consumer willingness to buy a chocolate bar. This impact is mediated by moral affective evaluations of the chocolate bar. Based...... on the dual process models of persuasion (HSM and ELM), we conclude that consumers mainly process the traceability label in a heuristic way, through a peripheral route, making a fast and frugal, affect-based judgment, rather than one based on elaborate reasoning. Being one of the first empirical studies...

  11. A Study of Job Satisfaction Among Community Nurses in A District%某区社区护士工作满意度的影响因素调查研究

    Institute of Scientific and Technical Information of China (English)

    唐娜; 沈琪; 邓婧怡; 兰雅平; 徐芳; 廖金兰

    2014-01-01

    目的:了解深圳市福田区社区护士工作满意度、工作稳定性及离职意愿的现状,并探讨工作满意度与工作稳定性、离职意愿三者之间的关系及其影响因素。方法本研究是横断面研究,采用方便抽样法,选取深圳市福田区27家社康中心一线在职注册护士,用社区卫生机构员工工作满意度调查表。结果被调查对象总体满意度平均得分为(113.46±25.04)分,工作条件、报酬与福利、培训与晋升等3个维度满意度得分较低分别为(8.41±1.87)、(10.22±3.10)、(10.68±3.97)分;领导管理、工作本身、人际关系等3个维度得分相对较高分别为(22.17±5.03)、(18.10±3.73)、(15.68±3.97)分。logistic回归分析发现年龄、用工形式、职称、月收入和是否喜欢护理工作是影响工作满意度的主要因素。结论深圳市福田区社区护士工作满意度处于中低水平;建立合理的报酬、晋升和培训机制,构建良好的工作环境是提高工作稳定性、工作满意度和降低离职率的根本解决办法。%Objective To investigate the job satisfaction of nurses in order to provide information for designing effective motivational programs and improving their job satisfaction. Methods With convenience sampling, a cross-sectional study involving 113 registered nurses from 27 community health service centers and above of Shenzhen Futian District was conducted through Job satisfaction questionnaire, Job security questionnaire and Turnover Intention Scale. Results The scores of the total job satisfaction , working conditions, Remuneration and welfare, Training and promotion were (113.46± 25.04), (8.41±1.87), (10.22±3.10), (10.68±3.97) respectively. And the scores of Leadership Management, working, relationship were (22.17±5.03), (18.10± 3.73), (15.68±3.97) respectively .Logistic regression analysis showed that there were statistically significant differences

  12. Molecular weight and its distribution of tetrafluoroethylene and propylene copolymer

    International Nuclear Information System (INIS)

    In comparison of molecular structure of tetrafluoroethylene and propylene copolymer produced by radiation and chemical initiators respectively, both were fractionated by elution method and fine structure was examined. For the fractionated sample by radiation, the relation between molecular weight anti Mn and intrinsic viscosity ( eta] is ( eta] = 3.97 x 10-4 anti Mnsup(0.630) The result is not in agreement with that of the unfractionated sample by radiation, and similar to those of samples by chemical initiators. There is no difference, however, in the elution method of GPC between both these copolymers; the elution behavior agrees with that of standard polystyrene. Long chain branching thus exists little in the copolymer of tetrafluoroethylene and propylene. To reveal the relations between reaction conditions and molecular weight and its distribution of the copolymer produced by flow apparatus, the molecular weight distribution was measured by GPC. The method of analysis could evaluate molecular weight distribution changing constantly. (auth.)

  13. New radiometric ages for the BH-1 hominin from Balanica (Serbia: implications for understanding the role of the Balkans in Middle Pleistocene human evolution.

    Directory of Open Access Journals (Sweden)

    William J Rink

    Full Text Available Newly obtained ages, based on electron spin resonance combined with uranium series isotopic analysis, and infrared/post-infrared luminescence dating, provide a minimum age that lies between 397 and 525 ka for the hominin mandible BH-1 from Mala Balanica cave, Serbia. This confirms it as the easternmost hominin specimen in Europe dated to the Middle Pleistocene. Inferences drawn from the morphology of the mandible BH-1 place it outside currently observed variation of European Homo heidelbergensis. The lack of derived Neandertal traits in BH-1 and its contemporary specimens in Southeast Europe, such as Kocabaş, Vasogliano and Ceprano, coupled with Middle Pleistocene synapomorphies, suggests different evolutionary forces acting in the east of the continent where isolation did not play such an important role during glaciations.

  14. Rolling Friction Torque in Ball-Race Contacts Operating in Mixed Lubrication Conditions

    Directory of Open Access Journals (Sweden)

    Mihaela Rodica D. Bălan

    2015-04-01

    Full Text Available Based on a theoretical model and an experimental methodology for defining the friction torque for lubricated conditions in a modified thrust ball bearing having only three balls, the authors experimentally investigated the influence of the lubricant parameter Λ on friction torque for mixed IVR (isoviscous rigid and EHL (elastohydrodynamic lubrication conditions. The experiments were conducted using ball diameters of 3 mm, 3.97 mm and 6.35 mm loaded at 0.125 N, 0.400 N and 0.633 N. Two oils of viscosity 0.08 Pa·s and 0.05 Pa·s were used and rotational speed was varied in the range 60–210 rpm to obtain a lubricant parameter Λ varying between 0.3 and 3.2. The experiments confirmed that the measured friction torque can be explained using hydrodynamic rolling force relationships respecting the transition from an IVR to an EHL lubrication regime.

  15. Irradiation of potatoes in Turkey. A feasibility study

    International Nuclear Information System (INIS)

    A preliminary investigation was done on the economic feasibility of installing a 60Co facility in central Turkey for the irradiation of potatoes. The city selected for study was Nevsehir. Of the 4 million tonnes of potatoes produced in Turkey each year 38% comes from this region. The investment criteria used for assessing economic feasibility were the internal rate of return, net present value, benefit-cost ratio and payback period. The calculated total investment cost (capital plus operational costs) for the facility was US $2,397,615. Unit processing cost was estimated at US $11.05/t. The study showed that installation of a 60Co facility at Nevsehir would be financially viable if it operated 3000 h/a. (author). 6 refs, 6 tabs

  16. Clinical validation of a real-time polymerase chain reaction assay for rapid detection of Acinetobacter baumannii colonization.

    Science.gov (United States)

    Blanco-Lobo, P; González-Galán, V; García-Quintanilla, M; Valencia, R; Cazalla, A; Martín, C; Alonso, I; Pérez-Romero, P; Cisneros, J M; Aznar, J; McConnell, M J

    2016-09-01

    Real-time polymerase chain reaction (PCR)-based approaches have not been assessed in terms of their ability to detect patients colonized by Acinetobacter baumannii during active surveillance. This prospective, double-blind study demonstrated that a real-time PCR assay had high sensitivity (100%) and specificity (91.2%) compared with conventional culture for detecting A. baumannii in 397 active surveillance samples, and provided results within 3h. Receiver-operator curve analyses demonstrated that the technique has diagnostic accuracy of 97.7% (95% confidence interval 96.0-99.3%). This method could facilitate the rapid implementation of infection control measures for preventing the transmission of A. baumannii. PMID:27206968

  17. A practical and efficient diabatization that combines Lorentz and Laplace functions to approximate nonadiabatic coupling terms.

    Science.gov (United States)

    An, Heesun; Baeck, Kyoung Koo

    2015-11-21

    A fixed relation of α × β = 1.397 between the α- and β-parameters of a Lorentz function and a Laplace function that approximates nonadiabatic coupling terms and maximizes the overlap area between the two functions was found. The mixing angle corresponding to the geometric average between the potential couplings calculated using the individual path-integral of the two functions was then used in the construction of diabatic states and the coupling of the states. Employing the new method, the actual computation of nonadiabatic coupling terms at just a few geometries before and after the guessed conical intersection is enough, and the remaining steps are straightforward and almost automatic. The new method was tested for the one-dimensional LiF system and the two-dimensional space of the collinear case of NH3Cl, and promising results were achieved. PMID:26590522

  18. Domestic violence against women in Kersa, Oromia region, eastern Ethiopia

    DEFF Research Database (Denmark)

    Shanko, W.; Wolday, M.; Assefa, N.;

    2013-01-01

    Intimate partner violence is common in rural areas of Ethiopia. The aim of this study was to assess the knowledge and prevalence of domestic violence among women in Kersa district of Oromia region and identify the types, perpetuators and triggers for violence. A community-based cross......-sectional interview-based survey was conducted in 2008 on 858 women of reproductive age. Only 39.7% of women reported that they recognized that violence against women was a problem in their area. Ever experience of violence by an intimate partner was reported by 166 women (19.6%) and 70.3% of the perpetuators were...... husbands. Ever experience of domestic violence among women was significantly related to Amhara ethnicity and age group 30-49 years. Only 33 (19.9%) women who ever experienced violence had reported it to the legal authorities. Women's reasons for failing to report to the legal system were not wanting...

  19. Oral Midodrine Hydrochloride for Prevention of Orthostatic Hypotension during Early Mobilization after Hip Arthroplasty

    DEFF Research Database (Denmark)

    Jans, Øivind; Mehlsen, Jesper; Kjærsgaard-Andersen, Per;

    2015-01-01

    BACKGROUND: Early postoperative mobilization is essential for rapid recovery but may be impaired by orthostatic intolerance (OI) and orthostatic hypotension (OH), which are highly prevalent after major surgery. Pathogenic mechanisms include an insufficient postoperative vasopressor response. The...... older and scheduled for total hip arthroplasty under spinal anesthesia to either 5 mg midodrine hydrochloride or placebo orally 1 h before mobilization at 6 and 24 h postoperatively. The primary outcome was the prevalence of OH (decrease in systolic or diastolic arterial pressures of > 20 or 10 mm......Hg, respectively) during mobilization 6 h after surgery. Secondary outcomes were OI and hemodynamic responses to mobilization at 6 and 24 h. RESULTS: At 6 h, 14 (25%; 95% CI, 14 to 38%) versus 23 (39.7%; 95% CI, 27 to 53%) patients had OH in the midodrine and placebo group, respectively, relative risk 0.63 (0...

  20. Improvement of vacuum squeezing resonant on the rubidium D1 line at 795 nm

    CERN Document Server

    Han, Yashuai; He, Jun; Yang, Baodong; Wang, Yanhua; Wang, Junmin

    2016-01-01

    We report on efficient generation of second harmonic laser and single-mode vacuum squeezed light of 795 nm with periodically poled KTiOPO4 (PPKTP) crystals. We achieved 111 mW of ultra-violet (UV) light at 397.5 nm from 191 mW of fundamental light with a PPKTP crystal in a doubling cavity, corresponding to a conversion efficiency of 58.1%. Using the UV light to pump an optical parametric oscillator with a PPKTP crystal, we realized -5.6 dB of a maximum squeezing. We analyzed the pump power dependence of the squeezing level and concluded that the UV light induced losses limit the improvement of the squeezing level. The generated squeezed light has huge potential application in quantum memory and ultra-precise measurement.

  1. Results of a Longer Term NDACC Measurements Comparison Campaign at Mauna Loa Observatory

    Directory of Open Access Journals (Sweden)

    McGee Thomas J.

    2016-01-01

    Full Text Available Between November, 2015 and January, 2015, the Goddard Space Flight Center operated a pair of lidar instruments at the NOAA facility at Mauna Loa on the Big Island of Hawaii (Lat. 19.5N, Lon. 155.5 W, Altitude 3.397 km. Measurements were made during six different four week periods during this time period by both the NASA GSFC Stratospheric Ozone Lidar (STROZ and the Aerosol and Temperature (ATL lidar. Also making measurements were the JPL Stratospheric Ozone Lidar and the NOAA Aerosol and Water Vapor Lidar. All instruments participate and archive data with the Network for the Detection of Atmospheric Composition Change. Measurement comparisons were made among various instruments in accordance with the standard intercomparison protocols of the NDACC.

  2. Del “Cuaderno de Prácticas” a la “Plataforma de Evaluación de Prácticas Clínicas“ en odontología

    OpenAIRE

    Gutiérrez Cárdenas, Lisbet; Leco Berrocal, María Isabel

    2015-01-01

    En la Policlínica Universitaria de la Universidad Europea de Madrid, los alumnos de 4º y 5º curso de Odontología realizan las prácticas clínicas; una media de 9.361 pacientes, 43.397 consultas y 87.669 tratamientos al año, lo avalan. La atención clínica está orientada en el paciente y el aprendizaje centrado en el alumno, bajo la supervisión del profesorado, con el objetivo de lograr una formación basada en el cumplimiento de las competencias, con estándares de validez, fiabilidad, equivalenc...

  3. Sperm whale clicks: Directionality and source level revisited

    DEFF Research Database (Denmark)

    Møhl, Bertel; Wahlberg, Magnus; Madsen, Peter T.;

    2000-01-01

    In sperm whales ~Physeter catodon L. 1758! the nose is vastly hypertrophied, accounting for about one-third of the length or weight of an adult male. Norris and Harvey @in Animal Orientation and Navigation, NASA SP-262 ~1972!, pp. 397–417# ascribed a sound-generating function to this organ complex....... A sound generator weighing upward of 10 tons and with a cross-section of 1 m is expected to generate high-intensity, directional sounds. This prediction from the Norris and Harvey theory is not supported by published data for sperm whale clicks ~source levels of 180 dB re 1 mPa and little, if any...... implicates sonar as a possible function of the clicks. Thus, previously published properties of sperm whale clicks underestimate the capabilities of the sound generator and therefore cannot falsify the Norris and Harvey theory....

  4. AcEST: BP917824 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 917824|Adiantum capillus-veneris mRNA, clone: YMU001_000105_H08. (518 letters) Database: uniprot_sprot.fasta 412,525 seq..._3, whole genome shotgun sequence OS=Vitis vinifera Align length 27 Score (bit) 39.7 E-value 0.091 Report BL...24|Adiantum capillus-veneris mRNA, clone: YMU001_000105_H08. (518 letters) Database: uniprot_trembl.fasta 7,341,751 seq...erized protein OS=Magna... 33 8.5 >tr|A7NYZ9|A7NYZ9_VITVI Chromosome chr6 scaffold_3, whole genome shotgun sequence OS=Vitis...9) Link to BlastX Result : Swiss-Prot sp_hit_id P04929 Definition sp|P04929|HRPX_PLALO His

  5. Flood-inundation maps and wetland restoration suitability index for the Blue River and selected tributaries, Kansas City, Missouri, and vicinity, 2012

    Science.gov (United States)

    Heimann, David C.; Kelly, Brian P.; Studley, Seth E.

    2015-01-01

    Digital flood-inundation maps for a 39.7-mile reach of the Blue River and selected tributaries (Brush Creek, Indian Creek, and Dyke Branch) at Kansas City, Missouri, and vicinity, were created by the U.S. Geological Survey (USGS) in cooperation with the City of Kansas City, Missouri. The flood-inundation maps, accessed through the USGS Flood-Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the spatial extent and depth of flooding corresponding to selected water levels (stages) at 15 reference streamgages and associated stream reaches in the Blue River Basin. Near-real-time stage data from the streamgages may be obtained from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service (AHPS) at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at selected sites.

  6. Electron drift in a large scale solid xenon

    CERN Document Server

    Yoo, J

    2015-01-01

    A study of charge drift in a large scale optically transparent solid xenon is reported. A pulsed high power xenon light source is used to liberate electrons from a photocathode. The drift speeds of the electrons are measured using a 8.7\\,cm long electrode in both the liquid and solid phase of xenon. In the liquid phase (163\\,K), the drift speed is 0.193 $\\pm$ 0.003 cm/$\\mu$s while the drift speed in the solid phase (157\\,K) is 0.397 $\\pm$ 0.006 cm/$\\mu$s at 900 V/cm over 8.0\\,cm of uniform electric fields. Therefore, it is demonstrated that a factor two faster electron drift speed in solid phase xenon compared to that in liquid in a large scale solid xenon.

  7. The Ultraviolet Filter Imager (SuFI) onboard the Sunrise balloon-borne solar observatory: Instrument description and first results

    Science.gov (United States)

    Gandorfer, Achim; Barthol, Peter; Feller, Alex; Grauf, Bianca; Hirzberger, Johann; Riethmueller, Tino; Solanki, Sami K.; Berkefeld, Thomas; Knoelker, Michael; Martinez Pillet, Valentin; Schmidt, Wolfgang; Title, Alan

    We describe the design of the near UV filter imager SuFi onboard Sunrise, which was successfully flown in the stratosphere in June 2009. During its five days flight SuFI captured the highest contrast images of solar granulation ever. SuFI is a diffraction limited filter imager with an effective focal length of 121m, working in 5 distinct wavelength bands between 210nm and 397nm. It is based on a two mirror modified Schwarzschild microscope, which is integral part of the central Image stabilization and light Distribution unit (ISLiD) of Sunrise, which acts as the reimaging optics between the 1m telescope and the science instruments. The key technical features of the instrument are presented under the view of the specific demands of balloon-borne optical systems. First results obtained with the instrument are presented to demonstrate the capabilities of the instrument.

  8. Relation between the Sunrise photospheric magnetic field and the Ca II H bright features

    Science.gov (United States)

    Jafarzadeh, Shahin; Hirzberger, J.; Feller, A.; Lagg, A.; Solanki, S. K.; Pietarila, A.; Danilovic, S.; Riethmueller, T.; Barthol, P.; Berkefeld, T.; Gandorfer, A.; Knülker, M.; Martínez Pillet, V.; Schmidt, W.; Schüssler, M.; Title, A.

    Recent observations from the Sunrise balloon-borne solar telescope have enabled us to reach an unprecedented high spatial resolution on the solar surface with the near-ultraviolet photo-spheric and chromospheric images as well as the magnetograms. We use these high resolution observations to investigate the structure of the solar upper photosphere and lower chromosphere as well as their temporal evolutions. We study the relation between the inter-granular Ca II 397 nm bright structures in images obtained by the Sunrise Filter Imager (SuFI) and their corresponding photospheric vector magnetic field computed from the Imaging Magnetogram eXperiment (IMaX) observations. The targets under study are in a quiet Sun region and close to disc-centre.

  9. Landscape preservation under ice? In-situ 10Be and 26Al from summit surfaces along Sognefjord, Norway

    DEFF Research Database (Denmark)

    Andersen, Jane Lund; Egholm, David Lundbek; Knudsen, Mads Faurschou;

    then be used to determine the total Quaternary bedrock erosion between the summits. However, the amount of Quaternary erosion of these summit flats remains debated (e.g. Steer, 2012) Here, we present an extensive new dataset of in-situ produced cosmogenic 10Be and 26Al in bedrock and boulders from high...... and flat summits along a 200 km long transect from the coast to the inner parts of Sognefjorden. Our results indicate substantial glacial modification of the summits within the last 50 ka. Close to the coast, at an elevation of around 700 meters, the cosmogenic nuclide signal was reset around the Younger...... et al. Landscape preservation under Fennoscandian ice sheets determined from in situ produced 10 Be and 26 Al. Earth and Planetary Science Letters 201(2), 397-406, 2002. Gjermundsen et al. Minimal erosion of Arctic alpine topography during late Quaternary glaciation. Nature Geoscience 8(10), 789...

  10. Study on Microstructure and Nanomechanics Properties of Antibacterial Bone China

    Institute of Scientific and Technical Information of China (English)

    Zhang Zhenyu; Li Hongqi; Zhang Jin; Zhou Hongxiu; Wang Lijuan; Zhang Taihua

    2004-01-01

    Fracture appearance, surface and nanomechanics properties of antibacterial ceramics contairing rare earth phosphate composite antibacterial materials were characterized and measured by SEM, AFM and Nanoindenter, respectively. Results show that grain of fracture surface of antibacterial ceramics grows uniform refinement topography of bubble break-up appears at the surface, which is flat and has liquid character, by adding the phosphate composite containing rare earth, nevertheless needle-like crystal and granular outgrowth form at fracture surface and surface of common ceramics, respectively. Young's modulus of antibacterial ceramic film is 74. 397 GPa and hardness is 8. 134 GPa, which increses by 4.4% and 1.6% comparing with common ceramics, respectively. Loading curves of two kind of ceramics have obvious nonlinear character under 700 nm and linear character between 700 ~ 1000 nm, and unloading curve have obvious linear character.

  11. Ontario emissions trading code : emission reduction credit creation, recording and transfer rules, rules for renewable energy projects and conservation projects, and rules for the operation of the Ontario Emissions Trading Registry

    International Nuclear Information System (INIS)

    Emissions trading has been an integral part of Ontario's air quality strategy since December 31, 2001. Ontario has adopted the 'cap, credit and trade' type of emissions trading system, a hybrid that takes the best features of pure 'cap-and-trade' and 'baseline-and-credit' type systems. It covers nitric oxide and sulphur dioxide. The Ontario Emissions Trading Code supplements Ontario Regulation 397/01 and sets out rules for renewable energy projects and conservation projects for which applications for emission allowances can be made. This Code describes the rules for the creation and transfer of emission reduction credits (ERCs). It also explains the rules for the operation of the registry that has been established to provide information to the public about the emissions trading program and records decisions about credit creation and credit and allowance retirement. 3 tabs

  12. How Do The Demographic Components Influence Job Satisfaction In The Hospitality Industry?

    Directory of Open Access Journals (Sweden)

    Derya KARA

    2010-12-01

    Full Text Available In this research, job satisfaction has been clarified according to different features of employees who work at accommodation establishments by emphasizing conceptual perspective about job satisfaction. Minnesota Satisfaction Questionnaire which evaluates job satisfaction regarding 20 dimensions has been used as a mean of data collection. Application field of the research consists of 397 employees who work at 5 star hotel establishments in Ankara. The data were solved using percent, frequency, mean, standard deviation, t-test, Anova and Tukey analysis. As a result of this research; it has been seen that, there is no statistical difference about job satisfaction level of employees work at hotel establishments considering their gender and marital status. Besides, it has been understood that, there is a statistical difference about job satisfaction level of employees considering their ages, education levels, incomes, and length of time in tourism sector.

  13. Multi-objective optimization of glycopeptide antibiotic production in batch and fed batch processes

    DEFF Research Database (Denmark)

    Maiti, Soumen K.; Eliasson Lantz, Anna; Bhushan, Mani; Wangikar, Pramod P.

    2011-01-01

    as pareto optimal solutions. These solutions gives flexibility in evaluating the trade-offs and selecting the most suitable operating policy. Here, ε-constraint approach was used to generate the pareto solutions for two objectives: product concentration and product per unit cost of media, for batch...... and fed batch operations using process model for Amycolatopsis balhimycina, a glycopeptide antibiotic producer. This resulted in a set of several pareto optimal solutions with the two objectives ranging from (0.75gl−1, 3.97g$-1) to (0.44gl−1, 5.19g$-1) for batch and from (1.5gl−1, 5.46g$-1) to (1.1gl......−1, 6.34g$-1) for fed batch operations. One pareto solution each for batch and for fed batch mode was experimentally validated....

  14. Self-assembly does not account for the hydrophobic effect.

    Science.gov (United States)

    Abraham, Michael H; Blandamer, Michael J

    2002-07-01

    Marmur has claimed that large values of activity coefficients for nonelectrolytes, particularly in the context of hydrophobic interactions between solutes in aqueous solution at ambient temperature and pressure, cannot be accounted for by thermodynamics, and has suggested that association (self-assembly) of solute molecules in solution solves this dilemma. We show that the analysis of Marmur is incorrect, specifically because the equilibrium in solution between monomeric solute molecules and associated solute molecules is entirely ignored. We show further that activity coefficients such as that for nitromethane solute in hexane solvent, 39.7, and that for solute hexane in solvent water, 4.48 x 10(5), can be calculated as 31.9 and 4.71 x 10(5), respectively, by methods based on well-known molecule-molecule interactions. No assumption of self-assembly is required. PMID:12083940

  15. Mental health predicts better academic outcomes: a longitudinal study of elementary school students in Chile.

    Science.gov (United States)

    Murphy, J Michael; Guzmán, Javier; McCarthy, Alyssa E; Squicciarini, Ana María; George, Myriam; Canenguez, Katia M; Dunn, Erin C; Baer, Lee; Simonsohn, Ariela; Smoller, Jordan W; Jellinek, Michael S

    2015-04-01

    The world's largest school-based mental health program, Habilidades para la Vida [Skills for Life (SFL)], has been operating on a national scale in Chile for 15 years. SFL's activities include using standardized measures to screen elementary school students and providing preventive workshops to students at risk for mental health problems. This paper used SFL's data on 37,397 students who were in first grade in 2009 and third grade in 2011 to ascertain whether first grade mental health predicted subsequent academic achievement and whether remission of mental health problems predicted improved academic outcomes. Results showed that mental health was a significant predictor of future academic performance and that, overall, students whose mental health improved between first and third grade made better academic progress than students whose mental health did not improve or worsened. Our findings suggest that school-based mental health programs like SFL may help improve students' academic outcomes. PMID:24771270

  16. Changing certain aspects of Band Four:how negative backwash mightbe changed to positive

    Institute of Scientific and Technical Information of China (English)

    邓妮

    2011-01-01

    Positive and negative and backwash:the concept Backwash is known as the effect of testing and learning which can either be harmful or beneficial (Hughes 1989:1).Messick called backwash "...the extent to which the introduction and use of a learners to do things they would not otherwise do that promote or inhibit language learning"(1996:241).Positive backwash can be considered as an aid to teaching and learning,‘encouraging the learner's awareness and to make the teaching and learning process as effective as possible'(Hedge 2000:397).On the contrary,negative backwash can prevent the teaching and learning process from progressing.Hughes points out that if a test is regarded as important,preparation for it can then dominate all teaching and learning activities,especially if the testing techniques are at variance with the objective of the course(Hughes 1989:1).

  17. Fabrication of visible-light responsive S-F-codoped TiO2 nanotubes

    Institute of Scientific and Technical Information of China (English)

    CHEN XiuQin; SU YaLing; ZHANG XingWang; LEI LeCheng

    2008-01-01

    Fabrication and S-F-codoping of TiO2 nanotubes were carried out by a one-step electrochemical ano-dization process to extend the photoresponse of TiO2 to the visible-light region. The prepared samples were annealed in air and deteoted by SEM, XRD, XPS and UV-vis DRS speotrophotometer. The results showed that the average tube diameter of the nanotubes was 150 nm and the average tube length was 400 nm. The doped TiO2 nanotubes exhibited strong absorption in visible-light region. Photoelectro- catalytic degradation efficiency of 4-CP over S-F-codoped TiO2 nanotubes was 39.7% higher than that of only-F-doped sample. Moreover, sulfur and fluorine codoped into substitutional sites of TiO2 had been proven to be indispensable for strong response and high photocatalytic activity under visible light, as assessed by XPS.

  18. Iodine deficiency in pregnancy in Denmark. Regional variations and frequency of individual iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, P; Børlum, K G;

    1993-01-01

    containing vitamin/mineral tablets. Approximately one third of the women had received tablets containing iodine. In women who had not received iodine supplementation urinary iodine was low with a median value of 39.7 micrograms/g creatinine (Aalborg 28, Randers 33, Ringkøbing 34, Arhus 43 and Copenhagen 62...... micrograms/g creatinine). These values are far below internationally recommended levels. The consequences remain to be evaluated and no firm recommendations can be given. It seems reasonable, however, to recommend a high intake of food containing iodine (e.g. milk products) during pregnancy and lactation....... Since nearly all the women took some kind of vitamin/mineral supplementation it could be considered to advocate intake of vitamin/mineral tablets containing iodine. Udgivelsesdato: 1993-Jul...

  19. Transcriptome profiling of human pre-implantation development.

    Directory of Open Access Journals (Sweden)

    Pu Zhang

    Full Text Available BACKGROUND: Preimplantation development is a crucial step in early human development. However, the molecular basis of human preimplantation development is not well known. METHODOLOGY: By applying microarray on 397 human oocytes and embryos at six developmental stages, we studied the transcription dynamics during human preimplantation development. PRINCIPAL FINDINGS: We found that the preimplantation development consisted of two main transitions: from metaphase-II oocyte to 4-cell embryo where mainly the maternal genes were expressed, and from 8-cell embryo to blastocyst with down-regulation of the maternal genes and up-regulation of embryonic genes. Human preimplantation development proved relatively autonomous. Genes predominantly expressed in oocytes and embryos are well conserved during evolution. SIGNIFICANCE: Our database and findings provide fundamental resources for understanding

  20. Wind tunnel modelling in conservation

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Stanislav; Drdácký, Miloš; Slížková, Zuzana; Lesák, Jaroslav; Knotková, D.

    Praha : ITAM,v.v.i, 2007 - (Drdácký, M.; Chapuis, M.), s. 397-408 ISBN 978-80-86246-31-4. [Intern. conference SAUVEUR. Safeguarded cultural heritage /7./. Praha (CZ), 31.05.2006-03.06.2006] Grant ostatní: evropská komise(XE) SSPI-CT-2003-501837; evropská komise(XE) SSPI-CT-2004-501609; evropská komise(XE) HPRI-CT-2002-00199 Institutional research plan: CEZ:AV0Z20710524 Source of funding: R - rámcový projekt EK ; R - rámcový projekt EK ; R - rámcový projekt EK Keywords : wind effects * historic structures * climatic factors Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Prevalence of G6PD deficiency among recruits in the Singapore Armed Forces.

    Science.gov (United States)

    Lim, M K; Tan, E H; Wan, A; Chao, A K

    1995-03-01

    Between 1986 and 1990, 107,397 National Servicemen between the ages of 17 to 18 years were screened on enlistment for Glucose-6-Phosphate Dehydrogenase (G6PD) enzyme activity by fluorescent spot test. The overall prevalence rate was 1.6% with ethnic differences as follows: 1.62% for Chinese, 1.80% for Malay, 0.76% for Indian and 0.68% for other races. The majority had no prior knowledge of their G6PD deficiency status (89.9%), or of any significant haemolytic episode (93.3%). The rest gave a history of neonatal jaundice, non-neonatal jaundice, anaemia and haemoglobinuria. Maloprim, fava beans, sulphur drugs and aspirin were cited as triggering factors. PMID:7653979

  2. Optical Properties of Co2+ Doped ZnS Nanocrystals

    Science.gov (United States)

    Sarkar, R.; Kumbhakar, P.; Mitra, A. K.

    2010-10-01

    ZnS nanocrystals with Co2+ doping have been prepared through a soft chemical route. The undoped ZnS and Co2+ doped ZnS:Co nanocrystals have been analyzed using X-ray diffraction (XRD), high resolution transmission electron microscope (HRTEM), and ultraviolet-visible (UV-VIS) spectrophotometer. Undoped sample exhibits room-temperature photoluminescence (PL) emission in the blue region with a broad spectral band peaked at ˜397 nm under UV excitation. But from the 1.5% Co2+ doped samples, a strong blue emission peaked at ˜470 nm is observed and further increase in doping leads to considerable blue shift and enhancement in intensity of the PL spectrum.

  3. Complete mitochondrial DNA genome of Polytremis nascens (Lepidoptera: Hesperiidae).

    Science.gov (United States)

    Jiang, Weibin; Zhu, Jianqing; Yang, Qichang; Zhao, Huidong; Chen, Minghan; He, Haiyan; Yu, Weidong

    2016-09-01

    In this study, the complete mitochondrial DNA (mtDNA) sequence of Polytremis nascens (Lepidoptera: Hesperiidae) was determined. The 15,392 bp mitogenome with GenBank accession number KM981865 contained 13 protein genes, 22 tRNAs, 2 rRNAs, and a non-coding control region (D-loop). All the 37 typical animal mitochondrial genes were found. The overall base composition was 39.7% A, 40.7% T, 7.7% G and 11.9% C, with a high A + T content (80.4%). This complete mitogenome of P. nascens provides a basic data for studies on species identification, molecular systematics and conservation genetics. PMID:25690054

  4. Design of a Low Power DSP with Distributed and Early Clock Gating

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    A novel clock structure of a low-power 16-bit very large instruction word (VLIW) digital signal processor (DSP) was proposed. To improve deterministic clock gating and to solve the drawback of conventional clock gating circuit in high speed circuit, a distributed and early clock gating method was developed on its instruction fetch &. decoder unit, its pipelined data-path unit and its super-Harvard memory interface unit. The core was im1.8-V 1P6M process, with a core size of 2 mm×2mm .Result shows that it can run under 200MHz with a powerperformance around 0.3mW/MIPS.Meanwhile,only39.7% circuit is active simultaneously in average,comparedto its non-gating counterparts.

  5. Study of multipion systems produced in the reaction π+N→Nπ+π+π-π0π0 at 3.5GeV/c

    International Nuclear Information System (INIS)

    A detailed analysis is presented of events belonging to the final state N2π+π-2π0 produced in π+ nuclei interactions at 3,5 GeV/c in a heavy liquid bubble chamber. Individual particle momentum distributions as well as center of mass angular emission distributions display deviations from the statistical phase space. A strong angular correlation is found in particular between the two π0 which can not be explained by the symmetrization of the wave functions and which produces an enhancement at low π0π0 masses. The ω0 production is found in 39+-7% of the events and the cross section on hydrogen is estimated at 1.1+-0.3 mb

  6. Primal Interior Point Method for Generalized Minimax Functions

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    Praha : MÚ AV ČR, v.v.i, 2008 - (Chleboun, J.; Přikryl, P.; Segeth, K.; Vejchodský, T.), s. 138-149 ISBN 978-80-85823-55-4. [Programs and Algorithms of Numerical Math ematics /14./. Dolní Maxov (CZ), 01.06.2008-06.06.2008] R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : unconstrained optimization * large-scale optimization * nonsmooth optimization * generalized minimax optimization * interior-point methods * modified Newton methods * variable metric methods * global convergence * computational experiments Subject RIV: BA - General Math ematics http://www. math .cas.cz/~panm/Panm14/proceedings/PANM14proc.pdf

  7. On Lagrange Multipliers of Trust-Region Subproblems

    Czech Academy of Sciences Publication Activity Database

    Lukšan, Ladislav; Matonoha, Ctirad; Vlček, Jan

    Praha : MÚ AV ČR, v.v.i, 2008 - (Chleboun, J.; Přikryl, P.; Segeth, K.; Vejchodský, T.), s. 130-137 ISBN 978-80-85823-55-4. [Programs and Algorithms of Numerical Math ematics /14./. Dolní Maxov (CZ), 01.06.2008-06.06.2008] R&D Projects: GA AV ČR IAA1030405; GA ČR GP201/06/P397 Institutional research plan: CEZ:AV0Z10300504 Keywords : unconstrained optimization * large-scale optimization * trust-region methods * conjugate gradients * Krylov subspaces Subject RIV: BA - General Math ematics http://www. math .cas.cz/~panm/Panm14/proceedings/PANM14proc.pdf

  8. New radiometric ages for the BH-1 hominin from Balanica (Serbia): implications for understanding the role of the Balkans in Middle Pleistocene human evolution.

    Science.gov (United States)

    Rink, William J; Mercier, Norbert; Mihailović, Dušan; Morley, Mike W; Thompson, Jeroen W; Roksandic, Mirjana

    2013-01-01

    Newly obtained ages, based on electron spin resonance combined with uranium series isotopic analysis, and infrared/post-infrared luminescence dating, provide a minimum age that lies between 397 and 525 ka for the hominin mandible BH-1 from Mala Balanica cave, Serbia. This confirms it as the easternmost hominin specimen in Europe dated to the Middle Pleistocene. Inferences drawn from the morphology of the mandible BH-1 place it outside currently observed variation of European Homo heidelbergensis. The lack of derived Neandertal traits in BH-1 and its contemporary specimens in Southeast Europe, such as Kocabaş, Vasogliano and Ceprano, coupled with Middle Pleistocene synapomorphies, suggests different evolutionary forces acting in the east of the continent where isolation did not play such an important role during glaciations. PMID:23405085

  9. Electrochemical study of iodide in the presence of barbituric acid. Application to the catalytic determination of barbituric acid

    International Nuclear Information System (INIS)

    Electrochemical oxidation of iodide has been studied in the presence of barbituric acid using cyclic voltammetry and controlled-potential coulometry. The results indicate that barbituric acid participating in halogenation reaction convert to iodo derivative of parent compound. Moreover the results are indication of the suitability of iodide as mediator for determination of barbituric acid in aqueous solutions. The quasicatalytic peak current is linearly dependent on the barbituric acid concentration. The calibration graph is parabolic, with two linear sections of 6.0 x 10-5 - 1.0 x 10-3 M and 1.0 x 10-3 - 1.0 x 10-2 M. The relative standard deviation for 10 determinations of 2.0 x 10-4 M barbituric acid is 2.1 % and the detection limit of the method is 3.97 x 10-5 M

  10. New White Dwarf Stars in the Sloan Digital Sky Survey Data Release 10

    CERN Document Server

    Kepler, S O; Koester, Detlev; Ourique, Gustavo; Kleinman, Scot J; Romero, Alejandra Daniela; Nitta, Atsuko; Eisenstein, Daniel J; Costa, José Eduardo da Silveira; Külebi, Baybars; Jordan, Stefan; Dufour, Patrick; Giommi, Paolo; Rebassa-Mansergas, Alberto

    2014-01-01

    We report the discovery of 9 088 new spectroscopically confirmed white dwarfs and subdwarfs in the Sloan Digital Sky Survey Data Release 10. We obtain Teff, log g and mass for hydrogen atmosphere white dwarf stars (DAs) and helium atmosphere white dwarf stars (DBs), and estimate the calcium/helium abundances for the white dwarf stars with metallic lines (DZs) and carbon/helium for carbon dominated spectra DQs. We found 1 central star of a planetary nebula, 2 new oxygen spectra on helium atmosphere white dwarfs, 71 DQs, 42 hot DO/PG1159s, 171 white dwarf+main sequence star binaries, 206 magnetic DAHs, 327 continuum dominated DCs, 397 metal polluted white dwarfs, 450 helium dominated white dwarfs, 647 subdwarfs and 6887 new hydrogen dominated white dwarf stars.

  11. Mental health predicts better academic outcomes: A longitudinal study of elementary school students in Chile

    Science.gov (United States)

    Murphy, J. Michael; Guzmán, Javier; McCarthy, Alyssa; Squicciarini, Ana María; George, Myriam; Canenguez, Katia; Dunn, Erin C.; Baer, Lee; Simonsohn, Ariela; Smoller, Jordan W.; Jellinek, Michael

    2015-01-01

    The world’s largest school-based mental health program, Habilidades para la Vida [Skills for Life, SFL], has been operating at a national scale in Chile for fifteen years. SFL’s activities include using standardized measures to screen elementary school students and providing preventive workshops to students at risk for mental health problems. This paper used SFL’s data on 37,397 students who were in first grade in 2009 and third grade in 2011 to ascertain whether first grade mental health predicted subsequent academic achievement and whether remission of mental health problems predicted improved academic outcomes. Results showed that mental health was a significant predictor of future academic performance and that, overall, students whose mental health improved between first and third grade made better academic progress than students whose mental health did not improve or worsened. Our findings suggest that school-based mental health programs like SFL may help improve students’ academic outcomes. PMID:24771270

  12. CARACTERÍSTICAS DE LAS PERSONAS ADICTAS A LA HEROÍNA EN TRATAMIENTO EN UNA EMPRESA SOCIAL DEL ESTADO DE ENERO DE 2003 A JUNIO DE 2008

    Directory of Open Access Journals (Sweden)

    Matilde Álvarez Gómez

    2009-01-01

    Full Text Available Se realizó un estudio descriptivo, para identificar características sociales, de salud y de consumo de heroinómanos en tratamiento en CARISMA, entre enero del 2003 a junio del 2008. La información se obtuvo de las historias clínicas. La edad promedio fue de 22.6, el 74% eran hombres; el 39.7% pertenecían a familias monoparentales, el 47.9% eran de estrato bajo, el 50.7% cursaban educación superior. Las comorbilidades fueron la depresión y trastornos de personalidad con 32.9%; la vía más frecuente fue la venosa con 74 %; el promedio de consumo fue 4 veces al día; otros consumos fueron marihuana 80.8%; benzodiazepinas 54.8%.

  13. Nuclear science and technology plan (1989-1993)

    International Nuclear Information System (INIS)

    The nuclear science and technology plan embodies the objectives strategies and activities of the Philippine Nuclear Research Institute (PNRI). It is an integral component of the national effort to make the Philippines a newly industrialized country (NIC) by the year 2000. The four major plans under the program are as follows: 1) Radiation protection and nuclear safety, 2) Radiation technology and engineering, 3) Radioisotopes and nuclear techniques application and 4) special projects. The cost of the plan is estimated to be two hundred ninety three million pesos (293, 000,000) for 1989-1993 covering personnel services (39.7%), maintenance and operating expenses (42.7%), equipment outlay (4.8%) and infrastructure (12.8%). The details of the different programs are given. (ELC). 7 figs.; 8 tabs

  14. Interaction of molybdophosphates with palladium(II) salts in aqueous solutions

    International Nuclear Information System (INIS)

    The methods of electron and 31P NMR spectroscopies were used to study the interaction of H3PMo12O40 with H2PdCl4 or PdSO4 in aqueous solution at pH 3.0-4.5 and the ratio [Pd(II)]:[H3PMo12O40]=1:1. Palladium(II) remains in solution in the form of intensely colored hydroxo species and does not change the structure of the newly formed unsaturated heteropolymolybdates PMo11O397- and PMo9O349- as shown by NMR data. Heteropoly compounds precipitated from tetrabutylammonium or cesium salts were characterized using IR spectroscopy, differential dissolution and elemental analysis. It was found that the composition of a compound was affected by not only formation conditions in the solution but also the precipitant cation

  15. Sequence analysis of the rDNA internal transcribed spacer 2 of five species of South American human malaria mosquitoes.

    Science.gov (United States)

    Fritz, G N

    1998-03-01

    The rDNA internal transcribed spacer 2 (ITS2) was sequenced for 5 species of mosquitoes that may be important vectors of human malaria in certain regions of South America and are difficult to distinguish by morphology: Anopheles evansae, An. nuneztovari, An. rangeli, An. strodei and An. trinkae. ITS2 sequences from samples collected in Ecuador, Bolivia, Venezuela and Brazil were aligned and compared in order to determine the usefulness of this spacer for the elaboration of species specific primers and DNA probes. The ITS2 was found to be different in size (ranging from 333 to 397 bp) and sequence between all pairs of species. Highly variable regions were found primarily at the 3' end of the spacer and were interspersed with relatively conserved sites. Instraspecific sequence variation was limited to a single transversion between specimens of An. rangeli from distant geographic locations suggesting concerted evolution and homogenization of the ITS2. PMID:10520449

  16. Functional adaptation of tendon and skeletal muscle to resistance training in three patients with genetically verified classic Ehlers Danlos Syndrome

    DEFF Research Database (Denmark)

    Møller, Mathias Bech; Kjær, Michael; Svensson, René Brüggebusch;

    2014-01-01

    BACKGROUND: tendon and skeletal muscle function adapts to physical training of resistive nature, but it is unknown to what extent persons with genetically altered connective tissue - who have a higher than normal tendon extensibility - will obtain any effect upon their tendon and muscle when...... undergoing muscle strength training. We investigated patients with classical Ehlers Danlos Syndrome (EDS) (collagen type V defect) who display articular hypermobility, skin extensibility and tissue fragility. METHODS: subjects underwent strength training 3 times a week for 4 months and were tested before and...... after intervention in regards to muscle strength, tendon mechanical properties, and muscle function. RESULTS: three subjects completed the scheduled 48 sessions and had no major adverse events. Mean isometric leg extension force and leg extensor power both increased by 8 and 11% respectively (358 to 397...

  17. Degradation of 5-hydroxymethylfurfural during yeast fermentation.

    Science.gov (United States)

    Akıllıoglu, Halise Gül; Mogol, Burçe Ataç; Gökmen, Vural

    2011-12-01

    5-Hydroxymethyl furfural (HMF) may occur in malt in high quantities depending on roasting conditions. However, the HMF content of different types of beers is relatively low, indicating its potential for degradation during fermentation. This study investigates the degradation kinetics of HMF in wort during fermentation by Saccharomyces cerevisiae. The results indicated that HMF decreased exponentially as fermentation progressed. The first-order degradation rate of HMF was 0.693 × 10(-2) and 1.397 × 10(-2)min(-1) for wort and sweet wort, respectively, indicating that sugar enhances the activity of yeasts. In wort, HMF was converted into hydroxymethyl furfuryl alcohol by yeasts with a high yield (79-84% conversion). Glucose and fructose were utilised more rapidly by the yeasts in dark roasted malt than in pale malt (pyeast cells, and presence of sugars in the fermentation medium increases this activity. PMID:22010851

  18. NuTEC annual report (April 1, 2000 - March 31, 2001)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-10-01

    This report summarizes the educational activities and related management of the Nuclear Technology and Education Center (NuTEC) during the 1999 fiscal year. Both Tokyo and Tokai Education Centers have successfully conducted almost all the planned domestic and international training courses. In addition Tokai Education Center has performed the 2nd nuclear supervisor training course and introduced a new course for special nuclear emergency preparedness in response to the legal amendment after the criticality accident. The sum total number of participants was 1,397. The International Technology Transfer Division has not only planned and organized the international training courses, but also taken charge of the 2nd workshop on Human Resource Development in Nuclear Field in Asian Region. Furthermore, various researches have been made to improve the educational programs. (author)

  19. Design, synthesis, and testing toward a 57-codon genome.

    Science.gov (United States)

    Ostrov, Nili; Landon, Matthieu; Guell, Marc; Kuznetsov, Gleb; Teramoto, Jun; Cervantes, Natalie; Zhou, Minerva; Singh, Kerry; Napolitano, Michael G; Moosburner, Mark; Shrock, Ellen; Pruitt, Benjamin W; Conway, Nicholas; Goodman, Daniel B; Gardner, Cameron L; Tyree, Gary; Gonzales, Alexandra; Wanner, Barry L; Norville, Julie E; Lajoie, Marc J; Church, George M

    2016-08-19

    Recoding--the repurposing of genetic codons--is a powerful strategy for enhancing genomes with functions not commonly found in nature. Here, we report computational design, synthesis, and progress toward assembly of a 3.97-megabase, 57-codon Escherichia coli genome in which all 62,214 instances of seven codons were replaced with synonymous alternatives across all protein-coding genes. We have validated 63% of recoded genes by individually testing 55 segments of 50 kilobases each. We observed that 91% of tested essential genes retained functionality with limited fitness effect. We demonstrate identification and correction of lethal design exceptions, only 13 of which were found in 2229 genes. This work underscores the feasibility of rewriting genomes and establishes a framework for large-scale design, assembly, troubleshooting, and phenotypic analysis of synthetic organisms. PMID:27540174

  20. Sub- and supercritical liquefaction of rice straw in the presence of ethanol-water and 2-propanol-water mixture

    International Nuclear Information System (INIS)

    The critical liquefaction of rice straw to bio-oil with sub- and supercritical mixtures (ethanol-water and 2-propanol-water mixture) was studied in a 1000 ml autoclave at 533-623 K, 6-18 MPa, respectively. The results showed that the maximum yield of bio-oil was 39.7% for the 2-propanol:water volume ratio of 5:5 at 573 K, while the higher heating value (HHV) of bio-oil increased with the reaction temperature and solvent volume ratio. The formation of low-boiling-point materials was reduced by a mixture. Using a mixture could inhibit the formation of residue and then promote the conversion of rice straw with the ratio of 1:9-5:5. The bio-oil was analyzed by GC/MS and Elemental Analyzer, while the morphological changes of residue were observed by a scanning electron microscope (SEM)