WorldWideScience

Sample records for alloy-ehi 183

  1. 46 CFR 183.352 - Battery categories.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Battery categories. 183.352 Section 183.352 Shipping...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.352 Battery categories. This section applies to batteries installed to meet the requirements of § 183.310 for secondary sources of power...

  2. 33 CFR 183.322 - Flotation materials.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation materials. 183.322 Section 183.322 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... of 2 Horsepower or Less General § 183.322 Flotation materials. (a) Flotation materials must meet...

  3. 49 CFR 572.183 - Neck assembly.

    Science.gov (United States)

    2010-10-01

    ... CFR 572.33) at the time the pendulum makes contact with the decelerating mechanism. The velocity-time... 49 Transportation 7 2010-10-01 2010-10-01 false Neck assembly. 572.183 Section 572.183... Dummy, 50th Percentile Adult Male § 572.183 Neck assembly. (a) The neck assembly consists of parts...

  4. 33 CFR 183.542 - Fuel systems.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fuel systems. 183.542 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Equipment Standards § 183.542 Fuel systems. (a) Each fuel system in a boat must have been tested by the boat manufacturer and not leak when subjected to...

  5. 46 CFR 183.378 - Ungrounded systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Ungrounded systems. 183.378 Section 183.378 Shipping...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.378 Ungrounded systems. Each ungrounded system must be provided with a suitably sensitive ground detection system located at the...

  6. 32 CFR 18.3 - Organization.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Organization. 18.3 Section 18.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS APPOINTING AUTHORITY FOR MILITARY COMMISSIONS § 18.3 Organization. (a) The Appointing Authority for Military Commissions...

  7. 46 CFR 183.390 - Shore power.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Shore power. 183.390 Section 183.390 Shipping COAST...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.390 Shore power. A vessel with an electrical system operating at more than 50 volts, which is provided with a means to connect to shore...

  8. 46 CFR 183.230 - Temperature ratings.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION General Requirements § 183.230 Temperature ratings. Temperature ratings of electrical equipment must meet the requirements of 46 CFR 111.01-15. ... 46 Shipping 7 2010-10-01 2010-10-01 false Temperature ratings. 183.230 Section 183.230...

  9. 21 CFR 133.183 - Romano cheese.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Romano cheese. 133.183 Section 133.183 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.183 Romano cheese. (a) Romano cheese is the food prepared from cow's milk or sheep's milk...

  10. Nuclear Data Sheets for A = 183

    Science.gov (United States)

    Baglin, Coral M.

    2016-05-01

    Evaluated nuclear structure and decay data for all nuclides with mass number A=183 (Yb, Lu, Hf, Ta, W, Re, Os, Ir, Pt, Au, Hg, Tl, Pb) are presented here. At, Po and Fr have not yet been observed, but for prediction of ground state and/or isomer properties see, e.g., 2015Bh08 (At, Fr), 2013Ba41 (Tl), 2013Ho05 (Po). This evaluation includes structure and decay data information available by 15 April 2015 and supersedes that by R.B. Firestone published in Nuclear Data Sheets65, 589 (1992) (literature cutoff 9 January 1991), and subsequent revisions by C.M. Baglin for 183Au in ENSDF database (literature cutoff 13 March 1999), 183Hg in Nuclear Data Sheets91, 117 (2000) (literature cutoff 25 September 2000), 183Tl in Nuclear Data Sheets95, 49 (2002) (literature cutoff 1 January 2002) and 183Pb in ENSDF (literature cutoff 6 January 2003). Since the prior Nuclear Data Sheets publication of this mass chain: 183Yb (2012Ku26) and 183Pb (2006An11, 2006Se18, 2007De09, 2009Se13) have been observed; our knowledge of high-spin states has been significantly expanded for 183Ta (2009Sh17), 183W (1999Sa60), 183Re (1998Ha51, 2001Sh41), 183Au (2002Jo18, 2005So01) and 183Tl (2001Mu26, 2004Ra28); a large amount of new structure information for 183W has been obtained from transfer reactions (1997Pr02, 2011Bo09), (n,n'γ) (1993Pr09) and thermal neutron capture (1993Pr09, 1997Pr02, 2011Bo09, 2014Hu02), as well as from the two-photon cascade study by 2005Su29.

  11. 14 CFR 183.53 - Procedures manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures manual. 183.53 Section 183.53... manual. No ODA Letter of Designation may be issued before the Administrator approves an applicant's procedures manual. The approved manual must: (a) Be available to each member of the ODA Unit; (b) Include...

  12. 33 CFR 183.302 - Flotation requirements.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation requirements. 183.302...) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of 2 Horsepower or Less General § 183.302 Flotation requirements. Each boat to which this...

  13. 33 CFR 117.183 - Old River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Old River. 117.183 Section 117... OPERATION REGULATIONS Specific Requirements California § 117.183 Old River. The draw of the California... notice is given to the drawtender at the Rio Vista bridge across the Sacramento River, mile 12.8....

  14. 33 CFR 183.715 - Exception.

    Science.gov (United States)

    2010-07-01

    ... SAFETY BOATS AND ASSOCIATED EQUIPMENT Start-in-Gear Protection § 183.715 Exception. Outboard motors... information must be displayed on the motor: “Warning—Ensure shift control is in neutral before starting...

  15. 183-H Basin sludge treatability test report

    International Nuclear Information System (INIS)

    This document presents the results from the treatability testing of a 1-kg sample of 183-H Basin sludge. Compressive strength measurements, Toxic Characteristic Leach Procedure, and a modified ANSI 16.1 leach test were conducted

  16. 14 CFR 61.183 - Eligibility requirements.

    Science.gov (United States)

    2010-01-01

    ... Flight Instructors With a Sport Pilot Rating § 61.183 Eligibility requirements. To be eligible for a... university. (f) Pass a knowledge test on the aeronautical knowledge areas listed in § 61.185(a)(2) and...

  17. 46 CFR 183.432 - Emergency lighting.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Lighting Systems § 183.432 Emergency lighting. (a) Each vessel must have adequate... accommodation spaces located below the main deck. (b) The emergency lighting required by paragraph (a) of...

  18. Closure proposal: 183-H Solar Evaporation Basins

    International Nuclear Information System (INIS)

    This document describes the overall approach and logic for implementing clean closure of the 183-H Solar Evaporation basins (183-H) in a cost-effective and timely manner and in accordance with all applicable regulations. The Resource Conservation and Recovery Act of 1976 and the Washington Administrative Code (WAC) 173-303 are the regulatory bases for this closure strategy. The closure described herein is consistent with potential future land uses, and with remedial action planning in the 100-H area, as well as with other decontamination and decommissioning (D ampersand D) of the 100-H structures

  19. 33 CFR 183.524 - Fuel pumps.

    Science.gov (United States)

    2010-07-01

    ... diaphragm pump must not leak fuel from the pump if the primary diaphragm fails. (b) Each electrically operated fuel pump must not operate except when the engine is operating or when the engine is started. (c) If tested under § 183.590, each fuel pump, as installed in the boat, must not leak more than...

  20. 38 CFR 18.3 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... III of Executive Order 11246 (3 CFR Chapter IV) or any Executive order which supersedes it. (2) In... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Discrimination prohibited... THE CIVIL RIGHTS ACT OF 1964 General § 18.3 Discrimination prohibited. (a) General. No person in...

  1. 50 CFR 18.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) TAKING... marine mammals taken by Alaskan Natives for food, clothing, shelter, heating, transportation, and other... (CONTINUED) MARINE MAMMALS Introduction § 18.3 Definitions. In addition to definitions contained in section...

  2. 40 CFR 436.183-436.184 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false 436.183-436.184 Section 436.183-436.184 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Phosphate Rock Subcategory §§ 436.183-436.184...

  3. 10 CFR 26.183 - Medical review officer.

    Science.gov (United States)

    2010-01-01

    ..., conducting a medical interview with the donor, reviewing the donor's medical history, or reviewing any other... 10 Energy 1 2010-01-01 2010-01-01 false Medical review officer. 26.183 Section 26.183 Energy... Determining Fitness § 26.183 Medical review officer. (a) Qualifications. The MRO shall be knowledgeable...

  4. 46 CFR 183.320 - Generators and motors.

    Science.gov (United States)

    2010-10-01

    ... reference; see 46 CFR 175.600), and for a generator derated in accordance with paragraph (b)(2) of this... 46 Shipping 7 2010-10-01 2010-10-01 false Generators and motors. 183.320 Section 183.320 Shipping...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.320 Generators and motors. (a)...

  5. 27 CFR 19.183 - Change of trade name.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Change of trade name. 19.183 Section 19.183 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... After Original Qualification § 19.183 Change of trade name. If there is to be a change in, or...

  6. Dicty_cDB: SHA183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 03109.1 C08027F07SK PhyRootSw1 Citrus sinensis cDNA clone C08027F07, mRNA sequence. 78 4e-33 3 DV664609 |DV664609.1 CGN-1811 Pericarp...is mRNA, clone: QnpA-15448, 5' end, expressed in brain parietal lobe. 74 2e-23 4 DV769286 |DV769286.1 ILL...AP007159 |pid:none) Aspergillus oryzae RIB40 genomic... 293 5e-78 ( Q10178 ) RecName: Full=U2 snRNP component prp1...SH (Link to library) SHA183 (Link to dictyBase) - - - Contig-U11096-1 | Contig-U126...63-1 SHA183P (Link to Original site) SHA183F 137 SHA183Z 600 SHA183P 717 - - Show SHA183 Library SH (Link to librar

  7. 33 CFR 183.538 - Metallic fuel line materials.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Metallic fuel line materials. 183... (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Equipment Standards § 183.538 Metallic fuel line materials. Each metallic fuel line connecting the fuel tank with the fuel inlet connection...

  8. 49 CFR 173.183 - Nitrocellulose base film.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Nitrocellulose base film. 173.183 Section 173.183... Nitrocellulose base film. Films, nitrocellulose base, must be packaged in packagings conforming to the... tape or paper; authorized only for not over 600 m (1969 feet) of film....

  9. 14 CFR 183.31 - Designated manufacturing inspection representatives.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Designated manufacturing inspection representatives. 183.31 Section 183.31 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... certificates for aircraft for which the manufacturer holds the type certificate and which have...

  10. Dicty_cDB: AHA183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHA183 (Link to dictyBase) - - - Contig-U16405-1 AHA183P (Link to Original ... tk*nt****fk*n*yyk**y*lfimpfrfkcekyirsiixpi*lniisi *crn *rn*ixsitkr*sxrc*n*iiqtikwfnnrxynw*cwwcscyrcxclll*n ...

  11. Dicty_cDB: SSB183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB183 (Link to dictyBase) - - - Contig-U08884-1 SSB183P (Link to Original ... c*cldhsfgyy*vaqfvhslflwqrllslgqplmnillkpvgs*kylgv *vtl *f*fqfvgfgnqmqiikslptlnwlikmmi*d*nplmv*vievtkiiptit ... kkk*r Frame C: mvflinivqqhhlyiqirvvshihhqemenlmqe*mvtl qliakhlfhqivmiivvivii iititiivmaiqmnhtlisyyie*mklni ...

  12. 33 CFR 183.114 - Test of flotation materials.

    Science.gov (United States)

    2010-07-01

    .../Outdrive Boats, and Airboats § 183.114 Test of flotation materials. (a) Vapor test. The flotation material... gasoline test. The flotation material must not reduce in buoyant force more than 5 percent after being..., see § 183.5). (d) 24-hour oil test. The flotation material must not reduce in buoyant force more...

  13. 37 CFR 1.83 - Content of drawing.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Content of drawing. 1.83... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions The Drawings § 1.83 Content of drawing. (a) The drawing in a nonprovisional application must show every feature of...

  14. 33 CFR 183.610 - Powered ventilation system.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Powered ventilation system. 183... (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Ventilation § 183.610 Powered ventilation system... must: (1) Be open to the atmosphere, or (2) Be ventilated by an exhaust blower system. (b) Each...

  15. Die oskische Weihung an Fatuus Ve. 183

    Directory of Open Access Journals (Sweden)

    Helmut Rix

    2015-09-01

    Full Text Available Die Inschrift Ve. 183 aus Civita di Tricarico (MT gehört zu den oskischen Tex­ ten, die beim bisherigen Stand der Forschung als allenfalls halb verständlich gelten können. Die jüngste Gesamtinterpretation, die E. Vetters von 19531,läßt drei der 12 Wörter unübersetzt und erklärt das Verständnis eines vierten als unklar. V. Pisani,der auf Vetter fußt, läßt ebenfalls drei Worter unübersetzt, darunter ein anderes als Vetter, und weicht an zwei weiteren Stellen von Vetter ab. Bin Gesamtverständnis gelingt ihm ebensowenig wie diesem. G. Bottiglioni schließlich referiert, mit Hinweis auf Vetters Vorbehalte, die Deutung Ribezzos, die allein wegen der vielen angenommenen Ab­ kürzungen verfehlt sein muß. Die hier vorgelegte Interpretation kann auch nicht alle Probleme des Textes lösen; doch hoffe ich, sowohl in den Details weiter als auch dem Gesamtverständnis näher zu kommen.

  16. 183-H Solar Evaporation Basins PostClosure Plan

    International Nuclear Information System (INIS)

    The 183-H Solar Evaporation Basins (183-H) have certified closure under a modified closure option available in the Hanford Facility Dangerous Waste Permit under Condition II.K.3. The following information contains a description of the unit, past closure actions, and postclosure care requirements subject to compliance under the Permit. Corrective actions required for dangerous waste constituents remaining at 183-H will occur in conjunction with Comprehensive Environmental Response, Compensation, and Liability Act remedial actions for the 100-HR-1 Source Operable Unit and the 100-HR-3 Groundwater Operable Unit

  17. Dicty_cDB: CHS183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS183 (Link to dictyBase) - - - Contig-U11143-1 - (Link to Original site) ... KKKKXFXFXKK--- Translated Amino Acid sequence (All Frames ) Frame A: kki*ltsknkpkknnfiy*ekkkkkkkkkkkxkkkkkkkx ...

  18. Detection of 183 GHz water megamaser emission towards NGC 4945

    CERN Document Server

    Humphreys, Elizabeth; Impellizzeri, Violette; Galametz, Maud; Olberg, Michael; Conway, John; Belitsky, Victor; De Breuck, Carlos

    2016-01-01

    Aim: The aim of this work is to search Seyfert 2 galaxy NGC 4945, a well-known 22 GHz water megamaser galaxy, for water (mega)maser emission at 183 GHz. Method: We used APEX SEPIA Band 5 to perform the observations. Results: We detected 183 GHz water maser emission towards NGC 4945 with a peak flux density of ~3 Jy near the galactic systemic velocity. The emission spans a velocity range of several hundred km/s. We estimate an isotropic luminosity of > 1000 Lsun, classifying the emission as a megamaser. A comparison of the 183 GHz spectrum with that observed at 22 GHz suggests that 183 GHz emission also arises from the active galactic nucleus (AGN) central engine. If the 183 GHz emission originates from the circumnuclear disk, then we estimate that a redshifted feature at 1084 km/s in the spectrum should arise from a distance of 0.022 pc from the supermassive black hole (1.6 x 10(5) Schwarzschild radii), i.e. closer than the water maser emission previously detected at 22 GHz. This is only the second time 183 G...

  19. 33 CFR 183.558 - Hoses and connections.

    Science.gov (United States)

    2010-07-01

    ... label under § 183.514(b)(3). (2) From the fuel tank to the fuel inlet connection on the engine must be... sleeve and threaded insert; or (3) A hose clamp. (d) The inside diameter of a hose must not exceed...

  20. 33 CFR 183.552 - Plastic encased fuel tanks: Installation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Plastic encased fuel tanks... § 183.552 Plastic encased fuel tanks: Installation. (a) Each fuel tank encased in cellular plastic foam or in fiber reinforced plastic must have the connections, fittings, and labels accessible...

  1. 5 CFR 550.183 - Substantial hours requirement.

    Science.gov (United States)

    2010-01-01

    ... ADMINISTRATION (GENERAL) Premium Pay Law Enforcement Availability Pay § 550.183 Substantial hours requirement. (a) A criminal investigator shall be eligible for availability pay only if the annual average number of... (numerator) by the number of regular workdays (denominator). (b) For the purpose of this section,...

  2. 40 CFR 52.183 - Small business assistance program.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Small business assistance program. 52... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS Arkansas § 52.183 Small business assistance... a Small Business Stationary Source Technical and Environmental Compliance Assistance...

  3. 33 CFR 183.202 - Flotation and certification requirements.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation and certification... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of More Than 2 Horsepower General § 183.202 Flotation and...

  4. 33 CFR 183.222 - Flotation material and air chambers.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation material and air... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of More Than 2 Horsepower General § 183.222 Flotation material and air...

  5. 33 CFR 183.225 - Flotation test for persons capacity.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation test for persons... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of More Than 2 Horsepower Tests § 183.225 Flotation test for persons...

  6. 33 CFR 183.105 - Quantity of flotation required.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Quantity of flotation required... (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Inboard Boats, Inboard/Outdrive Boats, and Airboats § 183.105 Quantity of flotation required. (a) Each boat must have...

  7. 33 CFR 183.112 - Flotation material and air chambers.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation material and air... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Inboard Boats, Inboard/Outdrive Boats, and Airboats § 183.112 Flotation material and air chambers. (a)...

  8. 33 CFR 183.325 - Flotation test for persons capacity.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation test for persons... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of 2 Horsepower or Less Tests § 183.325 Flotation test for persons...

  9. AMD183穿浪双体客船

    Institute of Scientific and Technical Information of China (English)

    唐志祥; 徐文珊

    2000-01-01

    This paper firstly analyzed the hi-speed passenger ship market along the coastal lines in Fujian Province in brief and then made detailed introductions to the prototype AMD 183 hi-speed wavepiecing catamaran on its hull structure, superstructure and marine equipment etc.

  10. 49 CFR 192.183 - Vaults: Structural design requirements.

    Science.gov (United States)

    2010-10-01

    ... vault or pit structure, provision must be made to prevent the passage of gases or liquids through the... Components § 192.183 Vaults: Structural design requirements. (a) Each underground vault or pit for valves... so that all of the equipment required in the vault or pit can be properly installed, operated,...

  11. α decay and recoil decay tagging studies of 183Tl

    International Nuclear Information System (INIS)

    High-spin states in the nucleus 183Tl have been studied using the recoil decay tagging and recoil tagging techniques. The data have enabled new structures to be identified which are believed to be based on prolate f7/2, h9/2, and oblate h9/2 configurations. In addition, the prolate i3/2 structure has also been extended. The systematics of the newly identified structures will be discussed. The α decay of 183Tl has also been investigated. Examination of both delayed and prompt γ rays in coincidence with the prominent 6333-keV α decay, together with an investigation of the effects of the summing of L electrons, allow assignment of transitions and the construction of tentative low-spin decay schemes for 179Au and 175Ir

  12. Characteristics and drivers of baseflow response in 183 Australian catchments

    OpenAIRE

    A. I. J. M. van Dijk

    2009-01-01

    Daily streamflow data for 183 Australian catchments were used to assess the characteristics and main drivers of baseflow and quick flow behaviour, and to find an appropriate balance between simplicity and explanatory performance in modelling. Baseflow separation was performed following the Wittenberg algorithm. A linear reservoir model (one parameter) produced baseflow estimates as good as those obtained using a non-linear reservoir (two parameters) and was therefore considered the mor...

  13. 7 CFR 18.3 - Development and adoption of equal employment opportunity programs.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Development and adoption of equal employment opportunity programs. 18.3 Section 18.3 Agriculture Office of the Secretary of Agriculture EQUAL EMPLOYMENT OPPORTUNITY IN THE STATE COOPERATIVE EXTENSION SERVICES § 18.3 Development and adoption of equal...

  14. 12 CFR 303.183 - Investment by insured state nonmember banks in foreign organization.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Investment by insured state nonmember banks in foreign organization. 303.183 Section 303.183 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES International Banking § 303.183 Investment by...

  15. 183-D filter backwash wastewater stream-specific report

    International Nuclear Information System (INIS)

    The proposed wastestream designation for the 183-D Filter Backwash Wastewater is that this stream is not a dangerous waste, pursuant to the Washington (State) Administrative Code (WAC) 173--303, Dangerous Waste Regulations. This proposed designation is based on applying both process knowledge and sample data to the WAC 173-303 requirements for the three types of dangerous waste: listed, criteria, and characteristic dangerous waste. The ''listed'' dangerous waste determination was made with process knowledge; the ''criteria'' and ''characteristic'' dangerous waste determinations were made with sampling data. Process knowledge was based on such things as Material Safety Data Sheets and facility inspections for chemical products stored or used in the 183-D Filter Building. Sample data were obtained from samples taken downstream from all process contributors. The proposed designation is made using validated data collected from samples taken downstream from October 1989 through March 1990. Data from samples taken before October 1989, while not validated, are included in Appendix A for completeness. 10 refs., 4 figs., 7 tabs

  16. 33 CFR 183.710 - Start-in-gear protection required.

    Science.gov (United States)

    2010-07-01

    ... this motor must comply with USCG requirements for start-in-gear protection in 33 CFR Part 183, Subpart... protection meeting USCG requirements of 33 CFR Part 183, Subpart L.” The letters and numbers on the tag or... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Start-in-gear protection...

  17. 27 CFR 1.83 - Acquiring or receiving distilled spirits in bulk for addition to wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Acquiring or receiving distilled spirits in bulk for addition to wine. 1.83 Section 1.83 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BASIC PERMIT REQUIREMENTS UNDER THE FEDERAL ALCOHOL ADMINISTRATION...

  18. 5 CFR 1201.183 - Procedures for processing petitions for enforcement.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Procedures for processing petitions for enforcement. 1201.183 Section 1201.183 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION... a statement of the actions that are in process and the actions that remain to be taken, along with...

  19. MiR-183 Regulates ITGB1P Expression and Promotes Invasion of Endometrial Stromal Cells

    Directory of Open Access Journals (Sweden)

    Jie Chen

    2015-01-01

    miR-183 expression induced the invasiveness and inhibition of apoptosis in endometrial stromal cells. The current study aims to identify the miR-183 targets with relevance to cell functions in endometrial stromal cells, to verify the interaction of miR-183 with its target genes, and to confirm the role of miR-183 in the process of endometriosis. Using microarray analysis, we identified 27 differentially expressed genes (19 were upregulated and 8 downregulated, from which we selected 4 downregulated genes (ITGB1, AMIGO2, VAV3, and PSEN2 based on GO databases for functional analysis and significant pathway analysis. Western blotting analyses showed that integrin β1 (ITGB1, but not AMIGO2, was affected by miR-183 overexpression, whereas no protein expression of VAV3 and PSEN2 was detected. Luciferase reporter assay verified that ITGB1 is a target gene of miR-183. Moreover, we found that ITGB1 is overexpressed in the endometrium of endometriosis patients. Furthermore, overexpression of ITGB1 rescued the repressive effects of miR-183 on the invasiveness of endometrial stromal cells. These findings, together with the fact that ITGB1 is a critical factor for cell adhesion and invasiveness, suggest that miR-183 may be involved in the development of endometriosis by regulating ITGB1 in endometrial stromal cells.

  20. Groundwater monitoring plan for the 183-H Solar Evaporation Basins

    International Nuclear Information System (INIS)

    Groundwater monitoring at the 183-H Solar Evaporation Basins is regulated under Washington Administrative Code 173-303-645. Proposed in this plan is the first phase of a final-status, corrective action monitoring program for the site. The monitoring network consists of four existing wells: 199-H4-3, 199-H4-7, 199-H4-12A, and 199-H4-12C. Well 199-H4-12C is completed at the base of the unconfined aquifer; the other wells are screened at the water table. Wells 199-H4-7 and 199-H4-12A are groundwater extraction wells used in a pump-and-treat system. Groundwater samples will be collected from each well annually. Samples will be analyzed for the following: (1) constituents of concern (i.e., chromium, nitrate, technetium-99, and uranium) and fluoride; (2) additional constituents to aid data interpretation (e.g., alkalinity, anions, and metals); and (3) field parameters routinely acquired at the wellhead (e.g., pH, specific conductance, temperature, and turbidity). The objective of monitoring during operation of the pump-and-treat system is to determine whether concentrations of the contaminants of concern are decreasing

  1. Characteristics and drivers of baseflow response in 183 Australian catchments

    Directory of Open Access Journals (Sweden)

    A. I. J. M. van Dijk

    2009-09-01

    Full Text Available Daily streamflow data for 183 Australian catchments were used to assess the characteristics and main drivers of baseflow and quick flow behaviour, and to find an appropriate balance between simplicity and explanatory performance in modelling. Baseflow separation was performed following the Wittenberg algorithm. A linear reservoir model (one parameter produced baseflow estimates as good as those obtained using a non-linear reservoir (two parameters and was therefore considered the more appropriate. The transition from storm flow dominated to baseflow dominated streamflow generally occurred 7 to 10 d after the storm event. The catchments investigated had baseflow half-times of about 12 d, with 80% of stations having half-times between 7 and 34 d. The shortest half-times occurred in the driest catchments and were attributed to intermittent occurrence of fast-draining (possibly perched groundwater. Median baseflow index (BFI was 0.45 with considerable variation between stations. Catchment humidity explained 27% of the variation in derived baseflow recession coefficients. Another 53% of variance in recession coefficients as well as in BFI showed spatial correlation lengths of 200 to 300 km, corresponding to terrain factors rather than climate or land use. The remaining 16 to 20% of variance remained unexplained. Most (84% of the variation between stations in average baseflow could be explained by monthly precipitation in excess of potential evapotranspiration. Most (70% of the variation in average quick flow could be explained by average rainfall. Another 20% of variation was spatially correlated over spatial scales of 400 km, possibly reflecting a combination of terrain and climate factors; the remaining 10 to 16% remained unexplained.

  2. Contribution to the study of odd nuclei, deficient in neutrons, of platinum (A=187, 185, 183) and of osmium (A= 183): nuclear deformations and intern conversion anomalies

    International Nuclear Information System (INIS)

    The 187,185,183Pt and 183Os nuclei, located in a region of shape instability, have been studied from the β+/EC decay of gold nuclei produced by the Pt(p(200 MeV),xn)Au reaction then mass-separated using the ISOCELE II isotope separator. For these four nuclei, levels schemes have been built from γ-γ-t and γ-e--t coincidence relationships and conversion electron measurements. Two very converted transitions have been observed in 185Pt, but none in 183Pt and 183Os. The 187Pt nucleus has also been studied from the 176Y(16O(93 MeV),5nγ) reaction to connect the low spin states to the high spin states. Experimental results have been interpreted In the frame of the 'rotor axial + quasi-particle HF' model. All the states located below 600 keV in 185Pt, 183Pt and 183Os correspond to a 'prolate' shape of the nucleus. But, to interpret the lowest states of negative parity in 187Pt, it is necessary either to consider an oblate-prolate shape coexistence or to take into account the γ-asymmetry parameter (as in the interpretation of the high spin levels of this nuclei). The anomalous M1 multipolarity has been attributed firmly to one of the very converted transitions of 185Pt since the spin values of the states connected by this transition are different. The second very converted transition of 185Pt is located between two states that we have interpreted as prolate-shaped states. Thus it seems that very converted transitions are not due to shape coexistence phenomenon. Complementary experiments are proposed in order to improve our knowledge of these conversion anomalies. (author)

  3. A clinical analysis of 183 patients with craniopharyngioma%颅咽管瘤183例临床分析

    Institute of Scientific and Technical Information of China (English)

    姜兰叶; 徐剑; 钟历勇

    2008-01-01

    Objective To explore the clinical characteristics,changes of neuroendocrine hormone before and aftter operation in patients with craniopharyngioma,so as to provide the basis for the replacement therapy after operation and educational practice.Methods The clinical data of 183 patients with craniopharyngioma were retrospectively analyzed. Results (1)Symptoms mainly were headache with nausea,disevesight,the second symptom was polydipsia and polyuria,in child,growth and development retardation was more,and another was hypothalamus syndrome.(2)Functions in endocrine:functions in thyreoid,adrenal and gonad(except PRL),the dysfunctions in neurohypophysis was displayed with completed insipidus and immaturity insipidus,contrasted it anteoperation to that postoperation,it was obvious in statishcs meanings (P<0.05). Conclusions In patients with craniopharyngioma,children and adolescent is more than the other people,clinical situation is complicated,neuroendocrine hormone is derangement before and after operation,tumor itself to oppress and operation trauma are the basic reasons for the hypofunction of neuroendocrine hormpne,hormones replacement therapy and monitoring should be catch earlier.%目的 探讨鞍区颅咽管瘤患者的临床特点,手术前后神经内分泌激素变化规律,为颅咽管瘤患者内分泌激素监控和更好地替代治疗、进一步实施教育提供依据.方法 回顾性分析183例颅咽管瘤患者临床表现、手术前及手术后不同时期内分泌激素变化等的临床资料.结果 患者术后甲状腺、肾上腺、性腺激素(泌乳素除外)测定较术前均下降,差异有统计学意义(P<0.05或<0.01);术后10 d与术后3 d比较,甲状腺(除T4外)、肾上腺、性腺激素水平虽有好转,但差异无统计学意义(P>0.05).术后糖皮质激素替代治疗143例(78.14%);甲状腺激素替代治疗89例(48.63%);抗利尿激素替代治疗40例(21.86%).结论 颅咽管瘤患者以儿童及青少年起病多

  4. Atomic mass determinations for 183W and 199Hg and the mercury problem

    International Nuclear Information System (INIS)

    Recent modifications to the 'Manitoba II' high resolution mass spectrometer are described. Mass differences among the members of the triplet 199 Hg -183W 16O- 12C 235 Cl 5 have been measured. These self-consistent mass differences give masses for 183W and 199Hg, as well as the mass difference across the W to Hg region of the mass table. These masses and the mass difference provide important constraints for the least squares atomic mass evaluation

  5. The 183-WSL Fast Rain Rate Retrieval Algorithm. Part II: Validation Using Ground Radar Measurements

    Science.gov (United States)

    Laviola, Sante; Levizzani, Vincenzo

    2014-01-01

    The Water vapour Strong Lines at 183 GHz (183-WSL) algorithm is a method for the retrieval of rain rates and precipitation type classification (convectivestratiform), that makes use of the water vapor absorption lines centered at 183.31 GHz of the Advanced Microwave Sounding Unit module B (AMSU-B) and of the Microwave Humidity Sounder (MHS) flying on NOAA-15-18 and NOAA-19Metop-A satellite series, respectively. The characteristics of this algorithm were described in Part I of this paper together with comparisons against analogous precipitation products. The focus of Part II is the analysis of the performance of the 183-WSL technique based on surface radar measurements. The ground truth dataset consists of 2.5 years of rainfall intensity fields from the NIMROD European radar network which covers North-Western Europe. The investigation of the 183-WSL retrieval performance is based on a twofold approach: 1) the dichotomous statistic is used to evaluate the capabilities of the method to identify rain and no-rain clouds; 2) the accuracy statistic is applied to quantify the errors in the estimation of rain rates.The results reveal that the 183-WSL technique shows good skills in the detection of rainno-rain areas and in the quantification of rain rate intensities. The categorical analysis shows annual values of the POD, FAR and HK indices varying in the range 0.80-0.82, 0.330.36 and 0.39-0.46, respectively. The RMSE value is 2.8 millimeters per hour for the whole period despite an overestimation in the retrieved rain rates. Of note is the distribution of the 183-WSL monthly mean rain rate with respect to radar: the seasonal fluctuations of the average rainfalls measured by radar are reproduced by the 183-WSL. However, the retrieval method appears to suffer for the winter seasonal conditions especially when the soil is partially frozen and the surface emissivity drastically changes. This fact is verified observing the discrepancy distribution diagrams where2the 183-WSL

  6. Unit-specific contingency plan for the 183-H Solar Evaporation Basins. Revision 2

    International Nuclear Information System (INIS)

    This document is a supplement to the Hanford Facility Contingency Plan. It provides the unit-specific information needed to fully comply with the Washington Administrative Code, Chapter 173-303, ''Dangerous Waste Regulations,'' for contingency plans. General emergency and response information is contained in the Hanford Facility Contingency Plan and is not repeated in this supplement. The 183-H Solar Evaporation Basins are four concrete internal surfaces which contained radiologically- and hazardous-contaminated waste. The 183-H basins are currently empty, inactive and designated as a Resource Conservation and Recovery Act interim-status treatment, storage, and disposal unit undergoing closure. There is no dangerous waste management actively occurring. There is very little likelihood of any incidents that would present hazards to public health or the environment occurring at the 183-H basins

  7. Unit-specific contingency plan for the 183-H solar evaporation basins. Revision 1

    International Nuclear Information System (INIS)

    This document is a supplement to the Hanford Facility Contingency Plan. It provides the unit-specific information needed to fully comply with the Washington Administrative Code, Chapter 173-303, ''Dangerous Waste Regulations,'' for contingency plans. General emergency and response information is contained in the Hanford Facility Contingency Plan and is not repeated in this supplement. The 183-H solar evaporation basins are four concrete internal surfaces which contained radiologically- and hazardous-contaminated waste. The 183-H basins are currently empty, inactive and designated as a Resource Conservation and Recovery Act interim-status treatment, storage, and disposal unit undergoing closure. There is no dangerous waste management actively occurring. There is very little likelihood of any incidents that would present hazards to public health or the environment occurring at the 183-H basins

  8. The microRNA-183 cluster: the family that plays together stays together

    OpenAIRE

    Dambal, Shweta; Shah, Mit; Mihelich, Brittany; Nonn, Larisa

    2015-01-01

    The microRNA (miR)183 cluster, which is comprised of miRs-183, -96 and -182, is also a miR family with sequence homology. Despite the strong similarity in the sequences of these miRs, minute differences in their seed sequences result in both overlapping and distinct messenger RNA targets, which are often within the same pathway. These miRs have tightly synchronized expression during development and are required for maturation of sensory organs. In comparison to their defined role in normal de...

  9. Unit-Specific Contingency Plan for the 183-H Solar Evaporation Basins

    International Nuclear Information System (INIS)

    This document is a supplement to DOE/RL-93-75, 'Hanford Contingency Plan.' It provides the unit-specific information needed to fully comply with the Washington Administrative Code. General emergency and response information is contained in the Hanford Facility Contingency Plan and is not repeated in this supplement. The 183-H Solar Evaporation Basins were four concrete internal surfaces, which contained radiologically and hazardous contaminated waste. The 183-H Basin area is a final status treatment, storage, and disposal unit undergoing Resource Conservation and Recovery Act modified post- closure care

  10. Remaining Sites Verification Package for the 126-B-2, 183-B Clearwells

    International Nuclear Information System (INIS)

    The 126-B-2, 183-B Clearwells were built as part of the 183-B Water Treatment Facility and are composed of 2 covered concrete reservoirs. The bulk of the water stored in the clearwells was used as process water to cool the 105-B Reactor and as a source of potable water. Residual conditions were determined to meet the remedial action objectives specified in the Remaining Sites ROD through an evaluation of the available process knowledge. The results of the evaluation do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also indicate that residual concentrations are protective of groundwater and the Columbia River.

  11. 78 FR 68814 - Subzone 183B; Authorization of Production Activity; Samsung Austin Semiconductor, LLC...

    Science.gov (United States)

    2013-11-15

    ... (78 FR 40427, 7-5-2013). The FTZ Board has determined that no further review of the activity is... Foreign-Trade Zones Board Subzone 183B; Authorization of Production Activity; Samsung Austin Semiconductor, LLC (Semiconductors); Austin, Texas On June 26, 2013, Samsung Austin Semiconductor, LLC submitted...

  12. 25 CFR 224.183 - What other administrative appeals processes also apply?

    Science.gov (United States)

    2010-04-01

    ... DETERMINATION ACT General Appeal Procedures § 224.183 What other administrative appeals processes also apply? The administrative appeal processes in 25 CFR part 2 and 43 CFR part 4, subject to the limitations in... 25 Indians 1 2010-04-01 2010-04-01 false What other administrative appeals processes also...

  13. 18 CFR 367.1830 - Account 183, Preliminary survey and investigation charges.

    Science.gov (United States)

    2010-04-01

    ... abandoned, the charge must be made to account 426.5, Other deductions (§ 367.4265), or to the appropriate... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 183..., FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Deferred Debits § 367.1830...

  14. Revised ground-water monitoring compliance plan for the 183-H Solar Evaporation Basins

    International Nuclear Information System (INIS)

    This document contains ground-water monitoring plans for a mixed waste storage facility located on the Hanford Site in southeastern Washington State. This facility has been used since 1973 for storage of mixed wastes, which contain both chemicals and radionuclides. The ground-water monitoring plans presented here represent revision and expansion of an effort in June 1985. At that time, a facility-specific monitoring program was implemented at the 183-H Basins as part of the regulatory compliance effort being conducted on the Hanford Site. This monitoring program was based on the ground-water monitoring requirements for interimstatus facilities, which are those facilities that do not yet have final permits, but are authorized to continue interim operations while engaged in the permitting process. The program initially implemented for the 183-H Basins was designed to be an alternate program, which is required instead of the standard detection program when a facility is known or suspected to have contaminated the ground water in the uppermost aquifer. This effort, named the RCRA Compliance Ground-Water Monitoring Project for the 183-H Basins, was implemented. A supporting project involving ground-water flow modeling for the area surrounding the 183-H Basins was also initiated during 1985. Those efforts and the results obtained are described in subsequent chapters of this document. 26 refs., 55 figs., 14 tabs

  15. 33 CFR 183.235 - Level flotation test without weights for persons capacity.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Level flotation test without..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of More Than 2 Horsepower Tests § 183.235 Level...

  16. 33 CFR 183.335 - Level flotation test without weights for persons capacity.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Level flotation test without..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of 2 Horsepower or Less Tests § 183.335 Level flotation...

  17. Doing Business 2011 : Making a Difference for Entrepreneurs - Comparing Business Regulation in 183 Economies

    OpenAIRE

    International Finance Corporation; World Bank

    2010-01-01

    Doing Business 2011: making a difference for entrepreneurs is the eighth in a series of annual reports investigating regulations that enhance business activity and those that constrain it. Doing Business presents quantitative indicators on business regulations and the protection of property rights that can be compared across 183 economies, from Afghanistan to Zimbabwe, over time. A set of ...

  18. 1995 Phase 1 concrete sampling at the decontaminated 183-H basins

    International Nuclear Information System (INIS)

    This report provides a consolidated reference for 1995 concrete sampling data associated with the Hanford Site's 183-H Solar Evaporation Basins (located at the Hanford Site in Richland, Washington). In 1995, the basins were decontaminated and dismantled. Sampling efforts began after completion of concrete decontamination efforts. Soil and water samples were collected and are described in chronological order in this report

  19. 14 CFR 121.183 - Part 25 airplanes with four or more engines: Reciprocating engine powered: En route limitations...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Part 25 airplanes with four or more engines: Reciprocating engine powered: En route limitations: Two engines inoperative. 121.183 Section 121.183 Aeronautics... more engines: Reciprocating engine powered: En route limitations: Two engines inoperative. (a)...

  20. Field screening sampling and analysis strategy and methodology for the 183-H Solar Evaporation Basins: Phase 2, Soils

    International Nuclear Information System (INIS)

    This document provides a sampling/analytical strategy and methodology for Resource Conservation and Recovery Act (RCRA) closure of the 183-H Solar Evaporation Basins within the boundaries and requirements identified in the initial Phase II Sampling and Analysis Plan for RCRA Closure of the 183-H Solar Evaporation Basins

  1. Dysregulated miR-183 inhibits migration in breast cancer cells.

    LENUS (Irish Health Repository)

    Lowery, Aoife J

    2010-01-01

    The involvement of miRNAs in the regulation of fundamental cellular functions has placed them at the fore of ongoing investigations into the processes underlying carcinogenesis. MiRNA expression patterns have been shown to be dysregulated in numerous human malignancies, including breast cancer, suggesting their probable involvement as novel classes of oncogenes or tumour suppressor genes. The identification of differentially expressed miRNAs and elucidation of their functional roles may provide insight into the complex and diverse molecular mechanisms of tumorigenesis. MiR-183 is located on chromosome 7q32 and is part of a miRNA family which are dysregulated in numerous cancers. The aims of this study were to further examine the expression and functional role of miR-183 in breast cancer.

  2. QCD studies with $e^{+}e^{-}$ annihilation data from 130 to 183 GeV

    CERN Document Server

    Cowan, G D; Jones, R; Stenzel, H

    1998-01-01

    QCD studies with e+e- annihilation data from 130 to 183 GeV The ALEPH Collaboration Properties of hadronic events produced at LEP at centre-of-mass energies of 130, 136, 161, 172 and 183 GeV are studied and compared with QCD predictions. Distributions of event-shape observables, jet rates, particle momentum spectra and multiplicities are presented and compared to the predictions of several Monte Carlo models and analytic QCD calculations. From a fit of O(\\alpha_s^2)+ NLLA QCD calculations to distributions of event-shape variables, alpha_s has been determined at various energies. The mean charged particle multiplicities and the peak positions xi^* of the xi = -ln x_p distribution have also been determined. These results have been compared to lower energy data and to analytic QCD or Monte Carlo predictions for their energy evolution.

  3. In vitro and in vivo characterization of the antimalarial lead compound SSJ-183 in Plasmodium models

    Directory of Open Access Journals (Sweden)

    Schleiferböck S

    2013-11-01

    Full Text Available Sarah Schleiferböck,1,2 Christian Scheurer,1,2 Masataka Ihara,3,4 Isamu Itoh,3,4 Ian Bathurst,5,† Jeremy N Burrows,5 Pascal Fantauzzi,5 Julie Lotharius,5 Susan A Charman,6 Julia Morizzi,6 David M Shackleford,6 Karen L White,6 Reto Brun,1,2 Sergio Wittlin1,21Swiss Tropical and Public Health Institute, Basel, 2University of Basel, Basel, Switzerland; 3Drug Discovery Science Research Center, Hoshi University, Shinagawa, Tokyo, Japan; 4Synstar Japan Co, Ltd, Odawara, Japan; 5Medicines for Malaria Venture, Geneva, Switzerland; 6Centre for Drug Candidate Optimisation, Monash Institute of Pharmaceutical Sciences, Parkville, VIC, Australia †Ian Bathurst passed away on 26 June 2011Abstract: The objective of this work was to characterize the in vitro (Plasmodium falciparum and in vivo (Plasmodium berghei activity profile of the recently discovered lead compound SSJ-183. The molecule showed in vitro a fast and strong inhibitory effect on growth of all P. falciparum blood stages, with a tendency to a more pronounced stage-specific action on ring forms at low concentrations. Furthermore, the compound appeared to be equally efficacious on drug-resistant and drug-sensitive parasite strains. In vivo, SSJ-183 showed a rapid onset of action, comparable to that seen for the antimalarial drug artesunate. SSJ-183 exhibited a half-life of about 10 hours and no significant differences in absorption or exposure between noninfected and infected mice. SSJ-183 appears to be a promising new lead compound with an attractive antimalarial profile.Keywords: antimalarial studies, cross-resistance, stage-specificity, Plasmodium falciparum

  4. Pregnancy Outcomes and Appropriate Timing of Pregnancy in 183 pregnancies in Korean Patients with SLE

    OpenAIRE

    Ko, Hyun Sun; Ahn, Hyun Young; Jang, Dong Gyu; Choi, Sae-Kyung; Park, Yong-Gyu; Park, In Yang; Lee, Guisera; Park, Sung-Hwan; Shin, Jong Chul

    2011-01-01

    This study was undertaken to investigate the pregnancy outcomes in patients with systemic lupus erythematosus (SLE) and the appropriate timing of pregnancy. We performed a retrospective evaluation of 183 pregnancies with SLE at Catholic University Medical Center during the 13-year period from 1998 to 2010. Pregnancy outcomes were compared according to SLE characteristics. The predictive value of the different cut-off points of the stable period before conception on adverse pregnancy outcomes ...

  5. Integration of photocatalysis and biological treatment for azo dye removal--application to AR183.

    Science.gov (United States)

    Chebli, Derradji; Fourcade, Florence; Brosillon, Stephan; Nacef, Saci; Amrane, Abdeltif

    2011-04-01

    The feasibility of coupling photocatalysis with biological treatment to treat effluents containing azo dyes was examined in this work. With this aim, the degradation of Acid Red 183 was investigated. The very low biodegradability of AR183 was confirmed beforehand by measuring the biological oxygen demand (BOD5). Photocatalysis experiments were carried out in a closed-loop step photoreactor. The reactor walls were covered by TiO2 catalyst coated on non-woven paper, and the effluent flowed over the photocatalyst as a thin falling film. The removal of the dye was 82.7% after 4 h, and a quasi-complete decolorization (98.5%) was obtained for 10 h of irradiation (initial concentration 100 mg L(-1)). The decrease in concentration followed pseudo-first-order kinetics, with a constant k of 0.47 h(-1). Mineralization and oxidation yields were 80% and 75%, respectively, after 10 h of pretreatment. Therefore, even if target compound oxidation occurs (COD removal), indicating a modification to the chemical structure, the concomitant high mineralization was not in favour of subsequent microbial growth. The BOD5 measurement confirmed the non-biodegradability of the irradiated solution, which remained toxic since the EC50 decreased from 35 to 3 mg L(-1). The proposed integrated process appeared, therefore, to be not relevant for the treatment of AR183. However, this result should be confirmed for other azo dyes. PMID:21877531

  6. 1996 Phase 2 soil sampling at the 183-H Solar Evaporation Basin site

    International Nuclear Information System (INIS)

    This report consolidates 1996 soil sampling data collected from the 183-H Solar Evaporation Basin Site. This report is intended to be a data reference and does not make comparisons or conclusions regarding specific regulatory criteria. Chemical and radiological data were collected to support cleanup activities at the Hanford Site; soil sampling occurred beneath and next to the former basin structures. The 183-H Solar Evaporation Basins, which consisted of four adjoining concrete basins, were located in the 100 Area of the Hanford Site, north of the retired 105-H Reactor. Originally, the basins were built as part of the 100-H water treatment structures. The four basins were inactive from the mid-1960's until 1973 when radioactive and dangerous (mixed) waste from the 300 Area Fuel Fabrication Facility was shipped to the basins for storage and treatment. The basins were used for solar evaporation of the waste. The last shipment of waste to the 183-H Basins took place in November 1985. Decontamination of the cement structure took place in 1995. The structure has subsequently been dismantled and disposed. Chapters 2.0 through 4.0 present summary information about sampling (1) beneath the loading ramp and berm piles, (2) in shallow soils beneath the former basin floor, and (3) deep vadose soils. Detailed data are provided in the appendices

  7. microRNA-183 plays as oncogenes by increasing cell proliferation, migration and invasion via targeting protein phosphatase 2A in renal cancer cells

    International Nuclear Information System (INIS)

    Highlights: • miR-183 was up-regulated in renal cancer tissues. • Inhibition of endogenous miR-183 suppressed renal cancer cell growth and metastasis. • miR-183 increased cell growth and metastasis. • miR-183 regulated renal cancer cell growth and metastasis via directly targeting tumor suppressor protein phosphatase 2A. - Abstract: The aim of this study was to investigate the function of miR-183 in renal cancer cells and the mechanisms miR-183 regulates this process. In this study, level of miR-183 in clinical renal cancer specimens was detected by quantitative real-time PCR. miR-183 was up- and down-regulated in two renal cancer cell lines ACHN and A498, respectively, and cell proliferation, Caspase 3/7 activity, colony formation, in vitro migration and invasion were measured; and then the mechanisms of miR-183 regulating was analyzed. We found that miR-183 was up-regulated in renal cancer tissues; inhibition of endogenous miR-183 suppressed in vitro cell proliferation, colony formation, migration, and invasion and stimulated Caspase 3/7 activity; up-regulated miR-183 increased cell growth and metastasis and suppressed Caspase 3/7 activity. We also found that miR-183 directly targeted tumor suppressor, specifically the 3′UTR of three subunits of protein phosphatase 2A (PP2A-Cα, PP2A-Cβ, and PP2A-B56-γ) transcripts, inhibiting their expression and regulated the downstream regulators p21, p27, MMP2/3/7 and TIMP1/2/3/4. These results revealed the oncogenes role of miR-183 in renal cancer cells via direct targeting protein phosphatase 2A

  8. Occurrence of cancer in a cohort of 183 persons with constitutional chromosome 7 abnormalities

    DEFF Research Database (Denmark)

    Hasle, H; Olsen, J H; Hansen, J;

    1998-01-01

    Cytogenetic abnormalities in human malignancies frequently involve chromosome 7. The existence of several tumor suppressor genes on the long arm of chromosome 7 has been suggested in both epithelial and hematologic malignancies. From the Danish Cytogenetic Register, we identified 183 persons with...... constitutional abnormalities involving chromosome 7, including 16 patients with Williams syndrome. By linkage to the Danish Cancer Registry, we found five persons with cancer, including one thyroid carcinoma, three carcinomas of the digestive tract, and one malignant melanoma. There were no cases of leukemia...

  9. Search for Scalar Leptons in $e^+ e^-$ collisions at $\\sqrt{s}$= 183 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; Cozzoni, B; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G; Zöller, M

    1999-01-01

    We report the result of a search for scalar leptons in $\\mathrm{ e^+ e^-}$ collisions at 183 GeV centre-of-mass energy at LEP. No evidence for such particles is found in a data sample of 55.2 pb$^{-1}$. Improved upper limits are set on the production cross sections for stable as well as unstable scalar leptons. New exclusion contours in the parameter space of the Minimal Supersymmetric Standard Model are derived, as well as new lower limits on scalar lepton masses.

  10. Spectroscopic Study of `CO’ and its Isotopic mm/Submillimeter Lines from Dark Cloud Lynds 183

    Indian Academy of Sciences (India)

    R. S. Thampi; L. Pagani

    2010-03-01

    We have made spectral line analysis of CO and its isotopic lines from dark cloud Lynds 183 (L183). Our dataset incorporates 12CO(1––0), 13CO(1––0) and 13CO(2––1) lines using NRAO-12m and 12CO(3––2), 13CO(3––2) lines using CSO-10m telescopes, respectively. Observations suggest steep north-south (direction with respect to the offset position (0, 0)) temperature gradient in the cloud. These are likely to be caused by non-uniform, Inter Stellar Radiation Field (ISRF) illumination due to the shadow of nearby L134 cloud complex. As the emission of radiation depends on local properties like density and kinetic temperature, the present study attempts to deduce the irradiation contrast (and the resulting temperature difference) using 1D Monte Carlo radiative transfer code RATRAN. The model results accord with the observed data and shows a temperature difference of ∼ 7 K mainly within the cloud envelope. This results in a non-uniform intensity distribution of both CO and its species.

  11. Biosynthesis of digalactosyldiacylglycerol in plastids from 16:3 and 18:3 plants

    International Nuclear Information System (INIS)

    Intact chloroplasts isolated from leaves of eight species of 16:3 and 18:3 plants and chromoplasts isolated from Narcissus pseudonarcissus L. flowers synthesize galactose-labeled mono-, di-, and trigalactosyldiacylglycerol (MGDG, DGDG, and TGDG) when incubated with UDP-[6-3H]galactose. In all plastids, galactolipid synthesis, and especially synthesis of DGDG and TGDG, is reduced by treatment of the organelles with the nonpenetrating protease thermolysin. Envelope membranes isolated from thermolysin-treated chloroplasts of Spinacia oleracea L. (16:3 plant) and Pisum sativum L. (18:3 plant) or membranes isolated from thermolysin-treated chromoplasts are strongly reduced in galactolipid:galactolipid galactosyltransferase activity, but not with regard to UDP-Gal:diacylglycerol galactosyltransferase. For the intact plastids, this indicates that thermolysin treatment specifically blocks DGDG (and TGDG) synthesis, whereas MGDG synthesis is not affected. Neither in chloroplast nor in chromoplast membranes is DGDG synthesis stimulated by UDP-Gal. DGDG synthesis in S. oleracea chloroplasts is not stimulated by nucleoside 5'-diphospho digalactosides. Therefore, galactolipid:galactolipid galactosyltransferase is so far the only detectable enzyme synthesizing DGDG

  12. MicroRNA-183 promotes migration and invasion of CD133(+)/CD326(+) lung adenocarcinoma initiating cells via PTPN4 inhibition.

    Science.gov (United States)

    Zhu, Conghui; Deng, Xi; Wu, Jingbo; Zhang, Jianwen; Yang, Hongru; Fu, Shaozhi; Zhang, Yan; Han, Yunwei; Zou, Yuanmei; Chen, Zhengtang; Lin, Sheng

    2016-08-01

    Non-small cell lung cancer (NSCLC) is the most common cancer worldwide and is a leading cause of lung cancer mortality due to early stage metastases. Cancer stem-like cells (CSLCs) or tumor-initiating cells (TICs) are rare subpopulation cells that are responsible for maintaining tumor growth and invasion leading to recurrence and metastasis. Previous studies revealed that miR-183 can mediate the invasiveness and growth of NSCLC. However, the exact role of miR-183 in regulating the biological behavior of CSLCs in NSCLC remains unclear. In the present study, we explored the regulation of protein tyrosine phosphatase non-receptor type 4 (PTPN4) by miR-183 in vitro using luciferase reporter assays, and we further analyzed the effects of miR-183 on the invasiveness of CSLCs in vitro and in vivo using transwell and bioluminescence assays. Following our finding that miR-183 binds to PTPN4 messenger RNA (mRNA) to prevent its translation through the 3'-untranslated region (UTR), we found that overexpression of miR-183 in CSLCs decreased PTPN4 protein levels while inhibition of miR-183 increased PTPN4 protein levels. The suppression of PTPN4 levels in CSLCs by miR-183 paralleled with a significant promotion in their motility in vitro and in vivo, while anti-sense miR-183 increased PTPN4 levels in CSLCs, which paralleled with a significant decrease in their invasiveness. Furthermore, correlation analysis between miR-183 and PTPN4 in clinical samples demonstrated a statistically significant inverse correlation between PTPN4 mRNA levels and miR-183. In brief, our data indicate that miR-183 plays a pro-invasive role by inverse regulation of PTPN4, and this axis may be a new therapeutic target for suppressing the metastatic capability of CSLCs in NSCLC. PMID:26951513

  13. 角膜塑形矫治近视183例随访体会%Follow-up experience of orthokeratology correctional myopia in 183 cases

    Institute of Scientific and Technical Information of China (English)

    王晓玉; 丁小云; 叶亚玲

    2015-01-01

    Objective:To observe the treatment effect of corneal orthopedic for myopia,and the relationship between various parameters and curative effects,the adverse reactions in the treatment.Methods:183 cases(346 eyes) with corneal orthodontic treatment were given followed up for 3 to 12 months.The different diopters were treated by using three different corneal orthopaedic mirror.The relationships between different parameters and curative effects,the emerging time and frequency of various adverse reactions of patients with ametropia.Results:After corneal orthopedic treatment,320 eyes(92.5%) were visual acuity more than or equal to 4.8,275 eyes(79.9%) were visual acuity more than or equal to 5.0.Before treatment,the patients with the diopter more than or equal to -5.0 D,the corneal curvature more than or equal to 45.0 D,the ocular axial length more than or equal to 25 mm and patients who were not provide E value in early,the curative effects were poor(P<0.01).The curative effect of 13 to 17 years old age group was poor(P<0.01).The main adverse reactions were corneal epithelial injury(first wear 49.7% ) and the appearance of double image(41% in 3 weeks),1 patient had persistent eyestrain.Conclusion:Corneal correction technique is a safe and effective method to improve the naked vision of myopia,and the treatment of juvenile myopia is better,but it should pay attention to the adverse reactions such as corneal epithelial injury and double image.%目的:观察角膜矫形对近视眼的治疗效果,以及各种参数与疗效的关系和治疗中出现的不良反应。方法:对角膜矫形治疗的183例346只眼进行了3~12个月随访观察。对不同屈光度用3种不同的角膜矫形镜做治疗,统计屈光不正患者的不同参数与疗效的关系及各种不良反应出现的时段与频率。结果:角膜矫形治疗后,视力≥4.8的320只眼(92.5%),视力≥5.0的275只眼(79.9%)。治疗前屈光度≥-5.0 D、角膜曲率≥45.0 D

  14. Clinical analysis of 183 cases with infectious keratitis%感染性角膜炎183例回顾性分析

    Institute of Scientific and Technical Information of China (English)

    罗知卫; 李建南; 姜德咏; 李曦; 李晓静; 彭婷

    2011-01-01

    目的 分析183例(187眼)感染性角膜炎的病因、治疗方法和结果.方法 明确角膜感染的种类,采用药物和手术进行治疗,治疗后观察临床效果.结果 单眼发病179例,双眼发病4例.发病年龄为1~80岁,平均(52.75±15.08)岁.男117例,女66例.真菌性角膜溃疡84眼(44.92%),细菌性角膜溃疡28眼(14.97%),病毒性角膜炎14眼(7.49%),细菌真菌混合感染5眼(2.67%),病因不确定56眼(29.95%).单纯药物治疗者118眼(63.10%),清创联合结膜瓣遮盖术24眼(12.83%),清创联合羊膜移植结膜瓣遮盖术19眼(10.16%),治疗性角膜移植术18眼(9.63%)(其中穿透性角膜移植术16眼,板层角膜移植术2眼),泪囊鼻腔吻合术5眼(2.67%),眼内容摘除术5眼(2.67%),其中2眼为羊膜移植失败者.结论 真菌性角膜炎是感染性角膜炎的主要病因,局部清创联合安尔碘Ⅲ稀释液冲洗及药物治疗对大部分感染性角膜炎有效,部分患者仍需要手术治疗.%Objective To analyse the pathogenesis,treatment and result of 183 in-patient with infectious keratitis form January 2004 to December 2009. Methods Clinical manifestations, pathogenesis results was used to clear different corneal infections. Operations and drugs were used to treat these diseases.and results were observed during whole in-patient period. Results All infectious eyes were seen in 179 cases with one eye affected and 4 cases with both eyes affected,the age between 1~80 years,mean age 52. 75 years;male 117 cases( 119 eyes) and female 66 cases(68 eyes). 84 eyes with fungal infection,28 eyes with bacterial infection, 14 eyes with viral infection,5 eyes with mixed infection and 56 eyes with unknown infection;118 eyes received drug treatment (63. 10% ) ,24 eyes received local debridement combined with conjunctival flap microsurgery (12. 83% ), 17 eyes received local debridement combined with amniotic membrane transplantation and conjunctival flap microsurgery (9. 09% ) , 18 eyes received

  15. Purification and properties of alpha-pinene oxide lyase from Nocardia sp. strain P18.3.

    OpenAIRE

    Griffiths, E T; Harries, P C; Jeffcoat, R; Trudgill, P W

    1987-01-01

    alpha-Pinene oxide is an intermediate in the degradation of alpha-pinene by Nocardia sp. strain P18.3 and some Pseudomonas strains. The epoxide is cleaved by a lyase which catalyzes a concerted reaction in which both rings of the bicyclic structure are cleaved with the formation of cis-2-methyl-5-isopropylhexa-2,5-dienal. The enzyme has been purified to homogeneity from Nocardia sp. strain P18.3. It was induced by growth with alpha-pinene and constituted 6 to 7% of the soluble protein of cell...

  16. Search for resonant nu production at $\\sqrt{s}$ = 183 to 208 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, G; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, W; Dalmau, J; De Maria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; Della Ricca, G; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Geralis, T; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Hansen, J; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, P D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, M; Mazzucato, F; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Prorok, Dariusz; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, R N; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verbeure, F; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zimin, N I; Zinchenko, A I; Zupan, M

    2003-01-01

    Searches for resonant nu production in e/sup +/e/sup -/ collisions under the assumption that R-parity is not conserved and that the dominant R-parity violating coupling is lambda /sub 121/or lambda /sub 131/ used data recorded by DELPHI in 1997 to 2000 at centre-of- mass energies of 183 to 208 GeV. No deviation from the standard model was observed. Upper limits are given for the lambda /sub lambda 121/ and lambda /sub 131/ couplings as a function of the sneutrino mass and total width. The limits are especially stringent for sneutrino masses equal to the centre-of-mass energies with the highest integrated luminosities recorded.

  17. Absolute Transition Probabilities from the 453.1 keV Level in 183W

    International Nuclear Information System (INIS)

    The half life of the 453.1 keV level in 183W has been measured by the delayed coincidence method to 18.4 ± 0.5 nsec. This determines twelve absolute M1 and E2 transition probabilities, out of which nine are K-forbidden. All transition probabilities are compared with the single particle estimate. The three K-allowed E2, ΔK = 2 transition rates to the 1/2- (510) rotational band are furthermore compared with the Nilsson model. An attempt to give a quantitative explanation of the observed transition rates has been made by including the effects from admixtures into the single particle wave functions

  18. A review of sources of systematic errors and uncertainties in observations and simulations at 183 GHz

    Science.gov (United States)

    Brogniez, Helene; English, Stephen; Mahfouf, Jean-Francois; Behrendt, Andreas; Berg, Wesley; Boukabara, Sid; Buehler, Stefan Alexander; Chambon, Philippe; Gambacorta, Antonia; Geer, Alan; Ingram, William; Kursinski, E. Robert; Matricardi, Marco; Odintsova, Tatyana A.; Payne, Vivienne H.; Thorne, Peter W.; Tretyakov, Mikhail Yu.; Wang, Junhong

    2016-05-01

    Several recent studies have observed systematic differences between measurements in the 183.31 GHz water vapor line by space-borne sounders and calculations using radiative transfer models, with inputs from either radiosondes (radiosonde observations, RAOBs) or short-range forecasts by numerical weather prediction (NWP) models. This paper discusses all the relevant categories of observation-based or model-based data, quantifies their uncertainties and separates biases that could be common to all causes from those attributable to a particular cause. Reference observations from radiosondes, Global Navigation Satellite System (GNSS) receivers, differential absorption lidar (DIAL) and Raman lidar are thus overviewed. Biases arising from their calibration procedures, NWP models and data assimilation, instrument biases and radiative transfer models (both the models themselves and the underlying spectroscopy) are presented and discussed. Although presently no single process in the comparisons seems capable of explaining the observed structure of bias, recommendations are made in order to better understand the causes.

  19. Action taken to remediate the 183-H solar evaporation basins at the Hanford, Washington site

    International Nuclear Information System (INIS)

    The four 183-H solar evaporation basins were originally constructed as floccation/settling basins which were part of the cooling water treatment facility associated with the operation of the 100-H plutonium production reactor (circa 1949-1965). The basins were converted in 1973 to solar evaporation basins for chemical/low level radioactive liquid wasted from Hanford fuel fabrication operations. Use of the basins for evaporation continued until 1985. One of the basins was suspected of leaking prior to being taken out of operation. When the current decontamination and decommissioning (D and D) efforts began in 1986, basin number-sign 1 which had suspected leakage, had been cleaned of all liquid and sludge, and the three remaining basins contained a total of 500,000 gallons of liquid and 30,000 cubic feet of sludge. Between 1986 and 1988, the 500,000 gallons of liquid was reduced to 350,000 gallons through natural evaporation

  20. Photon Events with Missing Energy at $\\sqrt{s}$= 183 to 189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moraes, D; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanic, S; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zucchelli, G C; Zumerle, G

    2000-01-01

    The production of single photons has been studiedin the reaction e+e- --> gamma+ invisible particles at centre-of-mass energies of 183~GeV and 189~GeV.A previously published analysis of events with multi-photonfinal states accompanied by missing energy has been updated with 189 GeV data.The data were collected with the DELPHI detector and correspondto integrated luminosities of about 51~pb^{-1}and 158~pb^{-1}at thetwo energies.The number of light neutrino families is measured to be2.86\\pm0.13(stat)\\pm0.14(syst)$. The absence ofan excess of events beyond that expected from Standard Modelprocesses is used to set limits on new physicsas described by supersymmetric and composite models.A limit on the gravitational scale is also determined.

  1. A test of charge symmetry in n-p scattering at En=183 MeV

    International Nuclear Information System (INIS)

    Measurements of the spin-dependent left-right asymmetries for n-p elastic scattering at En = 183 MeV have been obtained by scattering polarized neutrons from polarized protons. If charge symmetry holds in the n-p system, the two analyzing powers An and Ap must be equal. Our preliminary experimental result for the average value of An-Ap in the range 82.2deg ≤ θcm ≤ 116.1deg is (32.1 ± 6.1 ± 6)x10-4 where the first error is the statistical uncertainty and the second is the systematic uncertainty. This result provides clear evidence of charge symmetry breaking in the nuclear force, and agrees well with meson-exchange predictions based on the Bonn nucleon-nucleon potential. (orig.)

  2. Searches for R-Parity Violating Decays of Gauginos at 183 GeV at LEP

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Hoch, M; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    Searches for pair-produced charginos and neutralinos with R-parity violating decays have been performed using a data sample corresponding to an integrated luminosity of 56 pb-1 collected with the OPAL detector at LEP at a centre-of-mass energy of 183 GeV. An important consequence of R-parity violation is that the lightest supersymmetric particle becomes unstable. The searches have been performed under the assumptions that the lightest supersymmetric particle promptly decays and that only one R-parity violating coupling is dominant for each of the decay modes considered. Such processes would yield multiple leptons, leptons plus jets, or multiple jets with or without significant missing energy in the final state. No excess of such events above Standard Model backgrounds has been observed. Limits are presented on the production cross-sections of gauginos in R-parity violating scenarios. Limits are also presented in the framework of the Minimal Supersymmetric Standard Model.

  3. Radiative capture of polarized neutrons by polarized protons at Tn=183 MeV

    Science.gov (United States)

    Xu, G.; Pate, S. F.; Bloch, C.; Vigdor, S. E.; Bowyer, S. M.; Bowyer, T. W.; Jacobs, W. W.; Meyer, H. O.; Pierce, E.; Sowinski, J.; Whiddon, C.; Wissink, S. W.; Jolivette, P. L.; Pickar, M. A.

    1995-12-01

    In order to provide a quantitative test of theoretical calculations incorporating meson-exchange currents and intermediate Δ resonances, we measure the normal-component spin correlation coefficient CNN, the differential cross section dσ/dΩ, and the neutron and proton analyzing powers An and Ap, each as a function of angle, for n-->p-->-->dγ at Tn=183 MeV. Our n-->p-->-->dγ results, combined with the previous cross section and photon asymmetry data collected in the past decade, place quite strong constraints on model calculations. Our data are in excellent agreement with theoretical predictions by Jaus and Woolcock that incorporate meson-exchange and isobar current effects and relativistic corrections, signifying great recent progress in our understanding of these effects in the nucleon-nucleon system.

  4. Let-7, mir-98 and mir-183 as biomarkers for cancer and schizophrenia [corrected].

    Directory of Open Access Journals (Sweden)

    Emmanouil Rizos

    Full Text Available Recent evidence supports a role of microRNAs in cancer and psychiatric disorders such as schizophrenia and bipolar disorder, through their regulatory role on the expression of multiple genes. The rather rare co-morbidity of cancer and schizophrenia is an old hypothesis which needs further research on microRNAs as molecules that might exert their oncosuppressive or oncogenic activity in the context of their role in psychiatric disorders. The expression pattern of a variety of different microRNAs was investigated in patients (N = 6 suffering from schizophrenia termed control, patients with a solid tumor (N = 10 and patients with both schizophrenia and tumor (N = 8. miRNA profiling was performed on whole blood samples using the miRCURY LNA microRNA Array technology (6th & 7th generation. A subset of 3 microRNAs showed a statistically significant differential expression between the control and the study groups. Specifically, significant down-regulation of the let-7p-5p, miR-98-5p and of miR-183-5p in the study groups (tumor alone and tumorand schizophrenia was observed (p<0.05. The results of the present study showed that let-7, miR-98 and miR-183 may play an important oncosuppressive role through their regulatory impact in gene expression irrespective of the presence of schizophrenia, although a larger sample size is required to validate these results. Nevertheless, further studies are warranted in order to highlight a possible role of these and other micro-RNAs in the molecular pathways of schizophrenia.

  5. Epidemiological study of 183 patients with spontaneous rupture of cerebral aneurysm

    International Nuclear Information System (INIS)

    Cerebral vessels aneurysms represent a significant part of the cerebral vessels pathology. There is no extensive study on that in Bulgaria. We present a study of 183 patients with spontaneous rupture of cerebral aneurysm, diagnosed and treated in UMHATEM ‘Pirogov’, Sofia. We used clinical methods - data from subject history, analysis of the accompanying documentation, subject medical chart; imaging-diagnostics methods - CT, DSA and MRI; and statistical methods. A total of 183 patients with ruptured intracranial aneurysms were studied. 65% were females and 35% were men.The ration female/male is 1.86, The mean age of all patients is 53.1 ±10.1 years. The highest incidence of ruptured aneurysms is seen in the age group 50 to 59 years. Aneurysms of a. cerebri media and a. communicants anterior are the most frequent (63.4% in total); while the lest are those of a basilaris (4.9%). 88.5% of the aneurysms in the studied group are small, 9.8% are large and 1.6% are giant. Intracranial hematomas are seen in 13.1% of the patients with ruptured aneurysms. Most frequently hematomas are connected with a. cerebri media and a.communicants anterior (87.5% in total). Patients with multiple aneurysms are 11.5% in total, 85.7% of them with an aneurysm of a.cerebri media. The incidence of ruptured cerebral aneurysms is higher amongst female. Frequency in the fifth decade of life is the highest. Most often seen are the aneurysms of a. cerebri media and a. communicants anterior, and the least - those of a. basilaris. Intracranial hematomas most frequently are associated with ruptures of a. cerebri media and a. communicants anterior, in patients with multiple aneurysms the highest is the frequency of aneurysms of a. cerebri media. (authors)

  6. ICE AND DUST IN THE PRESTELLAR DARK CLOUD LYNDS 183: PREPLANETARY MATTER AT THE LOWEST TEMPERATURES

    Energy Technology Data Exchange (ETDEWEB)

    Whittet, D. C. B.; Poteet, C. A.; Bajaj, V. M.; Horne, D. [Department of Physics, Applied Physics and Astronomy and New York Center for Astrobiology, Rensselaer Polytechnic Institute, 110 Eighth Street, Troy, NY 12180 (United States); Chiar, J. E. [SETI Institute, Carl Sagan Center, 189 Bernardo Avenue, Mountain View, CA 94043 (United States); Pagani, L. [LERMA, UMR 8112 du CNRS, Observatoire de Paris, 61 Av. de l' Observatoire, F-75014 Paris (France); Shenoy, S. S. [SOFIA Science Center, NASA Ames Research Center, MS 232-12, Moffett Field, CA 94035 (United States); Adamson, A. J. [Gemini Observatory, Southern Operations Center, Casilla 603, La Serena (Chile)

    2013-09-10

    Dust grains are nucleation centers and catalysts for the growth of icy mantles in quiescent interstellar clouds, the products of which may accumulate into preplanetary matter when new stars and solar systems form within the clouds. In this paper, we present the first spectroscopic detections of silicate dust and the molecular ices H{sub 2}O, CO, and CO{sub 2} in the vicinity of the prestellar core L183 (L134N). An infrared photometric survey of the cloud was used to identify reddened background stars, and we present spectra covering solid-state absorption features in the wavelength range 2-20 {mu}m for nine of them. The mean composition of the ices in the best-studied line of sight (toward J15542044-0254073) is H{sub 2}O:CO:CO{sub 2} Almost-Equal-To 100:40:24. The ices are amorphous in structure, indicating that they have been maintained at low temperature ({approx}< 15 K) since formation. The ice column density N(H{sub 2}O) correlates with reddening by dust, exhibiting a threshold effect that corresponds to the transition from unmantled grains in the outer layers of the cloud to ice-mantled grains within, analogous to that observed in other dark clouds. A comparison of results for L183 and the Taurus and IC 5146 dark clouds suggests common behavior, with mantles first appearing in each case at a dust column corresponding to a peak optical depth {tau}{sub 9.7} = 0.15 {+-} 0.03 in the silicate feature. Our results support a previous conclusion that the color excess E{sub J-K} does not obey a simple linear correlation with the total dust column in lines of sight that intercept dense clouds. The most likely explanation is a systematic change in the optical properties of the dust as the density increases.

  7. ICE AND DUST IN THE PRESTELLAR DARK CLOUD LYNDS 183: PREPLANETARY MATTER AT THE LOWEST TEMPERATURES

    International Nuclear Information System (INIS)

    Dust grains are nucleation centers and catalysts for the growth of icy mantles in quiescent interstellar clouds, the products of which may accumulate into preplanetary matter when new stars and solar systems form within the clouds. In this paper, we present the first spectroscopic detections of silicate dust and the molecular ices H2O, CO, and CO2 in the vicinity of the prestellar core L183 (L134N). An infrared photometric survey of the cloud was used to identify reddened background stars, and we present spectra covering solid-state absorption features in the wavelength range 2-20 μm for nine of them. The mean composition of the ices in the best-studied line of sight (toward J15542044–0254073) is H2O:CO:CO2 ≈ 100:40:24. The ices are amorphous in structure, indicating that they have been maintained at low temperature (∼2O) correlates with reddening by dust, exhibiting a threshold effect that corresponds to the transition from unmantled grains in the outer layers of the cloud to ice-mantled grains within, analogous to that observed in other dark clouds. A comparison of results for L183 and the Taurus and IC 5146 dark clouds suggests common behavior, with mantles first appearing in each case at a dust column corresponding to a peak optical depth τ9.7 = 0.15 ± 0.03 in the silicate feature. Our results support a previous conclusion that the color excess EJ–K does not obey a simple linear correlation with the total dust column in lines of sight that intercept dense clouds. The most likely explanation is a systematic change in the optical properties of the dust as the density increases

  8. k183ar.m77t - MGD77 data file for Geophysical data from field activity K-1-83-AR in Arctic from 07/22/1983 to 08/03/1983

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-83-AR in Arctic from 07/22/1983 to 08/03/1983,...

  9. 78 FR 40427 - Foreign-Trade Zone (FTZ) 183-Austin, Texas; Notification of Proposed Production Activity; Samsung...

    Science.gov (United States)

    2013-07-05

    ... Activity; Samsung Austin Semiconductor, LLC (Semiconductors); Austin, Texas Samsung Austin Semiconductor, LLC (Samsung), operator of Subzone 183B, submitted a notification of proposed production activity to... the regulations of the FTZ Board (15 CFR 400.22) was received on June 26, 2013. Samsung currently...

  10. 25 CFR 183.3 - Does the American Indian Trust Fund Management Reform Act of 1994 apply to this part?

    Science.gov (United States)

    2010-04-01

    ... CARLOS APACHE TRIBE LEASE FUND Introduction § 183.3 Does the American Indian Trust Fund Management Reform... 25 Indians 1 2010-04-01 2010-04-01 false Does the American Indian Trust Fund Management Reform Act... accordance with the American Indian Trust Funds Management Act of 1994 (Management Act), except where...

  11. KOI-183b: a half-Jupiter mass planet transiting a very old solar-like star

    CERN Document Server

    Gandolfi, D; Deeg, H J; Lanza, A F; Fridlund, M; Moroni, P G Prada; Alonso, R; Augusteijn, T; Cabrera, J; Evans, T; Geier, S; Hatzes, A P; Holczer, T; Hoyer, S; Kangas, T; Mazeh, T; Pagano, I; Tal-Or, L; Tingley, B

    2014-01-01

    We report the spectroscopic confirmation of the Kepler object of interest KOI-183b (also known as KOI-183.01), a half-Jupiter mass planet transiting an old solar-like star every 2.7 days. Our analysis is the first to combine the full Kepler photometry (quarters 1-17) with high-precision radial velocity measurements taken with the FIES spectrograph at the Nordic Optical Telescope. We simultaneously modelled the photometric and spectroscopic data-sets using Bayesian approach coupled with Markov chain Monte Carlo sampling. We found that the Kepler pre-search data conditioned (PDC) light curve of KOI-183 exhibits quarter-to-quarter systematic variations of the transit depth, with a peak-to-peak amplitude of about 4.3 % and seasonal trends reoccurring every four quarters. We attributed these systematics to an incorrect assessment of the quarterly variation of the crowding metric. The host star KOI-183 is a G4 dwarf with $M_\\star=0.85\\pm0.04$ M$_\\rm{Sun}$, $R_\\star=0.95\\pm0.04$ R$_\\rm{Sun}$, $T_\\mathrm{eff}=5560\\pm...

  12. V1.42In1.83Mo15Se19

    Directory of Open Access Journals (Sweden)

    Michel Potel

    2010-10-01

    Full Text Available The structure of the title compound, vanadium indium pentadecamolybdenum nonadecaselenide, V1.42In1.83Mo15Se19, is isotypic with In2.9Mo15Se19 [Grüttner et al. (1979. Acta Cryst. B35, 285–292]. It is characterized by two cluster units Mo6Sei8Sea6 and Mo9Sei11Sea6 (where i represents inner and a apical atoms that are present in a 1:1 ratio. The cluster units are centered at Wyckoff positions 2b and 2c and have point-group symmetry overline{3} and overline{6}, respectively. The clusters are interconnected through additional Mo—Se bonds. In the title compound, the V3+ cations replace the trivalent indium atoms present in In2.9Mo15Se19, and a deficiency is observed on the monovalent indium site. One Mo, one Se and the V atom are situated on mirror planes, and two other Se atoms and the In atom are situated on threefold rotation axes.

  13. Analysis of serum 9 HBV marks in 183 HBV infected patients detected synchronously

    International Nuclear Information System (INIS)

    The purpose of this analyse is to investigate the significance of detecting serum 9 HBV marks on judging the replication and the activity of HBV, so as to direct the clinical treatment of anti-virus. 183 HBV infected patients were selected, and the five indexes of hepatitis B, Pre-S2, PHSA-R, HBsAg-IgM and HBV-DNA, were detected synchronously. The occurrence of HBV-DNA, Pre-S2, PHSA-R, HBsAg-IgM are 86.36%, 96.97%, 93.94%, 95.45% respectively when HBeAg is positive, and they are 15.79%, 44.74%, 39.47%, 48.68% respectively when both HBeAg and HBsAg are negative. So it was concluded that HBV-DNA, Pre-S2, PHSA-R, HBsAg-IgM and HBeAg can all be regarded as replication indexes. Pre-S2, PHSA-R and HBsAg-IgM are all surface albumen, the replication and infectivity are in positive proportion to their quantity. Virus can still be replicated when HBeAg and HBsAg are negative

  14. Pregnancy Outcomes and Appropriate Timing of Pregnancy in 183 pregnancies in Korean Patients with SLE

    Directory of Open Access Journals (Sweden)

    Hyun Sun Ko, Hyun Young Ahn, Dong Gyu Jang, Sae-Kyung Choi, Yong-Gyu Park, In Yang Park, Guisera Lee, Sung-Hwan Park, Jong Chul Shin

    2011-01-01

    Full Text Available This study was undertaken to investigate the pregnancy outcomes in patients with systemic lupus erythematosus (SLE and the appropriate timing of pregnancy. We performed a retrospective evaluation of 183 pregnancies with SLE at Catholic University Medical Center during the 13-year period from 1998 to 2010. Pregnancy outcomes were compared according to SLE characteristics. The predictive value of the different cut-off points of the stable period before conception on adverse pregnancy outcomes was calculated by ROC (Receiver operating characteristics curve analysis. In multivariate analysis, the presence of antiphospholipid antibodies (aPLs increased the risk of pregnancy loss (p<0.0001 and premature birth (p=0.0040. Active disease at conception increased the risk of premature birth (p< 0.0001 and complications (IUGR, PIH, or both (p= 0.0078. The other predictor of complications was found to be lupus flare (p=0.0252. At a cut-off level of stable period of 4 months before conception, sensitivity and specificity were 70.8% and 53.2%, 71.4% and 61.5%, and 63.6 % and 59.8 %, respectively on reducing pregnancy loss, premature birth, and complications. Pregnancies with aPLs, active disease at conception and SLE flares are at a higher risk of adverse outcomes. It is essential that disease activity remains stable at least 4 months before conception, for favorable pregnancy outcomes.

  15. 183-W, M2 = 2.4 Yb:YAG Q -switched laser

    International Nuclear Information System (INIS)

    We have fabricated a diode-array end-pumped Yb:YAG rod laser with output powers greater than 200thinspthinspW cw and 195thinspthinspW Q -switched at 5thinspthinspkHz. At an output power of 183thinspthinspW and a repetition rate of 5thinspthinspkHz, the beam quality was measured to be M2=2.4 . The laser design incorporates a hollow lens duct to concentrate the diode pump light for delivery to the end of the laser rod while maintaining access to the laser beam. This configuration provides increased flexibility for the resonator design and permits the use of birefringence compensation in the cavity to yield polarized output with increased efficiency. Using the recently described birefringence compensation method of Clarkson et al.thinspthinsp[in Conference on Lasers and Electro-Optics (Optical Society of America, Washington, D.C., 1998), paper CTuI3], we obtained 112thinspthinspW of cw power with a polarized beam of M2=3.2 . copyright 1999 Optical Society of America

  16. Search for Higgs Bosons in $e^{+} e^{-}$ Collisions at 183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Hoch, M; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    The data collected by the OPAL experiment at sqrts=183 GeV were used to search for Higgs bosons which are predicted by the Standard Model and various extensions, such as general models with two Higgs field doublets and the Minimal Supersymmetric Standard Model (MSSM). The data correspond to an integrated luminosity of approximately 54pb-1. None of the searches for neutral and charged Higgs bosons have revealed an excess of events beyond the expected background. This negative outcome, in combination with similar results from searches at lower energies, leads to new limits for the Higgs boson masses and other model parameters. In particular, the 95% confidence level lower limit for the mass of the Standard Model Higgs boson is 88.3 GeV. Charged Higgs bosons can be excluded for masses up to 59.5 GeV. In the MSSM, mh > 70.5 GeV and mA > 72.0 GeV are obtained for tan{beta}>1, no and maximal scalar top mixing and soft SUSY-breaking masses of 1 TeV. The range 0.8 < tanb < 1.9 is excluded for minimal scalar top...

  17. Description of Work for Drilling at the 183-DR Site in Support of the In Situ Gaseous Reduction Test

    Energy Technology Data Exchange (ETDEWEB)

    Thornton, Edward C.; Olsen, Khris B.; Schalla, Ronald

    2000-06-26

    In Situ Gaseous Reduction is a technology currently being developed by DOE for the remediation of soil waste sites contaminated with hexavalent chromium. Prior work suggests that a candidate for application of this approach is the 183-DR site at Hanford. However, deep vadose zone drilling is needed to verify the presence of a hexavalent chromium source and to determine the concentration levels and spatial distribution of contamination. This document presents the requirements associated with drilling one to two vadose zone boreholes at the 183-DR site to obtain this information. If hexavalent chromium is determined to be present at levels of at least 10 ppm in the vadose zone in one of the initial boreholes, this hole will be completed for gas injection and six additional gas extraction boreholes will be drilled and completed. This network will be used as a flowcell for performing a gas treatment test at the site.

  18. Photosystem II Repair and Plant Immunity: Lessons Learned from Arabidopsis Mutant Lacking the THYLAKOID LUMEN PROTEIN 18.3.

    Science.gov (United States)

    Järvi, Sari; Isojärvi, Janne; Kangasjärvi, Saijaliisa; Salojärvi, Jarkko; Mamedov, Fikret; Suorsa, Marjaana; Aro, Eva-Mari

    2016-01-01

    Chloroplasts play an important role in the cellular sensing of abiotic and biotic stress. Signals originating from photosynthetic light reactions, in the form of redox and pH changes, accumulation of reactive oxygen and electrophile species or stromal metabolites are of key importance in chloroplast retrograde signaling. These signals initiate plant acclimation responses to both abiotic and biotic stresses. To reveal the molecular responses activated by rapid fluctuations in growth light intensity, gene expression analysis was performed with Arabidopsis thaliana wild type and the tlp18.3 mutant plants, the latter showing a stunted growth phenotype under fluctuating light conditions (Biochem. J, 406, 415-425). Expression pattern of genes encoding components of the photosynthetic electron transfer chain did not differ between fluctuating and constant light conditions, neither in wild type nor in tlp18.3 plants, and the composition of the thylakoid membrane protein complexes likewise remained unchanged. Nevertheless, the fluctuating light conditions repressed in wild-type plants a broad spectrum of genes involved in immune responses, which likely resulted from shade-avoidance responses and their intermixing with hormonal signaling. On the contrary, in the tlp18.3 mutant plants there was an imperfect repression of defense-related transcripts upon growth under fluctuating light, possibly by signals originating from minor malfunction of the photosystem II (PSII) repair cycle, which directly or indirectly modulated the transcript abundances of genes related to light perception via phytochromes. Consequently, a strong allocation of resources to defense reactions in the tlp18.3 mutant plants presumably results in the stunted growth phenotype under fluctuating light. PMID:27064270

  19. Preparation of 183,184Re samples for modelling a rapid gas phase chemistry of Nielsbohrium (Ns), element 107

    International Nuclear Information System (INIS)

    Chemical gas phase reactions of the heavier group 7 elements in the system O2/H2O are presumably best suited for a separation of Nielsbohrium from the lighter transactinides. We expect a higher reaction velocity using the more reactive gas system O3/H2O2. For the experimental verification of this idea we prepared 183Re/184Re samples for thermochromatography experiments with both gas systems. (author) 8 refs

  20. Engineering evaluation/cost analysis for disposal of structural concrete and soil from the 183-H Solar Evaporation Basin

    International Nuclear Information System (INIS)

    This engineering evaluation/cost analysis is intended to aid the US Department of Energy, Richland Operations Office in selecting a preferred response action alternative for removing contaminated structural concrete and soils stockpiled next to the 183-H evaporation basin, which was conducted under the Resource Conservation and Recovery Act of 1976. This EE/CA evaluates possible alternative response actions and documents the decision making process

  1. QCD results from studies of hadronic events produced in $e^+ e^-$ annihilations at $\\sqrt{s}$ = 183 GeV

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Easo, S; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1998-01-01

    We present results obtained from a study of the structure of hadronic events recorded by the L3 detector at a centre-of-mass energy of 183 GeV. The data sample corresponds to an integrated luminosity of 55.3 $\\mathrm{pb^{-1}}$. % collected during the high energy run of 1997. The distributions of event shape variables and the energy dependence of their mean values are measured. From a comparison with resummed $\\cal{O}

  2. RCRA closure experience with radioactive mixed waste in the 183-H Solar Evaporation Basins at the Hanford Site

    International Nuclear Information System (INIS)

    This paper provides an overview of the Resource Conservation and Recovery Act (RCRA) of 1976 closure work of the 183-H Solar Evaporation Basins, at the Hanford Site for the US Department of Energy Field Office, Richland, Washington. A description of how the hazardous wastes and radioactive wastes (mixed wastes) were treated and removed is provided, as well as presenting an overview of the sampling program used to demonstrate and document closure

  3. Intensities of two-quanta cascades at different excitation energies of compound nuclei 146Nd, 174Yb, 183W

    International Nuclear Information System (INIS)

    Intensities of two-quanta cascades are obtained for 2-3 final low-lying levels of the following nuclei 146Nd, 174Yb and 183W. These measured intensities are compared with the intensities calculated in the frame of various models at primary transition energies ranging from 0.5 MeV to the neutron binding energy. Some excitation energy intervals are revealed, experimentally obtained intensities of cascade are inconsistent with model calculations. 15 refs.; 7 figs

  4. Simulation of VANAM M3 test using MELCOR 1.8.3

    International Nuclear Information System (INIS)

    A standard problem is defined as a comparison between experimental and analytical results in the field of reactor safety research. The detailed comparison of the data permits conclusions for the reliability and precision of computer simulations of postulated accidents and contributions to the development and improvement of reactor safety computer codes. Following a suggestion of the Federal Republic of Germany, the OECD-CSNI agreed to offer the experiment VANAM M3 at the Battelle Model Containment (BMC), an experiment on thermohydraulics and aerosol behavior in a containment, as International Standard Problem No. 37 (ISP 37). The general objectives of the ISP 37 are to analyse the thermohydraulics of a containment atmosphere and the distribution and settlement of aerosol after a high pressure path with depressurization by pressurizer relief valve discharge. Steam condensation at the aerosol particles(condensation in volume) is enhanced by the hygroscopic properties of the aerosol materials, even in case of limited steam supply. The originally small, low-density NaOH particles are converted to solution droplets by steam condensation, the increasing droplet mass significantly enhancing aerosol depletion by gravity settlement. As a result, higher depletion rate have been obtained for the NaOH aerosol than for the SnO2 aerosol in M2. The MELCOR code, version 1.8.3, has been used for the simulation of this experiment, and the results are compared with the results of other calculations at GRS. The objectives of this report are to contribute to the efficient use of MELCOR code and understanding of the aerosol behavior. 12 tabs., 19 figs., 11 refs. (Author)

  5. Simulation of VANAM M3 test using MELCOR 1.8.3

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Sung Won; Kim, Hee Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1996-07-01

    A standard problem is defined as a comparison between experimental and analytical results in the field of reactor safety research. The detailed comparison of the data permits conclusions for the reliability and precision of computer simulations of postulated accidents and contributions to the development and improvement of reactor safety computer codes. Following a suggestion of the Federal Republic of Germany, the OECD-CSNI agreed to offer the experiment VANAM M3 at the Battelle Model Containment (BMC), an experiment on thermohydraulics and aerosol behavior in a containment, as International Standard Problem No. 37 (ISP 37). The general objectives of the ISP 37 are to analyse the thermohydraulics of a containment atmosphere and the distribution and settlement of aerosol after a high pressure path with depressurization by pressurizer relief valve discharge. Steam condensation at the aerosol particles(condensation in volume) is enhanced by the hygroscopic properties of the aerosol materials, even in case of limited steam supply. The originally small, low-density NaOH particles are converted to solution droplets by steam condensation, the increasing droplet mass significantly enhancing aerosol depletion by gravity settlement. As a result, higher depletion rate have been obtained for the NaOH aerosol than for the SnO{sub 2} aerosol in M2. The MELCOR code, version 1.8.3, has been used for the simulation of this experiment, and the results are compared with the results of other calculations at GRS. The objectives of this report are to contribute to the efficient use of MELCOR code and understanding of the aerosol behavior. 12 tabs., 19 figs., 11 refs. (Author).

  6. Results of Groundwater Monitoring for the 183-H Solar Evaporation Basins Reporting Period: July-December 2006

    International Nuclear Information System (INIS)

    This is one of a series of reports on Resource Conservation and Recovery Act monitoring at the 183 H basins. It fulfills a requirement of WAC 173-303-645(11)(g) to report twice each year on the effectiveness of the corrective action program. This report covers the period from July through December 2006. The current objective of corrective action monitoring is simply to track trends. Although there is short-term variability in contaminant concentrations, trends over the past 10 years are downward. The current RCRA permit and monitoring plan remain adequate for the objective of tracking trends.

  7. Molecular characterization of oxysterol binding to the Epstein-Barr virus-induced gene 2 (GPR183)

    DEFF Research Database (Denmark)

    Benned-Jensen, Tau; Norn, Christoffer; Laurent, Stephane;

    2012-01-01

    Oxysterols are oxygenated cholesterol derivates that are emerging as a physiologically important group of molecules. Although they regulate a range of cellular processes, only few oxysterol-binding effector proteins have been identified, and the knowledge of their binding mode is limited. Recently......, the family of G protein-coupled seven transmembrane-spanning receptors (7TM receptors) was added to this group. Specifically, the Epstein-Barr virus-induced gene 2 (EBI2 or GPR183) was shown to be activated by several oxysterols, most potently by 7α,25-dihydroxycholesterol (7α,25-OHC). Nothing is...

  8. Search for Spontaneous R-parity violation at $\\sqrt{s}$ = 183 GeV and 189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moraes, D; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Mundim, L M; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinertsen, P L; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M

    2001-01-01

    Searches for spontaneous $R$-parity violating signals at $\\sqrt{s}=183$\\,GeV and \\mbox{$\\sqrt{s}=189$\\,GeV} have been performed using 1997 and 1998 DELPHI data, under the assumption of $R$-parity breaking in the third lepton family. The expected topology for the decay of a pair of charginos into two acoplanar taus plus missing energy was investigated and no evidence for a signal was found. The results were used to derive a limit on the chargino mass and to constrain the allowed domains of the MSSM parameter sp.

  9. Measurement and Interpretation of Fermion-Pair Production at LEP Energies of 183 and 189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moraes, D; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Mundim, L M; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinertsen, P L; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Chikilev, O G; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M

    2000-01-01

    An analysis of the data collected in 1997 and 1998 with the DELPHIdetector at $e^+e^-$ collision energies close to 183 and 189GeV was performed in order to extract the hadronic and leptonic fermion--paircross--sections, as well as the leptonic forward--backward asymmetries andangular distributions.The data are used to put limit on contact interactions between fermions,the exchange of R-parity violating SUSY sneutrinos, $\\Zprime$ bosons and the existence of gravity in extra dimensions.

  10. Preparation of {sup 183,184}Re samples for modelling a rapid gas phase chemistry of Nielsbohrium (Ns), element 107

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R.; Gaeggeler, H.W.; Eichler, B.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    Chemical gas phase reactions of the heavier group 7 elements in the system O{sub 2}/H{sub 2}O are presumably best suited for a separation of Nielsbohrium from the lighter transactinides. We expect a higher reaction velocity using the more reactive gas system O{sub 3}/H{sub 2}O{sub 2}. For the experimental verification of this idea we prepared {sup 183}Re/{sup 184}Re samples for thermochromatography experiments with both gas systems. (author) 8 refs.

  11. Immunoscintigraphy of septic loosening of knee endoprosthesis: a retrospective evaluation of the antigranulocyte antibody BW 250/183

    Energy Technology Data Exchange (ETDEWEB)

    Klett, Rigobert; Khalisi, Alexander; Puille, Maximillian; Steiner, Dagmar; Bauer, Richard [Clinic of Nuclear Medicine, University Hospital Giessen, Friedrichstrasse 25, 35385, Giessen (Germany); Kordelle, Jens [Orthopedic Clinic, University Hospital Giessen (Germany); Stahl, Ulrich [Department of Pathology, University Hospital Giessen (Germany)

    2003-11-01

    Immunoscintigraphy with the use of the antigranulocyte antibody BW 250/183 is a reliable method for detecting infection, especially in septic loosening of hip prostheses, for which purpose quantitative interpretation of the time-activity course is employed. Therefore, we retrospectively studied whether similar results could be achieved in knee prostheses. We verified 28 scintigraphic examinations in 26 patients by histology. Scintigraphy was performed during an early (4-6 h post injection) and a late phase (23-25 h post injection). Infection was diagnosed when activity around the knee prosthesis increased by more than 10% compared with bone marrow. We found a sensitivity and a negative predictive value of 100%, a specificity of 80%, a positive predictive value of 81% and an accuracy of 89%. Specificity and accuracy are lower than in the evaluation of hip prostheses; however, in comparison to other scintigraphic modalities, scintigraphy with the antigranulocyte antibody BW 250/183 is superior in excluding infection and has better specificity and accuracy. Therefore, as in the case of hip prostheses, the described methodology appears to be the scintigraphic modality of choice for knee prostheses. (orig.)

  12. Z boson pair production in $e^{+}e^{-}$ collisions at $\\sqrt{s}$ = 183 and 189 GeV

    CERN Document Server

    Abbiendi, G; Åkesson, P F; Alexander, Gideon; Allison, J; Anderson, K J; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Bailey, I; Ball, A H; Barberio, E; Barlow, R J; Batley, J Richard; Baumann, S; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Biebel, O; Biguzzi, A; Bloodworth, Ian J; Bock, P; Böhme, J; Boeriu, O; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Cammin, J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Cooke, O C; Couchman, J; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Dallison, S; Davis, R; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanfani, A; Fanti, M; Faust, A A; Feld, L; Ferrari, P; Fiedler, F; Fierro, M; Fleck, I; Frey, A; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Hajdu, C; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Harin-Dirac, M; Hauke, A; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J I; Karapetian, G V; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kobayashi, T; Kobel, M; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kupper, M; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lawson, I; Layter, J G; Leins, A; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; Lillich, J; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Lü, J; Ludwig, J; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Marchant, T E; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Méndez-Lorenzo, P; Merritt, F S; Mes, H; Meyer, I; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Okpara, A N; Oreglia, M J; Orito, S; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poli, B; Polok, J; Przybycien, M B; Quadt, A; Rembser, C; Rick, Hartmut; Robins, S A; Rodning, N L; Roney, J M; Rosati, S; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tarem, S; Taylor, R J; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Torrence, E; Towers, S; Trefzger, T M; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Zacek, V; Zer-Zion, D

    2000-01-01

    A study of Z boson pair production in e+e- annihilation at center-of-mass energies near 183 GeV and 189 GeV is reported. Final states containing only leptons, (l+l-l+l- and l+l-nu nubar), quark and lepton pairs, (q qbar l+l-, q qbar nu nubar) and the all-hadronic final state (q qbar q qbar) are considered. In all states with at least one Z boson decaying hadronically, q qbar and b bbar final states are considered separately using lifetime and event-shape tags, thereby improving the cross-section measurement. At sqrt(s) = 189 GeV the Z-pair cross section was measured to be 0.80 (+0.14-0.13, stat.) (+0.06-0.05, syst.) pb, consistent with the Standard Model prediction. At sqrt(s) = 183 GeV the 95.L. upper limit is 0.55 pb. Limits on anomalous ZZgamma and ZZZ couplings are derived.

  13. Evaluated 182,183,184,186W Neutron Cross Sections and Covariances in the Resolved Resonance Region

    Energy Technology Data Exchange (ETDEWEB)

    Pigni, Marco T [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Leal, Luiz C [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-01-01

    Oak Ridge National Laboratory (ORNL) has recently completed the resonance parameter evaluation of four tungsten isotopes, i.e., 182,183,184,186W, in the neutron energy range of thermal up to several keV. This nuclear data work was performed with support from the US Nuclear Criticality Safety Program (NCSP) in an effort to provide improved tungsten cross section and covariance data for criticality safety analyses. The evaluation methodology uses the Reich-Moore approximation of the R-matrix formalism of the code SAMMY to fit high-resolution measurements performed in 2010 and 2012 at the Geel linear accelerator facility (GELINA), as well as other experimental data sets on natural tungsten available in the EXFOR library. In the analyzed energy range, this work nearly doubles the resolved resonance region (RRR) present in the latest US nuclear data library ENDF/B-VII.1. In view of the interest in tungsten for distinct types of nuclear applications and the relatively homogeneous distribution of the isotopic tungsten—namely, 182W(26.5%), 183W(14.31%), 184W(30.64%), and 186W(28.43%) - the completion of these four evaluations represents a significant contribution to the improvement of the ENDF library. This paper presents an overview of the evaluated resonance parameters and related covariances for total and capture cross sections on the four tungsten isotopes.

  14. Evaluated 182,183,184,186W Neutron Cross Sections and Covariances in the Resolved Resonance Region

    International Nuclear Information System (INIS)

    Oak Ridge National Laboratory (ORNL) has recently completed the resonance parameter evaluation of four tungsten isotopes, i.e., 182,183,184,186W, in the neutron energy range of thermal up to several keV. This nuclear data work was performed with support from the US Nuclear Criticality Safety Program (NCSP) in an effort to provide improved tungsten cross section and covariance data for criticality safety analyses. The evaluation methodology uses the Reich-Moore approximation of the R-matrix formalism of the code SAMMY to fit high-resolution measurements performed in 2010 and 2012 at the Geel linear accelerator facility (GELINA), as well as other experimental data sets on natural tungsten available in the EXFOR library. In the analyzed energy range, this work nearly doubles the resolved resonance region (RRR) present in the latest US nuclear data library ENDF/B-VII.1. In view of the interest in tungsten for distinct types of nuclear applications and the relatively homogeneous distribution of the isotopic tungsten - namely, 182W(26.5%), 183W(14.31%), 184W(30.64%), and 186W(28.43%) - the completion of these four evaluations represents a significant contribution to the improvement of the ENDF library. This paper presents an overview of the evaluated resonance parameters and related covariances for total and capture cross sections on the four tungsten isotopes.

  15. Clinical application study of bone marrow immunoscintigraphy using 99mTc-labelled anti-granulocyte monoclonal antibody BW250/183

    International Nuclear Information System (INIS)

    Objective: To study: (1) The labelling method of 99mTc-BW250/183 and its organ distribution pattern after injection. (2) The clinical value of bone marrow immunoscintigraphy of evaluation of patients with aplastic anemia. (3) The clinical value of bone marrow immunoscintigraphy of determination of bone metastasis. Methods: (1) Whole body imaging was performed to one volunteer after injection of 555 MBq 99mTc-BW250/183, meanwhile, 2 ml blood samples was taken from a cubital vein. The percentage of radioactivity of different organs and the kinetic data of in-vivo 99mTc-BW250/183 was then calculated. In all the blood samples the peripheral leukocytes were counted by a standard procedure. (2) Bone marrow immunoscintigraphy were performed to 8 patients with aplastic anemia 4 h after injection of 99mTc-BW250/183, 6 of them also underwent bone marrow imaging with 99mTc-SC. (3) Bone marrow immunoscintigraphy and conventional bone scan were performed to 14 patients with suspected bone metastases to detect bone metastases. The results was compared with X-ray, X-CT or MRI. Results: 99mTc-BW250/183 is a safe and ideal bone marrow imaging agent. Bone marrow immunoscintigraphy plays an important role in evaluating patients with aplastic anemia and determining bone metastases

  16. High mass X-ray binary SXP18.3 undergoes the longest Type II outburst ever seen in the Small Magellanic Cloud

    CERN Document Server

    Schurch, M P E; Galache, J L; Corbet, R H D; McGowan, K E; McBride, V A; Townsend, L J; Udalski, A; Haberl, F

    2008-01-01

    On 30th August 2006 SXP18.3 a high mass X-ray binary (HMXB) in the Small Magellanic Cloud (SMC) with an 18.3s pulse period was observed by Rossi X-ray Timing Explorer (RXTE). The source was seen continuously for the following 36 weeks. This is the longest Type II outburst ever seen from a HMXB in the SMC. During the outburst SXP18.3 was located from serendipitous XMM-Newton observations. The identification of the optical counterpart has allowed SXP18.3 to be classified as a Be/X-ray binary. This paper will report on the analysis of the optical and weekly RXTE X-ray data that span the last 10 years. The extreme length of this outburst has for the first time enabled us to perform an extensive study of the pulse timing of an SMC Be/X-ray binary. We present a possible full orbital solution from the pulse timing data. An orbital period of 17.79d is proposed from the analysis of the OGLE III light curve placing SXP18.3 on the boundary of known sources in the Corbet diagram.

  17. The microRNA cluster miR-183/96/182 contributes to long-term memory in a protein phosphatase 1-dependent manner

    Science.gov (United States)

    Woldemichael, Bisrat T.; Jawaid, Ali; Kremer, Eloïse A.; Gaur, Niharika; Krol, Jacek; Marchais, Antonin; Mansuy, Isabelle M.

    2016-01-01

    Memory formation is a complex cognitive function regulated by coordinated synaptic and nuclear processes in neurons. In mammals, it is controlled by multiple molecular activators and suppressors, including the key signalling regulator, protein phosphatase 1 (PP1). Here, we show that memory control by PP1 involves the miR-183/96/182 cluster and its selective regulation during memory formation. Inhibiting nuclear PP1 in the mouse brain, or training on an object recognition task similarly increases miR-183/96/182 expression in the hippocampus. Mimicking this increase by miR-183/96/182 overexpression enhances object memory, while knocking-down endogenous miR-183/96/182 impairs it. This effect involves the modulation of several plasticity-related genes, with HDAC9 identified as an important functional target. Further, PP1 controls miR-183/96/182 in a transcription-independent manner through the processing of their precursors. These findings provide novel evidence for a role of miRNAs in memory formation and suggest the implication of PP1 in miRNAs processing in the adult brain. PMID:27558292

  18. The clinical application study of bone marrow immunoscintigraphy using 99Tcm-BW250/183 in evaluating patients with aplastic anemia

    International Nuclear Information System (INIS)

    Objective: To study the clinical value of bone marrow immunoscintigraphy for evaluation of patients with aplastic anemia. Methods: Twelve patients with aplastic anemia underwent bone marrow immunoscintigraphy using 99Tcm labelled anti-granulocyte monoclonal antibody BW250/183, 10 of them also underwent bone marrow imaging using 99Tcm-sulfur colloid (SC) 2 - 3 days later. The semiquantitative indexes of bone marrow immunoscintigraphy of the patients were compared with those of control patients. Results: Bone marrow immunoscintigraphy was superior to 99Tcm-SC bone marrow imaging. In patients with aplastic anemia, the accumulation of 99Tcm-BW250/183 in bone marrow and spleen was lower and in liver and kidney was higher than those of control patients. Nine patients were found with multiple focal accumulation in bone marrow. Conclusion: Bone marrow immunoscintigraphy with 99Tcm-BW250/183 plays an important role in evaluating patients with aplastic anemia

  19. Heteroepitaxial growth of strained multilayer superconducting thin films of Nd1.83Ce0.17CuOx/YBa2Cu3O7-δ

    International Nuclear Information System (INIS)

    Heteroepitaxial growth of strained multilayer thin films of YBa2Cu3O7-δ/Nd1.83Ce0.17CuOx by pulsed-laser deposition is reported. The coherency strain results in biaxial compression of the tetragonal Nd1.83Ce0.17CuOx layers, whereas the biaxial tension in the YBa2Cu3O7-δ layers removes the orthorhombic distortion and makes the unit cell isotropic in the basal plane (a=b). Depending on their oxygen content, either the YBa2Cu3O7-δ or the Nd1.83Ce0.17CuOx layers are superconducting in these multilayers. The strain-induced structural modification has a significant influence on the superconducting transition temperature of the YBa2Cu3O7-δ layers

  20. Rotating frame nuclear double resonance of 95Mo and 183W with 19F in polycrystalline MoF6 and WF6

    International Nuclear Information System (INIS)

    A series of rotating-frame nuclear-double-resonance experiments was performed in which the NMR of the isotopes 95Mo (I=5/2, natural abundance 16%) and 183W (I=1/2, natural abundance 14%) in MoF6 and WF6 respectively were detected via the strong resonance signal of the abundant 19F nuclei. Resonance peaks of two-quanta transitions were observed for 183W-NMR (I=1/2) in WF6, a nonlinear behavior was discussed 95Mo

  1. Molecular and functional properties of the granulocyte specific MAb BW 250/183 suited for the immunoscintigraphic localization of inflammatory processes

    International Nuclear Information System (INIS)

    The molecular characteristics of MAb BW 250/183 like high affinity and specificity for granulocytes and high epitope density on the granulocyte membrane are optimal prerequisites for in vivo binding to human granulocytes. The lack of negative, i.e. stimulatory influences on granulocyte associated physiological functions should not result in any side effects during diagnostic application. Combined with the recently developed 99mTc labelling procedure the MAb BW 250/183-99mTc conjugate is a safe, reliable and easy to handle reagent for the successful localization of inflammatory processes. (orig.)

  2. A direct comparison of MELCOR 1.8.3 and MAAP4 results for several PWR ampersand BWR accident sequences

    International Nuclear Information System (INIS)

    This paper presents a comparison of calculations of severe accident progression for several postulated accident sequences for representative Pressurized Water Reactors (PWR) and Boiling Water Reactors (BWR) nuclear power plants performed with the MELCOR 1.8.3 and the MAAP4 computer codes. The PWR system examined in this study is a 1100 MWe system similar in design to a Westinghouse 3-loop plant with a large dry containment; the BWR is a 1100 MWe system similar in design to General Electric BWR/4 with a Mark I containment. A total of nine accident sequences were studied with both codes. Results of these calculations are compared to identify major differences in the timing of key events in the calculated accident progression or other important aspects of severe accident behavior, and to identify specific sources of the observed differences

  3. Double-neutron capture reaction and natural abundance of 183W, 195Pt, and 199Hg isotopes

    International Nuclear Information System (INIS)

    The database for neutron cross sections is well developed over the nuclide chart for stable isotopes and not as much for the radioactive species. Double-neutron capture experiments could be productive to supply more data. Time-integrated mean flux of slow neutrons reaches a value of 2.3·1012 cm-2·s-1 at the irradiation port near the active zone of the IBR-2 pulsed reactor of JINR. This is enough to detect the double-neutron capture products by the activation method. A high capture cross section is deduced in the present experiment for intermediate radioactive 182Ta and 194Ir target nuclides. Together with the known one for 198Au, these values may prove an essential role of double-neutron capture process for nucleosynthesis of 183W, 195Pt, and 199Hg isotopes at stellar conditions.

  4. Double-neutron capture reaction and natural abundance of 183W, 195Pt and 199Hg isotopes

    Science.gov (United States)

    Karamian, S. A.; Aksenov, N. V.; Bozhikov, G. A.

    2016-06-01

    There are much data on neutron cross sections over the chart of nuclides for stable isotopes and not as much for the radioactive ones. Double neutron capture experiments could be fruitful to provide more data. Time-integrated mean flux of slow neutrons reaches the value of 2.3-1012 n/cm2 s at the irradiation port near the active zone of the IBR-2 pulsed reactor of JINR. This is enough to detect the double neutron capture products by the activation method. A high capture cross section is obtained in the present experiment for intermediate radioactive 182Ta and 194Ir target nuclides. Together with the known data for 198Au, these values may prove an essential role of double neutron capture process for nucleosynthesis of 183W, 195Pt and 199Hg isotopes at stellar conditions.

  5. Verification of the HDR-test V44 using the computer program RALOC-MOD1/83

    International Nuclear Information System (INIS)

    RALOC-MOD1/83 was extended by a drainage and sump level modul and several component models to serve as a containment systems code for various LWR types. One such application is to simulate the blowdown in a full pressure containment which is important for the short and long term hydrogen distribution. The post test calculation of the containment standard problem experiment HDR-V44 shows a good agreement, to the test data. The code may be used for short and long term predictions, but it was learned that double containments need the representation of the gap between the inner and outer shell into several zones to achieve a good long-term temperature prediction. The present work completes the development, verification and documentation of RALOC-MOD1. (orig.)

  6. Remaining Sites Verification Package for the 126-F-2, 183-F Clearwells, Waste Site Reclassification Form 2006-017

    International Nuclear Information System (INIS)

    The 126-F-2 site is the clearwell facility formerly used as part of the reactor cooling water treatment at the 183-F facility. During demolition operations in the 1970s, potentially contaminated debris was disposed in the eastern clearwell structure. The site has been remediated by removing all debris in the clearwell structure to the Environmental Restoration Disposal Facility. The results of radiological surveys and visual inspection of the remediated clearwell structure show neither residual contamination nor the potential for contaminant migration beyond the clearwell boundaries. The results of verification sampling at the remediation waste staging area demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River

  7. $Z\\gamma*$ production in $e^+ e^-$ interactions at $\\sqrt{s}$ = 183 - 209 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Kokkinias, P; Leinonen, L; Katsoufis, E; Kernel, G; Kersevan, B P; Krumshtein, Z; Lesiak, T; Kerzel, U; Liebig, W; King, B T; Lamsa, J; Liko, D; Kjaer, N J; Leder, G; Kluit, P; Kourkoumelis, C; Leitner, R; Kuznetsov, O; Kucharczyk, M; Ledroit, F; Lopes, J H; Lemonne, J; Lepeltier, V; Lipniacka, A; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou12, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Paganoni, M; Nassiakou, M; Paiano, S; Navarria, F; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Ouraou, A; Parkes, C; Oblakowska-Mucha, A; Oyanguren, A; Obraztsov, V F; Olshevskii, A G; Palacios, J P; Onofre, A; Palka, H; Orava, R; Österberg, K; Pape, L; Papadopoulou, T D; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G

    2007-01-01

    Measurements of Zgamma* production are presented using data collected by the DELPHI detector at centre-of-mass energies ranging from 183 to 209 GeV, corresponding to an integrated luminosity of about 667 pb^{-1}. The measurements cover a wide range of the possible final state four-fermion configurations: hadronic and leptonic (e+ e- q qbar, mu+ mu- q qbar, q qbar nu nubar), fully leptonic (l+ l- l'+ l'-) and fully hadronic final states (q qbar q qbar, with a low mass q qbar pair). Measurements of the Zgamma* cross-section for the various final states have been compared with the Standard Model expectations and found to be consistent within the errors. In addition, a total cross-section measurement of the l+ l- l'+ l'- cross-section is reported, and found to be in agreement with the prediction of the Standard Model.

  8. Multi-photon production in $e^{+}e^{-}$ collisions at $\\sqrt{s}$= 183 GeV

    CERN Document Server

    Ackerstaff, K; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Doucet, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanfani, A; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fischer, H M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Geich-Gimbel, C; Geralis, T; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Joly, A; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lefebvre, E; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Poli, B; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Tafirout, R; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Vikas, P; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1998-01-01

    The process e+e- to gamma gamma (gamma) is studied using data recorded with the OPAL detector at LEP. The data sample corresponds to a total integrated luminosity of 56.2 pb-1 taken at a centre-of-mass energy of 183 GeV. The measured cross-section agrees well with the expectation from QED. A fit to the angular distribution is used to obtain improved limits at 95% CL on the QED cut-off parameters: Lambda+ > 233 GeV and Lambda- > 265 GeV as well as a mass limit for an excited electron, M(e*) > 227 GeV assuming equal e*egamma and eegamma couplings. No evidence for resonance production is found in the invariant mass spectrum of photon pairs. Limits are obtained for the cross-section times branching ratio for a resonance decaying into two photons.

  9. Measurement of the W Mass and Width in $e^{+}e^{-}$ Collisions at 183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Hoch, M; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    Using a data sample of 57 pb-1 recorded at a centre-of-mass energy of 183 GeV with the Opal detector at LEP, 282 W+W- -> qqqq and 300 W+W- -> qqlnu candidate events are used to obtain a measurement of the mass of the W boson, W_W = 80.39 +- 0.13(stat.) +- 0.05(syst.) GeV assuming the Standard Model relation between M_W and Gam_W. A second fit provides a direct measure of the width of the W boson and gives Gam_W = 1.96 +- 0.34(stat.) +- 0.20(syst.) GeV. These results are combined with previous OPAL results to obtain M_W = 80.38 +- 0.12(stat.) +- 0.05(syst.) GeV and Gam_W = 1.84 +- 0.32(stat.) +- 0.20(syst.) GeV.

  10. Remaining Sites Verification Package for the 126-F-2, 183-F Clearwells, Waste Site Reclassification Form 2006-017

    Energy Technology Data Exchange (ETDEWEB)

    R. A. Carlson

    2006-05-04

    The 126-F-2 site is the clearwell facility formerly used as part of the reactor cooling water treatment at the 183-F facility. During demolition operations in the 1970s, potentially contaminated debris was disposed in the eastern clearwell structure. The site has been remediated by removing all debris in the clearwell structure to the Environmental Restoration Disposal Facility. The results of radiological surveys and visual inspection of the remediated clearwell structure show neither residual contamination nor the potential for contaminant migration beyond the clearwell boundaries. The results of verification sampling at the remediation waste staging area demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  11. RESULTS OF GROUNDWATER MONITORING FOR THE 183-H SOLAR EVAPORATION BASINS AND 300 AREA PROCESS TRENCHES JANUARY - JUNE 2008

    International Nuclear Information System (INIS)

    This is one of a series of reports on Resource Conservation and Recovery Act of 1976 (RCRA) monitoring at the 183-H solar evaporation basins and the 300 Area process trenches. It fulfills the requirement of Washington Administrative Code (WAC) 173-303-645(11)(g), 'Release from Regulated Units', to report twice each year on the effectiveness of the corrective action program. This report covers the period from January through June 2008. The current objective of corrective action monitoring the 183-H basins is simply to track trends. Although there is short-term variability in contaminant concentrations, trends over the past 10 years are downward. The current Hanford Facility RCRA Permit (Dangerous Waste Portion of the Resource Conservation and Recovery Act Permit for the Treatment, Storage, and Disposal of Dangerous Waste (Permit No. WA 7890008967)) and monitoring plan remain adequate for the objective of tracking trends. The objective of groundwater monitoring at the 300 Area process trenches is to demonstrate the effectiveness of the corrective action program by examining the trend of the constituents of interest to confirm that they are attenuating naturally. The overall concentration of uranium in network wells remained above the 30 (micro)g/L drinking water standard in the three downgradient wells screened at the water table. Fluctuations of uranium concentration are caused by changes in river stage. The concentration of cis-1,2-dichloroethene remained above the 70 (micro)g/L drinking water standard in one well (399-1-16B). Concentrations are relatively steady at this well and are not affected by river stage. Trichloroethene and tetrachloroethene concentrations were below detection limits in all wells during the reporting period

  12. Detection and grading of soft tissue sarcomas of the extremities with F-18-3 '-fluoro-3 '-deoxy-L-thymidine

    NARCIS (Netherlands)

    Cobben, DCP; Elsinga, PH; Suurmeijer, AJH; Vaalburg, W; Maas, B; Jager, PL; Hoekstra, HJ

    2004-01-01

    Purpose: The aim of the study was to investigate the feasibility of F-18-3'-fluoro-3'-deoxy-L-thymidine positron emission tomography (FLT-PET) for the detection and grading of soft tissue sarcoma (STS). Experimental Design: Nineteen patients with 20 STSs of the extremities were scanned, using attenu

  13. Measurements of the Trilinear Gauge Boson Couplings WWV $(V \\equiv \\gamma,Z)$ in $e^+ e^-$ Collisions at 183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pegoraro, M; Peralta, L; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schneider, H; Schwemling, P; Schwering, B; Schwickerath, U; Schyns, M A E; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Shellard, R C; Sheridan, A; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stanic, S; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Vollmer, C F; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G

    1999-01-01

    Measurements of the trilinear gauge boson couplings $WW\\gamma$ and $WWZ$ are presented from data taken by DELPHI in 1997 at an energy of 183 GeV. From a study of the reactions $e^+ e^- \\to W^+ W^-, e^+ e^- \\to We\

  14. Search for chargino pair production in scenarios with gravitino LSP and stau NLSP at $\\sqrt{s} \\sim$ 183 GeV at LEP

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanic, S; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Dam, P; Van den Boeck, W; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zucchelli, G C; Zumerle, G

    1999-01-01

    Promptly decaying lightest charginos were searched for in the context of scenarios with gravitino LSP. It was assumed that the stau is the next to lightest supersymmetric particle (NLSP). Data collected with the DELPHI detector at a centre-of-mass energy near 183~{~mbox{${mathrm{GeV}}$}}\

  15. Effect of a Mycoplasma hominis-Like Mycoplasma on the Infection of HEp-2 Cells by the TW-183 Strain of Chlamydia pneumoniae

    OpenAIRE

    Castilla, Elias A.; Wadowsky, Robert M.

    2000-01-01

    We isolated a Mycoplasma hominis-like mycoplasma from a stock culture of Chlamydia pneumoniae TW-183 obtained from the American Type Culture Collection and eradicated the contaminant by treating the stock suspension with a nonionic detergent, Igepal CA-630. The M. hominis-like mycoplasma neither inhibits nor enhances the infectivity of C. pneumoniae for HEp-2 cells.

  16. Application of PEG based aqueous biphasic systems in extraction and separation of no-carrier-added {sup 183}Re from bulk tantalum

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, B.; Lahiri, S. [Saha Institute of Nuclear Physics, Kolkata (India); Tomar, B.S. [Bhabha Atomic Research Centre, Mumbai (India). Radioanalytical Chemistry Div.

    2013-03-01

    No-carrier-added (nca) rhenium isotopes ({sup 182,182m,183}Re) were produced by irradiation with 30 MeV alpha particles on natural tantalum target. The short-lived {sup 182,182m}Re were allowed to decay and long-lived nca {sup 183}Re was separated from bulk tantalum matrix by aqueous biphasic system (ABS) using 2 M solutions of nine different salts, namely, Na{sub 2}SO{sub 4}, Na2SO{sub 3}, NaHSO{sub 3}, Na{sub 2}S{sub 2}O{sub 3}, Na{sub 2}HPO{sub 4}, Na{sub 2}CO{sub 3}, Na-citrate, Na-tartrate, and (NH{sub 4}){sub 2}SO{sub 4} as salt rich phases against 50% (w/w) PEG-4000 as polymer rich phase at room temperature. The influence of temperature and thermodynamic parameters {Delta} H and {Delta} S were obtained for the partition of {sup 183}Re and tantalum in these systems. Nca {sup 183}Re was extracted in high amount in polymer rich phases irrespective of the salt rich phases. Bulk tantalum showed tendency to remain in salt rich phases. ABSs with PEG-4000 polymer rich phase in combination with Na{sub 2}SO{sub 4}, Na{sub 2}SO{sub 3}, NaHSO{sub 3}, Na{sub 2}HPO{sub 4}, Na{sub 2}CO{sub 3}, Na-citrate and Na-tartrate as salt rich phases at basic pH and at ambient temperature (27 C) offered single-step separation between nca {sup 183}Re and bulk Ta. When Na{sub 2}S{sub 2}O{sub 3} and (NH{sub 4}){sub 2}SO{sub 4} were used as salt rich phase, slight extraction of bulk tantalum was observed in PEG-4000 rich phase. The dynamic dissociation constant of {sup 183}Re-PEG-4000 complex was measured by dialysis of the PEG-rich phase against de-ionised water. The k{sub dissociation} value was found as low as 0.0185 min{sup -1}. Therefore, it is possible to have pure {sup 183}Re in de-ionized water immediately after the dialysis. (orig.)

  17. Overexpression of members of the microRNA-183 family is a risk factor for lung cancer: A case control study

    International Nuclear Information System (INIS)

    Lung cancer is the leading cause of cancer-related deaths worldwide. Early detection is considered critical for lung cancer treatment. MicroRNAs (miRNAs) have shown promise as diagnostic and prognostic indicators. This study was to identify specific miRNAs with diagnostic and prognostic value for patients with lung cancer, and to explore the correlation between expression profiles of miRNAs and patient survival. Gene expression of members of the miR-183 family (miR-96, miR-182, and miR-183) were examined in 70 paired samples from lung cancer patients (primary cancer and non-cancerous tissues and sera), as well as 44 serum samples from normal volunteers and lung cancer cell lines by quantitative real-time reverse transcription polymerase chain reaction (RT-qPCR). The correlation between the expression of miRNAs in tissues, sera, and patient overall survival were also examined by log-rank and Cox regression analysis. Expression levels of members of the miR-183 family in lung cancer tumor and sera were higher than that of their normal counterparts. The miR-96 expression in tumors was positively associated with its expression in sera. Log-rank and Cox regression analyses demonstrated that high expression of tumor and serum miRNAs of the miR-183 family were associated with overall poor survival in patients with lung cancer. Our results suggest that the expressions of miR-96, miR-182, and miR-183 in tumor and sera may be considered potential novel biomarkers for the diagnosis and prognosis of lung cancer

  18. Analgesic drug delivery via recombinant tissue plasminogen activator and microRNA-183-triggered opening of the blood-nerve barrier.

    Science.gov (United States)

    Yang, Shaobing; Krug, Susanne M; Heitmann, Johanna; Hu, Liu; Reinhold, Ann Kristin; Sauer, Solange; Bosten, Judith; Sommer, Claudia; Fromm, Michael; Brack, Alexander; Rittner, Heike L

    2016-03-01

    The peripheral nerve contains three barriers which include the blood-nerve barrier consisting of endoneurial vessels and the perineurium as well as autotypic junctions in Schwann cells. The perineurium prevents diffusion of perineurally injected drugs that can be used for selective regional pain control. It is composed of a basal membrane and layers of perineurial cells sealed by tight junction proteins like claudin-1. Claudin-1 expression and barrier function are regulated via low-density lipoprotein receptor-related protein (LRP-1). Perisciatic application of recombinant tissue plasminogen activator (rtPA) or the catalytically inactive rtPAi - both agonists of LRP-1 - reduced claudin-1 mRNA and protein expression in the rat nerve. This facilitated an increase of nociceptive thresholds after local application of hydrophilic opioids or the voltage gated sodium channel blocker (NaV1.7) ProToxin-II without apparent nerve toxicity. RtPA-induced barrier opening was mediated by LRP-1 and intracellularly by Erk phosphorylation. In silico, microRNA (miR)-rno-29b-2-5p and rno-miR-183-5p were identified as potential regulators of claudin-1 transcription in the rat. RtPA application increased miR-183-5p in the sciatic nerve. MiR-183-5p mimics functionally opened the perineurium and downregulated claudin-1 expression in vivo. In vitro, hsa-miR-183-3p mimics reduced claudin-1 expression in human HT-29/B6 cells. Overall, rtPA regulates perineurial barrier tightness via LRP-1, Erk phosphorylation and miR-183-5p/3p. This mechanism might serve as a new principle to facilitate drug delivery to peripheral nerves in humans. PMID:26735170

  19. MELCOR computer code manuals: Primer and user`s guides, Version 1.8.3 September 1994. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Summers, R.M.; Cole, R.K. Jr.; Smith, R.C.; Stuart, D.S.; Thompson, S.L. [Sandia National Labs., Albuquerque, NM (United States); Hodge, S.A.; Hyman, C.R.; Sanders, R.L. [Oak Ridge National Lab., TN (United States)

    1995-03-01

    MELCOR is a fully integrated, engineering-level computer code that models the progression of severe accidents in light water reactor nuclear power plants. MELCOR is being developed at Sandia National Laboratories for the US Nuclear Regulatory Commission as a second-generation plant risk assessment tool and the successor to the Source Term Code Package. A broad spectrum of severe accident phenomena in both boiling and pressurized water reactors is treated in MELCOR in a unified framework. These include: thermal-hydraulic response in the reactor coolant system, reactor cavity, containment, and confinement buildings; core heatup, degradation, and relocation; core-concrete attack; hydrogen production, transport, and combustion; fission product release and transport; and the impact of engineered safety features on thermal-hydraulic and radionuclide behavior. Current uses of MELCOR include estimation of severe accident source terms and their sensitivities and uncertainties in a variety of applications. This publication of the MELCOR computer code manuals corresponds to MELCOR 1.8.3, released to users in August, 1994. Volume 1 contains a primer that describes MELCOR`s phenomenological scope, organization (by package), and documentation. The remainder of Volume 1 contains the MELCOR Users` Guides, which provide the input instructions and guidelines for each package. Volume 2 contains the MELCOR Reference Manuals, which describe the phenomenological models that have been implemented in each package.

  20. The Kerguelen Plateau : new paleontologic and paleomagnetic age constraints on growth history from ODP Leg 183 drilling

    International Nuclear Information System (INIS)

    Although the submergent Kerguelen Plateau (KP), a large igneous province in the Southern Indian Ocean, was initiated after the rifting of India from Antarctica, its construction, fed by the Kerguelen hot spot, has taken place over the past c. 114 m.y. Preliminary shipboard paleontologic and paleomagnetic dates from ODP Leg 183 on marine sediments above igneous basement help constraint the growth history of this feature. The oldest such date is Late Albian (105-106 Ma or younger) from Site 1136 on the southern KP, whereas the youngest is Early Oligocene (more precisely, 34 Ma) from sites 1139 and 1140 on the northern KP. Elan Bank provided intermediate ages of Late Campanian (c. 75 Ma); however, Site 1138 on the central KP yielded Lower Turonian (c. 93.5 Ma) marine sediments (Cenomanian/Turonian boundary 'black shales') above Upper Albian-Lowest Cenomanian (c. 102-96 Ma) non-marine (fluvial) claystones, sandstones, and conglomerates. This latter date (from shore-based palynology) diminishes considerably the previously inferred age difference between the southern and central KP, and, in so doing, tends to blur the geophysical distinction between these two domains. (author). 53 refs., 5 figs

  1. Search for sleptons in $e^+ e^-$ collisions at $\\sqrt{s}$= 183 to 189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bol, L; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Croix, J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Haug, S; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hertz, O; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kucharczyk, M; Kurowska, J; Lamsa, J; Laugier, J P; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, M R; Montenegro, J; Moraes, D; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Nicolaidou, R; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Perepelitsa, V F; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salmi, L; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwanda, C; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M

    2001-01-01

    Data taken by the {\\tt DELPHI} experiment at centre-of-mass energies of 183~\\GeV\\ and 189~\\GeV\\ with a total integrated luminosity of 212 pb$^{-1} have been used to search for the supersymmetric partners of the electrons, muons, and taus in the context of the Minimal Supersymmetric Standard Model (MSSM). The decay topologies searched for were the direct decay ({\\tilde \\ell} -> \\ell {\\tilde\\chi_1^0}), producing acoplanar lepton pairs plus missing energy, and the cascade decay ({\\tilde \\ell} -> \\ell {\\tilde \\chi_2^0} -> \\ell\\gamma {\\tilde \\chi_1^0}), producing acoplanar lepton and photon pairs plus missing energy. The observed number of events is in agreement with Standard Model predictions. The 95% CL excluded mass limits for selectrons, smuons and staus are m_{\\tilde {e}\\leq 87 GeV/c^2, m_{\\tilde {\\mu}} \\leq 80 GeV/c^2 and m_{\\tilde {\\tau}} \\leq 75 GeV/c^2, respectively, for values of \\mu=-200 GeV/c^2 and tan(beta)=1.5.

  2. MELCOR computer code manuals: Primer and user's guides, Version 1.8.3 September 1994. Volume 1

    International Nuclear Information System (INIS)

    MELCOR is a fully integrated, engineering-level computer code that models the progression of severe accidents in light water reactor nuclear power plants. MELCOR is being developed at Sandia National Laboratories for the US Nuclear Regulatory Commission as a second-generation plant risk assessment tool and the successor to the Source Term Code Package. A broad spectrum of severe accident phenomena in both boiling and pressurized water reactors is treated in MELCOR in a unified framework. These include: thermal-hydraulic response in the reactor coolant system, reactor cavity, containment, and confinement buildings; core heatup, degradation, and relocation; core-concrete attack; hydrogen production, transport, and combustion; fission product release and transport; and the impact of engineered safety features on thermal-hydraulic and radionuclide behavior. Current uses of MELCOR include estimation of severe accident source terms and their sensitivities and uncertainties in a variety of applications. This publication of the MELCOR computer code manuals corresponds to MELCOR 1.8.3, released to users in August, 1994. Volume 1 contains a primer that describes MELCOR's phenomenological scope, organization (by package), and documentation. The remainder of Volume 1 contains the MELCOR Users' Guides, which provide the input instructions and guidelines for each package. Volume 2 contains the MELCOR Reference Manuals, which describe the phenomenological models that have been implemented in each package

  3. The Variant p.(Arg183Trp) in SPTLC2 Causes Late-Onset Hereditary Sensory Neuropathy.

    Science.gov (United States)

    Suriyanarayanan, Saranya; Auranen, Mari; Toppila, Jussi; Paetau, Anders; Shcherbii, Maria; Palin, Eino; Wei, Yu; Lohioja, Tarja; Schlotter-Weigel, Beate; Schön, Ulrike; Abicht, Angela; Rautenstrauss, Bernd; Tyynismaa, Henna; Walter, Maggie C; Hornemann, Thorsten; Ylikallio, Emil

    2016-03-01

    Hereditary sensory and autonomic neuropathy 1 (HSAN1) is an autosomal dominant disorder that can be caused by variants in SPTLC1 or SPTLC2, encoding subunits of serine palmitoyl-CoA transferase. Disease variants alter the enzyme's substrate specificity and lead to accumulation of neurotoxic 1-deoxysphingolipids. We describe two families with autosomal dominant HSAN1C caused by a new variant in SPTLC2, c.547C>T, p.(Arg183Trp). The variant changed a conserved amino acid and was not found in public variant databases. All patients had a relatively mild progressive distal sensory impairment, with onset after age 50. Small fibers were affected early, leading to abnormalities on quantitative sensory testing. Sural biopsy revealed a severe chronic axonal neuropathy with subtotal loss of myelinated axons, relatively preserved number of non-myelinated fibers and no signs for regeneration. Skin biopsy with PGP9.5 labeling showed lack of intraepidermal nerve endings early in the disease. Motor manifestations developed later in the disease course, but there was no evidence of autonomic involvement. Patients had elevated serum 1-deoxysphingolipids, and the variant protein produced elevated amounts of 1-deoxysphingolipids in vitro, which proved the pathogenicity of the variant. Our results expand the genetic spectrum of HSAN1C and provide further detail about the clinical characteristics. Sequencing of SPTLC2 should be considered in all patients presenting with mild late-onset sensory-predominant small or large fiber neuropathy. PMID:26573920

  4. $W^{+}W^{-}$ production and triple gauge boson couplings at LEP energies up to 183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Hoch, M; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Vachon, B; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    A study of W-pair production in e+e- annihilations at Lep2 is presented, based on 877 W+W- candidates corresponding to an integrated luminosity of 57 pb-1 at sqrt(s) = 183 GeV. Assuming that the angular distributions of the W-pair production and decay, as well as their branching fractions, are described by the Standard Model, the W-pair production cross-section is measured to be 15.43 +- 0.61 (stat.) +- 0.26 (syst.) pb. Assuming lepton universality and combining with our results from lower centre-of-mass energies, the W branching fraction to hadrons is determined to be 67.9 +- 1.2 (stat.) +- 0.5 (syst.)%. The number of W-pair candidates and the angular distributions for each final state (qqlnu,qqqq,lnulnu) are used to determine the triple gauge boson couplings. After combining these values with our results from lower centre-of-mass energies we obtain D(kappa_g)=0.11+0.52-0.37, D(g^z_1)=0.01+0.13-0.12 and lambda=-0.10+0.13-0.12, where the errors include both statistical and systematic uncertainties and each co...

  5. Bose-Einstein Correlations in $e^{+} e^{-} \\to W^{+}W^{-}$ at 172 and 183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Hoch, M; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    Bose-Einstein correlations between like-charge pions are studied in hadronic final states produced by e+e- annihilations at center-of-mass energies of 172 and 183 GeV. Three event samples are studied, each dominated by one of the processes W+W- to qqlnu, W+W- to qqqq, or (Z/g)* to qq. After demonstrating the existence of Bose-Einstein correlations in W decays, an attempt is made to determine Bose-Einstein correlations for pions originating from the same W boson and from different W bosons, as well as for pions from (Z/g)* to qq events. The following results are obtained for the individual chaoticity parameters lambda assuming a common source radius R: lambda_same = 0.63 +- 0.19 +- 0.14, lambda_diff = 0.22 +- 0.53 +- 0.14, lambda_Z = 0.47 +- 0.11 +- 0.08, R = 0.92 +- 0.09 +- 0.09. In each case, the first error is statistical and the second is systematic. At the current level of statistical precision it is not established whether Bose-Einstein correlations, between pions from different W bosons exist or not.

  6. Synthesis and 183W NMR Characterization of a-K7GaW11(TiO2)O39×11H2O Heteropolyanion

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The peroxotitanium-substituted heteropolytungstate a-K7GaW11(TiO2)O39×11H2O has been synthesized and characterized by elemental analysis, IR, UV, 183W NMR and electrochemistry. 183W NMR spectrum consists of six lines with intensity ratio 2:2:1:2:2:2, indicated that the TiO2 occupied the empty octahedral site of the GaW11 anion forming a polyanion with Cs symmetry. The characteristic charge-transfer absorption band O22-?Ti at 385 nm occurs in the UV spectrum. The polarographic reduction potential of O22- at ca.+0.87 V has been found.

  7. Single and multi-photon events with missing energy in $e^+ e^-$ collisions at $\\sqrt{s}$ = 183 GeV

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Easo, S; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1998-01-01

    An analysis of single and multi-photon events with missing energy is performed using data collected with the L3 detector at LEP at centre-of-mass energies around 183\\gev, for a total of 55.3 pb$^{-1}$ of integrated luminosity. The results obtained are in good agreement with the Standard Model prediction and are used to derive the value for the $\\epem\\ra\

  8. Remaining Sites Verification Package for the 100-D-50:5 Process Sewers (183-DR Sedimentation Basin Drains), Waste Site Reclassification Form 2006-025

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-11-06

    The 100-D-50:5 subsite encompasses the southern process sewers formerly servicing the 183-DR coagulation and sedimentation basins and proximate surface runoff collection drains. The results of confirmatory sampling of pipeline sediments and underlying soils at the 100-D-50:5 subsite demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  9. Remaining Sites Verification Package for the 100-D-50:5 Process Sewers (183-DR Sedimentation Basin Drains). Attachment to Waste Site Reclassification Form 2006-025

    International Nuclear Information System (INIS)

    The 100-D-50:5 subsite encompasses the southern process sewers formerly servicing the 183-DR coagulation and sedimentation basins and proximate surface runoff collection drains. The results of confirmatory sampling of pipeline sediments and underlying soils at the 100-D-50:5 subsite demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River

  10. MELCOR 1.8.3 application to NUPEC M-7-1 test (ISP-35) and two hydrogen severe accident scenarios in a typical PWR plant

    International Nuclear Information System (INIS)

    Combustion of the hydrogen released to the containment during a severe accident is one of the issues to establish the real threats to the third barrier integrity in nuclear power facilities. Computational efforts on management procedures, such as the containment spray operation, are being addressed at the CTN-UPM to cope with the problem. On top of this, studies about in-containment hydrogen distribution and combustion are currently carried out with the codes MELCOR 1.8.3 and ESTER 1.0-RALOC 2.2. In this study, MELCOR 1.8.3 has been validated against the NUPEC M-7-1 Test, which already showed in 1993 that a good agreement was reached out when the previous MELCOR 1.8.2 calculations were performed regarding to the helium distribution throughout the facility. Nevertheless, some discrepancies were detected when analysing wall and atmosphere temperatures. Generally, well-mixed atmosphere scenarios, in which the role played by the containment water spraying is of the major importance, appear when such a mechanism promotes the onset of convection driven flow patterns that rapidly homogenize the gas properties. The purpose of the new MELCOR 1.8.3 assessment is to take advantage of the newest implemented models to obtain a more realistic thermalhydraulics simulation. A variation case was also performed to highlight the influence of water spray operation. In a second part of the study, insights coming from the previous work were used to apply MELCOR 1.8.3 models to a SBO severe accident scenario management in a commercial 2700 MWt 3-loop W PWR containment

  11. Radiological dose assessment for the decontaminated concrete removed from 183-H solar evaporation basins at the Hanford site, Richland, Washington

    International Nuclear Information System (INIS)

    Potential maximum radiation dose rates over a 1,000-year time horizon were calculated for exposure to the decontaminated concrete removed from the 183-H Solar Evaporation Basins at the Hanford Site, Richland, Washington. The RESRAD computer code, Version 5.62, which implements the methodology described in the US Department of Energy's manual for developing residual radioactive material guidelines, was used in this evaluation. Currently, the concrete is not being used. Four potential exposure scenarios were developed for the land area where the decontaminated concrete will be stored. In Scenario A industrial use of the land is assumed; in Scenario B recreational use of the land is assumed; in Scenario C residential use of the land is assumed; and in Scenario D (a plausible but unlikely land-use scenario), the presence of a subsistence farmer in the immediate vicinity of the land is assumed. For Scenarios A and B, water used for drinking is assumed to be surface water from the Columbia River; for Scenarios C and D, groundwater drawn from a well located at the downgradient edge of the storage area is the only source of water for drinking, irrigation, and raising livestock. Conservative parameters values were used to estimate the radiation doses. The results of the evaluation indicate that the US Department of Energy's dose limit of 100 mrem/yr would not be exceeded for any of the scenarios analyzed. The potential maximum dose rates for Scenarios A, B, C, and D are 0.75, 0.022, 29, 29 mrem/yr, respectively. An uncertainty analysis was performed to determine which parameters have the greatest impact on the estimated doses. The doses in Scenarios C and D were found to be very sensitive to the magnitude of the irrigation rate

  12. Measurement of lifetimes of high spin states in the N = 106 nuclei {sup 183}Ir and {sup 182}Os

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Blumenthal, D.; Carpenter, M.P. [and others

    1995-08-01

    Lifetimes of high spin states in the isotones {sup 183}Ir and {sup 182}Os were measured using the Notre Dame plunger device in conjunction with the Argonne Notre Dame {gamma}-ray facility. The aim of these measurements was to determine the deformation-driving properties of the h{sub 9/2} proton intruder orbital by comparing the values of the intrinsic quadrupole moments in the ground state bands in the odd-mass Ir nucleus and the even-even Os core. Levels in these nuclei were populated by the {sup 150}Nd ({sup 37}Cl,4n) and {sup 150}Nd ({sup 36}S,4n) reactions using a {sup 37}Cl beam of 169 MeV and 164-Mev {sup 36}S beam. The {sup 150}Nd target was 0.9-g/cm{sup 2} thick and was prepared by evaporating enriched {sup 150}Nd onto a stretched 1.5-mg/cm{sup 2} gold foil. The target was covered with a layer of a 60-{mu}g/cm{sup 2} Au to prevent its oxidation. Gamma-ray spectra were accumulated for approximately 4 hours for each target-stopper distance. Data were collected for 20 target-stopper distances ranging from 16 {mu}m to 10.4 mm. Preliminary analysis indicates that it will be possible to extract the lifetimes of the levels in the yrast bands up to and including part of the backbending region with sufficient accuracy. Detailed analysis of the data is in progress.

  13. Food sources of alpha-linolenic acid (PFA 18:3), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of alpha-linolenic acid (PFA 18:3), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  14. NMR-ON measurement s of 187WFe, 187,183,186ReNi, 186ReFe and 203PbFe

    International Nuclear Information System (INIS)

    The magnetic hyperfine splitting frequencies of 187WFe, 182Re(jπ = 2+)Ni, 186ReNi, 186ReFe, 186ReFe and 203PbFe in a zero external magnetic field have been determined by the NMR-ON method at about 7 mK as 225.56(6), 130.9(1), 98.17(4), 136.6(4), 1007.0(3) and 58.43(3) MHz, respectively. With the known g-factors of g(186Re, 1-) = 1.739(3) and g(203Pb, 5/2-) = 0.27456(20), the following hyperfine fields were deduced: BHF(186ReNi) = -103.05(35) kG; BHF(186ReFe) = -759.7(13) kG; BHF(203PbFe) = +279.18(25) kG. Taking hyperfine anomalies into account, the g-factor of 183Re was deduced as vertical strokeg(183Re, 5/2+)vertical stroke = 1.267(6). With the assumption of Knight shift factor K = 0, the g-factors of 182Re and 187W and the hyperfine field of 187WFe were determined as vertical strokeg(182Re, 2+)vertical stroke = 1.63(5), vertical strokeg(187W, 3/2-)vertical stroke = 0.414(10) and BHF(187WFe) = -714(18) kG. The large hyperfine anomaly was deduced to be 183W Δ 187W = -0.124(22). (orig.)

  15. Fermentation by gut microbiota cultured in a simulator of the human intestinal microbial ecosystem is improved by probiotic Enterococcus faecium CRL 183

    Directory of Open Access Journals (Sweden)

    Elizeu A. Rossi

    2011-10-01

    Full Text Available Background: Enterococci are used in a large number of dairy products, such as starter cultures in food supplements and in foods considered functional. In vitro gut fermentation models present an unmatched opportunity of performing studies frequently allenged in humans and animals owing to ethical concerns. A dynamic model of the human intestinal microbial ecosystem (SHIME was designed to better simulate conditions intestinal microbiota.Methods: The SHIME model was used to study the effect of Enterococuus faecium CRL 183 on the fermentation pattern of the colon microbiota. Initially, an inoculum prepared from human feces was introduced into the reactor vessels and stabilized over 2 wk using a culture medium. This stabilization period was followed by a 2-wk control period during which the microbiota were monitored. The microbiota were then subjected to a 4-wk treatment period by adding 108 CFU/mL of the Enterococcus faecium CRL 183 to vessel one (the stomach compartment.Results: The addition resulted into an overall increase of bacterial marker populations (Enterobacteriaceae, Lactobacillus spp., Bifidobacterium spp. and Clostridium spp., with a significant increase of the Lactobacillus sp. and Bifidobacterium sp populations. The short-chain fatty acid (SCFA concentration increased during the supplementation period; this was due mainly to a significant increase in the levels of acetic, butyric and propionic acids. Ammonium concentrations increased during the supplementation period.Conclusions: Results showed that the major effect of E. faecium CRL 183 was found in the ascendant and transverse colonFunctional Foods in Health and Disease 2011; 10:389-402

  16. Z Boson Pair Production in e^+ e^- Collisions at √s between 183 and 202, GeV with the OPAL detector at LEP

    Science.gov (United States)

    Kim, Dae Hwan; Strom, David

    2000-05-01

    A study of Z boson pair production in e^+ e^- annihilation at center-of-mass energies between 183, GeV and 202, GeV is reported. Final states containing only leptons, (l l l l and l l ν ν), quark and lepton pairs, (qq l l, qq ν ν) and the all-hadronic final state (qqqq) are considered. In all states with at least one Z boson decaying hadronically, q barq and b barb final states are considered separately using lifetime and event-shape tags, thereby improving the cross-section measurement. Limits on anomalous ZZγ and ZZZ couplings are derived.

  17. Evaluation of the 183-D Water Filtration Facility for Bat Roosts and Development of a Mitigation Strategy, 100-D Area, Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Lindsey, C. T.; Gano, K. A.; Lucas, J. G.

    2011-03-07

    The 183-D Water Filtration Facility is located in the 100-D Area of the Hanford Site, north of Richland, Washington. It was used to provide filtered water for cooling the 105-D Reactor and supplying fire-protection and drinking water for all facilities in the 100-D Area. The facility has been inactive since the 1980s and is now scheduled for demolition. Therefore, an evaluation was conducted to determine if any part of the facility was being used as roosting habitat by bats.

  18. Production of single W bosons in $e^+ e^-$ interactions at $130 \\leq \\sqrt{s} \\leq 183 GeV$ and limits on anomalous $WW\\gamma$ couplings

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Easo, S; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1998-01-01

    We report on a study of single W boson production in a data sample collected by the L3 detector at centre-of-mass energies from 130 to 183 GeV. The signal consists of large missing energy final states with a single energetic lepton or two hadronic jets. The measured cross sections at five different centre-of-mass energies are consistent with the Standard Model expectations. The following limits on the anomalous WW$\\gamma$ gauge couplings are derived at 95\\% CL: $-0.46 < \\Delta \\kappa_\\gamma < 0.57$ and $-0.86 < \\lambda_\\gamma < 0.75$.

  19. Search for R-parity Violating Chargino and Neutralino Decays in $e^+ e^-$ Collisions up to $\\sqrt{s}$= 183 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; Cozzoni, B; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G; Zöller, M

    1999-01-01

    A search for chargino and neutralino pair production in $\\mathrm{ e^+e^-}$ collisions at center-of-mass energies between 161~\\textrm{Ge\\kern -0.1em V} and 183~\\textrm{Ge\\kern -0.1em V} is performed under the assumptions that R-parity is not conserved and that only purely leptonic or hadronic R-parity violating decays are allowed. No signal is found in the data. Limits on the production cross sections, on the Minimal Supersymmetric Standard Model parameters and on the masses of the supersymmetric particles are derived.

  20. Search for charged Higgs bosons in $e^+ e^-$ collisions at centre-of-mass energies between 130 and 183 GeV

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Easo, S; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1999-01-01

    A search for pair-produced charged Higgs bosons is performed with the L3 detector at LEP using data collected at centre-of-mass energies from \\mbox{130 to 183 \\GeV{}}, corresponding to an integrated luminosity of 88.3 \\pb. The Higgs decays into a charm and a strange quark or into a tau lepton and its associated neutrino are considered. The observed candidates are consistent with the expectations from Standard Model background processes. A lower limit of 57.5 \\GeV{} on the charged Higgs mass is derived at 95\\% CL, independent of the decay branching ratio $\\mathrm{Br(H^\\pm\\ra \\tau\

  1. Search for an invisibly decaying Higgs boson in $e^{+} e^{-}$ collisions at $\\sqrt{s}$ = 183-189 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; Cozzoni, B; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lassila-Perini, K M; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muijs, A J M; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Sciarrino, D; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zöller, M

    2000-01-01

    A search for a Higgs boson decaying into invisible particles is performed using the datacollected at LEP by the L3 experiment at centre-of-mass energies of$183\\gev{}$ and $189\\gev{}$. The integrated luminosities are respectively 55.3~\\pb{} and 176.4~\\pb{}.The observed candidates are consistent with the expectations from StandardModel processes.In the hypothesis that the production cross section of this Higgs bosonequals the Standard Model one and the branching ratio into invisibleparticles is $100\\%$, a lower masslimit of $89.2\\gev{}$ is set at $95\\%$ confidence level.

  2. Study of Neutral-Current Four-Fermion and ZZ Production in $e^+ e^-$ Collisions at $\\sqrt{s}$= 183 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Conventi, F; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Pietra, M; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G; Zöller, M

    1999-01-01

    Study of Neutral--Current Four--Fermion and ZZ \\\\ Production in $\\rm e^+ e^-$ Collisions at $\\rm \\sqrt{s}=$ 183 GeV A study of neutral--current four--fermion processes is performed using a data sample corresponding to 55.3~pb$^{-1}$ of integrated luminosity collected by the L3 detector at LEP at an average centre--of--mass energy of $183~\\GeV$. The neutral--current four--fermion cross sections for final states with a pair of charged leptons plus jets and with four charged leptons are measured to be consistent with the Standard Model predictions. Events with fermion pair masses close to the Z boson mass are selected in all observable final states and the ZZ production cross section is measured to be %\\begin{center} $\\rm \\sigma_{ZZ} = 0.30 ^{+0.22\\,\\,+0.07}_{-0.16\\,\\,-0.03}\\,\\mathrm{pb},$ %\\end{center} in agreement with the Standard Model expectation. No evidence for the existence of anomalous triple gauge boson ZZZ and ZZ$\\gamma$ couplings is found and limits on these couplings are set.

  3. Search for acoplanar lepton pair events in e+e- collisions at √(s)=161, 172 and 183 GeV

    International Nuclear Information System (INIS)

    A selection of di-lepton events with significant missing transverse momentum has been performed using a total data sample of 77.0 pb-1 at e+e- centre-of-mass energies of 161 GeV, 172 GeV and 183 GeV. The observed numbers of events: four at 161 GeV, nine at 172 GeV, and 78 at 183 GeV, are consistent with the numbers expected from standard model processes, which arise predominantly from W+W- production with each W decaying leptonically. This topology is an experimental signature also for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. Further event selection criteria are described that optimise the sensitivity to particular new physics channels. No evidence for new phenomena is apparent and limits on the production cross-section times branching ratio squared for various new physics processes are presented in a manner intended to minimise the number of model assumptions. (orig.)

  4. ESTUDIO DE SENSIBILIDAD ANTIMICROBIANA DE 183 CEPAS DE STREPTOCOCCUS AGALACTIAE AISLADAS EN REGION VAGINO-PERINEAL DE EMBARAZADAS EN EL TERCER TRIMESTRE

    Directory of Open Access Journals (Sweden)

    Cristián Belmar J.

    2002-01-01

    Full Text Available fluctúa entre 1 y 3 por 1000 recién nacidos vivos. Se han entregado pautas dirigidas a reducir las tasas de sepsis precoz con la administración de antibióticos intraparto. Se ha propuesto como antibiótico de primera elección la Penicilina o Ampicilina, y Clindamicina para pacientes alérgicos a las primeras, pero también se ha planteado el uso de Eritromicina o Cefazolina. Se estudia la sensibilidad a estas drogas, en 183 cepas de Streptococcus Grupo B, aisladas en 917 embarazadas, al final del tercer trimestre, en región vaginal y pStreptococcus agalactiae (Grupo B Streptococcus is the main bacterial agent involved in neonatal sepsis of early onset (1 to 3/1000 live newborns. Has been given standards for reducing the rates of neonatal sepsis of early onset using antibiotics during labor. Has been proposed as the first choice Penicilin or Ampicilin and Clindamicin for allergic patients. Erythromycin and Cefazolin has been proposed to treat this patients. This report study sensibilities for this drugs in 183 Group B Streptococcus strains from vaginal and perianal region of 917 pregnant women during the last trimester

  5. Hadronization properties of b quarks compared to light quarks in $e^{+}e^{-} \\to q\\overline{q}$ from 183 to 200 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Chapkin, M M; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moraes, D; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinertsen, P L; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanic, S; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zucchelli, G C; Zumerle, G

    2000-01-01

    The DELPHI detector at LEP has collected 54 pb$^{-1}$ of dataat a centre-of-mass energy around 183 GeV during 1997,158 pb$^{-1}$ around 189 GeV during 1998,and 187 pb$^{-1}$ between 192 and 200 GeV during 1999.These data were used tomeasure the average charged particle multiplicity in $e^+e^-ightarrow bar{b}$ events, $langle nangle_b$, and the difference $delta_{bl}$between $langle nangle_b$ and themultiplicity, $langle nangle_ll$, in generic light quark (u,d,s) events:egin{eqnarray*}delta_{bl}m{(183 , GeV)} &=& 4.55 pm 1.31 (stat) pm 0.73 (syst) \\delta_{bl}m{(189 , GeV)} &=& 4.43 pm 0.85 (stat) pm 0.61 (syst) \\delta_{bl}m{(200 , GeV)} &=& 3.42 pm 0.89 (stat) pm 1.01 (syst) , .end{eqnarray*}This result is consistent with QCD predictions, while it isinconsistent with calculations assuming that themultiplicity accompanying the decay of a heavy quark is independent of the mass ofthe quark itself.

  6. Search for Acoplanar Lepton Pair Events in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 161, 172 and 183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    2000-01-01

    A selection of di-lepton events with significant missing transverse momentum has been performed using a total data sample of 77.0 pb-1 at e+e- centre-of-mass energies of 161 GeV, 172 GeV and 183 GeV. The observed numbers of events: four at 161 GeV, nine at 172 GeV, and 78 at 183 GeV, are consistent with the numbers expected from Standard Model processes, which arise predominantly from W+W- production with each W decaying leptonically. This topology is an experimental signature also for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. Further event selection criteria are described that optimise the sensitivity to particular new physics channels. No evidence for new phenomena is apparent and model independent limits on the production cross-section times branching ratio squared for various new physics processes are presented. Assuming a 100% branching ratio for the decay of a right-handed charged slepton to a charged lepton and the lightest neutr...

  7. Search for Anomalous Photonic Events with Missing Energy in $e^{+} e^{-}$ Collisions at $\\sqrt{s}$ = 130, 136 and 183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    Photonic events with large missing energy have been observed in e+e- collisions at centre-of-mass energies of 130, 136 and 183 GeV collected in 1997 using the OPAL detector at LEP. Results are presented for event topologies with a single photon and missing transverse energy or with an acoplanar photon pair. Cross-section measurements are performed within the kinematic acceptance of each selection. These results are compared with the expectations from the Standard Model process e+e- to nunubar + photon(s). No evidence is observed for new physics contributions to these final states. Using the data at Ecm = 183 GeV, upper limits on sigma(e+e- to X.Y)*BR(X to Y gamma) and sigma(e+e- to X.X)*BR(X to Y gamma)**2 are derived for the case of stable and invisible Y. These limits apply to single and pair production of excited neutrinos (X = nu*, Y = nu), to neutralino production (X = Chi_2^0, Y = Chi_1^0) and to supersymmetric models in which X = chi_1^0 and Y is a light gravitino.

  8. Closure study between 183.31 GHz passive microwave and in-situ radiosonde measurements of water vapor in the atmosphere

    Science.gov (United States)

    Bobryshev, Oleksandr; Brath, Manfred; John, Viju; Buehler, Stefan

    2016-04-01

    Water vapor is an effective greenhouse gas and has a strong effect on the Earth's Energy balance. Often water vapor is measured in-situ by radiosondes and remotely by passive microwave satellite sensors. Satellite and radiosonde measurements can not be compared directly because of their different nature. We can use the profiles measured by the radiosondes as an input data for a radiative transfer model and then compare the output of the model with the satellite data. One of the remote sensing techniques employs series measurements of radiant intensity at the water vapor absorption line centered at 183.31 GHz. Recently it was shown that there is a bias between the satellite and radiosonde measurements. Also this bias has a spectral shape - satellite data is warmer than radiosonde measurements near the center of the absorption line and satellite data is colder on the wings of the line. The source of the bias is not clear. The source can be problems with radiosonde or satellite data or imprecise spectroscopic data for radiative transfer models. Objective of this study is to make a closure study of 183.31 GHz satellite and radiosonde measurements to check the agreement between them. To accomplish this we utilized up-to-date spectroscopic parameters of 183.31 GHz water vapor absorption line and the Global Climate Observing System (GCOS) Reference Upper-Air Network (GRUAN) processed radiosonde data for 5 stations around the globe. We used data for microwave sensors the Advanced Microwave Sounding Unit B (AMSU-B) and the Microwave Humidity Sounder (MHS). We examined data from 2009 to 2015. We used the Atmospheric Radiative Transfer Simulator (ARTS) to simulate radiosonde profiles. We will present the comprehensive analysis of comparison. In most of the examined cases the data are comparable and consistent within the estimated uncertainty. Our comparison does not show spectral dependence of the bias. The results indicate good agreement between the satellite and radiosonde

  9. Study of neutral-current four-fermion and ZZ production in e+e- collisions at sqrt(s)= 183 GeV

    Science.gov (United States)

    L3 Collaboration; Acciarri, M.; Achard, P.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M. G.; Ambrosi, G.; Anderhub, H.; Andreev, V. P.; Angelescu, T.; Anselmo, F.; Arefiev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Baksay, L.; Balandras, A.; Ball, R. C.; Banerjee, S.; Banerjee, Sw.; Banicz, K.; Barczyk, A.; Barillère, R.; Barone, L.; Bartalini, P.; Basile, M.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B. L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J. J.; Blyth, S. C.; Bobbink, G. J.; Böhm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J. G.; Brigljevic, V.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J. D.; Burger, W. J.; Busenitz, J.; Button, A.; Cai, X. D.; Campanelli, M.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A. M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y. H.; Chaturvedi, U. K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G. M.; Chen, H. F.; Chen, H. S.; Chereau, X.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colijn, A. P.; Colino, N.; Conventi, F.; Costantini, S.; Cotorobai, F.; de La Cruz, B.; Csilling, A.; Dai, T. S.; van Dalen, J. A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degré, A.; Deiters, K.; della Pietra, M.; della Volpe, D.; Denes, P.; Denotaristefani, F.; de Salvo, A.; Diemoz, M.; van Dierendonck, D.; di Lodovico, F.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M. T.; Duchesneau, D.; Dufournand, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F. J.; Erné, F. C.; Extermann, P.; Fabre, M.; Faccini, R.; Falagan, M. A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Ferroni, F.; Fesefeldt, H.; Fiandrini, E.; Field, J. H.; Filthaut, F.; Fisher, P. H.; Fisk, I.; Forconi, G.; Fredj, L.; Freudenreich, K.; Furetta, C.; Galaktionov, Yu.; Ganguli, S. N.; Garcia-Abia, P.; Gataullin, M.; Gau, S. S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Goldfarb, S.; Gong, Z. F.; Gruenewald, M. W.; van Gulik, R.; Gupta, V. K.; Gurtu, A.; Gutay, L. J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Hervé, A.; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S. R.; Iashvili, I.; Jin, B. N.; Jones, L. W.; de Jong, P.; Josa-Mutuberría, I.; Khan, R. A.; Kamrad, D.; Kapustinsky, J. S.; Kaur, M.; Kienzle-Focacci, M. N.; Kim, D.; Kim, D. H.; Kim, J. K.; Kim, S. C.; Kinnison, W. W.; Kirkby, J.; Kiss, D.; Kittel, W.; Klimentov, A.; König, A. C.; Kopp, A.; Korolko, I.; Koutsenko, V.; Kraemer, R. W.; Krenz, W.; Kunin, A.; Lacentre, P.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lapoint, C.; Lassila-Perini, K.; Laurikainen, P.; Lavorato, A.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H. J.; Le Goff, J. M.; Leiste, R.; Leonardi, E.; Levtchenko, P.; Li, C.; Lin, C. H.; Lin, W. T.; Linde, F. L.; Lista, L.; Liu, Z. A.; Lohmann, W.; Longo, E.; Lu, Y. S.; Lübelsmeyer, K.; Luci, C.; Luckey, D.; Luminari, L.; Lustermann, W.; Ma, W. G.; Maity, M.; Majumder, G.; Malgeri, L.; Malinin, A.; Maña, C.; Mangeol, D.; Marchesini, P.; Marian, G.; Martin, J. P.; Marzano, F.; Massaro, G. G. G.; Mazumdar, K.; McNeil, R. R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W. J.; von der Mey, M.; Migani, D.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Molnar, P.; Monteleoni, B.; Moulik, T.; Muanza, G. S.; Muheim, F.; Muijs, A. J. M.; Nahn, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nippe, A.; Nisati, A.; Nowak, H.; Oh, Y. D.; Organtini, G.; Ostonen, R.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Park, H. K.; Park, I. H.; Pascale, G.; Passaleva, G.; Patricelli, S.; Paul, T.; Pauluzzi, M.; Paus, C.; Pauss, F.; Peach, D.; Pedace, M.; Pei, Y. J.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Petrak, S.; Piccolo, D.; Pieri, M.; Piroué, P. A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Produit, N.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Raja, N.; Rancoita, P. G.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; van Rhee, T.; Riemann, S.; Riles, K.; Robohm, A.; Rodin, J.; Roe, B. P.; Romero, L.; Rosier-Lees, S.; Rubio, J. A.; Ruschmeier, D.; Rykaczewski, H.; Sakar, S.; Salicio, J.; Sanchez, E.; Sanders, M. P.; Sarakinos, M. E.; Schäfer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Scholz, N.; Schopper, H.; Schotanus, D. J.; Schwenke, J.; Schwering, G.; Sciacca, C.; Sciarrino, D.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shukla, J.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.

    1999-03-01

    A study of neutral-current four-fermion processes is performed using a data sample corresponding to 55.3 pb-1 of integrated luminosity collected by the L3 detector at LEP at an average centre-of-mass energy of 183 GeV. The neutral-current four-fermion cross sections for final states with a pair of charged leptons plus jets and with four charged leptons are measured to be consistent with the Standard Model predictions. Events with fermion pair masses close to the Z boson mass are selected in all observable final states and the ZZ production cross section is measured to be σZZ=0.30+0.22 +0.07-0.16 -0.03 pb, in agreement with the Standard Model expectation. No evidence for the existence of anomalous triple gauge boson ZZZ and ZZγ couplings is found and limits on these couplings are set.

  10. Search for supersymmetry with R-parity violating $LL\\overline{E}$ couplings at $\\sqrt{s}$ = 183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Masik, J; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schneider, H; Schwemling, P; Schwering, B; Schwickerath, U; Schyns, M A E; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Shellard, R C; Sheridan, A; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stanic, S; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Vollmer, C F; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G

    2000-01-01

    Searches for pair production of supersymmetric particles in e$^{+}$e$^{-}$ collisions at centre-of-mass energy of 183~GeV have been performed on DELPHI data under the assumption that $R$-parity is not conserved. Only one $R$-parity violating coupling of $\\lambda$ type, which couples the sleptons to the leptons ($LL \\bar{E}$ term), is considered to be dominant at a time. Since in models with $R$-parity violation any supersymmetric particle can be the lightest one, searches for charginos, neutralinos, sleptons and squarks have been performed both for direct $R$-parity violating decays and for indirect cascade decays. Morever, it is assumed that the strength of the $R$-parity violating couplings is such that the lifetimes can be neglected. The present study?base=prep

  11. Tests of the Standard Model and constraints on new physics from measurements of fermion-pair production at 183 GeV at LEP

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    Cross-sections for hadronic, b-bbar and lepton pair final states in e+e- collisions at sqrt(s) = 183 GeV, measured with the OPAL detector at LEP, are presented and compared with the predictions of the Standard Model. Forward-backward asymmetries for the leptonic final states have also been measured. Cross-sections and asymmetries are also presented for data recorded in 1997 at sqrt(s) = 130 and 136 GeV. The results are used to measure the energy dependence of the electromagnetic coupling constant alpha_em, and to place limits on new physics as described by four-fermion contact interactions or by the exchange of a new heavy particle such as a leptoquark, or of a squark or sneutrino in supersymmetric theories with R-parity violation.

  12. Search for acoplanar lepton pair events in e+e- collisions at √(s)=161, 172 and 183 GeV

    International Nuclear Information System (INIS)

    A selection of di-lepton events with significant missing transverse momentum has been performed using a total data sample of 77.0 pb-1 at e+e- centre-of-mass energies of 161 GeV, 172 GeV and 183 GeV. The observed numbers of events: four at 161 GeV, nine at 172 GeV, and 78 at 183 GeV, are consistent with the numbers expected from Standard Model processes, which arise predominantly from W+W- production with each W decaying leptonically. This topology is an experimental signature also for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. Further event selection criteria are described that optimise the sensitivity to particular new physics channels. No evidence for new phenomena is apparent and model independent limits on the production cross-section times branching ratio squared for various new physics processes are presented. Assuming a 100% branching ratio for the decay lR±→l±χ10, we exclude at 95% CL: right-handed smuons with masses below 65 GeV for mμ--mχ10>2 GeV and right-handed staus with masses below 64 GeV for mτ--mχ10>10 GeV. Right-handed selectrons are excluded at 95% CL for masses below 77 GeV for me--mc10>5 GeV within the framework of the Minimal Supersymmetric Standard Model assuming μ<-100 GeV and tanβ=1.5. (orig.)

  13. Search for anomalous production of acoplanar di-lepton events in e+e- collisions at √(s)=183 and 189 GeV

    International Nuclear Information System (INIS)

    A selection of di-lepton events with significant missing transverse momentum has been performed using a total data sample of 237.4 pb-1 at e+e- centre-of-mass energies of approximately 183 GeV and 189 GeV. The observed numbers of events - 78 at 183 GeV and 301 at 189 GeV - are consistent with the numbers expected from standard model processes, which arise predominantly from W+W- production with both W bosons decaying leptonically. This topology is also an experimental signature for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. Discrimination techniques are described that optimise the sensitivity to particular new physics channels. No evidence for new phenomena is apparent. Upper limits on the production cross-section times branching ratio squared for sleptons and for leptonically decaying charginos and charged Higgs are presented in a manner intended to minimise the number of model assumptions. Assuming a 100% branching ratio for the decay l±R→l±χ01, where χ01 is the lightest neutralino, we exclude at 95% CL: right-handed smuons with masses below 82.3 GeV for mμ--mχ01>3 GeV and right-handed staus with masses below 81.0 GeV for mτ--mχ01>8 GeV. Right-handed selectrons are excluded at 95% CL for masses below 87.1 GeV for me--mχ01>5 GeV, within the framework of the minimal supersymmetric standard model assuming μ±, are excluded at 95% CL for masses below 82.8 GeV, assuming a 100% branching ratio for the decay H±→τ±ντ. (orig.)

  14. The co-existence of the IL-18+183 A/G and MMP-9 -1562 C/T polymorphisms is associated with clinical events in coronary artery disease patients.

    Directory of Open Access Journals (Sweden)

    Trine B Opstad

    Full Text Available OBJECTIVE: Interleukin (IL-18 has been associated with severity of atherosclerosis and discussed to predict cardiovascular (CV events. We have previously shown that the IL-18+183 G-allele significantly reduces IL-18 levels. This study was aimed to investigate the prognostic significance of the IL-18+183 A/G polymorphism (rs5744292, single and in coexistence with the matrix metalloproteinase (MMP-9 -1562 C/T (rs3918242 polymorphism, in patients with stable coronary artery disease (CAD. Serum levels of IL-18, MMP-9 and tissue inhibitor of matrix metalloproteinase (TIMP-1 were additionally assessed. METHODS: 1001 patients with angiographically verified CAD were genotyped and the biomarkers were measured accordingly. After two years follow-up, 10.6% experienced new clinical events; acute myocardial infarction (AMI, stroke, unstable angina pectoris and death. RESULTS: The IL-18+183 G-allele associated with 35% risk reduction in composite endpoints after adjusting for potential covariates (p = 0.044. The IL-18+183 AA/MMP-9 -1562 CT/TT combined genotypes associated with a significant increase in risk of composite endpoints (OR = 1.87; 95% CI = 1.13-3.11, p = 0.015, adjusted. Patients with clinical events presented with significantly higher IL-18 levels as compared to patients without (p = 0.011, adjusted. The upper tertile of IL-18 levels associated with an increase in risk of AMI as compared to lower tertiles (OR = 2.36; 95% CI = 1.20-4.64, p = 0.013, adjusted. CONCLUSION: The IL-18+183 A/G polymorphism, single and in combination with MMP-9 genotypes, may influence the risk of clinical events in stable CAD patients.

  15. Classification of biodiesel and fuel blends using gas chromatography - differential mobility spectrometry with cluster analysis and isolation of C18:3 me by dual ion filtering.

    Science.gov (United States)

    Pasupuleti, Dedeepya; Eiceman, Gary A; Pierce, Karisa M

    2016-08-01

    Fatty acid alkyl esters (FAAEs) were determined at 10-100mg/L in biodiesel and blends with petrodiesel without sample pre-treatment using gas chromatography with a tandem differential mobility detector. Selectivity was provided through chromatographic separations and atmospheric pressure chemical ionization reactions in the detector with mobility characterization of gas ions. Limits of detection were ~0.5ng with an average of 2.98% RSD for peak area precision, ≤1.3% RSD for retention time precision, and ≤9.2% RSD for compensation voltage precision. Biodiesel blends were classified using principal component analysis (PCA) and hierarchical cluster analysis (HCA). Unsupervised cluster analysis captured 52.72% of variance in a single PC while supervised analysis captured 71.64% of variance using Fisher ratio feature selection. Test set predictions showed successful clustering according to source or feedstock when regressed onto the training set model. Detection of the regulated substance methyl linolenate (C18:3 me) was achieved in 6-10s with a 1m long capillary column using dual ion filtering in the tandem differential mobility detector. PMID:27216685

  16. MELCOR 1.8.3. Code Assessment and Validation in Nuclear Power Plants Research Institute Trnava a.s., International Standard Problem 37 Code Comparison Results

    International Nuclear Information System (INIS)

    The Nuclear Power Plants Research Institute Trnava a.s. (Slovakia) implementation of MELCOR 1.8.3 code in 1995. In an effort to introduce and to validate the code for severe accident analysis of Slovak WWER 440 several activities were carried out, starting from sample tests and aiming to development of complex WWER-440 V-213 model. In the frame of the MELCOR code validation Nuclear Power Plants Research Institute Trnava a.s. (Slovakia) participated in the International Standard Problem 37 (VANAM M3 - A Multi Compartment Aerosol Depletion Test). Brief description of International Standard Problem 37 is given in the paper together with Nuclear Power Plants Research Institute Trnava a.s. (Slovakia) MELCOR model of the experiment. Summary of final evaluation of the International Standard Problem 37 results from Nuclear Power Plants Research Institute Trnava a.s. (Slovakia) MELCOR participation is presented. Present status of WWER-440/V-213 MELCOR model is briefly described as well as the plans for next steps in the MELCOR code validation

  17. Experimental evidence of the $^6$He level at $E^*$ = 18.3 MeV by the $^4$He+$^3$H three-body reaction

    CERN Document Server

    Povoroznyk, O M; Jachmenjov, O O; Mokhnach, H V; Ponkratenko, O; Mandaglio, G; Curciarello, F; De Leo, V; Fazio, G; Giardina, G

    2012-01-01

    Measurements of the t-t and p-t coincidence events in the $^3$H ($\\alpha$, ttp) reaction have been obtained at $E_\\alpha$ incident energy of 67.2 MeV. Various appropriate angular configurations of detectors were chosen in order to observe the population of the $^6$He$^*$ state at around 18 MeV. Its contribution appears at the $E_{\\rm tt}$ relative energy of 6.0 MeV by the analysis of bidimensional spectra. We found the formation of the $^6$He excited state at $E^* = 18.3 \\pm 0.2$ MeV (with a $\\Gamma$ width of 1.1 $\\pm$ 0.3 MeV) by the decay into the t+t binary channel, since the threshold energy of the t+t channel is 12.31 MeV. In each analyzed bidimensional energy spectrum of ($E_{\\rm t}$, $E_{\\rm t}$) and ($E_{\\rm p}$, $E_{\\rm t}$) coincidence events resonance structures are present due to the formation of both $^6$He$^*$ and $^4$He$^*$ excited states. Our results on the $E^*$ and $\\Gamma$ values regarding the $^6$He$^*$ level of about 18 MeV are compared with the results obtained by other reactions. Moreov...

  18. The Stress Corrosion Resistance and the Cryogenic Temperature Mechanical Behavior of 18-3 Mn (Nitronic 33) Stainless Steel Parent and Welded Material

    Science.gov (United States)

    Montano, J. W.

    1976-01-01

    The ambient and cryogenic temperature mechanical properties and the ambient temperature stress corrosion results of 18-3 Mn (Nitronic 33)stainless steel, longitudinal and transverse, as received and as welded (TIG) material specimens manufactured from 0.063 inch thick sheet material, were described. The tensile test results indicate an increase in ultimate tensile and yield strengths with decreasing temperature. The elongation remained fairly constant to -200 F, but below that temperature the elongation decreased to less than 6.0% at liquid hydrogen temperature. The notched tensile strength (NTS) for the parent metal increased with decreasing temperature to liquid nitrogen temperature. Below -320 F the NTS decreased rapidly. The notched/unnotched (N/U) tensile ratio of the parent material specimens remained above 0.9 from ambient to -200 F, and decreased to approximately 0.65 and 0.62, respectively, for the longitudinal and transverse directions at liquid hydrogen temperature. After 180 days of testing, only those specimens exposed to the salt spray indicated pitting and some degradation of mechanical properties.

  19. Search for neutral Higgs bosons in $e^{+}e^{-}$ interactions at center-of-mass energies between 130 GeV and 183 GeV

    CERN Document Server

    Matzner-Dominguez, David Aaron

    1998-01-01

    We have implemented precision tracking algorithms and developed novel techniques to efficiently identify the production of b quarks with a high purity. These techniques would allow us to discover the Higgs boson through its decay into b quark pairs. The search for the Higgs boson was carried out within the framework of the Standard Model and a restricted version of the Minimal Supersymmetric Standard Model using the four-jets channel in the data from e$\\sp+$e$\\sp-$ interactions with center-of-mass energies 130 $\\rm GeV \\le \\sqrt{s} \\le 183$ GeV collected by the L3 detector. After combining the results of the search in the four-jets channel with the other decay modes, no evidence of the production of a Higgs signal is observed. Lower limits are set on the mass of the Standard Model Higgs and on the Minimal Supersymmetric Standard Model Higgs as a function of tan $\\beta.$ The mass of the Standard Model Higgs boson, h, is restricted to be

  20. Search for invisibly decaying Higgs bosons in $e^{+}e^{-} \\rightarrow Z^{0}h^{0}$ production at $\\sqrt{s} = 183 - 209 GeV$

    CERN Document Server

    Abbiendi, G; Åkesson, P F; Alexander, G; Anagnostou, G; Anderson, K J; Asai, S; Axen, D; Bailey, I; Barberio, E; Barillari, T; Barlow, R J; Batley, R J; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, S; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brown, R M; Burckhart, H J; Campana, S; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Ciocca, C; Csilling, A; Cuffiani, M; Dado, S; Dallavalle, G M; de Roeck, A; De Wolf, E A; Desch, K; Dienes, B; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, F; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Gagnon, P; Gary, J W; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, J; Gruwé, M; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harel, A; Hauschild, M; Hawkes, C M; Hawkings, R; Herten, G; Heuer, R D; Hill, J C; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanzaki, J; Karlen, D; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kramer, T; Krasznahorkay, A; Krieger, P; Von Krogh, J; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, A; Ludwig, J; Mader, W; Marcellini, S; Martin, A J; Mashimo, T; Mättig, P; McKenna, J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Meyer, N; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Pilcher, J E; Pinfold, J L; Plane, D E; Pooth, O; Przybycien, M; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rossi, A M; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schiecks, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, J; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2010-01-01

    A search is performed for Higgs bosons decaying into invisible final states, produced in association with a Zo boson in e+e- collisions at energies between 183 and 209 GeV. The search is based on data samples collected by the OPAL detector at LEP corresponding to an integrated luminosity of about 660 pb-1. The analysis aims to select events containing the hadronic decay products of the Zo boson and large missing momentum, as expected from Higgs boson decay into a pair of stable weakly interacting neutral particles, such as the lightest neutralino in the Minimal Supersymmetric Standard Model. The same analysis is applied to a search for nearly invisible Higgs boson cascade decays into stable weakly interacting neutral particles. No excess over the expected background from Standard Model processes is observed. Limits on the production of invisibly decaying Higgs bosons produced in association with a Zo boson are derived. Assuming a branching ratio BR(ho->invisible)=1, a lower limit of 108.2 GeV is placed on the...

  1. Search for stable and long-lived massive charged particles in $e^{+} e^{-}$ collisions at $\\sqrt{s}$ = 130-183 GeV

    CERN Document Server

    Ackerstaff, K; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Bonacorsi, D; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Clarke, P E L; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallapiccola, C; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Doucet, M; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Evans, M; Fabbri, Franco Luigi; Fanfani, A; Fanti, M; Faust, A A; Feld, L; Fiedler, F; Fierro, M; Fischer, H M; Fleck, I; Folman, R; Fong, D G; Foucher, M; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Geddes, N I; Geich-Gimbel, C; Geralis, T; Giacomelli, G; Giacomelli, P; Giacomelli, R; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Goodrick, M J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hajdu, C; Hanson, G G; Hansroul, M; Hapke, M; Hargrove, C K; Hart, P A; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Hutchcroft, D E; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jawahery, A; Jeffreys, P W; Jeremie, H; Jimack, Martin Paul; Joly, A; Jones, C R; Jones, M; Jost, U; Jovanovic, P; Junk, T R; Kanzaki, J I; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kirk, J; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kyberd, P; Lafferty, G D; Lahmann, R; Lai, W P; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lefebvre, E; Lellouch, Daniel; Letts, J; Levinson, L; List, B; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mannelli, M; Marcellini, S; Markopoulos, C; Markus, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mincer, A; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oh, A; Oldershaw, N J; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, J L; Plane, D E; Poffenberger, P R; Poli, B; Posthaus, A; Rembser, C; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Rooke, A M; Rossi, A M; Routenburg, P; Rozen, Y; Runge, K; Runólfsson, O; Ruppel, U; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schleper, P; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skillman, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Springer, R W; Sproston, M; Stephens, K; Steuerer, J; Stockhausen, B; Stoll, K; Strom, D; Ströhmer, R; Szymanski, P; Tafirout, R; Talbot, S D; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Utzat, P; Van Kooten, R; Vannerem, P; Verzocchi, M; Vikas, P; Vokurka, E H; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1998-01-01

    A search for stable and long-lived massive particles of electric charge |Q/e| = 1 or 2/3, pair-produced in e+e- collisions at centre-of-mass energies from 130 to 183 GeV, is reported by the OPAL collaboration at LEP. No evidence for production of these particles was observed in a mass range between 45 and 89.5 GeV. Model-independent upper limits on the production cross-section between 0.05 and 0.19 pb have been derived for scalar and spin-1/2 particles with charge +/-1. Within the framework of the minimal supersymmetric model (MSSM), this implies a lower limit of 82.5 (83.5) GeV on the mass of long-lived right- (left-)handed scalar muons and scalar taus. Long-lived charged leptons and charginos are excluded for masses below 89.5 GeV. For particles with charge +/-2/3 the upper limits on the production cross-section vary between 0.05 and 0.2 pb. All limits, on masses and on cross-sections, are valid at the 95% confidence level for particles with lifetimes longer than 10^{-6} s.

  2. Chemical shifts of 17O, 183W NMR and state of [ZW10O36]n-heteropolyanions in aqueous solutions

    International Nuclear Information System (INIS)

    By 17O, 183W NMR aqueous solutions of Na- and K-salts of heteropolyanions (HPA) [ZW10O36]n-, where Z = La3+-Er3+, Ce3+, Th4+, U4+, have been studied. HPA in aqueous solution exist as inert in the NMR time scale (1-100 ms) complexes, moreover, coordination sphere of Z is filled with O atoms of oxotungstate ligands, as in crystal state. The character of paramagnetic shifts (LIS) of all HPA atoms has been defined - in O and W atoms nearest to Z in LIS contact contribution prevails, for W-O-W bridge atoms and internal O atom dipole contribution prevails, for the rest atoms the dipole and contact contributions are comparable. The change in chemical shifts in lanthanide series depends not only on magnetic properties of element, but also on structural change in HPA. The width of 17O NMR lines for HPA studied (except HPA containing gadolinium) is determined by quadrupole mechanism of nuclear magnetic relaxation. 24 refs., 2 figs., 3 tabs

  3. Armazenamento refrigerado sob atmosfera modificada de pedúnculos de cajueiro-anão-precoce dos clones CCP-76, end-157, end-183 e end-189 Storage of cashew apples from dwarf clones CCP-76, end-157, end-183 and end-189 under refrigeration and modified atmosphere

    Directory of Open Access Journals (Sweden)

    Auricélia de Souza Morais

    2002-12-01

    Full Text Available Pedúnculos de clones de cajueiro-anão-precoce, dos clones CCP-76, END-157, END-183 e END-189, foram armazenados durante 25 dias, sob refrigeração associada a atmosfera modificada, com o objetivo de avaliar o efeito das condições atualmente utilizadas (5ºC e 85-90% de UR para conservação, transporte e comercialização de cajus in natura. Os pedúnculos foram avaliados a cada 5 dias quanto às seguintes características: perda de peso, firmeza, cor (antocianinas, sólidos e açúcares solúveis, acidez, pH, vitamina C e compostos fenólicos. O uso da refrigeração (5ºC e 85% U.R, associada a atmosfera modificada, proporcionou uma vida útil pós-colheita de 10 dias para o clone END 189, de até 15 dias para o clone END 157 e de até 25 dias para os clones CCP 76 e END 183. A temperatura de 5ºC não se mostrou adequada para armazenamento de pedúnculos de coloração mais intensa (END 157 e END 189 que a testemunha (CCP 76, provocando perda de cor (antocianinas a partir do 10º dia de armazenamento. A atmosfera modificada reduziu significativamente a perda de peso, favorecendo a aparência do produto para comercialização, independentemente do clone estudado.Apples or false fruits from early dwarf cashew clones CCP-76, END-157, END-183 and END-189 were stored for 25 days under refrigeration associated to modified atmosphere with the aim of evaluating the effect of the conditions presently adopted (5ºC and 85-90% RH for conservation, storage and commercialization of fresh cashew apples. The cashew apples were evaluated every 5 days for the following characteristics: weight loss, pulp firmness, color (anthocyannins, acidity, pH, soluble solids, vitamin C and phenolic contents. With the use of refrigeration and modified atmosphere it was possible to attain postharvest storage life of 10 days for clone END 189, 15 days for clone END 157 and up to 25 days for clones CCP 76 and END 183. It was found that 5ºC was not an adequate

  4. Significance of fragmented QRS complexes for identifying culprit lesions in patients with non-ST-elevation myocardial infarction: a single-center, retrospective analysis of 183 cases

    Directory of Open Access Journals (Sweden)

    Guo Rong

    2012-06-01

    Full Text Available Abstract Background Fragmented QRS (fQRS complexes are novel electrocardiographic signals, which reflect myocardial conduction delays in patients with coronary artery disease (CAD. The importance of fQRS complexes in identifying culprit vessels was evaluated in this retrospective study. Methods A 12-lead surface electrocardiogram was obtained in 183 patients who had non-ST-elevation myocardial infarction (NSTEMI and subsequently underwent coronary angiography (CAG. On the basis of the frequency of fQRS complexes, indices such as sensitivity, specificity, positive and negative predictive values, and likelihood ratio were evaluated to determine the ability of fQRS complexes to identify the culprit vessels. Results Among the patients studied, elderly patients (age ≥ 65 years and those with diabetes had a significantly higher frequency of fQRS complexes (p = 0.005, p = 0.003, respectively. The fQRS complexes recorded in the 4 precordial leads had the highest specificity (81.8% for indentifying the culprit vessel (left anterior descending artery. However, the specificity of fQRS complexes to identify lesions in the left circumflex and right coronary arteries was lower for the inferior and lateral leads than for the limb leads (65.5% versus 71.7%; however, the limb leads had higher sensitivity (92.3% versus 89.4%. And the total sensitivity and specificity of fQRS (77.1% and 71.5% were higher than those values for ischemic T-waves. Conclusions The frequency of fQRS complexes was higher in elderly and diabetic patients with NSTEMI. The frequency of fQRS complexes recorded in each of the ECG leads can be used to identify culprit vessels in patients with NSTEMI.

  5. A 1.83 μJ/Classification, 8-Channel, Patient-Specific Epileptic Seizure Classification SoC Using a Non-Linear Support Vector Machine.

    Science.gov (United States)

    Bin Altaf, Muhammad Awais; Yoo, Jerald

    2016-02-01

    A non-linear support vector machine (NLSVM) seizure classification SoC with 8-channel EEG data acquisition and storage for epileptic patients is presented. The proposed SoC is the first work in literature that integrates a feature extraction (FE) engine, patient specific hardware-efficient NLSVM classification engine, 96 KB SRAM for EEG data storage and low-noise, high dynamic range readout circuits. To achieve on-chip integration of the NLSVM classification engine with minimum area and energy consumption, the FE engine utilizes time division multiplexing (TDM)-BPF architecture. The implemented log-linear Gaussian basis function (LL-GBF) NLSVM classifier exploits the linearization to achieve energy consumption of 0.39 μ J/operation and reduces the area by 28.2% compared to conventional GBF implementation. The readout circuits incorporate a chopper-stabilized DC servo loop to minimize the noise level elevation and achieve noise RTI of 0.81 μ Vrms for 0.5-100 Hz bandwidth with an NEF of 4.0. The 5 × 5 mm (2) SoC is implemented in a 0.18 μm 1P6M CMOS process consuming 1.83 μ J/classification for 8-channel operation. SoC verification has been done with the Children's Hospital Boston-MIT EEG database, as well as with a specific rapid eye-blink pattern detection test, which results in an average detection rate, average false alarm rate and latency of 95.1%, 0.94% (0.27 false alarms/hour) and 2 s, respectively. PMID:25700471

  6. Three-body analysis of 11Li and its -decay to deuteron channel and to halo analog state 11Be* (18.3 MeV)

    Indian Academy of Sciences (India)

    S Kumar; V S Bhasin

    2004-09-01

    The ground state wave function of 11Li obtained in a three-body model proposed earlier (S Kumar and V S Bhasin, Phys. Rev. C65, 034007 (2002)) has been employed to study the probability distributions, momentum distributions and n–n correlation. Complex scaling method has been used to find the energy positions and widths of the three resonant states of 11Li above the breakup threshold. The formalism is extended further to study the -decay of 11Li to two channels. One is the -transition of 11Li into a high lying excited state of 11Be at 18.3 MeV, i.e., 11Be* and the second is the decay to deuteron + 9Li channel. The 11Be* state has been considered as a halo analog state identified as a bound three-body (9Li + n + p) system. The n- 9Li interaction in-corporates both the virtual state and the p-wave resonance observed experimentally. For p- 9Li interaction, a Coulomb corrected separable interaction is constructed using charge indepedendence for strong interaction part. The n–p interaction is operative only in 3S1 state corresponding to the isotopic spin h = 0. As a result the 11Be* state has the same isotopic spin as that of 9Li core, i.e., = 3/2. Using these realistic parameters as input and without invoking any other free parameter, the model has been used to predict the strength of the Gamow–Teller -decay of 11Li to 11Be* , i.e., GT = 1.5 and the value of the branching ratio to 9Li + deuteron channel to be 1.3 × 10−4. These results are found to be in rather good agreement with the recent experimental findings.

  7. Missense splice variant (g.20746A>G, p.Ile183Val) of interferon gamma receptor 1 (IFNGR1) coincidental with mycobacterial osteomyelitis - a screen of osteoarticular lesions.

    Science.gov (United States)

    Bińczak-Kuleta, Agnieszka; Szwed, Aleksander; Walter, Mark R; Kołban, Maciej; Ciechanowicz, Andrzej; Clark, Jeremy S C

    2016-08-01

    Previously, dominant partial interferon-gamma receptor 1 (IFN-g-R1) susceptibility to environmental mycobacteria was found with IFNGR1 deletions or premature stop. Our aim was to search for IFNGR1 variants in patients with mycobacterial osteoarticular lesions. Biopsies from the patients were examined for acid-fast bacilli, inflammatory cell infiltration, and mycobacterial niacin. Mycobacterial rRNA was analyzed using a target-amplified rRNA probe test. Peripheral-blood-leukocyte genomic DNA was isolated from 19 patients using the QIAamp DNA Mini Kit, and all IFNGR1 exons were sequenced using an ABIPRISM 3130 device. After the discovery of an exon 5 variant, a Polish newborn population sample (n = 100) was assayed for the discovered variant. Splice sites and putative amino acid interactions were analyzed. All patients tested were positive for mycobacteria; one was heterozygous for the IFNGR1 exon 5 single-nucleotide-missense substitution (g.20746A>G, p.Ile183Val). No other variant was found. The splice analysis indicated the creation of an exonic splicing silencer, and alternatively, molecular graphics indicated that the p.Ile183Val might alter beta-strand packing (loss of van der Waals contacts; Val183/Pro205), possibly altering the IFN-g-R1/IFN-g-R2 interaction. The probability of non-deleterious variant was estimated as genes affecting Type 1 T-helper-cell-mediated immunity. PMID:27483180

  8. Oceanographic profile data collected from CTD and sound velocimeter - moving vessel profiler casts aboard FAIRWEATHER as part of project OPR-P183-FA-09 in the Gulf of Alaska from 2009-06-17 to 2009-08-11 (NCEI Accession 0130818)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0130818 includes physical and profile data collected aboard the FAIRWEATHER during project OPR-P183-FA-09 in the Gulf of Alaska from 2009-06-17 to...

  9. Oceanographic profile data collected from CTD and sound velocimeter - moving vessel profiler casts aboard FA2805, FA2806, FA2808 and FAIRWEATHER as part of project OPR-P183-FA-15 in the Gulf of Alaska and North Pacific Ocean from 2015-05-16 to 2015-06-14 (NCEI Accession 0130665)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0130665 includes physical and profile data collected aboard the FA2805, FA2806, FA2808 and FAIRWEATHER during project OPR-P183-FA-15 in the Gulf of...

  10. The Fatty Acid Profile Analysis of Cyperus laxus Used for Phytoremediation of Soils from Aged Oil Spill-Impacted Sites Revealed That This Is a C18:3 Plant Species.

    Directory of Open Access Journals (Sweden)

    Noemí Araceli Rivera Casado

    Full Text Available The effect of recalcitrant hydrocarbons on the fatty acid profile from leaf, basal corm, and roots of Cyperus laxus plants cultivated in greenhouse phytoremediation systems of soils from aged oil spill-impacted sites containing from 16 to 340 g/Kg total hydrocarbons (THC was assessed to investigate if this is a C18:3 species and if the hydrocarbon removal during the phytoremediation process has a relationship with the fatty acid profile of this plant. The fatty acid profile was specific to each vegetative organ and was strongly affected by the hydrocarbons level in the impacted sites. Leaf extracts of plants from uncontaminated soil produced palmitic acid (C16, octadecanoic acid (C18:0, unsaturated oleic acids (C18:1-C18:3, and unsaturated eichosanoic (C20:2-C20:3 acids with a noticeable absence of the unsaturated hexadecatrienoic acid (C16:3; this finding demonstrates, for the first time, that C. laxus is a C18:3 plant. In plants from the phytoremediation systems, the total fatty acid contents in the leaf and the corm were negatively affected by the hydrocarbons presence; however, the effect was positive in root. Interestingly, under contaminated conditions, unusual fatty acids such as odd numbered carbons (C15, C17, C21, and C23 and uncommon unsaturated chains (C20:3n6 and C20:4 were produced together with a remarkable quantity of C22:2 and C24:0 chains in the corm and the leaf. These results demonstrate that weathered hydrocarbons may drastically affect the lipidic composition of C. laxus at the fatty acid level, suggesting that this species adjusts the cover lipid composition in its vegetative organs, mainly in roots, in response to the weathered hydrocarbon presence and uptake during the phytoremediation process.

  11. Remaining Sites Verification Package for the 100-F-26:10, 1607-F3 Sanitary Sewer Pipelines (182-F, 183-F, and 151-F Sanitary Sewer Lines), Waste Site Reclassification Form 2007-028

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-12-03

    The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  12. Measurement of the Cross-Section for the Process $\\gamma-\\gamma$ to Proton-Antiproton at $\\sqrt{s_{ee}}$ = 183 - 189 GeV with the OPAL Detector at LEP

    CERN Document Server

    Barillari, T

    2004-01-01

    The exclusive production of proton-antiproton pairs in the collisions of two quasi-real photons has been studied using data taken at sqrt(s_ee) = 183 GeV and 189 GeV with the OPAL detector at LEP. Results are presented for proton-antiproton invariant masses, W, in the range 2.15 < W < 3.95 GeV. The cross-section measurements are compared with previous data and with recent analytic calculations based on the quark-diquark model.

  13. Remaining Sites Verification Package for the 100-F-26:10, 1607-F3 Sanitary Sewer Pipelines (182-F, 183-F, and 151-F Sanitary Sewer Lines). Attachment to Waste Site Reclassification Form 2007-028

    International Nuclear Information System (INIS)

    The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  14. Cisplatin and Paclitaxel Alter the Expression Pattern of miR-143/145 and miR-183/96/182 Clusters in T24 Bladder Cancer Cells.

    Science.gov (United States)

    Papadopoulos, Emmanuel I; Scorilas, Andreas

    2015-12-01

    Although cisplatin-based chemotherapy is considered to be the treatment of choice for metastatic bladder cancer, its efficacy and tolerability has proven to be limited. MicroRNAs are small noncoding RNAs, whose genes are frequently organized in clusters. These molecules constitute posttranscriptional regulators of mRNA expression and are claimed to be deregulated in cancer. miR-143/145 and miR-183/96/182 clusters have been extensively studied in bladder cancer cells. Herein, we tried to add up to this knowledge by assessing the expression levels of the five mature microRNAs derived from the aforementioned clusters in T24 bladder cancer cells exposed to either cisplatin or paclitaxel. For both compounds, the viability of treated T24 cells was estimated via the MTT colorimetric assay and the Trypan Blue exclusion method, while a fraction of the cells was left to recover. The expression levels of all mature microRNAs were finally quantified both in treated and in recovered cells by performing real-time PCR. According to our data, cisplatin and paclitaxel strongly decreased T24 cells' viability, showing in parallel the ability to significantly down-regulate miR-143 levels, and up-regulate the expression levels of miR-145, miR-183, miR-96, and miR-182, which, in their total, demonstrated case-specific variations after recovery period. PMID:26356996

  15. Analysis of in-hospital death-related factors for acute encephalocele in patients with craniocerebral injury for craniotomy:a report of 183 cases%颅脑损伤开颅术中急性脑膨出患者的院内死亡相关因素分析(附183例报告)

    Institute of Scientific and Technical Information of China (English)

    何建青; 时忠华; 王玉海; 张春雷; 陈磊; 陈军辉; 朱军

    2015-01-01

    Objective To investigate the in-hospital death-related factors for acute encephalocele in patients with craniocerebral injury for craniotomy in order to provide evidence for clinical treatment and prognosis determination.Methods The clinical data of 183 patients with craniocerebral injury occurring acute encephalocele during craniotomy treated at the Department of Neurosurgery,the 101 st Hospital of PLA from August 2008 to July 2014 were analyzed retrospectively.The correlations of the factors including sex,age,preoperative hypoxia,preoperative blood pressure,preoperative Glasgow coma scale (GCS) scores,preoperative pupil status,brain swelling,preoperative intracranial pressure (ICP),causes of encephalocele,postoperative pupillary status,postoperative ICP,postoperative GCS,coagulation mechanism,blood glucose,and complications of the patients of in-hospital deaths were analyzed.Results The prognosis was assessed according to the Glasgow outcome scale (GOS) scores after procedure; there were 135 patients in a death group (namely death cases) and 48 in a survival group (including good recovery,moderate disability,severe disability,and vegetative cases).The postoperative GCS scores,glucose,causes of encephalocele,and postoperative pupillary status were closely associated with the inhospital death in patients with acute encephalocele in craniocerebral injury operation (P < 0.05).There was significant difference in postoperative ICP between the survival group and the death group (P < 0.05).Conclusion The postoperative GCS,glucose,causes of encephalocele,postoperative pupillary status,postoperative ICP and postoperative complications could be used as the important indexes for predicting inhospital death of acute encephalocele in craniocerebral injury for craniotomy.%目的 探讨颅脑损伤开颅术中急性脑膨出患者的院内死亡相关因素,为临床治疗及预后判断提供依据.方法 回顾性分析2008年8月至2014年7月解放军第101

  16. [The experience of 183 medical special forces of the Volga-Urals Military District in the elimination of the health effects of the emergency in the Republic of Indonesia].

    Science.gov (United States)

    Korniushko, I G; Iakovlev, S V; Vladimirov, A V

    2011-08-01

    The article is based on personal experience of the authors with assistance in the aftermath of the tsunami in the Republic of Indonesia, which killed about 120 thousand (December 26, 2004 at 255 km to the west coast of Sumatra). In the disaster area were sent to 183 medical detachments for special purposes of the Volga-Urals Military District, reinforced brigade of specialized medical care of military medical institutions under the central government and the Moscow Military District. As the authors noted, in the aftermath of a disaster like the tsunami, at first put forward preventive measures among displaced persons. The experience gained by the Medical Service of the Armed Forces of the Russian Federation in the aftermath of natural disaster in the Republic of Indonesia, is used to plan future humanitarian operations abroad with the assistance of military medical specialists from Russia. PMID:22164981

  17. Improved photon-production data for thermal-neutron capture for Z≤30 and 70,72,73,74,76Ge, 149Sm, 155,157Gd, 181Ta and 182,183,184,186W

    International Nuclear Information System (INIS)

    Prompt gamma-ray spectroscopy is used in a wide variety of applications for determining material compositions. High-quality photon-production data from thermal-neutron capture reactions are essential for these applications. Radiation transport codes, such as MCNPTM, are often used to design detector systems, determine minimum detection thresholds, etc. These transport codes rely on evaluated nuclear databases such as ENDF (Evaluated Nuclear Data File) to provide the fundamental data used in the transport calculations. Often the photon-production data from incident neutron reactions in the evaluations are of relatively poor quality. We have compiled the best experimental data for thermal-neutron capture for the naturally occurring isotopes for elements from hydrogen through zinc as well as for 70,72,73,74,76Ge, 149Sm, 155,157Gd, 181Ta and 182,183,184,186W. This compilation has been used to update the ENDF evaluations for 1H, 4He, 9Be, 14N, 16O, 19F, Na, Mg, 27Al, 32S, S, 35,37Cl, K, Ca, 45Sc, Ti, 51V, 50,52,53,54Cr, 55Mn, 54,56,57,58Fe, 58,60,61,62,64Ni, 63,65Cu and 182,183,184,186W. In addition, the inelastic cross sections and corresponding secondary-photon distributions were updated for 160. Complete new evaluations were submitted to ENDF for 35,37Cl. This report briefly describes the compilation process and the changes made to the ENDF evaluations. (author)

  18. Food sources of total omega 3 fatty acids (18:3 + 20:5 + 22:6), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of total omega 3 fatty acids (18:3 + 20:5 + 22:6), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  19. Allan B. Chinen, ...e foram felizes para sempre: contos de fadas para adultos (in the ever after - fairy tales and the second half of life, 1989), interpretados segundo as teorias psicodinâmicas do desenvolvimento humano postuladas por Carl G. Jung e Erik Erikson, tradução de Cecília Casas, São Paulo, Cultrix, 1997, 183 pp.

    OpenAIRE

    Weigert, Beatriz

    1997-01-01

    Notas e recensões sobre Allan B. Chinen, ...e foram felizes para sempre: contos de fadas para adultos (in the ever after - fairy tales and the second half of life, 1989), interpretados segundo as teorias psicodinâmicas do desenvolvimento humano postuladas por Carl G. Jung e Erik Erikson, tradução de Cecília Casas, São Paulo, Cultrix, 1997, 183 pp.

  20. A Rapid Method for Determination of the Main Conjugated Linoleic Acid Precursors (C18:2 n-6 and C18:3 n-3) in Forage by Capillary Zone Electrophoresis with Ultraviolet Detection Using Gas Chromatography with Flame Ionization Detection as a Comparative Method.

    Science.gov (United States)

    de Jesus Coelho Castro, Renata; Sobrinho, Fausto Souza; Sundfeld da Gama, Marco Antônio; Takabayashi Sato, Renata; Lavorato Lima, Larissa; Leal de Oliveira, Marcone Augusto

    2015-01-01

    A rapid method has been proposed for determination of the main conjugated linoleic acid precursors such as linoleic (C18:2 n-6) and linolenic (C18:3 n-3) acids in forages by capillary zone electrophoresis (CZE) with direct UV detection at 200 nm. Among the fatty acids found in forages, C18:2 n-6 and C18:3 n-3 have received particular attention due to their roles as precursors for the synthesis of conjugated linoleic acid, a class of health-enhancing compounds that is predominantly found in dairy products. The electrolyte background consisted of 12.0 mmol/L tetraborate buffer (pH 9.2) added to 12.0 mmol/L Brij 35®, 17% acetonitrile, and 33% methanol. Under the optimized conditions, the baseline separation of C18:2 n-6 and C18:3 n-3 was achieved within 4 min. The CZE-UV method was compared to GC with a flame ionization detector, which is the American Oil Chemists' Society (AOCS 996.06) official method for fatty acid analysis. The methods did not show any evidence of significant differences within 95% confidence interval (P>0.05). The CZE-UV method was successfully applied to the analysis of 80 genotypes of Brachiaria ruzizienses clones submitted to a genetic improvement program in agricultural research. PMID:26651572

  1. 33 CFR 183.590 - Fire test.

    Science.gov (United States)

    2010-07-01

    ... tested under the following conditions and procedures: (1) Fuel stop valves, “USCG Type A1” or USCG Type A2” hoses and hose clamps are tested in a fire chamber. (2) Fuel filters, strainers, and pumps are tested in a fire chamber or as installed on the engine in the boat. (3) Fuel tanks must be tested...

  2. 49 CFR 18.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Office of the Secretary of Transportation UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND COOPERATIVE.... Acquisition cost of an item of purchased equipment means the net invoice unit price of the property including...) school district, special district, intrastate district, council of governments (whether or...

  3. 29 CFR 1910.183 - Helicopters.

    Science.gov (United States)

    2010-07-01

    ... device before ground personnel touch the suspended load, unless protective rubber gloves are being worn by all ground personnel who may be required to touch the suspended load. (k) Weight limitation. The... cargo hooks shall have the electrical activating device so designed and installed as to...

  4. 28 CFR 18.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Justice Act means the Juvenile Justice and Delinquency Prevention Act of 1974, 42 U.S.C. 5601, et seq., as... Juvenile Justice and Delinquency Prevention (OJJDP), as appropriate. (i) Sub-grant applicant or recipient... provisions of part D of the Crime Control Act; part B, subpart I of the Juvenile Justice Act; and...

  5. 33 CFR 183.420 - Batteries.

    Science.gov (United States)

    2010-07-01

    .... (a) Each installed battery must not move more than one inch in any direction when a pulling force of 90 pounds or twice the battery weight, whichever is less, is applied through the center of gravity of the battery as follows: (1) Vertically for a duration of one minute. (2) Horizontally and parallel...

  6. 46 CFR 183.380 - Overcurrent protection.

    Science.gov (United States)

    2010-10-01

    ... fuses or circuit breakers rated at not more than 30 amperes. (h) Overcurrent devices capable of carrying... or circuit breaker, unless the ungrounded conductors are simultaneously disconnected. (c) A conductor... circuit must be protected by a circuit breaker that meets the requirements of § 58.25-55 in subchapter...

  7. Coho Abundance - Linear Features [ds183

    Data.gov (United States)

    California Department of Resources — The CalFish Abundance Database contains a comprehensive collection of anadromous fisheries abundance information. Beginning in 1998, the Pacific States Marine...

  8. 50 CFR 218.183 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... employing a scanning methodology in accordance with the Lookout Training Handbook (NAVEDTRA 12968-D). (v... testing requirement and general marine mammal mitigation measures. (iii) Test Directors shall make use of... operating level if any detected animals are within 500 yards (457 m) of the sonar source. Vessels...

  9. 33 CFR 183.425 - Conductors: General.

    Science.gov (United States)

    2010-07-01

    ... Conductors: General. (a) Each conductor must be insulated, stranded copper. (b) Except for intermittent... equipment; electronic circuits having a current flow of less than one ampere; conductors which are...

  10. QTL Information Table: 183 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Resistance or Tolerance Other soil stress tolerance tolerance to ferrous iron ... toxicity C)Interva ... r some traits associated with tolerance to ferrous iron ... toxicity in rice (Oryza sativa L.), using recombin ...

  11. 7 CFR 1.183 - Proceedings covered.

    Science.gov (United States)

    2010-01-01

    ....S.C. 1599) Horse Protection Act (15 U.S.C. 1823(c), 1825) Packers and Stockyards Act (7 U.S.C. 193....S.C. 156) Wheat and Wheat Foods Research and Nutrition Education Act (7 U.S.C. 3409) (b) The...

  12. Dicty_cDB: VHB183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QNPVAIADRSIKQDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiyli fiifllsfinnkinfq Translated Amino Acid sequence...QDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiyli fiifllsfinnkinfq Homology vs CSM-cDNA Score E Sequences pro

  13. 33 CFR 183.5 - Incorporation by reference.

    Science.gov (United States)

    2010-07-01

    ... Council, Inc., 3069 Solomons Island Road, Edgewater, Maryland 21037-1416: ABYC A-16 Electric Navigation... Service—Code 1052, 5801 Tabor Avenue, Philadelphia, PA 19120: MILSPEC-P-21929B Plastic Material,...

  14. 12 CFR 19.183 - Rights of witnesses.

    Science.gov (United States)

    2010-01-01

    ... witness. (d) Any person who is compelled to give testimony is entitled to inspect any transcript that has... to furnish testimony, documentary evidence, or other information with respect to any matter under... before, during and after the conclusion of testimony; (2) Question the person briefly at the...

  15. 16 CFR 18.3 - Substitution of products.

    Science.gov (United States)

    2010-01-01

    ... to be construed as sanctioning the dissemination of an advertisement of an industry product or... substitution involved relates but to a product or products the total price of which is comparatively small, and... solicitation the industry member has a supply of such product or products sufficient to meet normal...

  16. 46 CFR 183.350 - Batteries-general.

    Science.gov (United States)

    2010-10-01

    ... dissipate the gases generated. (b) Each battery must be located as high above the bilge as practicable... made to battery terminals with permanent type connectors. Spring clips or other temporary type clamps... is resistant to damage by the electrolyte. (f) Battery chargers must have an ammeter connected in...

  17. Dicty_cDB: VHF183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available al sequences cloning vector DNA pDXD-3C. 86 1e-12 1 X85120 |X85120.1 Artificial...AB120175 |AB120175.1 Dictyostelium discoideum DD7-1 mRNA for hypothetical protein, complete cds. 78 1e-33 6 X85121 |X85121.1 Artifici

  18. State Waste Discharge Permit application, 183-N Backwash Discharge Pond

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    As part of the Hanford Federal Facility Agreement and Consent Order negotiations (Ecology et al. 1994), the US Department of Energy, Richland Operations Office, the US Environmental Protection Agency, and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground on the Hanford Site which affect groundwater or have the potential to affect groundwater would be subject to permitting under the structure of Chapter 173--216 (or 173--218 where applicable) of the Washington Administrative Code, the State Waste Discharge Permit Program. As a result of this decision, the Washington State Department of Ecology and the US Department of Energy, Richland Operations Office entered into Consent Order No. DE91NM-177, (Ecology and DOE-RL 1991). The Consent Order No. DE91NM-177 requires a series of permitting activities for liquid effluent discharges. Liquid effluents on the Hanford Site have been classified as Phase I, Phase II, and Miscellaneous Streams. The Consent Order No. DE91NM-177 establishes milestones for State Waste Discharge Permit application submittals for all Phase I and Phase II streams, as well as the following 11 Miscellaneous Streams as identified in Table 4 of the Consent Order No. DE91NM-177.

  19. Dicty_cDB: VFG183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ***ic*y*tif*kyn*knnfss*invn**ydwllfimvricsihqsr kqrcftrn*rnlvkslqnngw*fkin*cklpslydlikkk--- ---fs*fnycgtscsl...v*ftcil*rikkiikrkwfinhlvlwfnenyk***cssss*ktl l*nnrrpilgtrekiy***ic*y*tif*kyn*knnfss*invn**ydwllfimvricsih qsrkqrcftr

  20. 46 CFR 183.360 - Semiconductor rectifier systems.

    Science.gov (United States)

    2010-10-01

    ...) Meet Sections 35.84.2 and 35.84.4 of the ABS Steel Vessel Rules (incorporated by reference; see 46 CFR... systems. (a) Each semiconductor rectifier system must have an adequate heat removal system that prevents overheating. (b) Where a semiconductor rectifier system is used in a propulsion system or in other...

  1. 33 CFR 183.25 - Display of markings.

    Science.gov (United States)

    2010-07-01

    ... XX Persons or XXX Pounds XXX Pounds, persons, motor, gear XXX Horsepower, motor or U.S. Coast Guard Maximum Capacities XX Persons or XXX Pounds XXX Pounds, persons, motor, gear XXX Horsepower, motor with remote steering XXX Horsepower, motor without remote steering (2) For inboard boats and...

  2. Dicty_cDB: SHD183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Rasgsc6510 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequenc...e. 54 1e-04 2 CK807987 |CK807987.1 Rasgsc0236 Salivary Gland 4th instar 3rd period (spinning...Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 54 2e-04... 2 CK808261 |CK808261.1 Rasgsc0738 Salivary Gland 4th instar 3rd period (spinning...and 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 54 2e-04 2 AR550596

  3. Dicty_cDB: SHB183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hfhsrrydscngvtkshsiyds*sqetl*sr*ewsitlgrsy*sles*t nflwfcwylyfimerrfrfnr*ts*s*kd*ss*vshveleerfrketssl*sfpsn*i...vpkgnefsiigiwhnkwrski *yig*s*y*fsrdgrenastqgiprattattttatttkakr*rvvitkeetiinaik*ke tcr--- ---tnrckrsn...nnsnnnkskkikschhkrrnhhqcn*vkrn ms--- ---qsl*kiqsfsfssv*fl*wcyqesfni*fleprdlmkpvrv...vhhfg*kllifgelnk lslvllvlifhhgekvplqslnflklerlvvis*pcgigreis*rnq*fvkfsvklnwsm kmimlknqvvnirlnnlsvlqtknliplki...nts: (bits) Value N AF163835 |AF163835.1 Dictyostelium discoideum cellulose synthase (dcsA) mRNA, complet

  4. Dicty_cDB: VSJ183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sqkink i*ki*ktrii*riliriififififiirvflirirvfiii*r*kkekekeilfnfikeif lkekksril...SDSVSSSTTTTIITNNKKINNNNNNKSKDIG*fkly*i*k*kictkk*krkrisqkink i*ki*ktrii*riliriififififiirvflirirvfiii*r*kkekekeilfnfikeif lkekksril...kiyfrkksk*rk*iifirkcntnrgfisncikfik*is ksfk*in*srisinre**xq*ynkwrlir*slnsne**stksikrffkytsn*rw*...enlf*kekqmkkidyfyqemqhqqriyfklyqih*infk ii*mnqliqn*h*qriiixiiqqmathpmkp*fq*vminqih*kilqihfkltmvmfqkd ilivfhl...lasmic 32.0 %: nuclear 12.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: peroxisom

  5. Dicty_cDB: VSF183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gth of database: 80,480,566 effective HSP length: 16 effective length of query: 53 effective... length of database: 78,918,790 effective search space: 4182695870 effective search space used: 4...0: 0 length of query: 69 length of database: P,810,167,932 effective HSP length: 21 effective... length of query: 48 effective length of database: P,277,002,040 effective search space: 1549296097920 effective

  6. Dicty_cDB: VFK183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KVFXXINXVSFSXVXN*xmvxlxsdyniqkesxlhlvlrlxggmqxf vktltgktitlevegsdnienvktkiqdkegippdqqrlifagkqledgrtlsdyniqke... stlhlvlrlrggmqifvktltgktitlevegsdnienvkakiqdkegippdqqrlifagk qledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle... C: ihfyytnikfifyffiycnis*kkkkkkkxkkxxfxkkk--- ---ENVKXXFKIXKVFXXINXVSFSXVXN*xmvxlxsdyniqkesxlhlvlrlxggmqxf vktltgktitle...vegsdnienvktkiqdkegippdqqrlifagkqledgrtlsdyniqke stlhlvlrlrggmqifvktltgktitlevegsdnienvkakiqdkeg...ippdqqrlifagk qledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqd kegip

  7. FCJ-183 iHootenanny: A Folk Archeology of Social Media

    Directory of Open Access Journals (Sweden)

    Henry Adam Svec

    2016-02-01

    Full Text Available This paper excavates two models of communication that can be found littered across the intertwining histories of folk revivalism and digital culture in the United States. First I examine the Hootenanny, initially a form of rent party made popular in New York City in the 1940s by the group the Almanac Singers, which constituted a complex site of convergence of a range interests, styles, media, and performance genres. Second, I explore how the utopian vision of a community joined in song has been taken up recently by ‘social music’ iPhone apps made by the developer Smule. I will ultimately consider how the mediation idealised by the Almanacs has trickled down to a narcissistic will-to-be-‘in touch’ in mainstream digital culture, making the Hootenanny a virtual path untaken in the history of mobile communication.

  8. 26 CFR 1.183-1 - Activities not engaged in for profit.

    Science.gov (United States)

    2010-04-01

    ... B continued to keep a few Charolais bulls at stud. In 1972, B started to raise Tennessee Walking... there were no stud fees received in 1972 with respect to Charolais bulls, but for 1973 stud fees...

  9. 41 CFR 301-10.183 - What class of ship accommodations must I use?

    Science.gov (United States)

    2010-07-01

    ... Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES ALLOWABLE TRAVEL EXPENSES 10-TRANSPORTATION EXPENSES... duration of the special accommodation; and (iii) A recommendation as to the suitable class of... internal procedures pursuant to § 301-70.102(i). Transit Systems...

  10. 27 CFR 555.183 - Importation of plastic explosives on or after April 24, 1997.

    Science.gov (United States)

    2010-04-01

    ... under the penalties of perjury: (a) “I declare under the penalties of perjury that the plastic explosive to be imported contains a detection agent as required by 27 CFR 555.180(b)”; or (b) “I declare under the penalties of perjury that the plastic explosive to be imported is a “small amount” to be used...

  11. Study of ZZ Production at LEP at √s=183 - 209 GeV

    Science.gov (United States)

    Pásztor, Gabriella

    A study of Z boson pair production in e+e- annihilation using the OPAL detector at LEP is reported . The ZZ production cross-section is measured, limits on anomalous ZZγ and ZZZ couplings are derived, and constraints on models of low scale quantum gravity in extra spatial dimensions are set.

  12. Study of ZZ production at LEP at $\\sqrt{s}$ = 183-209 GeV

    CERN Document Server

    Pásztor, G

    2001-01-01

    A study of Z boson pair production in e+e- annihilation using the OPAL detector at LEP is reported. The ZZ production cross-section is measured, limits on anomalous ZZgamma and ZZZ couplings are derived, and constraints on models of low scale quantum gravity in extra spatial dimensions are set.

  13. MELCOR 1.8.3 assessment: GE large vessel blowdown and level swell experiments

    International Nuclear Information System (INIS)

    MELCOR is a fully integrated, engineering-level computer code, being developed at Sandia National Laboratories for the USNRC, that models the entire spectrum of severe accident phenomena in a unified framework for both BWRs and PWRS. As part of an ongoing assessment program, the MELCOR computer code has been used to analyze a series of blowdown tests performed in the early 1980s at General Electric. The GE large vessel blowdown and level swell experiments are a set of primary system thermal/hydraulic separate effects tests studying the level swell phenomenon for BWR transients and LOCAS; analysis of these GE tests is intended to validate the new implicit bubble separation algorithm added since the release of MELCOR 1.8.2. Basecase MELCOR results are compared to test data, and a number of sensitivity studies on input modelling parameters and options have been done. MELCOR results for these experiments also are compared to MAAP and TRAC-B qualification analyses for the same tests. Time-step and machine-dependency calculations were done to identify whether any numeric effects exist in our GE large vessel blowdown and level swell assessment analyses

  14. Tank 241-S-106, cores 183, 184 and 187 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1997-06-30

    This document is the final laboratory report for tank 241-S-106 push mode core segments collected between February 12, 1997 and March 21, 1997. The segments were subsampled and analyzed in accordance with the Tank Push Mode Core Sampling and Analysis Plan (TSAP), the Tank Safety Screening Data Quality Objective (Safety DQO), the Historical Model Evaluation Data Requirements (Historical DQO) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO). The analytical results are included in Table 1. Six of the twenty-four subsamples submitted for the differential scanning calorimetry (DSC) analysis exceeded the notification limit of 480 Joules/g stated in the DQO. Appropriate notifications were made. Total Organic Carbon (TOC) analyses were performed on all samples that produced exotherms during the DSC analysis. All results were less than the notification limit of three weight percent TOC. No cyanide analysis was performed, per agreement with the Tank Safety Program. None of the samples submitted for Total Alpha Activity exceeded notification limits as stated in the TSAP. Statistical evaluation of results by calculating the 95% upper confidence limit is not performed by the 222-S Laboratory and is not considered in this report. No core composites were created because there was insufficient solid material from any of the three core sampling events to generate a composite that would be representative of the tank contents.

  15. 33 CFR 183.516 - Cellular plastic used to encase fuel tanks.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Cellular plastic used to encase....516 Cellular plastic used to encase fuel tanks. (a) Cellular plastic used to encase metallic fuel...-polyurethane cellular plastic used to encase metallic fuel tanks must have a compressive strength of at...

  16. 78 FR 60248 - Foreign-Trade Zone (FTZ) 183-Austin, Texas; Notification of Proposed Production Activity...

    Science.gov (United States)

    2013-10-01

    ... sinks; upper ring housing gaskets; WiFi flex holder finishes; connector brackets; frames; holders...; connectors; printed circuit board assemblies; WiFi interposers; and, cables (duty rate ranges from duty-...

  17. Interim status of closure/post-closure plan for 183-H solar evaporation basins

    International Nuclear Information System (INIS)

    This report describes a plan for decommissioning several solar evaporation basins on the Hanford reservation. The document describes procedures for sampling during decommissioning and a plan for certification of the resulting completed landfill. Additional plans deal with the training, security of the site, and post-closure monitoring

  18. Computer-controlled color display for the energy dispersive X-ray spectrometer EDR 183

    International Nuclear Information System (INIS)

    A new micro-computer controlled graphic display developed for applications in nuclear spectrometers is described. Central part of the device is the MPS4944 microcomputer supplied by direct memory access module boards for data input and output. Ordinate resolution of screen is 512 dots. The maximum number of channels simultaneously displayed is 512 too

  19. 26 CFR 1.183-2 - Activity not engaged in for profit defined.

    Science.gov (United States)

    2010-04-01

    ... geologically to be proven oil bearing land. However, on the rare occasions that these activities do result in... encompasses appreciation in the value of assets, such as land, used in the activity. Thus, the taxpayer may... land used in the activity is realized since income from the activity together with the appreciation...

  20. Tank 241-S-106, cores 183, 184 and 187 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final laboratory report for tank 241-S-106 push mode core segments collected between February 12, 1997 and March 21, 1997. The segments were subsampled and analyzed in accordance with the Tank Push Mode Core Sampling and Analysis Plan (TSAP), the Tank Safety Screening Data Quality Objective (Safety DQO), the Historical Model Evaluation Data Requirements (Historical DQO) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO). The analytical results are included in Table 1. Six of the twenty-four subsamples submitted for the differential scanning calorimetry (DSC) analysis exceeded the notification limit of 480 Joules/g stated in the DQO. Appropriate notifications were made. Total Organic Carbon (TOC) analyses were performed on all samples that produced exotherms during the DSC analysis. All results were less than the notification limit of three weight percent TOC. No cyanide analysis was performed, per agreement with the Tank Safety Program. None of the samples submitted for Total Alpha Activity exceeded notification limits as stated in the TSAP. Statistical evaluation of results by calculating the 95% upper confidence limit is not performed by the 222-S Laboratory and is not considered in this report. No core composites were created because there was insufficient solid material from any of the three core sampling events to generate a composite that would be representative of the tank contents

  1. National Ignition Facility subsystem design requirements target diagnostics subsystem SSDR 1.8.3

    International Nuclear Information System (INIS)

    This SSDR establishes the performance, design, development and test requirements for the Target Experimental System's Diagnostic, WBS 1.8. 3. This includes the individual diagnostic components, the Target Diagnostic Data Acquisition System (Target DAS), the diagnostic vacuum system, the timing/fiducial system, and the EMI protection system

  2. A morte no pensamento de Lúcio Aneu Sêneca - DOI: 10.4025/actascihumansoc.v28i1.183 Death in the works of Lucius Annaeus Seneca - DOI: 10.4025/actascihumansoc.v28i1.183

    Directory of Open Access Journals (Sweden)

    José Joaquim Pereira Melo

    2006-06-01

    Full Text Available O presente trabalho tem como preocupação fazer algumas reflexões sobre o pensamento de Lúcio Aneu Sêneca, político e pensador do s éculo I da era cristã, no que se refere à morte, natural ou provocada por suicídio, que é apresentada pelo pensador latino como parte integrante do conteúdo para a formação do homem ideal, o sábio. Sêneca entende que a morte é um dos deveres da existência, cabendo ao homem ideal, o sábio, ser formado no sentido de tomar consciência dessa condição e, por extensão, romper com o medo por ela despertado, o que se expressa em recorrer ao suicídio quando isto se fizer necessário para preservar a dignidade da pess oa humana. Assim, cabe à filosofia afastar do homem o medo e angústia diante da morte.Reflections on death, in its natural form or through suicide, in the works of Lucius Annaeus Seneca, a philosopher of the 1st century A.D., are provided. The Roman philosopher reflects on death as part and parcel to the formation of the ideal wise man. Since Seneca considers death as one of the duties of being, the ideal wise man must be aware of such a condition and should distance himself from the fear that its thought awakes in him. Such conscious awareness leads to suicide if it is necessary so that the dignity of the human being be preserved. Philosophy makes the human being distance himself from the fear and the anguish provoked by death.

  3. Epidemiologic features of 183 children with fall-from-height injury%183例儿童坠落伤患者流行病学特点分析

    Institute of Scientific and Technical Information of China (English)

    金朋; 朱烈烈; 孟伟阳; 潘达; 闻浩; 林露阳; 陈大庆

    2014-01-01

    目的 分析儿童坠落伤患者的流行病学特点,为预防及科学救治提供依据. 方法 采用填写调查表的方式收集温州医科大学附属第二医院2011年1月-2012年12月收治的儿童坠落伤患者,分析流行病学特点及相关因素之间的关系. 结果 儿童坠落伤常发生于天气转暖的季节,即每年的4,5月份,且较集中于每天中午和傍晚家长疏于防范的时间.坠落最常发生的地点是楼梯和阳台.头部是最容易受伤的部位.坠落高度是影响伤情的最主要因素. 结论 加强重点区域防护改造、加大坠落伤发生高峰时间段的监管力度,可在一定程度上减少儿童坠落伤的发生.%Objective To detect the epidemiologic features of pediatric patients with fall from height injury in an effort to provide a reference for prevention and scientific treatment.Methods Data of pediatric patients with fall from height injury treated from January 2011 to December 2012 were collected in the form of questionnaires.Epidemiologic features and relationship of associated factors were measured.Results Pediatric fall injury occurred very often in warmer season,namely on April and May,and in a day,it was more likely to happen when parents slacked at noon and night.Stairs and balconies were the most common sites of falls and head was most vulnerable to the injury.Falling height was the primary factor to the severity of injury.Conclusion To strengthen the protection reform in key areas,the supervision in peak time for falls and the care to children of the migrant workers can reduce fall injury in a certain extent.

  4. Guglielmo di Poitiers, “Ab la dolchor del temps novel” (BdT 183.1

    Directory of Open Access Journals (Sweden)

    Francesca Gambino

    2010-11-01

    Full Text Available This paper will put forward some possible new interpretations for selected passages in “Ab la douzor del temps novel” by William of Aquitaine. The term ‘vers’, for example, has always been paraphrased in different ways, but its primary meaning might be that provided by the naturalistic context: in the spring birds twitter among the branches, they produce a ‘verse’. Thus the literal meaning of ‘vers’ could be that of ‘a characteristic sound produced by the vocal organs of a particular animal (mainly a bird’. As for l. 15, instead of the traditional image of the hawthorn branch ‘tremblan’ (‘trembling’ on the tree, the alternative reading entrenan (the branch ‘stands firmly on the tree’, ‘resists the elements’ is preferred, which could well be a lectio difficilior. The paper will end by providing a commentary to the text. The edition used is Eusebi, with some corrections.

  5. 25 CFR 183.5 - What documents must the Tribe submit to request money from the Trust Fund?

    Science.gov (United States)

    2010-04-01

    ... how the tribe will spend the money, including what amounts should come from principal and what amounts... 25 Indians 1 2010-04-01 2010-04-01 false What documents must the Tribe submit to request money... the Tribe submit to request money from the Trust Fund? To request a distribution of principal...

  6. 27 CFR 17.183 - Disposition of recovered alcohol and material from which alcohol can be recovered.

    Science.gov (United States)

    2010-04-01

    ... prevent recovery of residual alcohol. Material from which alcohol can be recovered may also be destroyed..., under this section, of any substance proposed to be added to prevent recovery of alcohol, or of any... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Disposition of...

  7. SU-E-T-183: Feasibility of Extreme Dose Escalation for Glioblastoma Multiforme Using 4π Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, D; Rwigema, J; Yu, V; Kaprealian, T; Kupelian, P; Selch, M; Low, D; Sheng, K [Department of Radiation Oncology, UCLA, Los Angeles, CA (United States)

    2014-06-01

    Purpose: GBM recurrence primarily occurs inside or near the high-dose radiation field of original tumor site requiring greater than 100 Gy to significantly improve local control. We utilize 4π non-coplanar radiotherapy to test the feasibility of planning target volume (PTV) margin expansions or extreme dose escalations without incurring additional radiation toxicities. Methods: 11 GBM patients treated with VMAT to a prescription dose of 59.4 Gy or 60 Gy were replanned with 4π. Original VMAT plans were created with 2 to 4 coplanar or non-coplanar arcs using 3 mm hi-res MLC. The 4π optimization, using 5 mm MLC, selected and inverse optimized 30 beams from a candidate pool of 1162 beams evenly distributed through 4π steradians. 4π plans were first compared to clinical plans using the same prescription dose. Two more studies were then performed to respectively escalate the GTV and PTV doses to 100 Gy, followed by a fourth plan expanding the PTV by 5 mm and maintaining the prescription dose. Results: The standard 4π plan significantly reduced (p<0.01) max and mean doses to critical structures by a range of 47.0–98.4% and 61.0–99.2%, respectively. The high dose PTV/high dose GTV/expanded PTV studies showed a reduction (p<0.05) or unchanged* (p>0.05) maximum dose of 72.1%/86.7%/77.1% (chiasm), 7.2%*/27.7%*/30.7% (brainstem), 39.8%*/84.2%/51.9%* (spinal cord), 69.0%/87.0%/66.9% (L eye), 76.2%/88.1%/84.1% (R eye), 95.0%/98.6%/97.5% (L lens), 93.9%/98.8%/97.6% (R lens), 74.3%/88.5%/72.4% (L optical nerve), 80.4%/91.3%/75.7% (R optical nerve), 64.8%/84.2%/44.9%* (L cochlea), and 85.2%/93.0%/78.0% (R cochlea), respectively. V30 and V36 for both brain and (brain - PTV) were reduced for all cases except the high dose PTV plan. PTV dose coverage increased for all 4π plans. Conclusion: Extreme dose escalation or further margin expansion is achievable using 4π, maintaining or reducing OAR doses. This study indicates that clinical trials employing 4π delivery using prescription doses up to 100 Gy are feasible. Funding support partially contributed by Varian.

  8. Identification and Protection of a Bat Colony in the 183-F Clearwell: Mitigation of Bat Habitat on the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    K. A. Gano, J. G. Lucas, C. T. Lindsey

    2009-01-06

    An ecological investigation was conducted to evaluate mitigation options for demolition of a retired facility that contained a maternity roost of approximately 2,000 Myotis yumanensis bats. The recommendation from the study was to leave the non-contaminated structure intact and fence the area.

  9. A human fecal contamination index for ranking impaired recreational watersusing the HF183 quantitative real-time PCR method

    Science.gov (United States)

    Human fecal pollution of surface water remains a public health concern worldwide. As a result, there is a growing interest in the application of human-associated fecal source identification quantitative real-time PCR (qPCR) technologies for recreational water quality risk managem...

  10. W pair production cross-section and W branching fractions in $e^+ e^-$ interactions at 183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schneider, H; Schwemling, P; Schwering, B; Schwickerath, U; Schyns, M A E; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Shellard, R C; Sheridan, A; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Sokolov, A; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stanic, S; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Chikilev, O G; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Vulpen, I B; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Vollmer, C F; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G

    1999-01-01

    The cross-section for the process $e^+e^-\\rightarrow W^+W^-$ has been measured with the data sample collected by DELPHI at an average centre-of-mass energy of 182.65 GeV and corresponding to an integrated luminosity of 53 pb$^{-1}$. Based on the 770 events selected as $WW$ candidates, the cross-section for the doubly resonant process $ \\sigma (e^+e^-\\rightarrow W^+W^-) = 15.86~{\\pm 0.69}~\\mbox{(stat)} ~\\pm 0.26~\\mbox{(syst)~pb} $ has been measured and found to be in good agreement with the Standard Model expectation. The branching fractions of the $W$ decay were also measured. From these a value of the CKM mixing matrix element $ |V_{cs}| = 0.985 \\pm 0.073~\\mbox{(stat)} \\pm 0.025 ~\\mbox{(syst)}$ was derived. Our previously published $WW$ cross-section measurements and the derived measurement of $m_W$ have been revised and updated with the present cross-section measurement to yield $ m_W = 80.49 \\pm 0.43 \\mbox{(stat)} \\pm 0.09 (\\mathrm{syst}) \\pm 0.03 (\\mathrm{LEP})~{\\mathrm GeV}/{\\it c}^2$.

  11. Measurement of the ZZ cross-section in $e^+ e^-$ interactions at 183-189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Croix, J; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Haug, S; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Montenegro, J; Moraes, D; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Mundim, L M; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinertsen, P L; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwanda, C; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M

    2001-01-01

    Measurements of on-shell $ZZ$ production are described, using data collected by DELPHI in 1997 and 1998, at centre-of-mass energies $\\sqrt s$ = 182.6 GeV and 188.6 GeV respectively. Results obtained in each of the final states $q \\bar{q} q \\bar{q}$, $\\mu^+ \\mu^- q \\bar{q}$, $e^+e^- q \\bar{q}$, $\

  12. Single Intermediate Vector Boson Production in $e^+ e^-$ collisions at $\\sqrt{s}$ = 183 and 189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Bellunato, T F; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bilenky, S M; Bloch, D; Blom, H M; Bol, L; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Croix, J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Haug, S; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hertz, O; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, M; Kriznic, E; Krumshtein, Z; Kubinec, P; Kucharczyk, M; Kurowska, J; Lamsa, J; Laugier, J P; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, M R; Montenegro, J; Moraes, D; Morettini, P; Morton, G; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Nicolaidou, R; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Perepelitsa, V F; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salmi, L; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwanda, C; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M; Krammer, Manfred

    2001-01-01

    The cross-sections for the production of single charged and neutral intermediate vector bosons were measured using integrated luminosities of 52~pb$^{-1}$ and 154~pb$^{-1}$ collected by the DELPHI experiment at centre-of-mass energies of 182.6~GeV and 188.6~GeV, respectively. The cross-sections for the reactions were determined in limited kinematic regions. The results found are in agreement with the Standard Model predictions for these channels.

  13. Radioactive air emissions notice of construction for the decontamination and closure of the 183-H Solar Evaporation Basins

    International Nuclear Information System (INIS)

    A Notice of Construction (NOC) is required by the Washington State Department of Health (DOH), pursuant to Washington Administrative Code (WAC) Chapter 246-247-060, for any proposed construction or modification of an existing registered or unregistered emissions unit. The following document is the NOC application to be submitted to the DOH for the establishment of a new environmental analytical laboratory at the 100-N Area on the Hanford Site. The environmental analytical laboratory will contain a radioactive air emissions unit

  14. The 1984 Literacy Campaign in the People's Democratic Republic of Yemen. A Case Study. Notes, Comments...No. 183.

    Science.gov (United States)

    Fara, Mohammed Saeed; Fisher, Nigel

    In 1984, the People's Democratic Republic of Yemen undertook a nationwide literacy campaign, which mobilized the entire nation in an effort to reach an estimated 194,000 illiterate people, 77 percent of them women. The campaign plan demanded the full and active participation of formal school teachers and students at secondary level and above as…

  15. Photosystem II Repair and Plant Immunity: Lessons Learned from Arabidopsis Mutant Lacking the THYLAKOID LUMEN PROTEIN 18.3

    OpenAIRE

    Järvi, Sari; Isojärvi, Janne; Kangasjärvi, Säijaliisa; Salojärvi, Jarkko; Mamedov, Fikret; Suorsa, Marjaana; Aro, Eva-Mari

    2016-01-01

    Chloroplasts play an important role in the cellular sensing of abiotic and biotic stress. Signals originating from photosynthetic light reactions, in the form of redox and pH changes, accumulation of reactive oxygen and electrophile species or stromal metabolites are of key importance in chloroplast retrograde signaling. These signals initiate plant acclimation responses to both abiotic and biotic stresses. To reveal the molecular responses activated by rapid fluctuations in growth light inte...

  16. Search for Higgs bosons and new particles decaying into two photons at $\\sqrt{s}$ = 183 GeV

    CERN Document Server

    Ackerstaff, K; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Doucet, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanfani, A; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fischer, H M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Geich-Gimbel, C; Geralis, T; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Joly, A; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lefebvre, E; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Poli, B; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Tafirout, R; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Vikas, P; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1998-01-01

    A search for the resonant production of high mass photon pairs associated with a leptonic or hadronic system has been performed using a data sample of 57.7 pb-1 collected at an average center-of-mass energy of 182.6 GeV with the OPAL detector at LEP. No evidence for contributions from non-Standard Model physics processes was observed. The observed candidates are used to place limits on BR (H to gamma gamma) assuming a Standard Model production rate for Higgs boson masses up to 92 GeV, and on the production cross section for a scalar resonance decaying into di-photons up to a mass of 170 GeV. Upper limits on the product of cross section and branching ratios, sigma(e+e- to XY) * BR(X to gamma gamma) * BR(Y to f fbar) as low as 70fb are obtained over the M(X) range 10 - 170 GeV for the case where 10 90 GeV, independent of the nature of Y provided it decays to a fermion pair and has negligible width. Higgs scalars which couple only to gauge bosons at Standard Model strength are ruled out up to a mass of 90.0 GeV...

  17. Colour reconnection studies in $e^{+}e^{-} \\to W^{+}W^{-}$ at $\\sqrt{s}$=183 GeV

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; de Roeck, A; Dervan, P J; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Graham, K; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Harel, A; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hobson, P R; Hoch, M; Höcker, Andreas; Hoffman, K; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Spagnolo, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomas, J; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Ueda, I; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    The predicted effects of final state interactions such as colour reconnection are investigated by measuring properties of hadronic decays of W bosons, recorded at a centre-of-mass energy of sqrt(s)=182.7 GeV in the OPAL detector at LEP. Dependence on the modelling of hadronic W decays is avoided by comparing W+W- -> qqqq events with the non-leptonic component of W+W- -> qqlnu events. The scaled momentum distribution, its mean value, x_p, and that of the charged particle multiplicity, n_ch, are measured and found to be consistent in the two channels. The measured differences are: Diff(x_p) = +0.7 +- 0.8 +- 0.6 and Diff(n_ch) = (-0.09 +- 0.09 +-0.05)*10**-2. In addition, measurements of rapidity and thrust are performed for W+W- -> qqqq events. The data are described well by standard QCD models and disfavour one model of colour reconnection within the ARIADNE program. The current implementation of the ELLIS-GEIGER model of colour reconnection is excluded. At the current level of statistical precision no evidenc...

  18. SU-E-J-183: Quantifying the Image Quality and Dose Reduction of Respiratory Triggered 4D Cone-Beam Computed Tomography with Patient- Measured Breathing

    International Nuclear Information System (INIS)

    Purpose: Respiratory triggered four dimensional cone-beam computed tomography (RT 4D CBCT) is a novel technique that uses a patient's respiratory signal to drive the image acquisition with the goal of imaging dose reduction without degrading image quality. This work investigates image quality and dose using patient-measured respiratory signals for RT 4D CBCT simulations instead of synthetic sinusoidal signals used in previous work. Methods: Studies were performed that simulate a 4D CBCT image acquisition using both the novel RT 4D CBCT technique and a conventional 4D CBCT technique from a database of oversampled Rando phantom CBCT projections. A database containing 111 free breathing lung cancer patient respiratory signal files was used to create 111 RT 4D CBCT and 111 conventional 4D CBCT image datasets from realistic simulations of a 4D RT CBCT system. Each of these image datasets were compared to a ground truth dataset from which a root mean square error (RMSE) metric was calculated to quantify the degradation of image quality. The number of projections used in each simulation is counted and was assumed as a surrogate for imaging dose. Results: Based on 111 breathing traces, when comparing RT 4D CBCT with conventional 4D CBCT the average image quality was reduced by 7.6%. However, the average imaging dose reduction was 53% based on needing fewer projections (617 on average) than conventional 4D CBCT (1320 projections). Conclusion: The simulation studies using a wide range of patient breathing traces have demonstrated that the RT 4D CBCT method can potentially offer a substantial saving of imaging dose of 53% on average compared to conventional 4D CBCT in simulation studies with a minimal impact on image quality. A patent application (PCT/US2012/048693) has been filed which is related to this work

  19. Multiresidue Method for Determination of 183 Pesticide Residues in Leeks by Rapid Multiplug Filtration Cleanup and Gas Chromatography-Tandem Mass Spectrometry.

    Science.gov (United States)

    Zou, Nan; Han, Yongtao; Li, Yanjie; Qin, Yuhong; Gu, Kejia; Zhang, Jingru; Pan, Canping; Li, Xuesheng

    2016-08-10

    This study reports the development of a novel multiplug filtration cleanup (m-PFC) procedure for analysis of pesticide residues in leek samples followed by gas chromatography-tandem mass spectrometry detection. The leek samples were initially purified following the dispersive solid-phase extraction with different sorbents to determine the most suitable proportioning of sorbent materials; then, the m-PFC method was carried out by applying the streamlined procedure with syringes. Average recoveries of most pesticides were in the range from 70.2 to 126.0% with the relative standard deviation market samples. In that analysis, 35 pesticides were detected in 29 samples, with values ranging from 2.0 to 9353.1 μg kg(-1). PMID:26651870

  20. CRED Subsurface Temperature Recorder (STR); NWHI, FFS; Long: -166.17377, Lat: 23.64515 (WGS84); Sensor Depth: 1.83m; Data Range: 20080915-20100910.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series...

  1. {mu}SR measurements on the vortex lattice of La{sub 1.83}Sr{sub 0.17}CuO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Drew, A.J. [School of Physics and Astronomy, University of St. Andrews, Fife, KY16 9SS (United Kingdom)]. E-mail: ajd10@st-and.ac.uk; Heron, D.O.G. [School of Physics and Astronomy, University of St. Andrews, Fife, KY16 9SS (United Kingdom); Divakar, U.K. [School of Physics and Astronomy, University of St. Andrews, Fife, KY16 9SS (United Kingdom); Lee, S.L. [School of Physics and Astronomy, University of St. Andrews, Fife, KY16 9SS (United Kingdom); Gilardi, R. [Laboratory for Neutron Scattering, ETH Zurich and PSI Villigen, CH-5232, Villigen, PSI (Switzerland); Mesot, J. [Laboratory for Neutron Scattering, ETH Zurich and PSI Villigen, CH-5232, Villigen, PSI (Switzerland); Ogrin, F.Y. [School of Physics, University of Exeter, Exeter, EX4 4QL (United Kingdom); Charalambous, D. [Department of Physics, Lancaster University, Lancaster, LA1 4YB (United Kingdom); Momono, N. [Department of Physics, Hokkaido University, Sapporo 060-0810 (Japan); Oda, M. [Department of Physics, Hokkaido University, Sapporo 060-0810 (Japan); Baines, C. [Laboratory for Muon Spin Spectroscopy, PSI Villigen, CH-5232, Villigen, PSI (Switzerland)

    2006-03-31

    We report {mu}SR measurements of the vortex lattice in the slightly overdoped compound La{sub 2-x}Sr{sub x}CuO{sub 4}(x=0.17). The magnetic phase diagram provides an interesting comparison to the more exotic phases observed in the underdoped (x=0.10) compound. The field induced hexagonal to intrinsic square transition is observed to occur at around 0.4T in agreement with previous neutron measurements.

  2. Communications of the Lunar and Planetary Laboratory: Communications nos. 173-183, volume 9, part 5. [planetary astronomy and physics of Jupiter and Saturn

    Science.gov (United States)

    Kuiper, G. P. (Editor)

    1973-01-01

    Short discussions are presented on: (1) multicolor photography of Jupiter; (2) narrow band photography of Jupiter and Saturn; (3) photographic observations of the occulation of Beta Scorpii by Jupiter; (4) development of the June 1971 South Equatorial Belt Disturbance on Jupiter; (5) rotation period for subsurface source in the NNTeB of Jupiter; (6) correlation between color of Jovian clouds and their 5 micron temperatures; (7) and observations of Jupiter's North North Temperature Belt Current B.

  3. Measurement of W-pair cross sections in $e^{+}e^{-}$ interactions at $\\sqrt{s}$ = 183 GeV and W-decay branching fractions

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Easo, S; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1998-01-01

    We report on the measurement of W-boson pair-production with the L3 detector at LEP. In a data sample corresponding to a total luminosity of 55.47~pb$^{-1}$ collected at an average centre-of-mass energy of $182.68~\\GeV$, we select 824 four-fermion events with pairs of hadronic jets or pairs of leptons with high invariant masses. Branching fractions of W decays into different fermion-antifermion pairs are determined. Assuming charged-current lepton universality, the branching fraction for hadronic W decays is measured to be: $ B(\\mathrm{W\\rightarrow hadrons}) = 70.1 \\pm 1.3~(stat.) \\pm 0.4~(syst.)~\\%$. Combining all final states the total cross section for W-pair production is measured to be: $\\SWW = 16.53 \\pm 0.67~(stat.) \\pm 0.26~(syst.)$~pb.

  4. 26 CFR 1.42-4 - Application of not-for-profit rules of section 183 to low-income housing credit activities.

    Science.gov (United States)

    2010-04-01

    ... is allowable may be limited or disallowed under other provisions of the Code or principles of tax law... SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Credits Against Tax § 1.42-4 Application...

  5. SU-E-J-183: Quantifying the Image Quality and Dose Reduction of Respiratory Triggered 4D Cone-Beam Computed Tomography with Patient- Measured Breathing

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, B; OBrien, R; Kipritidis, J; Keall, P [The University of Sydney, Sydney, New South Wales (Australia)

    2014-06-01

    Purpose: Respiratory triggered four dimensional cone-beam computed tomography (RT 4D CBCT) is a novel technique that uses a patient's respiratory signal to drive the image acquisition with the goal of imaging dose reduction without degrading image quality. This work investigates image quality and dose using patient-measured respiratory signals for RT 4D CBCT simulations instead of synthetic sinusoidal signals used in previous work. Methods: Studies were performed that simulate a 4D CBCT image acquisition using both the novel RT 4D CBCT technique and a conventional 4D CBCT technique from a database of oversampled Rando phantom CBCT projections. A database containing 111 free breathing lung cancer patient respiratory signal files was used to create 111 RT 4D CBCT and 111 conventional 4D CBCT image datasets from realistic simulations of a 4D RT CBCT system. Each of these image datasets were compared to a ground truth dataset from which a root mean square error (RMSE) metric was calculated to quantify the degradation of image quality. The number of projections used in each simulation is counted and was assumed as a surrogate for imaging dose. Results: Based on 111 breathing traces, when comparing RT 4D CBCT with conventional 4D CBCT the average image quality was reduced by 7.6%. However, the average imaging dose reduction was 53% based on needing fewer projections (617 on average) than conventional 4D CBCT (1320 projections). Conclusion: The simulation studies using a wide range of patient breathing traces have demonstrated that the RT 4D CBCT method can potentially offer a substantial saving of imaging dose of 53% on average compared to conventional 4D CBCT in simulation studies with a minimal impact on image quality. A patent application (PCT/US2012/048693) has been filed which is related to this work.

  6. Measurement of the e$^{+}$e$^{-} \\rightarrow ZZ$ Production Cross Section at Centre-of-Mass Energies of 183 and 189 GeV

    OpenAIRE

    Barate, R.; Decamp, D.; Ghez, P.; Goy, C.; Jezequel, S.; Lees, J. P.; Martin, F.; E. Merle; M.N. Minard; Pietrzyk, B; Alemany, R; Bravo, S.; Casado, M. P.; M. Chmeissani; Crespo, J M.

    1999-01-01

    The e+e- -> ZZ cross section at sqrt(s)=182.7 and 188.6 GeV has been measured using the ALEPH detector. The analysis covers all of the visible ZZ final states and yields cross section measurements of sigma_ZZ(182.7 GeV) = 0.11 +- (0.16,0.11) (stat.) +- 0.04 (syst.) pb and sigma_ZZ(188.6 GeV) = 0.67 +- 0.13 (stat.) +- 0.04 (syst.) pb consistent with the Standard Model expectations.

  7. Search for R-Parity Violating Decays of Supersymmetric Particles in $e^{+} e^{-}$ Collisions at Centre-of-Mass Energies near 183 GeV

    OpenAIRE

    Barate, R.; Decamp, D.; Ghez, P.; Goy, C.; Jezequel, S.; Lees, J. P.; Martin, F.; E. Merle; M.N. Minard; Pietrzyk, B; Przysiezniak, H.; Alemany, R; Casado, M. P.; M. Chmeissani; Crespo, J M.

    2000-01-01

    Searches for pair-production of supersymmetric particles under the assumption that R-parity is violated via a single dominant $LL{\\bar E}$, $LQ{\\bar D}$ or ${\\bar U} {\\bar D} {\\bar D}$ coupling are performed using the data collected by the \\ALEPH\\ collaboration at centre-of-mass energies of 181--184~$\\gev$. The observed candidate events in the data are in agreement with the Standard Model expectations. Upper limits on the production cross-sections and lower limits on the masses of charginos, ...

  8. Neutron-capture cross sections of the tungsten isotopes 182W, 183W, 184W, and 186W from 2.6 to 2000 keV

    International Nuclear Information System (INIS)

    Neutron-capture cross sections of four stable tungsten isotopes were measured as a function of energy by time of flight at the Oak Ridge Electron Linear Accelerator. The resolution achieved, ΔE/E about 1/750 FWHM, has allowed the analysis of several hundred resonance peaks at energies a few kiloelectron volts above the neutron-binding energy. Strength functions were fitted to the average cross sections up to about 100 keV, and average cross sections were extended with less precision from 100 to 2000 keV. The capture cross section of natural tungsten was calculated from measurements for individual isotopes. Compound nucleus calculations have been made with deformed optical model parameters for comparison with experimental cross sections

  9. CRED Acoustic Doppler Profiler (ADP); NWHI, MID; Long: -177.42181, Lat: 28.21826 (WGS84); Sensor Depth: 1.83m; Data Range: 20080926-20090321.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Island Fisheries Science Center Acoustic Doppler Profilers (ADP) provide a time series of water current...

  10. Computations with the FIPLOC MOD 1/83 program on the methyl iodide and aerosol distribution of number A-5 and A-11 containment systems experiments

    International Nuclear Information System (INIS)

    In the present final report different computations regarding two containment systems experiments are documented by the FIPLOC program. The spatial distribution for methyl iodide and a cesium aerosol in consequence of natural, undisturbed flow processes in the model containment measuring 850 m3 and divided into three rooms was calculated. By improved discretisation and precise simulation of the course of the experiments the measuring results were closely confirmed. The characteristic courses of the two experiments, which differ mainly by the variation of steam feed, are analytically verified by means of the computation results and interpreted. The verification calculations carried through for the FIPLOC code clearly demonstrate the necessity of simultaneous simulation of distribution and deposition phenomena. Future improvements of the model are planned both for the thermohydraulic part, from which especially more precise indications are to be obtained regarding local saturation conditions, and for the aerosol part, which is to be enlarged in such a manner that also the time and site-related changes in particle size can be simulated by condensation/evaporation and coagulation. (orig./RB)

  11. 183,000,000:数字蕴含的超凡实力--亚洲最大最先进的数字化整体厨房生产基地%183,000,000: The numeral contains unusual strength

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ 作为我国整体厨房行业的领军品牌,海尔厨房设施有限公司成立于1997年,秉承海尔集团世界白电五强、中国家电第一品牌的实力和品牌优势,以至优品质为标准,以国际一流的制造系统,打造出品质一流的整体厨房产品!

  12. 自然观光地旅游小企业经营障碍分析--基于九寨沟183位旅游小企业主访谈调查%Analysis the business barriers of small tourism business in natural scenery sightseeing place based on the survey of 183 small tourism owners---A case study of Jiuzhaigou, Sichuan

    Institute of Scientific and Technical Information of China (English)

    徐龙梅; 贡波索郎; 杨钊

    2015-01-01

    Small tourism business occupied an important position in the economic development of the tourism in-dustry, they took the significant economic value to the tourism industry, and faced many business barriers as well. Based on the natural scenery place of Jiuzhaigou, the thesis explored the business barriers of small tourism business, and analyzed the in-depth interviews. At last, it pointed out the five aspects of business barriers in small tourism business development process: market environment, seasonal differences, government policy and management, rent barriers, natural disasters. The study on the business barriers of small tourism business will help the owners have an intuitive understanding on the weakness of tourism development, and promote a leap de-velopment between small tourism business and tourism destination economy.%旅游小企业在旅游业经济发展中占据重要的地位,给旅游业带来重要经济价值的同时也面临着很多方面的经营障碍。本文以自然旅游观光地九寨沟为案例地,对旅游小企业的经营障碍进行探究,在深度访谈的基础上进行分析。最后,指出自然观光地旅游小企业在发展过程中主要存在五个方面的经营障碍:市场环境;淡旺季影响;政府政策与管理;租金障碍;自然灾害。对旅游小企业的经营障碍研究,利于经营者更加直观地认识小企业在旅游发展中的不足,促进旅游小企业和旅游目的地经济的跨越式发展。

  13. Oxidative stability of structured lipids containing C18:0, C18:1, C18:2, C18:3 or CLA in sn 2-position - as bulk lipids and in milk drinks

    DEFF Research Database (Denmark)

    Timm Heinrich, Maike; Nielsen, Nina Skall; Xu, Xuebing;

    2004-01-01

    In this study, we compared the oxidative stability of a specific structured lipid (SL) containing conjugated linoleic acid (CLA) in the sn2-position with SL containing other C18 fatty acids of different degree of unsaturation (stearic, oleic, linoleic or linolenic acid). SL was produced by...... oxidative stability of our SL was very different when comparing (a) bulk lipids and milk drink and (b) the five different batches of each product. SL based on oleic acid was the most unstable as bulk lipid, while SL based on linoleic acid was the most unstable in milk drink. SL based on CLA was the second...

  14. Maximum mass ratio of am CVn-type binary systems and maximum white dwarf mass in ultra-compact x-ray binaries (addendum - Serb. Astron. J. No. 183 (2011, 63

    Directory of Open Access Journals (Sweden)

    Arbutina B.

    2012-01-01

    Full Text Available We recalculated the maximum white dwarf mass in ultra-compact X-ray binaries obtained in an earlier paper (Arbutina 2011, by taking the effects of super-Eddington accretion rate on the stability of mass transfer into account. It is found that, although the value formally remains the same (under the assumed approximations, for white dwarf masses M2 >~0.1MCh mass ratios are extremely low, implying that the result for Mmax is likely to have little if any practical relevance.

  15. Δ-6 Desaturase substrate competition: dietary linoleic acid (18:2n-6) has only trivial effects on α-linolenic acid (18:3n-3) bioconversion in the teleost rainbow trout.

    Science.gov (United States)

    Emery, James A; Hermon, Karen; Hamid, Noor K A; Donald, John A; Turchini, Giovanni M

    2013-01-01

    It is generally accepted that, in vertebrates, omega-3 (n-3) and omega-6 (n-6) poly-unsaturated fatty acids (PUFA) compete for Δ-6 desaturase enzyme in order to be bioconverted into long-chain PUFA (LC-PUFA). However, recent studies into teleost fatty acid metabolism suggest that these metabolic processes may not conform entirely to what has been previously observed in mammals and other animal models. Recent work on rainbow trout has led us to question specifically if linoleic acid (LA, 18∶2n-6) and α-linolenic acid (ALA, 18∶3n-3) (Δ-6 desaturase substrates) are in direct competition for access to Δ-6 desaturase. Two experimental diets were formulated with fixed levels of ALA, while LA levels were varied (high and low) to examine if increased availability of LA would result in decreased bioconversion of ALA to its LC-PUFA products through substrate competition. No significant difference in ALA metabolism towards n-3 LC-PUFA was exhibited between diets while significant differences were observed in LA metabolism towards n-6 LC-PUFA. These results are evidence for minor if any competition between substrates for Δ-6 desaturase, suggesting that, paradoxically, the activity of Δ-6 desaturase on n-3 and n-6 substrates is independent. These results call for a paradigm shift in the way we approach teleost fatty acid metabolism. The findings are also important with regard to diet formulation in the aquaculture industry as they indicate that there should be no concern for possible substrate competition between 18∶3n-3 and 18∶2n-6, when aiming at increased n-3 LC-PUFA bioconversion in vivo. PMID:23460861

  16. Δ-6 Desaturase substrate competition: dietary linoleic acid (18:2n-6 has only trivial effects on α-linolenic acid (18:3n-3 bioconversion in the teleost rainbow trout.

    Directory of Open Access Journals (Sweden)

    James A Emery

    Full Text Available It is generally accepted that, in vertebrates, omega-3 (n-3 and omega-6 (n-6 poly-unsaturated fatty acids (PUFA compete for Δ-6 desaturase enzyme in order to be bioconverted into long-chain PUFA (LC-PUFA. However, recent studies into teleost fatty acid metabolism suggest that these metabolic processes may not conform entirely to what has been previously observed in mammals and other animal models. Recent work on rainbow trout has led us to question specifically if linoleic acid (LA, 18∶2n-6 and α-linolenic acid (ALA, 18∶3n-3 (Δ-6 desaturase substrates are in direct competition for access to Δ-6 desaturase. Two experimental diets were formulated with fixed levels of ALA, while LA levels were varied (high and low to examine if increased availability of LA would result in decreased bioconversion of ALA to its LC-PUFA products through substrate competition. No significant difference in ALA metabolism towards n-3 LC-PUFA was exhibited between diets while significant differences were observed in LA metabolism towards n-6 LC-PUFA. These results are evidence for minor if any competition between substrates for Δ-6 desaturase, suggesting that, paradoxically, the activity of Δ-6 desaturase on n-3 and n-6 substrates is independent. These results call for a paradigm shift in the way we approach teleost fatty acid metabolism. The findings are also important with regard to diet formulation in the aquaculture industry as they indicate that there should be no concern for possible substrate competition between 18∶3n-3 and 18∶2n-6, when aiming at increased n-3 LC-PUFA bioconversion in vivo.

  17. Multibeam collection for TN183: Multibeam data collected aboard Thomas G. Thompson from 2005-09-02 to 2005-10-04, departing from Seattle, WA and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Enrollment in Postsecondary Institutions, Fall 2012; Financial Statistics, Fiscal Year 2012; Graduation Rates, Selected Cohorts, 2004-09; and Employees in Postsecondary Institutions, Fall 2012. First Look (Provisional Data). NCES 2013-183

    Science.gov (United States)

    Ginder, Scott A.; Kelly-Reid, Janice E.

    2013-01-01

    The Integrated Postsecondary Education Data System (IPEDS) collects institution-level data from postsecondary institutions in the United States (50 states and the District of Columbia) and other U.S. jurisdictions (see appendix A for a list of other U.S. jurisdictions). This "First Look" presents findings from the provisional…

  19. 33 CFR Table 4 to Subpart H of... - Weights (Pounds) of Outboard Motor and Related Equipment for Various Boat Horsepower Ratings

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Weights (Pounds) of Outboard Motor and Related Equipment for Various Boat Horsepower Ratings 4 Table 4 to Subpart H of Part 183... or Less Pt. 183, Subpt. H, Table 4 Table 4 to Subpart H of Part 183—Weights (Pounds) of...

  20. 76 FR 8892 - Removal of Expired Federal Aviation Administration Regulations and References

    Science.gov (United States)

    2011-02-16

    ...-28, 183-14] Removal of Expired Federal Aviation Administration Regulations and References AGENCY... Special Federal Aviation Regulations (SFARs) and cross-references, as well as other expired or obsolete..., 135.153, 183.61(a)(1), 183.63, and corresponding references. The following tables are presented...

  1. Master’s Students in History Could Benefit from a Greater Library Sensitivity and Commitment to Interdisciplinarity, and from More Efficient Document Delivery. A Review of: Sherriff, G. (2010. Information use in history research: A citation analysis of master’s level theses. Portal: Libraries and the Academy, 10 (2 165-183. doi: 10.1353/pla.0.0092.

    Directory of Open Access Journals (Sweden)

    R. Laval Hunsucker

    2011-09-01

    Full Text Available Objective – This study sought to determine the characteristics of research materials used by history students in preparing their master’s theses. Of which information resources formats did such students make use, and in what proportions? What was the age distribution of resources used? What was the dispersal over journal titles and over subject classification, i.e., the degree of interdisciplinarity? To what extent did the master’s students make use of non-English-language materials? To what extent did their institution’s library hold the resources in question?The investigator was especially interested in finding quantitative support for what he terms two “hypotheses.” The first of these is that historical research depends to a high degree on monographs, journal articles being far less important to it than they are to research in, especially, the natural sciences and technology. The second is that the age distribution of resources important to historical research is much flatter and longer than that of resources upon which researchers in the natural sciences and technology rely.Design – Citation analysis, supplemented with comprehensive catalogue searches.Setting – Southern Connecticut State University (SCSU, a mid-sized public university located in New Haven, Connecticut, U.S.A.Subjects – MA and MS theses (N=47 successfully submitted to the Department of History over the period from academic year 1998/1999 through academic year 2007/2008, inclusive.Methods – The investigator initially identified the theses through a search of the online catalogue (“Consuls” of the Connecticut State University system, and retrieved all of them in either electronic or hard-copy form. He then subjected all citations (N=3,498 listed in the references sections of these theses to an examination in order to identify for each cited resource the format, the age, the language, and, in the case of scholarly journal articles, the journal of publication. He carried out bibliographic searches in order to rectify any citations which he had noted to be faulty or incomplete. The study took no account of possible additional citations in footnotes or endnotes or in the text, and did not measure citation intensity (whether, for instance, a thesis referred only once, or perhaps many times, to a given resource. Duplicates “were ignored.” He furthermore performed systematic searches in Consuls and in the Library of Congress (LC online catalogue in order to establish, insofar as possible, into which assigned LC Classification class each resource fell, and whether it belonged to the holdings of the SCSU library. “Holdings,” as used here, includes physical resources owned, as well as those resources to which the library has licensed access. Not marked as either “held” or “not held” were: resources available online without restriction or charge, items not identified in either Consuls or the LC catalogue, and all government documents. Ages of cited resources were calculated based on the edition or version date actually given in a student’s citation, without any consideration of a possible earlier date of the original version of the publication or document concerned. Main Results – Format, age distribution, and journal frequency. The local citation analysis found that 53.2% of all cited resources were monographs, 7.8% were scholarly articles, 5.3% were contributed chapters in books, and 0.6% were dissertations or theses. Non-scholarly periodicals accounted for 15.7%, government documents for 6.7%, and freely available web documents for 4.1%. The remainder, approximately 6.5%, comprised archival papers, judicial documents, directories, interviews, posters, audiovisual materials, and 13 other formats. Cited resources, measured back from the date of acceptance of the citing thesis, ranged from 0 to 479 years old; the mode was 3 years, but the median was “25” (p. 170 or “26” (p. 177 years. Just over 70% (i.e., 2,500 cited resources were more than ten years old. Almost one thousand of the cited resources were fifty or more years old. The 274 scholarly journal articles included in the references sections were spread over 153 distinct journal titles, of which 105 titles made only one appearance, and 136 titles three or fewer appearances. The mean was 1.8 appearances.Subject dispersal and language. Of the 2,084 cited resources for which LC classification was locatable, 51.5% had a classification other than history, i.e., other than class C, D, E, or F. Nearly two thirds (66.0% of the cited scholarly journal articles had appeared in journals with a focus other than history. (Note: table 4 is incorrect, precisely reversing the actual ratio. Of all cited items, 98.5% were in the English language. Half (27 of the non-English-language resources cited were in Korean, all cited in the same thesis. Books (i.e., monographs plus compilations from which contributed chapters were cited accounted for 87.0% of foreign-language citations. More than four fifths of the examined theses (83.0% cited not a single non-English-language resource. Local holdings. Of all 3,498 cited items, 3,022 could be coded as either “held” or “not held” by the SCSU library. Of the items so coded (not, as indicated on p. 180, of all cited items, scarcely two fifths (41.0% belonged to the library’s holdings. The holdings percentage was highest (72.6% for the 274 scholarly journal articles cited, followed by the 186 contributed chapters (50.0%, the 550 non-scholarly periodical items (49.5%, and the 1,861 monographs (46.8%. For other cited formats, the percentage was much lower, and in some cases, e.g., for the 55 archival and the 44 judicial documents, it was 0.0%. Of the 54 foreign-language resources cited, the institution’s library held only two. Conclusion – The investigator concludes that his study’s findings do indeed lend quantitative support to his two “hypotheses.” This outcome will surprise few, if any, librarians; it is in accord with what Koenig (1978 long ago saw as a matter of “intuition” and “all conventional wisdom,” something that many subsequent studies have confirmed. Sherriff accordingly recommends, firstly, that collections which strive to support historical research should, in matters of acquisition policy and budget allocation, take serious account of that field’s relatively strong dependence on monographs. Secondly, the data on age distribution carry obvious implications for librarians’ decision-making on matters such as de-accessioning and weeding, relegation to remote storage, and retrospective acquisitions. This finding should also be considered, for instance, in connection with preservation policy and the maintaining of special collections. He even suggests that librarians “need to teach students the value of reviewing literature historically and showing them how to do so effectively” (p. 177.Sherriff considers a number of further (tentative conclusions to be warranted or suggested by the results of this study. First of all, that historical research is now characteristically an interdisciplinary matter, in the sense that it requires extensive access to information resources, including journals, which libraries have traditionally not classified as belonging to the discipline of history itself. For a library supporting such research, this phenomenon “has implications for matters including collection budgets, reference work, bibliographic instruction, and the location of collections and departmental libraries” (p. 168. It also means “that librarians working with history students and history collections need to be aware of the relevant resources in other disciplines. This can improve reference work, research assistance, and bibliographic instruction; it may also help the coordination of acquisitions across departmental lines” (p. 179. Secondly, one may conclude that “there is no ‘core’ collection of journals for history” (p. 178 which will be able to satisfy a large proportion of master’s students’ research needs. Thirdly, the fact that a library such as SCSU’s holds significantly less than half of what master’s students require for preparing their theses “may exercise a narrowing effect on students’ awareness of the existing literature on their topics” (p. 180, “increases the importance of departmental faculty, reference librarians, and subject specialist librarians drawing students’ attention to resources beyond the library’s catalogues and collections” (p. 180, and requires that the library give serious attention to effective document delivery arrangements. Finally, this study’s finding that only a small percentage of master’s students in history made use of non-English-language materials, but then in certain cases used them rather extensively (27 Korean items cited in one thesis, ten Italian in another, nine Spanish in yet another, suggests that acquisition, or at least proactive acquisition, of such materials needn’t be a priority, as long as, once again, the students concerned have easy access to efficient and affordable document delivery services. Sherriff does concede, however, that his finding could indicate “that students are unaware of relevant resources in other languages or are aware of them but lack the language skills necessary to use them” (p. 179.

  2. Master’s Students in History Could Benefit from a Greater Library Sensitivity and Commitment to Interdisciplinarity, and from More Efficient Document Delivery. A Review of: Sherriff, G. (2010). Information use in history research: A citation analysis of master’s level theses. Portal: Libraries and the Academy, 10 (2) 165-183. doi: 10.1353/pla.0.0092.

    OpenAIRE

    R. Laval Hunsucker

    2011-01-01

    Objective – This study sought to determine the characteristics of research materials used by history students in preparing their master’s theses. Of which information resources formats did such students make use, and in what proportions? What was the age distribution of resources used? What was the dispersal over journal titles and over subject classification, i.e., the degree of interdisciplinarity? To what extent did the master’s students make use of non-English-language materials? To what ...

  3. Interlibrary Loan Rates for Academic Libraries in the United States of America Have Increased Despite the Availability of Electronic Databases, but Fulfilment Rates Have Decreased. A Review of: Williams, J. A., & Woolwine, D. E. (2011. Interlibrary loan in the United States: An analysis of academic libraries in a digital age. Journal of Interlibrary Loan, Document Delivery & Electronic Reserve, 21(4, 165-183. doi: 10.1080/1072303X.2011.602945

    Directory of Open Access Journals (Sweden)

    Kathryn Oxborrow

    2012-12-01

    Full Text Available Objectives – To determine the number of interlibrary loan (ILL requests in academiclibraries in the United States of America over the period 1997-2008, and how various factors have influenced these rates. These factors included electronic database subscriptions,size of print journal and monograph collections, and the presence of link resolvers.Data were collected from libraries as both lenders and borrowers. The study also lookedat whether the number of professional staff in an ILL department had changed during theperiod studied, and whether ILL departments led by a professional librarian correlated positively with rates of ILL.Design – Online questionnaire.Setting – Academic library members of the Online Computer Library Center (OCLC ILL scheme in the United States of America.Subjects – A total of 442 academic library members of the OCLC ILL scheme.Methods – An electronic questionnaire was sent to 1433 academic library memberinstitutions of the OCLC ILL scheme. Datawere collected for libraries as both lending andborrowing institutions. Data were analyzed using a statistical software package,specifically to calculate Spearman’s rank correlations between the variables and rates of ILL.Main Results – Responses to the electronic questionnaire were received from 442 (31% academic libraries. There was an overall increase in the number of ILL requests in the period 1997-2008. The number of ILL requests which were unfulfilled also increased during this period. There was a positive correlation between rates of ILL and all of the variables investigated, with the strongest correlations with size of print monograph collections and size of print journal collections. The numbers of staff in ILL departments remained relatively static during the period covered by the study, although the majority of staff working in ILL was composed of paraprofessionals. There was a weak positive correlation between numbers of ILL requests and whether ILL departments were headed by a professional librarian.Conclusions – Access to full text electronic databases has not decreased the numbers of ILL requests in academic libraries in the United States of America. In fact, ILL requests have increased, probably due to the fact that students and staff of academic libraries now have access to a larger number of citations through online databases and other information sources. The authors suggest that the increase in unfulfilled ILL requests is also due to this increased access. Libraries with large print collections are more likely to receive ILL requests precisely because they have more material to lend out, and may make more ILL requests due to the research output of their presumably larger institutions. There may be a higher number of ILL requests fulfilled by departments headed by a professional librarian because a librarian has more knowledge of sources to fulfil requests.

  4. AcEST: DK961469 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0010_D11 615 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_D11. 5' end seq ... EQAEQIH 340 Query: 183 KAIMKTIEEGKFLTGDLGGKASTSDYTKAVC ENL 284 AI+ TI EGK+ T DLGG ++T+++TKA+C++L Sbjct: 34 ... KQAEQIH 340 Query: 183 KAIMKTIEEGKFLTGDLGGKASTSDYTKAVC ENL 284 AI+ TI EGK+ T DLGG ++T+D+TKA+C++L Sbjct: 34 ... HEASIIE 314 Query: 183 KAIMKTIEEGKFLTGDLGGKASTSDYTKAVC ENL*NSL 296 A++ T+ EGK TGDLGG +S S+YT + + + SL Sbjc ... TYADKIE 343 Query: 183 KAIMKTIEEGKFLTGDLGGKASTSDYTKAVC ENL 284 +A +TI+EGK+LTGDLGG+A S++T +C L Sbjct: 344 R ...

  5. AcEST: BP913082 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000026_C09 271 Adiantum capillus-veneris mRNA. clone: YMU001_000026_C09. BP913082 CL1025C ... EQAEQIHSAIIN 345 Query: 183 TIEEGKFLTGDLGGKASTSDYTKAVC ENL 269 TI EGK+ T DLGG ++T+++TKA+C++L Sbjct: 346 TI ... KQAEQIHSAIIN 345 Query: 183 TIEEGKFLTGDLGGKASTSDYTKAVC ENL 269 TI EGK+ T DLGG ++T+D+TKA+C++L Sbjct: 346 TI ... HEASIIENAVLN 319 Query: 183 TIEEGKFLTGDLGGKASTSDYTKAVC ENL 269 T+ EGK TGDLGG +S S+YT + + + Sbjct: 320 TLTE ... DHAARIEAACFA 333 Query: 183 TIEEGKFLTGDLGGKASTSDYTKAVC ENL 269 TI++GK LT DLGG A SD+T+ +C + Sbjct: 334 TIKD ...

  6. AcEST: DK960600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0007_N19 414 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_N19. 5' end seq ... = +1 Query: 4 DAGTALDSRVPEVLYPFLSISLLTVSLMVAAYFFIY*VTT SKFTMSLVHEL*TAPVYTI* 183 +A + S V ++P L++ LL + + A+ ... = +1 Query: 4 DAGTALDSRVPEVLYPFLSISLLTVSLMVAAYFFIY*VTT SKFTMSLVHEL*TAPVYTI* 183 +A + S V ++P L++ LL + + A+ ... = +1 Query: 4 DAGTALDSRVPEVLYPFLSISLLTVSLMVAAYFFIY*VTT SKFTMSLVHEL*TAPVYTI* 183 +A + S V ++P L++ LL + + A+ ... = +1 Query: 4 DAGTALDSRVPEVLYPFLSISLLTVSLMVAAYFFIY*VTT SKFTMSLVHEL*TAPVYTI* 183 +A + S V ++P L++ LL + + A+ ...

  7. Review: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008) Buchbesprechung: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008)

    OpenAIRE

    Hans-Bernd Zöllner

    2009-01-01

    Review of the monograph: Grigoleit, Grit (2008), Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 pages Besprechung der Monographie: Grigoleit, Grit (2008), Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 Seiten

  8. Review: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008 Buchbesprechung: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008

    Directory of Open Access Journals (Sweden)

    Hans-Bernd Zöllner

    2009-07-01

    Full Text Available Review of the monograph: Grigoleit, Grit (2008, Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 pages Besprechung der Monographie: Grigoleit, Grit (2008, Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 Seiten

  9. Acyclic nucleoside phosphonates containing a second phosphonate group as potent inhibitors of 6-oxopurine phosphoribosyltransferases with antimalarial activity

    Czech Academy of Sciences Publication Activity Database

    Špaček, Petr; Keough, D. T.; Hocková, Dana; Tichý, Tomáš; Vrbková, Silvie; Slavětínská, Lenka; Janeba, Zlatko; Naesens, L.; Edstein, M. D.; Chavchich, M.; Wang, T.; de Jersey, J.; Guddat, L. W.

    Marseille : -, 2013. s. 183-183. [ESOC 2013. European Symposium on Organic Chemistry /18./. 07.07.2013-12.07.2013, Marseille] R&D Projects: GA ČR GAP207/11/0108 Institutional support: RVO:61388963 Keywords : nucleotide analogues * enzyme inhibitors * Plasmodium Subject RIV: CC - Organic Chemistry

  10. Unigene BLAST: CBRC-CELE-05-0548 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0548 gnl|UG|Cel#S5710463 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-183) (srh-183) mRNA, complete cds /cds=p(1,996) /gb=NM_075466 /gi=17566101 /ug=Cel.28344 /len=996 3e-77 45% ...

  11. Hepatitis B Virus Core Protein Phosphorylation Sites Affect Capsid Stability and Transient Exposure of the C-terminal Domain.

    Science.gov (United States)

    Selzer, Lisa; Kant, Ravi; Wang, Joseph C-Y; Bothner, Brian; Zlotnick, Adam

    2015-11-20

    Hepatitis B virus core protein has 183 amino acids divided into an assembly domain and an arginine-rich C-terminal domain (CTD) that regulates essential functions including genome packaging, reverse transcription, and intracellular trafficking. Here, we investigated the CTD in empty hepatitis B virus (HBV) T=4 capsids. We examined wild-type core protein (Cp183-WT) and a mutant core protein (Cp183-EEE), in which three CTD serines are replaced with glutamate to mimic phosphorylated protein. We found that Cp183-WT capsids were less stable than Cp183-EEE capsids. When we tested CTD sensitivity to trypsin, we detected two different populations of CTDs differentiated by their rate of trypsin cleavage. Interestingly, CTDs from Cp183-EEE capsids exhibited a much slower rate of proteolytic cleavage when compared with CTDs of Cp183-WT capsids. Cryo-electron microscopy studies of trypsin-digested capsids show that CTDs at five-fold symmetry vertices are most protected. We hypothesize that electrostatic interactions between glutamates and arginines in Cp183-EEE, particularly at five-fold, increase capsid stability and reduce CTD exposure. Our studies show that quasi-equivalent CTDs exhibit different rates of exposure and thus might perform distinct functions during the hepatitis B virus lifecycle. Our results demonstrate a structural role for CTD phosphorylation and indicate crosstalk between CTDs within a capsid particle. PMID:26405031

  12. Integrated management of sustainable development and environmental protection along the Indian coasts

    Digital Repository Service at National Institute of Oceanography (India)

    Sawkar, K.

    stream_size 7 stream_content_type text/plain stream_name Proc_South_Asia_Workshop_Estuar_Model_CZM_!999_183.pdf.txt stream_source_info Proc_South_Asia_Workshop_Estuar_Model_CZM_!999_183.pdf.txt Content-Encoding ISO-8859-1 Content...

  13. 46 CFR 28.370 - Wiring methods and materials.

    Science.gov (United States)

    2010-10-01

    ... must: (1) For circuits of less than 50 volts, meet 33 CFR 183.425 and 183.430; and (2) For circuits of... Boat or UL Marine Shipboard cable; or (iii) Meet 46 CFR part 111, subpart 111.60. (e) All...

  14. AcEST: BP918665 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_B05 577 Adiantum capillus-veneris mRNA. clone: YMU001_000116_B05. BP918665 CL709Co ... RVHEWIKEN 426 Query: 183 GLASETQVANALIDMHVKCGSLKDARIVF DKLLNRDIVTWNTLVAGYAEHC-NDETFELF 359 L + V+NAL+DM+ K ... AVHSIGVKA 325 Query: 183 GLASETQVANALIDMHVKCGSLKDARIVF DKLLNRDIVTWNTLVAGYA-EHCNDETFELF 359 + E + N L+DM+ K ...

  15. Measurement of pH micro-heterogeneity in natural cheese matrices by fluorescence lifetime imaging

    Czech Academy of Sciences Publication Activity Database

    Burdikova, Z.; Svindrych, Z.; Pala, J.; Hickey, C. D.; Wilkinson, M. G.; Pánek, Jiří; Auty, M. A. E.; Periasamy, A.; Sheehan, J. J.

    2015-01-01

    Roč. 6, March (2015), 183_1-183_10. ISSN 1664-302X Institutional support: RVO:61389013 Keywords : cheese matrix * C-SNARF-4 * Oregon Green Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.989, year: 2014

  16. Novel plasmid vectors for testing in vivo promoter activities in Corynebacteria and Rhodococci

    Czech Academy of Sciences Publication Activity Database

    Knoppová, Monika; Phensaijai, M.; Zemanová, Martina; Nešvera, Jan; Pátek, Miroslav

    California: Blackwell, 2006, s. 183-183. [Plasmid Biology 2006. Lake Tahoe (US), 23.09.2006-27.09.2006] R&D Projects: GA ČR GA204/06/0330 Institutional research plan: CEZ:AV0Z50200510 Keywords : plasmid vectors * promoter Subject RIV: EE - Microbiology, Virology

  17. AcEST: DK949862 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_C01 701 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_C01. 5' end seq ... uery: 183 IMTLSSWATSSVEEVASVGPGIRFFQLYVYKDRNVVAQLVRRAE KAGFRAIALTVDTPRL 362 IMTLSSWATSSVEEVAS GPGIRFFQLYVY ... KDRNVVAQLVRRAE +AGF+AIALTVDTPRL Sbjct: 102 IMTLSSWATSSVEEVASTGPGIR ... FFQLYVYKDRNVVAQLVRRAE RAGFKAIALTVDTPRL 161 Query: 363 GRREADIKNRFVLPPHLTL ... uery: 183 IMTLSSWATSSVEEVASVGPGIRFFQLYVYKDRNVVAQLVRRAE KAGFRAIALTVDTPRL 362 IMTLSSWATSSVEEVAS GPGIRFFQLYVY ...

  18. AcEST: DK961803 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0011_C15 682 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_C15. 5' end seq ... uery: 183 IMTLSSWATSSVEEVASVGPGIRFFQLYVYKDRNVVAQLVRRAE KAGFRAIALTVDTPRL 362 IMTLSSWATSSVEEVAS GPGIRFFQLYVY ... KDRNVVAQLVRRAE +AGF+AIALTVDTPRL Sbjct: 102 IMTLSSWATSSVEEVASTGPGIR ... FFQLYVYKDRNVVAQLVRRAE RAGFKAIALTVDTPRL 161 Query: 363 GRREADIKNRFVLPPHLTL ... uery: 183 IMTLSSWATSSVEEVASVGPGIRFFQLYVYKDRNVVAQLVRRAE KAGFRAIALTVDTPRL 362 IMTLSSWATSSVEEVAS GPGIRFFQLYVY ...

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC183 (Link to dictyBase) - - - Contig-U16263-1 VFC183Z (Link... to Original site) - - VFC183Z 630 - - - - Show VFC183 Library VF (Link to library) Clone ID VFC183 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16263-1 Original site URL http://dict... 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U13150 |U13150.1 Dict...yostelium discoideum vacuolar ATPase subunit DVA41 mRNA, complete cds. 1180 0.0 1 AC116984 |AC116984.2 Dict

  20. Rapid modification of the insect elicitor N-linolenoyl-glutamate via a lipoxygenase-mediated mechanism on Nicotiana attenuata leaves

    Directory of Open Access Journals (Sweden)

    VanDoorn Arjen

    2010-08-01

    Full Text Available Abstract Background Some plants distinguish mechanical wounding from herbivore attack by recognizing specific constituents of larval oral secretions (OS which are introduced into plant wounds during feeding. Fatty acid-amino acid conjugates (FACs are major constituents of Manduca sexta OS and strong elicitors of herbivore-induced defense responses in Nicotiana attenuata plants. Results The metabolism of one of the major FACs in M. sexta OS, N-linolenoyl-glutamic acid (18:3-Glu, was analyzed on N. attenuata wounded leaf surfaces. Between 50 to 70% of the 18:3-Glu in the OS or of synthetic 18:3-Glu were metabolized within 30 seconds of application to leaf wounds. This heat-labile process did not result in free α-linolenic acid (18:3 and glutamate but in the biogenesis of metabolites both more and less polar than 18:3-Glu. Identification of the major modified forms of this FAC showed that they corresponded to 13-hydroxy-18:3-Glu, 13-hydroperoxy-18:3-Glu and 13-oxo-13:2-Glu. The formation of these metabolites occurred on the wounded leaf surface and it was dependent on lipoxygenase (LOX activity; plants silenced in the expression of NaLOX2 and NaLOX3 genes showed more than 50% reduced rates of 18:3-Glu conversion and accumulated smaller amounts of the oxygenated derivatives compared to wild-type plants. Similar to 18:3-Glu, 13-oxo-13:2-Glu activated the enhanced accumulation of jasmonic acid (JA in N. attenuata leaves whereas 13-hydroxy-18:3-Glu did not. Moreover, compared to 18:3-Glu elicitation, 13-oxo-13:2-Glu induced the differential emission of two monoterpene volatiles (β-pinene and an unidentified monoterpene in irlox2 plants. Conclusions The metabolism of one of the major elicitors of herbivore-specific responses in N. attenuata plants, 18:3-Glu, results in the formation of oxidized forms of this FAC by a LOX-dependent mechanism. One of these derivatives, 13-oxo-13:2-Glu, is an active elicitor of JA biosynthesis and differential

  1. AcEST: DK955153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_F10 608 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_F10. 5' end seq ... 7 GRSRRKKK-RTQNPLQSEGETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKE 183 GRSR +K+ R Q L++ P SFV RG+ +R+L D+R++M ... 7 GRSRRKKK-RTQNPLQSEGETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKE 183 GRSR +K+ R Q L++ P SFV RG +R+L D+R++M ... 7 GRSRRKKK-RTQNPLQSEGETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKE 183 GRSR +K+ R Q L++ P SFV RG +R+L D+R++M ... ery: 25 KKRTQNPLQSE-GETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKEKKSNSM 201 K RT SE E + P SFVI RG P + L D R+ ...

  2. AcEST: BP921312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available MVESGTKPNEVVFMNVLSACGHSGSVEEGKYYFNLMKSFG 635 Query: 189 VKMDVTVANTLIDMYAKCGCVEEARRVFDLLPRRSIVS-WGAMIAGYVQGGC...CSHSGLVEAGLKCFYMMKENY 569 Query: 177 IVSDVKMDVTVANTLIDMYAKCGCVEEARRVFDLLPRRSIVS-WG...66 LVGGYAKQGYFDEAMCLYHRMLWVGGVKPDVYTFPCVLRTCGGIPDLARGKEVHVHVVRY 225 Query: 186 DVKMDVTVANTLIDMYAKCGCVEEARRVFDLLPRRSIVSWG...GVLPDQATFVTVLRVCSVLSSLREGRAIHSLIFH 760 Query: 183 SDVKMDVTVANTLIDMYAKCGCVEEARRVFDLLPRRS-IVSWGAMIAGYVQGGCNHCT...jct: 357 LIAGYTQNGENEEALSLFCLLKRESVCPTHYSFANILKACADLAELHLGMQAHVHVLKHG 416 Query: 189 VKM------DVTVANTLIDMYAKCGCVEEARRVFDLLPRRSIVSWG

  3. Dicty_cDB: Contig-U00892-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124 ggattattttaaagaattaaagagatatatatatttncttcatctcttttcaaccaataa 183 Query: 184 attgncaaatgaaaatgtgttaccna...|||||||||||||||| Sbjct: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 Query: 244 naaa...aacc 303 Query: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataaa 363 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataa...Query: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 ||||||||||||||||||||||||||||||||

  4. Dicty_cDB: CHC316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available malaria and immune antigen for suppressing growth of plasmodium. 58 9e-19 6 BD183...625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58

  5. 100 Area D4 Project Building Completion Report - July 2007 to December 2008

    Energy Technology Data Exchange (ETDEWEB)

    M. T. Stankovich

    2009-04-15

    This report documents the decontamination, decommissioning, and demolition of the 105-NB, 163-N, 183-N, 183-NA, 183-NB, 183-NC, 184-N, 184-NA, 184-NB, 184-NC, 184-ND, 184-NE, 184-NF, 1312-N, 1330-N, 1705-N, 1705-NA, 1706-N, 1712-N, 1714-N, 1714-NA, 1714-NB, 1802-N, MO-050, MO-055, MO-358, MO-390, MO-900, MO-911, and MO-950 facilities in the 100 Area of the Hanford Site. The D4 activities for these facilities include utility disconnection, planning, characterization, engineering, removal of hazardous and radiological contaminated materials, equipment removal, decommissioning, deactivation, decontamination, demolition of the structure, and removal of the remaining slabs.

  6. Physiological tolerance and stoichiometric potential of cyanobacteria for hydrocarbon fuel production

    Czech Academy of Sciences Publication Activity Database

    Kamarainen, J.; Knoop, H.; Stanford, N.; Guerrero, F.; Akhtar, M. K.; Aro, E. M.; Steuer, Ralf; Jones, P. R.

    2012-01-01

    Roč. 162, č. 1 (2012), s. 67-74. ISSN 0168-1656 Institutional support: RVO:67179843 Keywords : Cyanobacteria * Hydrocarbon * Fuel * Toxicity * Stoichiometric potential Subject RIV: EH - Ecology, Behaviour Impact factor: 3.183, year: 2012

  7. Control of insect pests by entomopathogenic nematodes

    Czech Academy of Sciences Publication Activity Database

    Půža, Vladimír

    Cham : Springer International Publishing, 2015 - (Lugtenberg, B.), s. 175-183 ISBN 978-3-319-08574-6 Institutional support: RVO:60077344 Keywords : Nematodes Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  8. Decoupling of epitaxial graphene via gold intercalation probed by dispersive Raman spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Pillai, P.B.; DeSouza, M.; Narula, R.; Reich, S.; Wong, L.Y.; Batten, T.; Pokorný, Jan

    2015-01-01

    Roč. 117, č. 18 (2015), "183103-1"-"183103-8". ISSN 0021-8979 Institutional support: RVO:68378271 Keywords : superlattice * scattering * graphite * nitride * strain Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  9. Pohřeb lučištníka z pohoří Sabaloka

    Czech Academy of Sciences Publication Activity Database

    Suková, L.; Varadzin, Ladislav; Havelková, P.; Novák, J.; Pokorná, Adéla

    Praha: Národní muzeum, 2014 - (Onderka, P.; Vrtal, V.), s. 178-183 ISBN 978-80-7036-420-8 Institutional support: RVO:67985912 Keywords : Sudan * archaeology * Post Meroitic * archer's burial * archaeobotany Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. 1998 Miyake-Jima, Papua New Guinea Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — At least 2,183 people killed, thousands injured, about 9,500 homeless and about 500 missing as a result of a tsunami generated in the Sissano area. Maximum wave...

  11. AcEST: BP915384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_H04 433 Adiantum capillus-veneris mRNA. clone: YMU001_000070_H04. BP915384 CL3734C ... THEERELLEK 349 Query: 183 LASL 194 LA + Sbjct: 350 LAKI ... 353 >sp|Q7UA76|DNAJ_SYNPX Chaperone protein dnaJ O ... IPEERELLEK 353 Query: 183 LASL 194 LA + Sbjct: 354 LAKI ... 357 >sp|Q8YUA5|DNAJ_ANASP Chaperone protein dnaJ O ... IPEERELLEK 353 Query: 183 LASL 194 LA + Sbjct: 354 LAKI ... 357 >sp|Q7V9C8|DNAJ_PROMM Chaperone protein dnaJ O ... TPEEKELLEK 349 Query: 183 LASL 194 LA + Sbjct: 350 LAKI ... 353 TrEMBL (release 39.9) Link to BlastX Result : ...

  12. Inspirace literaturou a ilustrace

    Czech Academy of Sciences Publication Activity Database

    Machalíková, Pavla

    Praha: Národní galerie, 2014, s. 155-183. ISBN 978-80-7035-554-1 Institutional support: RVO:68378033 Keywords : Joseph Führich * visual art * 19th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. Antimicrobial activities and essential oils composition of Nigella arvensis and Nigella orientalis

    Czech Academy of Sciences Publication Activity Database

    Havlík, J.; Landa, L.; Maršík, Petr; Valterová, Irena; Rada, V.; Kokoška, L.

    Florence: -, 2005. s. 183. [GA Congress Joint with SIF /53./. 21.04.2005-25.04.2005, Florence] Institutional research plan: CEZ:AV0Z40550506 Keywords : essencial oil * Nigella * terpenes Subject RIV: CC - Organic Chemistry

  14. Cytochemical and ultrastructural aspects of aquatic carnivorous plant turions

    Czech Academy of Sciences Publication Activity Database

    Plachno, B.J.; Adamec, Lubomír; Kozieradzka-Kiszkurno, M.; Świątek, P.; Kamińska, I.

    2014-01-01

    Roč. 251, č. 6 (2014), s. 1449-1454. ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic carnivorous plants * winter buds * storage functions Subject RIV: EF - Botanics Impact factor: 2.651, year: 2014

  15. Modeling geochemical datasets for source apportionment: Comparison of least square regression and inversion approaches.

    Digital Repository Service at National Institute of Oceanography (India)

    Tripathy, G.R.; Das, Anirban.

    . Analysis of different modes of factor analysis as least squares fit problems. Chemometrics and Intelligent Laboratory Systems 18, 183–194. Paatero, P., 1997. Least squares formulation of robust non-negative factor analysis. Chemometrics and Intelligent...

  16. Critiques of growth in classical political economy: Mill's stationary state and a Marxian response

    OpenAIRE

    Dale, G.

    2013-01-01

    This is an Author's Accepted Manuscript of an article published in New Political Economy, 18(3), 431 - 457, 2013, copyright Taylor & Francis, available online at: http://www.tandfonline.com/10.1080/13563467.2012.709839.

  17. Specific Statistics of Czech Legislation

    Czech Academy of Sciences Publication Activity Database

    Novák, František

    2015-01-01

    Roč. 5, č. 3 (2015), s. 162-183. ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : legislation * quantitative description of legislation * structure and development of the legislation in the CR Subject RIV: AG - Legal Sciences

  18. Nástin rozšíření vybraných ruderálních a synantropních druhů plžů (Gastropoda) v oblasti Šumavy a Pošumaví

    Czech Academy of Sciences Publication Activity Database

    Dvořák, L.; Hlaváč, Jaroslav

    2001-01-01

    Roč. 6, - (2001), s. 183-198. ISSN 1211-7420 Institutional research plan: CEZ:AV0Z3013912 Keywords : distribution * new records * ruderal and synanthropic habitats Subject RIV: DB - Geology ; Mineralogy

  19. On reliability of 3D reconstructions of thermal plasma jet radiation by inverse Radon transform

    Czech Academy of Sciences Publication Activity Database

    Sekerešová, Zuzana; Hlína, Jan

    2011-01-01

    Roč. 56, č. 2 (2011), s. 171-183. ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20570509 Keywords : thermal plasma jet * tomography * image reconstruction Subject RIV: BL - Plasma and Gas Discharge Physics

  20. Indirect photometric detection of boron cluster anions electrophoretically separated in methanol

    Czech Academy of Sciences Publication Activity Database

    Vítová, Lada; Fojt, Lukáš; Vespalec, Radim

    2014-01-01

    Roč. 1338, APR 2014 (2014), s. 174-183. ISSN 0021-9673 Institutional support: RVO:68081707 Keywords : Boron cluster * Capillary electrophoresis * Indirect photometry Subject RIV: BO - Biophysics Impact factor: 4.169, year: 2014

  1. Processing Methodology and Dialectological Aspects of the Dictionary of Moravian and Silesian Anoikonyms (Minor Place Names)

    Czech Academy of Sciences Publication Activity Database

    Čižmárová, Libuše

    2010-01-01

    Roč. 3, č. 1 (2010), s. 183-195. ISSN 1855-6302 Institutional research plan: CEZ:AV0Z90610518 Keywords : onomastics, dialectology * electronic dictionary * anoikonyms * digitization * Moravia * Silesia * minor place names Subject RIV: AI - Linguistics

  2. Headaches and Complementary Health Approaches

    Science.gov (United States)

    ... training of investigators in the basic and clinical neurosciences, and seeks better understanding, diagnosis, treatment, and prevention ... type headache in adults: are they beneficial? CNS Neuroscience & Therapeutics. 2009;15(2):183–205. Vickers AJ, ...

  3. Molecular phylogeny, population genetics, and evolution of heterocystous cyanobacteria using nifH gene sequences

    Czech Academy of Sciences Publication Activity Database

    Singh, P.; Singh, S. S.; Elster, Josef; Mishra, A. K.

    2013-01-01

    Roč. 250, č. 3 (2013), s. 751-764. ISSN 0033-183X Institutional support: RVO:67985939 Keywords : evolution * heterocystous cyanobacteria * nifH gene Subject RIV: EH - Ecology, Behaviour Impact factor: 3.171, year: 2013

  4. Preparation, characterization and photocatalytic properties of cerium doped TiO.sub.2./sub. : On the effect of Ce loading on the photocatalytic reduction of carbon dioxide

    Czech Academy of Sciences Publication Activity Database

    Matějová, L.; Kočí, B.; Reli, M.; Čapek, L.; Hospodková, Alice; Peikertová, P.; Matěj, Z.; Obalová, L.; Wach, A.; Kustrowski, P.; Kotarba, A.

    152-153, JUN (2014), s. 172-183. ISSN 0926-3373 Institutional support: RVO:68378271 Keywords : cerium * titania * nanocrystalline * photocatalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 7.435, year: 2014

  5. Michael Angelo Unterberger und seine Nachfolger im Dienst des böhmischen und mährischen Adels

    Czech Academy of Sciences Publication Activity Database

    Valeš, Tomáš

    2013-01-01

    Roč. 67, 1/2 (2013), s. 174-183. ISSN 0029-9626 Institutional support: RVO:68378033 Keywords : Unterberger * Plandry * Breitenau * Vienna * aristocracy * Zebo * Gedon Subject RIV: AL - Art, Architecture, Cultural Heritage

  6. High – temperature thermoelectric properties of Hg – doped CuInTe2

    Czech Academy of Sciences Publication Activity Database

    Kucek, V.; Drašar, Č.; Kašparová, J.; Plecháček, T.; Navrátil, Jiří; Vlček, Milan; Beneš, L.

    2015-01-01

    Roč. 118, č. 12 (2015), 125105-1 - 125105-7. ISSN 0021-8979 Institutional support: RVO:61389013 Keywords : thermoelectric materials * Hall coefficient * Seebeck coefficient Subject RIV: CA - Inorganic Chemistry Impact factor: 2.183, year: 2014

  7. Disease: H00539 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00539 PTEN hamartoma tumor syndrome (PHTS), including: Cowden syndrome; Bannayan-Riley-Ruvalcab ... 22:183-98 (2003) PMID:16379592 (description, gene) Wang ... QK Update on the molecular genetics of vascular an ...

  8. Quantitative impedance analysis of solid ionic conductors: Effects of electrode polarization

    Czech Academy of Sciences Publication Activity Database

    Patil, D.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2014-01-01

    Roč. 115, č. 14 (2014), "143707-1"-"143707-6". ISSN 0021-8979 Institutional support: RVO:61389013 Keywords : impedance * conductivity * ion conductors Subject RIV: CA - Inorganic Chemistry Impact factor: 2.183, year: 2014

  9. K narativnímu pojetí autobiografické paměti: výzkumné možnosti metody čáry života

    Czech Academy of Sciences Publication Activity Database

    Vlčková, Irena; Blatný, Marek

    Olomouc: Univerzita Palackého v Olomouci, 2005, s. 183-199. ISBN 80-244-1159-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : Autobiographical memory * narrative psychology Subject RIV: AN - Psychology

  10. Constitutive equation of concrete: Mesomechanical isotropic model

    Czech Academy of Sciences Publication Activity Database

    Kafka, Vratislav; Vokoun, David

    2005-01-01

    Roč. 1, č. 2 (2005), s. 183-193. ISSN 1573-6105 Institutional research plan: CEZ:AV0Z20710524 Keywords : plasticity * constitutive modeling * concrete * mesomechanics Subject RIV: JI - Composite Materials

  11. DMSP SSMT/2 - Atmospheric Water Vapor Profiler

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The SSM/T-2 sensor is a five channel, total power microwave radiometer with three channels situated symmetrically about the 183.31 GHz water vapor resonance line...

  12. Floating large-volume mesocosms as a simple, low-cost experimental design suitable for the variety of lakes and reservoirs

    Czech Academy of Sciences Publication Activity Database

    Šorf, M.; Brandl, Z.; Znachor, Petr; Vašek, Mojmír

    2013-01-01

    Roč. 183, č. 1 (2013), s. 41-48. ISSN 1863-9135 Institutional support: RVO:60077344 Keywords : mesocosms * enclosures * methods * lakes * reservoirs Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.000, year: 2013

  13. Batrachochytrium dendrobatidis not found in rainforest frogs along an altitudinal gradient of Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Dahl, C.; Kiatik, I.; Baisen, I.; Bronikowski, E.; Fleischer, R. C.; Rotzel, N. C.; Lock, J.; Novotný, Vojtěch; Narayan, E.; Hero, J.-M.

    2012-01-01

    Roč. 22, č. 3 (2012), s. 183-186. ISSN 0268-0130 Institutional support: RVO:60077344 Keywords : altitude * amphibians * Batrachochytrium dendrobatidis Subject RIV: EH - Ecology, Behaviour Impact factor: 1.081, year: 2012

  14. Ein vermisster Großvater, ein Tango und ein Museum. Erinnern und Vergessen des Zweiten Weltkriegs und der Shoah in der ukrainischen Gegenwartsliteratur (Larysa Denysenko, Jurij Vynnyčuk, Oksana Zabužko)

    Czech Academy of Sciences Publication Activity Database

    Kratochvil, Alexander

    2015-01-01

    Roč. 60, č. 2 (2015), s. 164-183. ISSN 0044-3506 Institutional support: RVO:68378068 Keywords : contemporary ukrainian literature * 2nd world war * shoah * memory * trauma Subject RIV: AJ - Letters, Mass-media, Audiovision

  15. GNSS-R concept extended by a fine orbit tuning

    Czech Academy of Sciences Publication Activity Database

    Klokočník, Jaroslav; Bezděk, Aleš; Kostelecký, J.

    2012-01-01

    Roč. 49, č. 5 (2012), s. 957-965. ISSN 0273-1177 Institutional support: RVO:67985815 Keywords : bistatic altimetry * PARIS concept * orbit resonances Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.183, year: 2012

  16. TT2014 meeting report on the 12th Transgenic Technology meeting in Edinburgh: new era of transgenic technologies with programmable nucleases in the foreground

    Czech Academy of Sciences Publication Activity Database

    Beck, Inken; Sedláček, Radislav

    2015-01-01

    Roč. 24, č. 1 (2015), s. 179-183. ISSN 0962-8819 Institutional support: RVO:68378050 Keywords : Transgenic * Nuclease * Gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.322, year: 2014

  17. Escape dynamics: a continuous-time approximation

    Czech Academy of Sciences Publication Activity Database

    Kolyuzhnov, D.; Bogomolova, A.; Slobodyan, Sergey

    2014-01-01

    Roč. 38, January (2014), s. 161-183. ISSN 0165-1889 Institutional support: RVO:67985998 Keywords : constant gain adaptive learning * escape dynamics * recursive least squares Subject RIV: AH - Economics Impact factor: 1.018, year: 2014

  18. AcEST: DK953535 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0018_A12 582 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_A12. 5' end seq ... QNLKRPSVLALS 375 Query: 183 RQKLPNLPGTSIEGVTKGGYIISDNS MDKKPDLILMGTGSELEIAFKAAEAVRKELGRTV 362 RQKLP LPGTSI ... EGV KGGY+ISDNS ... KPD+IL+GTGSELEIA KA E +RKE G+ V Sbjct: 376 RQKLPQL ... PGTSIEGVEKGGYVISDNS SGNKPDVILIGTGSELEIAAKAGEVLRKE-GKGV 434 Query: 363 R ... LNRKRPSILALS 532 Query: 183 RQKLPNLPGTSIEGVTKGGYIISDNS MDKKPDLILMGTGSELEIAFKAAEAVRKELGRTV 362 RQKLP+LPGTSI ...

  19. Trienoic fatty acids and plant tolerance of temperature

    OpenAIRE

    Routaboul Jean-Marc; Browse John

    2002-01-01

    The biophysical reactions of light harvesting and electron transport during photosynthesis take place in a uniquely constructed bilayer, the thylakoid. In all photosynthetic eukaryotes, the complement of atypical glycerolipid molecules that form the foundation of this membrane are characterised by sugar head-groups and a very high level of unsaturation in the fatty acids that occupy the central portion of the thylakoid bilayer. alpha-linolenic (18:3) or a combination of 18:3 and hexadecatrien...

  20. Effects of isoflavone-supplemented soy yogurt on lipid parameters and atherosclerosis development in hypercholesterolemic rabbits: a randomized double-blind study

    OpenAIRE

    Pauly-Silveira Nadiége D; Bomdespacho Laura Q; Bedani Raquel; Vendramini Regina C; Abdalla Dulcinéia SP; Cavallini Daniela CU; de Valdez Graciela F; Rossi Elizeu A

    2009-01-01

    Abstract Background There is increasing interest in natural treatments to control dyslipidemia and reduce the risk of cardiovascular disease. Previous studies have demonstrated the beneficial effects of soy yogurt fermented with Enterococcus faecium CRL 183 and of dietary isoflavones on the lipid profile. The purpose of the present study was to investigate the effects of isoflavone-supplemented soy yogurt, fermented with E. faecium CRL183, on lipid parameters and atherosclerosis development i...

  1. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show ... rame = +1 Query: 16 MSPSTPL----NTNSPL*ITLEKIGSLALSLSIP HLKPYNSLYINNPSSYIPDCDIAYYH 183 +SP PL + +P +T E+IGS ... LS SIP ... Y S + P P + Sbjct: 94 LSPHDPLLQIKTSQTPTALTFERIGSAV ... LSTSIP QSSTYRSAQESAPHLLQPQFSLLPSA 153 Query: 184 EGLIWCPHQ ... rame = +1 Query: 16 MSPSTPL----NTNSPL*ITLEKIGSLALSLSIP HLKPYNSLYINNPSSYIPDCDIAYYH 183 +SP PL + +P +T E+IGS ...

  2. EST Table: FS762540 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available tein analogous to peritrophins 3-B [Tribolium castaneum] gb|ABL73928.1| obstractor B [Tribolium castaneum] g...:43321197:-1|gene:AGAP009790 10/09/10 68 %/183 aa gnl|Amel|GB17664-PA 10/09/10 77 %/183 aa gi|119387886|gb|ABL73928.1| obstractor B [Tribolium castaneum] FS939122 fcaL ...

  3. Alumina-Zirconia-Silica Coatings with Nanostructured Surface

    Czech Academy of Sciences Publication Activity Database

    Chráska, Tomáš; Dubský, Jiří

    Pittsburgh : MS&T Partner Societies, 2009 - (Parrington, R.). s. 183-183 ISBN 978-1-61503-006-4. [Materiále Science & Technology 2009 Conference and Exhibition. 25.10.2009-29.10.2009, Pittsburgh] R&D Projects: GA AV ČR KAN300430651 Institutional research plan: CEZ:AV0Z20430508 Keywords : nanocrystalline ceramics * plasma spraying * heat treatment Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  4. AcEST: DK962668 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0014_H20 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0014_H20. 5' end seq ... GMPHKFYHGRTGRIWNVTK 69 Query: 183 RAIGVEMNKQVNTRIVKKRI HVRIEHVLPSRCREDFIERVKKNDLLXXXXXXXXXXISTK 362 RA+GVE ... +NKQ+ RI++KRI HVR+EHV SRC E+F R K+ND+L ISTK Sbjct: 70 RAVGVEVNKQI ... GNRIIRKRI HVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTK 129 Query: ... GMPHKFYHGRTGRIWNVTK 69 Query: 183 RAIGVEMNKQVNTRIVKKRI HVRIEHVLPSRCREDFIERVKKNDLLXXXXXXXXXXISTK 362 RA+GVE ...

  5. 胸腔镜手术在中国地市级医院胸外科应用现状的问卷调查%A Questionnaire Study Investigating Current Application Status of Video-assisted Thoracoscopic Surgery of Thoracic Surgeons in Some Municipal Hospitals in China

    Institute of Scientific and Technical Information of China (English)

    杜恒; 廖虎; 宋志芳; 林琳; 马林; 车国卫; 刘伦旭

    2013-01-01

    目的 研究中国地市级医院胸外科医师对胸腔镜手术的认识及应用现状,为今后胸腔镜手术的学习与培训提供参考. 方法 对参加2012年成都第五届华西微创胸外科手术论坛会议的地市级医院医师进行问卷调查.调查内容包括医师及医师所在医院胸外科的基本情况和胸腔镜手术应用情况等.共发放问卷263份,对收回的有效问卷183份(69.58%)进行描述性分析. 结果 (1)对胸腔镜手术的看法:89.62% (164/183)的医师认为胸腔镜手术优点主要是创伤小且康复快,缺点是费用高(76.50%,140/183);71.04% (130/183)的医师认为肺癌患者行胸腔镜肺叶切除术后生活质量高,而仅有12.57% (23/183)认为5年生存率优于开胸手术;60.11% (110/183)的医师认为国内普及水平不如美国,但个别中心的水平优于或等同于美国;52.46% (96/183)认为胸腔镜手术可应用于局部晚期肺癌的治疗.(2)胸腔镜肺叶切除术学习情况:学习班或短期培训(32.24%,59/183)是胸腔镜肺叶切除术的最佳学习途径,开胸-小切口-腔镜(60.66%,111/183)是主要学习过程,而单向式(54.64%,100/183)是主要技术,其学习曲线是至少30例(26.78%,49/183);(3)胸腔镜应用情况:被调查医师所在的183家医院均开展胸腔镜手术,胸部良性疾病是最初开展(81.42%,149/183)的主要病种,肺癌肺叶切除术最初开展的困难是手术室及团队配合差(39.34%,72/183)和医师技术未成熟(36.07%,66/183);且胸腔镜技术的进一步优化(118/183,64.48%)是其发展方向. 结论 胸腔镜手术治疗胸部疾病(包括肺癌)已在中国大陆胸外科医师中达成共识,单向式是大家普遍采用的胸腔镜肺叶切除方法,胸腔镜培训和发展的方向是设备完善和建立团队.%Objective To explore current view and application status of video-assisted thoracoscopic surgery (VATS) of thoracic surgeons in some municipal hospitals in China

  6. Associação de marcadores moleculares SNP com o conteúdo de ácido linolênico em sementes de soja Association of SNP markers with the linolenic acid content in soybean seeds

    Directory of Open Access Journals (Sweden)

    Marcos de Oliveira Pinto

    2013-03-01

    Full Text Available O objetivo deste trabalho foi validar a associação de marcadores moleculares do tipo "single nucleotide polymorphism" (SNP para os genes FAD3A, FAD3B e FAD3C com o conteúdo de ácido linolênico (18:3 em sementes de soja e analisar a influência dos parâmetros genéticos destes marcadores nesta característica. Foram genotipadas 185 progênies F2 derivadas do cruzamento entre A29 (mutante para os três genes FAD3, 1% de 18:3 e Tucunaré (genótipo selvagem, 11% de 18:3. Os marcadores moleculares para os genes FAD3A, FAD3B e FAD3C explicaram a variação do conteúdo de 18:3 nas populações segregantes F2 e F2:3. Além disso, as substituições alélicas no loco FAD3A proporcionam maiores variações no conteúdo de 18:3 que as substituições nos outros dois locos.The objective of this work was to validate the association of single nucleotide polymorphism (SNP markers for the genes FAD3A, FAD3B, and FAD3C with the linolenic acid content (18:3 in soybean seeds and to analyze the influence of the genetic parameters of these markers on this trait. One hundred and eighty‑five F2 progenies derived from a cross between A29 (mutant for the three FAD3 genes, 1% 18:3 content and Tucunaré (wild‑type genotype, 11% 18:3 content were genotyped. The molecular markers for genes FAD3A, FAD3B, and FAD3C explained the variations in 18:3 content of the F2 and F2:3 segregating populations. In addition, allelic substitutions in the FAD3A locus provide greater variations in 18:3 content than substitutions in the other two loci.

  7. Investigation on status and risk factors of allergic rhinitis in children%儿童变应性鼻炎的现状调查及危险因素分析

    Institute of Scientific and Technical Information of China (English)

    黄懿娟; 武军驻

    2014-01-01

    Objective To understand the clinical features and risk factors of allergic rhinitis(AR) in children,in order to provide guidance for early diagnosis and treatment. Methods A total of 183 children with AR,who received treatment in the hos-pital from January 2009 to December 2010,were selected as case group by cases-control study;meanwhile another 183 children without disease of respiratory system were selected as control group. The related questionnaires were issued among the patients and patients in the case group for investigation. After returning,the results were entered into the database and analyzed statistically. Relative factors analysis in the two groups was conducted. Results The age of children with AR were mainly distributed in pre-school age(3-7 years old),accounting for 45.4%(83/183);90.7%(166/183) of the children with AR was combined with asthma;among the 183 patients,32.8%(60/183) of which had a history of drug allergy,and 52.5%(96/183) had a family history of aller-gies. Family history of allergy,exposure to pollen and eczema were major risk factors for AR. Conclusion The children,who have family history of allergy,history of eczema and long-term exposure to pollen,are susceptible to AR, and early prevention and treatment of AR can prevent the occurrence of asthma.%目的:了解儿童变应性鼻炎(AR)的发病特点及危险因素,为其早期临床诊断和治疗提供指导。方法采用病例对照研究方法,选取2009年1月至2010年12月确诊的183例AR患儿为病例组,并选取同期非呼吸系统疾病183例儿童为对照组,对病例组AR患儿及家长发放相关问卷进行调查,问卷收回后录入数据库,进行统计分析,对两组进行相关因素分析。结果变应性鼻炎患儿的年龄大多分布在学龄前期(3~7岁),占45.4%(83/183);有90.7%(166/183)的AR患儿合并哮喘;183例患儿中32.8%(60/183)有药物过敏史,52.5%(96/183)有家族过敏史;家族过

  8. A new technique for elucidating $\\beta$-decay schemes which involve daughter nuclei with very low energy excited states

    CERN Document Server

    Venhart, M; Boston, A J; Cocolios, T E; Harkness-Brennan, L J; Herzberg, R -D; Joss, D T; Judson, D S; Kliman, J; Matousek, V; Motycak, S; Page, R D; Patel, A; Petrik, K; Sedlak, M; Veselsky, M

    2016-01-01

    A new technique of elucidating $\\beta$-decay schemes of isotopes with large density of states at low excitation energies has been developed, in which a Broad Energy Germanium (BEGe) detector is used in conjunction with coaxial hyper-pure germanium detectors. The power of this technique has been demonstrated on the example of 183Hg decay. Mass-separated samples of 183Hg were produced by a deposition of the low-energy radioactive-ion beam delivered by the ISOLDE facility at CERN. The excellent energy resolution of the BEGe detector allowed $\\gamma$ rays energies to be determined with a precision of a few tens of electronvolts, which was sufficient for the analysis of the Rydberg-Ritz combinations in the level scheme. The timestamped structure of the data was used for unambiguous separation of $\\gamma$ rays arising from the decay of 183Hg from those due to the daughter decays.

  9. The Clinical Observation on the Treatment of Avascular Necrosis of Femoral Head with Comprehensive Therapy Dominated by Medical Ozone%医用臭氧为主联合中药治疗骨股头坏死的临床观察

    Institute of Scientific and Technical Information of China (English)

    华国昌

    2009-01-01

    Objective To investigate the clinical effect of treating avascular necrosis of femoral head with comprehensive therapy dominated by medical ozone. Methods Joint cavity of femoral articulation was performed blockage and injected with fluids for eliminating inflammation and reliving pain. After 5 to 10 minutes interval, if the patients did not show any abnormal reaction, medical Ozone with the concentration of 30%, 8 to 10ml, was injected to the joint cavity. Meanwhile, needle-knife therapy was used to reduce pressure inside the cavity. Traditional Chinese medicine was also used for the treatment. Results of all 183 femoral articulations of 135 cases, the therapeutic result of 38 articulations perfect, occupying 20.8% (38/183), 88 were good, occupying 48.1% (88/183), 31 were normal, occupying 16.9% (31/183) and 26 were bad, occupying 14.2% (26/183).The total effective rate was 85.8% (157/183). Conclusion The treatment of avascular necrosis of femoral head with comprehensive therapy dominated by medical ozone had outstanding therapeutic effects.%目的 探讨医用臭氧为主,辅以中药综合疗法治疗股骨头坏死的临床疗效.方法 行髋关节腔阻滞,注入消炎镇痛液后观察5~10min,患者无异常反映,则用10ml的注射空针把空针乳头插入臭氧治疗仪的出气嘴,稍用力下按,臭氧顶起针栓自动进入空针,达到所需量后迅速拔出针乳头,用带冒针头快速盖住乳头,尽快向关节腔注入浓度为30%的医用臭氧8~10ml.注射后被动活动髋关节,促进药物扩散.在关节注射腔进针处,针刀的刀刃平行于神经、血管走向刺入皮肤直达关节腔,将关节囊前壁切2~3刀,以降低关节腔内压力,减压后再配合中药治疗.按照ANFH评价标准进行疗效评价.结果 ①135例的183个髋关节中,优20.77%(38/183)、良48.09%(88/183)、可16.94%(31/183)、差14.21%(26/183),总有效率为85.79%(157/183).②ANFH分期Ⅰ+Ⅱ期为99.02%(101/102)、Ⅲ期为81

  10. Associação de marcadores moleculares SNP com o conteúdo de ácido linolênico em sementes de soja

    OpenAIRE

    Marcos de Oliveira Pinto; Pedro Ivo Vieira Good‑God; Maurílio Alves Moreira; Everaldo Gonçalves Barros

    2013-01-01

    O objetivo deste trabalho foi validar a associação de marcadores moleculares do tipo "single nucleotide polymorphism" (SNP) para os genes FAD3A, FAD3B e FAD3C com o conteúdo de ácido linolênico (18:3) em sementes de soja e analisar a influência dos parâmetros genéticos destes marcadores nesta característica. Foram genotipadas 185 progênies F2 derivadas do cruzamento entre A29 (mutante para os três genes FAD3, 1% de 18:3) e Tucunaré (genótipo selvagem, 11% de 18:3). Os marcadores moleculares p...

  11. CHARM: A CubeSat Water Vapor Radiometer for Earth Science

    Science.gov (United States)

    Lim, Boon; Mauro, David; DeRosee, Rodolphe; Sorgenfrei, Matthew; Vance, Steve

    2012-01-01

    The Jet Propulsion Laboratory (JPL) and Ames Research Center (ARC) are partnering in the CubeSat Hydrometric Atmospheric Radiometer Mission (CHARM), a water vapor radiometer integrated on a 3U CubeSat platform, selected for implementation under NASA Hands-On Project Experience (HOPE-3). CHARM will measure 4 channels at 183 GHz water vapor line, subsets of measurements currently performed by larger and more costly spacecraft (e.g. ATMS, AMSU-B and SSMI/S). While flying a payload that supports SMD science objectives, CHARM provides a hands-on opportunity to develop technical, leadership, and project skills. CHARM will furthermore advance the technology readiness level (TRL) of the 183 GHz receiver subsystem from TRL 4 to TRL 6 and the CubeSat 183 GHz radiometer system from TRL 4 to TRL 7.

  12. Influencia de la Peroxidación de Lípidos sobre el Daño Oxidativo Mitocondrial y la Integridad de Saccharomyces cerevisiae Influence of Lipoperoxidation over Mitochondrial Oxidative Damage and Integrity of Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Christian Cortés-Rojo

    2009-01-01

    Full Text Available Se ha estudiado la influencia de la peroxidación de lípidos sobre el daño oxidativo mitocondrial y la integridad de Saccharomyces cerevisiae. Para esto, se aumentó el grado de insaturación de las membranas celulares de S. cerevisiae con ácido α-linolénico (C18:3. Se obtuvieron esferoplastos para poder estudiar la función mitocondrial in situ. Se encontró que la peroxidación de lípidos, estimulada por la adición de Fe2+, incrementó únicamente en esferoplastos con C18:3, mientras que la función mitocondrial, medida como el consumo de oxígeno sensible a cianuro y la integridad celular, determinada por la exclusión del colorante azul de tripano, se ven afectadas de manera significativa sólo en esferoplastos con C18:3. Estos resultados muestran que la peroxidación de lípidos sensibiliza la integridad celular y la función mitocondrial hacia los daños por el estrés oxidativo.The influence of lipoperoxidation over mitochondrial oxidative damage and integrity of Saccharomyces cerevisiae has been studied. For this, the unsaturation degree of cell membranes from Saccharomyces cerevisiae was increased by adding α-linolenic acid (C18:3. Spheroplasts were obtained to evaluate in situ the mitochondrial function. Lipid peroxidation levels, stimulated by the treatment with Fe2+, increased only in spheroplasts with C18:3, while mitochondrial function, measured as cyanide-sensitive oxygen consumption, and cell integrity, determined by trypan blue exclusion, were affected significatively only in spheroplasts with C18:3. These results show that lipid peroxidation sensitizes cell integrity and mitochondrial function towards damaging effects of oxidative stress.

  13. Dicty_cDB: SHD815 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CR356247.4 Zebrafish DNA sequence *** SEQUENCING IN PROGRESS *** from clone. 38 0.50 9 AC127465 |AC127465.3 Didelphis virginiana...y lfc*ly**iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*yksfrygc ssqrw*sssf*f*wfsst...*ry lfc*ly**iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*yksfrygc ssqrw*sssf*f*wfs...stir*nfkdwslnfmysq*ihcl*n*tsqnqihlkslqwkik*n kif*n Frame C: kngnkkyisl*d*icke**inmfnlskry**rsssywl*nkiktl*wngcima...183 1e-44 J03473_1( J03473 |pid:none) Human poly(ADP-ribose) synthetase mRNA... 183 1e-44 AB384394_1( AB3843

  14. Ampicillin and Gentamicin Are a Useful First-line Combination for the Management of Sepsis in Under-five Children at an Urban Hospital in Bangladesh

    OpenAIRE

    Bibi, Samira; Chisti, Mohammod Jobayer; Akram, Farhana; Pietroni, Mark A.C.

    2012-01-01

    The study evaluated the commonly-used drugs for the management of sepsis and their outcome among under-five children. We evaluated the hospital-records of all paediatric sepsis patients (n= 183) in the intensive care unit (ICU) and longer-stay unit (LSU) of the Dhaka Hospital of icddr,b. These records were collected from the hospital management system (SHEBA) during November 2009 to October 2010. A total of 183 under-five children with clinical sepsis were found during the study period, and 1...

  15. Fluorescence spectrum analysis using Fourier series modeling for Fluorescein solution in Ethanol

    CERN Document Server

    Hadi, Mahasin F

    2011-01-01

    We have measured the fluorescence spectrum for fluorescein solution in ethanol with concentration 1 {\\times} 10-3 mol/liter at different temperatures from room temperature to freezing point of solvent, (T = 153, 183, 223, 253, and 303 K) using liquid nitrogen. Table curve 2D version 5.01 program has been used to determine the fitting curve and fitting equation for each fluorescence spectrum. Fourier series (3 {\\times} 2) was the most suitable fitting equation for all spectra. Theoretical fluorescence spectrum of fluorescein in ethanol at T = 183K was calculated and compared with experimental fluorescence spectrum at the same temperature. There is a good similarity between them.

  16. Dietary a-linolenic acid, linoleic acid, and n-3 long-chain PUFA and risk of ischemic heart disease

    DEFF Research Database (Denmark)

    Vedtofte, Mia Sadowa; Jakobsen, Marianne Uhre; Lauritzen, Lotte;

    2011-01-01

    n-3 (omega-3) PUFA has been proposed as having health-promoting effects, primarily in relation to ischemic heart disease (IHD). Whether these benefits can be achieved by both α-linolenic acid (ALA, 18:3n-3) and n-3 long-chain PUFA (LC-PUFA) is debatable.......n-3 (omega-3) PUFA has been proposed as having health-promoting effects, primarily in relation to ischemic heart disease (IHD). Whether these benefits can be achieved by both α-linolenic acid (ALA, 18:3n-3) and n-3 long-chain PUFA (LC-PUFA) is debatable....

  17. Effect of Linseed Oil Dietary Supplementation on Fatty Acid Composition and Gene Expression in Adipose Tissue of Growing Goats

    OpenAIRE

    Ebrahimi, M; Rajion, M. A.; Goh, Y. M.; Sazili, A. Q.; Schonewille, J. T.

    2013-01-01

    This study was conducted to determine the effects of feeding oil palm frond silage based diets with added linseed oil (LO) containing high α -linolenic acid (C18:3n-3), namely, high LO (HLO), low LO (LLO), and without LO as the control group (CON) on the fatty acid (FA) composition of subcutaneous adipose tissue and the gene expression of peroxisome proliferator-activated receptor (PPAR) α , PPAR- γ , and stearoyl-CoA desaturase (SCD) in Boer goats. The proportion of C18:3n-3 in subcutaneous ...

  18. Influence of Preheating Temperature on the Quality of the Interface between Plasma Sprayed Coatings and Substrate

    Czech Academy of Sciences Publication Activity Database

    Vilémová, Monika; Nevrlá, Barbara; Matějíček, Jiří; Mušálek, Radek

    Vol. 606. Zurich: Trans Tech Publications Ltd, 2014 - (Haušíld, P.; Materna, A.; Vilémová, M.), s. 183-186. (606). ISSN 1662-9795. [International Conference on Local Mechanical Properties, LMP 2013/10./. Kutná Hora (CZ), 06.11.2013-08.11.2013] R&D Projects: GA ČR(CZ) GAP108/12/1872 Institutional support: RVO:61389021 Keywords : Adhesion * Failure Mechanism * Interface Quality * Plasma Sprayed Coatings Subject RIV: JK - Corrosion ; Surface Treatment of Materials http://www.scientific.net/KEM.606.183

  19. Impact of Urban-Area Geometry on Pollution Ventilation

    Czech Academy of Sciences Publication Activity Database

    Kukačka, Libor; Fuka, V.; Nosek, Štěpán; Jaňour, Zbyněk

    Hatfield : University of Hertfordshire, 2014 - (Mitto, T.; Fallmann, J.; Mikolajczyk, U.; Suppan, P.; Singh, V.; Sokhi, R.). s. 183-183 ISBN 978-1-909291-20-1. [International Conference on Air Quality - Science and Application /9./. 24.03.2014-28.03.2014, Garmisch-Partenkirchen] R&D Projects: GA ČR GAP101/12/1554 Institutional support: RVO:61388998 Keywords : wind tunnel * large eddy simulation * atmospheric boundary layer * air pollution * scalar flux * urban-area ventilation * urban-area geometry * street canyon Subject RIV: DG - Athmosphere Sciences, Meteorology

  20. Measurement of the cross-section for the process $\\gamma^* \\gamma^* \\to$ hadrons at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G; Zöller, M

    1999-01-01

    Measurements of the two-photon interaction e+e- --> e+e- hadrons at sqrt(s) = 91 GeV and sqrt(s) = 183 GeV are presented. The double-tag events, collected with the L3 detector, correspond to integrated luminosities of 140 pb-1 at 91 GeV and 52 pb-1 at 183 GeV. The cross-section of gamma*gamma* collisions has been measured at = 3.5 GeV^2 and = 14 GeV^2. The data agree well with predictions based on perturbative QCD, while the Quark Parton Model alone is insufficient to describe the data.

  1. Millimeter-wave imaging radiometer for cloud, precipitation and atmospheric water vapor studies

    Science.gov (United States)

    Racette, P. E.; Dod, L. R.; Shiue, J. C.; Adler, R. F.; Jackson, D. M.; Gasiewski, A. J.; Zacharias, D. S.

    1992-01-01

    A millimeter-wave imaging radiometer (MIR) developed by NASA Goddard Space Flight Center is described. The MIR is a nine-channel total power radiometer developed for atmospheric research. Three dual-pass band channels are centered about the strongly opaque 183-GHz water vapor absorption line; the frequencies are 183 +/- 1, +/- 3, and +/- 7 GHz. Another channel is located on the wing of this band at 150 GHz. These four channels have varying degrees of opacity from which the water vapor profile can be inferred. The design and salient characteristics of this instrument are discussed, together with its expected benefits.

  2. Design and engineering of optical diagnostics for COMPASS

    Czech Academy of Sciences Publication Activity Database

    Šesták, David; Weinzettl, Vladimír; Bílková, Petra; Brotánková, Jana; Böhm, Petr; Aftanas, Milan; Naydenkova, Diana; Stöckel, Jan; Ďuran, Ivan

    Garching bei Munchen : Max-Planck-Institute fur Plasmaphysik, 2008. s. 183-183. ISBN N. [Symposium on Fusion Technology/25th./. 15.09.2008-19.09.2008, Rostock] R&D Projects: GA ČR GD202/08/H057 Institutional research plan: CEZ:AV0Z20430508 Keywords : COMPASS * tokamak * optical diagnostic * Thomson scattering Subject RIV: BL - Plasma and Gas Discharge Physics http://www.ipp.mpg.de/eng/for/veranstaltungen/soft2008/resource/abstracts/BookOfAbstracts_final.pdf

  3. Radiometric remote sensing of mesospheric and stratospheric water vapor

    Science.gov (United States)

    Croskey, Charles L.; Olivero, John J.; Martone, Joseph P.

    1991-01-01

    The remote sensing of stratospheric and mesospheric water vapor by microwave and millimeter radiometry is described. The received radiation is emitted by and interacts with all levels of the atmosphere. The pressure dependence of the linewidth for the absorption cross section of water vapor permits retrieval of vapor mixing ratios. The 183.31-GHz line of water vapor can also be used for remote sensing of the water vapor concentration in the upper atmosphere, but due to the much stronger absorption cross section for this line, ground-based observations are difficult. To date all measurements at 183 GHz have been made from platforms above the troposphere.

  4. Dicty_cDB: Contig-U01584-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YFN IDWKCNTQDIFINDMGYYDIASILNPKRNCHAFKTPCDEIVSLNITDCHGSQPFNSSCRF VLNYYRDTISCDNIPVLVTDFNCESF...YFN IDWKCNTQDIFINDMGYYDIASILNPKRNCHAFKTPCDEIVSLNITDCHGSQPFNSSCRF VLNYYRDTISCDNIPVLVTDFNCESFGKHHD...st U01584 List of clone(s) est1= SSC155F ,1,183 est2= SSC447F ,6,183 est3= SSJ617Z ,184,875 est4= SSM449Z ,190,791 est5= SSC1...e SSM449. 1005 0.0 1 ( C84870 ) Dictyostelium discoideum slug cDNA, clone SSC155. 660 0.0 1 ( C84180 ) Dicty...93608 ) E012766-024-026-P12-SP6 MPIZ-ADIS-024-developing ... 44 9.2 1 ( CP000716

  5. AcEST: DK949780 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_O12 646 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_O12. 5' end seq ... 8 + D+ ++E + K+ + K+ + AP+KR + M +R ++ +L+ K+ DD + MAR S bjct: 125 IEVDEEKELEPVEAKTEVVKRLEELAASAAPVKRHSSMSE ... /175 (72%), Gaps = 2/175 (1%) Frame = +2 Query: 11 MARS KRTYKKSKPTVKVGLPSRKPFKPRPATP--LPANAVLNSAEWDESASLLRN ... 184 (63%), Gaps = 17/184 (9%) Frame = +2 Query: 11 MARS KRTYKKSKPTVKVGLPSRKP--FKPRPATPLPANAVLNSA---EWDESASL ... 183 (63%), Gaps = 16/183 (8%) Frame = +2 Query: 11 MARS KRTYKKSKPTVKVGLPSRKPFKPRPATPLP-ANAVLNSAE-------WDES ...

  6. Nuclear medicine. Abstracts; Nuklearmedizin 2000. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2000-07-01

    This issue of the journal contains the abstracts of the 183 conference papers as well as 266 posters presented at the conference. Subject fields covered are: Neurology, psychology, oncology, pediatrics, radiopharmacy, endocrinology, EDP, measuring equipment and methods, radiological protection, cardiology, and therapy. (orig./CB) [German] Die vorliegende Zeitschrift enthaelt die Kurzfassungen der 183 auf der Tagung gehaltenen Vortraege sowie der 226 praesentierten Poster, die sich mit den folgenden Themen befassten: Neurologie, Psychiatrie, Onkologie, Paediatrie, Radiopharmazie, Endokrinologie, EDV, Messtechnik, Strahlenschutz, Kardiologie sowie Therapie. (MG)

  7. EST Table: BY938382 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BY938382 E_FL_e100_05P15_F_0 10/09/28 66 %/183 aa ref|XP_001600958.1| PREDICTED: si...0/09/10 64 %/193 aa gnl|Amel|GB30214-PA 10/09/10 66 %/183 aa gi|189237999|ref|XP_001812951.1| PREDICTED...A 10/08/28 low homology 10/09/10 60 %/192 aa AGAP005604-PA Protein|2L:17803628:17804284:1|gene:MED20_ANOGA 1

  8. AcEST: DK947586 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0016_G02 527 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0016_G02. 5' end seq ... KENVNNALWNCLSYPFVREKMSSGELTLHG 182 DW+ I A KV + H +A F E QCT CEKE VN +L N L+YPFVR+ + L L G Sbjct: 235 DWVK ... VNVSLGNLLTYPFVRDGLVKKTLALQG 294 Query: 183 GYYDFVNNAFE SWSVD 230 GYYDFVN +FE W ++ Sbjct: 295 GYYDFVNGSFELW ... EKENVNNALWNCLSYPFVREKMSSGELTLHG 182 +W+ I A KVK+ H A F E ... CT CEKE VN +L N L+YPFVRE + + L L G Sbjct: 244 EW ... VNASLGNLLTYPFVREGLVNKTLALKG 303 Query: 183 GYYDFVNNAFE SWSVDLASMS 245 GYYDFV +FE W ++ S Sbjct: 304 GYYDFVK ...

  9. Tungsten isotopes in bulk meteorites and their inclusions-Implications for processing of presolar components in the solar protoplanetary disk

    DEFF Research Database (Denmark)

    Holst, Jesper Christian; Paton, Chad; Wielandt, Daniel Kim Peel;

    2015-01-01

    that 183W is variable due to a nucleosynthetic s-process deficit/r-process excess among chondrites and iron meteorites. This variability supports the widespread nucleosynthetic s/r-process heterogeneity in the protoplanetary disk inferred from other isotope systems and we show that W and Ni...... isotope variability is correlated. Correlated isotope heterogeneity for elements of distinct nucleosynthetic origin (183W and 58Ni) is best explained by thermal processing in the protoplanetary disk during which thermally labile carrier phases are unmixed by vaporization thereby...

  10. Increasing withdrawal rates add oil reserves in Java Sea area

    International Nuclear Information System (INIS)

    This paper reports on an offshore Southeast Sumatra contract area, resizing downhole pumps which increased withdrawal rates from 36 to 37 worked-over wells. These greater fluid producing rates, according to decline curve analysis, will substantially add to the recoverable oil reserves. The work increased an average well's oil production rate by 183 bo/d and added 183,000 bbl/well to recoverable oil reserves without materially affecting water cut. The cost of the reserve additions was $0.37/bbl. No loss in ultimate recovery was indicated for any of the wells

  11. Increasing withdrawal rates add oil reserves in Java Sea area

    Energy Technology Data Exchange (ETDEWEB)

    Ventura, J. (Maxis Energy Corp., Dallas, TX (US)); Temansja, A.D. (Maxus Southeast, Sumatra Inc., Jakarta (ID))

    1991-11-18

    This paper reports on an offshore Southeast Sumatra contract area, resizing downhole pumps which increased withdrawal rates from 36 to 37 worked-over wells. These greater fluid producing rates, according to decline curve analysis, will substantially add to the recoverable oil reserves. The work increased an average well's oil production rate by 183 bo/d and added 183,000 bbl/well to recoverable oil reserves without materially affecting water cut. The cost of the reserve additions was $0.37/bbl. No loss in ultimate recovery was indicated for any of the wells.

  12. Charakteristické vlastnosti konopného oleje pro použití v potravinářství

    OpenAIRE

    PROCHÁZKOVÁ, Marie

    2012-01-01

    This work deals with the characteristics of cannabis sativa, which is the most widespread kind of cannabis and it belongs to menials of hemp plants. The hemp´s oil contains the most unsaturated fatty acids off all oils. Proportion of acid is 51 - 65 % of linoleic acid (LAC 18:2, w - 6), 19 - 25 % of ? - linolenic acid (ALA C18:3, w - 3), and 2 - 5 % of ? - linolenic acid (GLA C18:3, w - 6). There are also 6 - 9 % of palm and 2 - 3 % stearic acid. The drawback of cannabis o...

  13. Complete Genome Sequence of the Human Gut Symbiont Roseburia hominis

    DEFF Research Database (Denmark)

    Travis, Anthony J.; Kelly, Denise; Flint, Harry J; Aminov, Rustam

    2015-01-01

    We report here the complete genome sequence of the human gut symbiont Roseburia hominis A2-183(T) (= DSM 16839(T) = NCIMB 14029(T)), isolated from human feces. The genome is represented by a 3,592,125-bp chromosome with 3,405 coding sequences. A number of potential functions contributing to host...

  14. China Strongly Condemns Massacre(谴责大屠杀) on Bali Island

    Institute of Scientific and Technical Information of China (English)

    陈绍璋

    2003-01-01

    Foreign Ministry spokeswoman Zhang Qiyue said yesterday China strongly condemns the violent explosions on Indonesia's resort(胜地) island of Bali on Saturday night which left at least 183 dead and more than 300 injured. Zhang made the remarks when asked to comment (评论) on whether there were any victims of Chinese nationality.

  15. Dicty_cDB: Contig-U11690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 190/190 (100%) Strand = Plus / Plus Query: 182 gatgnagatatcnttcaaagatttaatccnattagnntggtcntttcnatnaaaccna...aa 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 182 gatgnagatatcnttcaaagatttaatccna...ttagnntggtcntttcnatnaaaccnaaa 241 Query: 242 tnggattnntcnattaggccatatnttttnaaan... = 9e-41 Identities = 189/189 (100%) Strand = Plus / Minus Query: 183 atgnagatatcnttcaaagatttaatccna...ttagnntggtcntttcnatnaaaccnaaat 242 ||||||||||||||||||||||||||||||||||||||||||||||||||||||

  16. Dicty_cDB: Contig-U12608-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore = 216 bits (109), Expect = 1e-56 Identities = 248/253 (98%) Strand = Plus / Plus Query: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccn...||||||||||||||||||||||||||||| Sbjct: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccnanaacctgaaagnattgnatt 63 Query...atgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccnaggcna 183 ||||||||||||||||||...|||||||||||||||||||||||||||||||||||||||||| Sbjct: 124 ttatgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccna...xpect = 2e-05 Identities = 83/105 (79%) Strand = Plus / Plus Query: 150 atcnaaaatcnactgcttcaaccccccnaggcnang

  17. Glucose-induced monoubiquitination of the Saccharomyces cerevisiae galactose transporter is sufficient to signal its internalization

    Czech Academy of Sciences Publication Activity Database

    Horák, Jaroslav; Wolf, D. H.

    2001-01-01

    Roč. 183, č. 10 (2001), s. 3083-3088. ISSN 0021-9193 R&D Projects: GA ČR GA204/98/0475; GA AV ČR IAA5011005 Institutional research plan: CEZ:AV0Z5011922 Keywords : Saccharomyces cerevisiae Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.984, year: 2001

  18. Leader - Member Exchange in Different Organizational Cultures and Effects to Organizational Burnout

    OpenAIRE

    Erdem Kırkbeşoğlu; Şule Tuzlukaya

    2014-01-01

    The purpose of this study is to examine the effect of leader- member exchange to burnout syndrome in different organizational cultures. Sample of the study is constituted by 183 participants who work in life insurance companies which represent organic organizational culture and non-life insurance companies which represent mechanical organizational culture. As a result of regression and correlation analysis, it is determined t...

  19. An efficient PAH-degrading Lentinus (Panus) tigrinus strain: Effect of inoculum formulation and pollutant bioavailability in solid matrices

    Czech Academy of Sciences Publication Activity Database

    Covino, S.; Čvančarová, M.; Muzikář, Milan; Svobodová, Kateřina; D´Annibale, A.; Petruccioli, M.; Federici, F.; Křesinová, Z.; Cajthaml, Tomáš

    2010-01-01

    Roč. 183, 1-3 (2010), s. 669-676. ISSN 0304-3894 R&D Projects: GA MŠk 2B06156 Institutional research plan: CEZ:AV0Z50200510 Keywords : Biodegradation * White rot fungi * Polycyclic aromatic hydrocarbons Subject RIV: EE - Microbiology, Virology Impact factor: 3.723, year: 2010

  20. Proprietes dielectriques des fruits et des legumes; cas des produits traites par DIC

    Czech Academy of Sciences Publication Activity Database

    Klíma, L.; Sobolík, Václav; Allaf, K.

    Nantes: TEC&DOC, 2004, s. 179-183. ISBN 2-7430-0754-0. [rencontres Agoral Nantes 2004 /16./. Nantes (FR), 30.11.2004-01.12.2004] Grant ostatní: DIC SME(XE) IPS/2000/00087 Institutional research plan: CEZ:AV0Z4072921 Keywords : dielectric characteristics * DIC * expansion Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  1. Feeding habits of reintroduced Eurasian beaver: spatial and seasonal variation in the use of food resources

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Hamšíková, L.; Vorel, A.

    2010-01-01

    Roč. 281, č. 3 (2010), s. 183-193. ISSN 0952-8369 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Castor fiber * diet composition * faecal analysis * PCA Subject RIV: EH - Ecology, Behaviour Impact factor: 1.787, year: 2010

  2. ARP2 and ARP3 are localized to sites of actin filament nucleation in tobacco BY-2 cells

    Czech Academy of Sciences Publication Activity Database

    Fišerová, J.; Schwarzerová, K.; Petrášek, Jan; Opatrný, Z.

    2006-01-01

    Roč. 227, 2-4 (2006), s. 119-128. ISSN 0033-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : Nicotiana tabacum * BY-2 cells * actin filament Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.333, year: 2006

  3. Occurrence of chiral organochlorine compounds in the environmental matrices from King George Island and Ardley Island, west Antarctica

    Science.gov (United States)

    Wang, Pu; Zhang, Qinghua; Li, Yingming; Zhu, Chaofei; Chen, Zhaojing; Zheng, Shucheng; Sun, Huizhong; Liang, Yong; Jiang, Guibin

    2015-09-01

    Chiral organochlorine compounds (OCs) were measured in various environmental matrices (air, soil and vegetation) from west Antarctica using high resolution gas chromatography coupled with high resolution mass spectrometry (HRGC/HRMS). They were generally detected at a global background level compared with the previous studies. α-HCH and PCB-183 was observed in all the matrices except PCB-183 in two soil samples, while PCB-95, -136, -149, -174, -176 and o,p’-DDT were detected in most air but only a few solid matrices. Enantiomeric fractions (EFs) indicated that nonracemic residues of chiral OCs occurred in all the matrices and a wide variation of the EF values was observed in the vegetation. There was significant discrepancy between the EF values of PCB-183 and the racemic values, indicating that stereoselective depletion of PCB-183 was probably associated with the water-air exchange. The EFs values of α-HCH were generally lower than the racemic values but no statistical difference was obtained in all the matrices except lichen, supporting the assumption that water-air exchange may make influence on long-range transport of α-HCH.

  4. Separation of trivalent actinides and lanthanides from simulated high-level waste using cobalt bis(dicarbollide) ion derivate substituted with diphenyl-N-tert.octyl-carbamoylmethylphosphine oxide

    Czech Academy of Sciences Publication Activity Database

    Selucký, P.; Lučaníková, M.; Grüner, Bohumír

    2012-01-01

    Roč. 100, č. 3 (2012), s. 179-183. ISSN 0033-8230 R&D Projects: GA MŠk LC523; GA ČR GA104/09/0668 Institutional research plan: CEZ:AV0Z40320502 Keywords : dicarbollide * CMPO * liquid-liquid extraction * actinides * lanthanides Subject RIV: CA - Inorganic Chemistry Impact factor: 1.373, year: 2012

  5. Response of arginine vasopressin-enhanced green fluorescent protein fusion gene in the hypothalamus of adjuvant-induced arthritic rats

    Czech Academy of Sciences Publication Activity Database

    Suzuki, H.; Onaka, T.; Kasai, M.; Kawasaki, M.; Ohnishi, H.; Otsubo, H.; Saito, T.; Hashimoto, H.; Yokoyama, T.; Fujihara, H.; Dayanithi, Govindan; Murphy, D.; Nakamura, T.; Ueta, Y.

    2009-01-01

    Roč. 21, č. 3 (2009), s. 183-190. ISSN 0953-8194 Institutional research plan: CEZ:AV0Z50390512 Keywords : arginine vasopressin * Corticotrophin-releasing hormone * GFP Subject RIV: FH - Neurology Impact factor: 3.700, year: 2009

  6. Association of trace elements with colloidal fractions in leachates from closed and active municipal solid waste landfills

    Czech Academy of Sciences Publication Activity Database

    Matura, M.; Ettler, V.; Ježek, J.; Mihaljevič, M.; Šebek, O.; Sýkora, V.; Klementová, Mariana

    2010-01-01

    Roč. 183, 1-3 (2010), s. 541-548. ISSN 0304-3894 Institutional research plan: CEZ:AV0Z40320502 Keywords : Landfill * leachate * trace elements * colloids * cascade filtration Subject RIV: DD - Geochemistry Impact factor: 3.723, year: 2010

  7. Arsenic speciation in drugs by selective hydride generation-cryotrapping-gas chromatography-atomic absorption spectrometry with the multiatomizer

    Czech Academy of Sciences Publication Activity Database

    de Moraes, D. P.; Dědina, Jiří; Matoušek, Tomáš; de Moraes Flores, E. M.

    2010. s. 183. [Rio Symposium on Atomic Spectrometry /11./. 24.10.2010-29.10.2010, Mar del Plata] R&D Projects: GA ČR GA203/09/1783 Institutional research plan: CEZ:AV0Z40310501 Keywords : arsenic * HG-CT-AAS * multiatomizer Subject RIV: CB - Analytical Chemistry, Separation http://www.11thriosymposium.com.ar/index.htm

  8. Úvod do statistiky

    Czech Academy of Sciences Publication Activity Database

    Hurt, K.; Zvárová, Jana

    Praha: Galén, 2004 - (Halaška, M.), s. 183-186 ISBN 80-7262-272-2 Source of funding: V - iné verejné zdroje Keywords : urogynekologie * statistika * epidemiologie Subject RIV: BB - Applied Statistics, Operational Research

  9. 46 CFR 182.455 - Fuel piping.

    Science.gov (United States)

    2010-10-01

    ... piping of other materials, such as seamless steel pipe or tubing, which provide equivalent safety may be... by reference; see 46 CFR 175.600), or 33 CFR 183, subpart J, or with machinery powered by diesel fuel and a fuel system built in accordance with ABYC H-33 (incorporated by reference; see 46 CFR...

  10. 75 FR 59086 - Approval and Promulgation of Air Quality Implementation Plans; Maryland; Adoption of Control...

    Science.gov (United States)

    2010-09-27

    ... established the four groups of categories in the Federal Register on March 23, 1995 (60 FR 15264). Flexible... under CAA section 183(e). EPA published a revised schedule and grouping on March 18, 1999 (64 FR 13422). EPA again revised the list to regroup the product categories on November 17, 2005 (70 FR 69759)....

  11. Breast cancer-associated protein - a novel binding partner of Mason-Pfizer monkey virus protease

    Czech Academy of Sciences Publication Activity Database

    Rumlová, Michaela; Křížová, Ivana; Hadravová, Romana; Doležal, Michal; Strohalmová, Karolína; Keprová, Alena; Pichová, Iva; Ruml, T.

    2014-01-01

    Roč. 95, č. 6 (2014), s. 1383-1389. ISSN 0022-1317 R&D Projects: GA ČR GA204/09/1388 Institutional support: RVO:61388963 Keywords : gene * AKIP1 * expression Subject RIV: EE - Microbiology, Virology Impact factor: 3.183, year: 2014

  12. Peanut, Cotton, and Corn Yield and Partial Net Income with Two Surface Drip Lateral Spacings

    Science.gov (United States)

    Surface drip irrigation laterals were spaced next to crop rows (0.91 m) and in alternate row middles (1.83 m) to document crop yield and partial net economic returns compared with non-irrigated peanut (Arachis hypogaea), cotton (Gossypium hirsutum), and corn (Zea mays). A drip irrigation system was ...

  13. Berge und Jahrhunderte. Nikola Šuhaj und die literarische Polyglossie in den Karpaten

    Czech Academy of Sciences Publication Activity Database

    Kratochvil, Alexander

    Bielefeld: Transcript, 2013 - (Kratochvil, A.; Makarska, R.; Schwitin, K.; Werberger, A.), s. 165-183. (Kulturwissenschaft. 2). ISBN 978-3-8376-1777-1 Institutional support: RVO:68378068 Keywords : Czech literature * Olbracht, Ivan Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. Phylogenetic analysis of coccidian parasites from invertebrates: search for missing links

    Czech Academy of Sciences Publication Activity Database

    Kopečná, Jana; Jirků, Milan; Oborník, Miroslav; Tokarev, Y. S.; Lukeš, Julius; Modrý, David

    2006-01-01

    Roč. 157, č. 2 (2006), s. 173-183. ISSN 1434-4610 R&D Projects: GA ČR GP524/03/D104 Institutional research plan: CEZ:AV0Z60220518 Keywords : Adelina * Aggregata * molecular phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.262, year: 2006

  15. Housing Services for Child Welfare-Involved Families: An Initial Evaluation Using Observational Data

    Science.gov (United States)

    Fowler, Patrick J.; Taylor, Jeremy J.; Rufa, Anne K.

    2011-01-01

    This study evaluated the impact of housing services among child welfare-involved families using observational data. Propensity score matching with data from the National Survey of Child and Adolescent Well-Being compared intact families (n = 183) who received housing services 12 months after initial investigation to nontreated families balanced on…

  16. Mineralogy of Bohemian green earth pigment and its microanalytical evidence in historical paintings

    Czech Academy of Sciences Publication Activity Database

    Hradil, David; Píšková, Anna; Hradilová, J.; Bezdička, Petr; Lehrberger, G.; Gerzer, S.

    2011-01-01

    Roč. 53, č. 3 (2011), s. 563-586. ISSN 0003-813X R&D Projects: GA ČR GA203/07/1324 Institutional research plan: CEZ:AV0Z40320502 Keywords : Bohemian green earth * celadonite * smectite * microanalysis Subject RIV: CA - Inorganic Chemistry Impact factor: 1.183, year: 2011

  17. Who Goes Where? Choice of Single-Sex and Coeducational Independent Secondary Schools.

    Science.gov (United States)

    Lee, Valerie E.; Marks, Helen M.

    1992-01-01

    Discusses a study of why 3,183 secondary school students and their families chose either single-sex or coeducational independent schools. Considers the personal, demographic, and educational characteristics of the students and their families and the students' gender. Reports that family traditions for private schooling and religious orientation…

  18. K basin sandfilter backwash line characterization project, analytical results for campaign 15

    International Nuclear Information System (INIS)

    Sample 183KWBMF was taken from the K West Sandfilter Backwash Pit on August 28, 1998 and received by 222-S Laboratory on August 28, 1998. Analyses were performed in accordance with ''Letter of Instruction for K Basins Sandfilter Backwash Line Samples'' (LOI) in support of the K Basin Sandfilter Backwash Line Characterization Project

  19. Seroprevalence of Chlamydia abortus in camel in the western region of Libya

    Directory of Open Access Journals (Sweden)

    Rabia Elzlitne

    2016-06-01

    Conclusion: The present findings signify the C. abortus as a potential agent to cause abortion in Libyan camel (C. dromedarius. Besides, the persons who handle camels in Libya are at risk of infecting with C. abortus. [J Adv Vet Anim Res 2016; 3(2.000: 178-183

  20. Dicty_cDB: Contig-U13025-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13025-1 no gap 183 4 5130027 5129843 MINUS 2 2 U13025 0 0 0 0 0 0 0 0 0 2 0 0 0 0 Show C ... 11, 5' ... 161 1e-35 1 ( CX078116 ) UCRCS08_7A11_g Parent ... Washington Navel Orange Cal... 36 0.079 2 ( AC2091 ...

  1. Interparental Conflict and Adolescents' Romantic Relationship Conflict

    Science.gov (United States)

    Simon, Valerie A.; Furman, Wyndol

    2010-01-01

    This study examined associations between interparental conflict and adolescents' romantic relationship conflict. High school seniors (N = 183) who lived with married parents completed questionnaires about their parents' marriage and their own romantic relationships. A subset of 88 adolescents was also observed interacting with their romantic…

  2. Genetic Diversity of Turf-Type Tall Fescue Using Diversity Arrays Technology

    Czech Academy of Sciences Publication Activity Database

    Baird, J. H.; Kopecký, David; Lukaszewski, A.J.; Green, R. J.; Bartoš, Jan; Doležel, Jaroslav

    2012-01-01

    Roč. 52, č. 1 (2012), s. 408-412. ISSN 0011-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : Festuca arundinacea * Diversity Arrays Technology (DArT) * Low genetic polymorphism Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.513, year: 2012

  3. Dicty_cDB: VFF511 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF511 (Link to dictyBase) - - - Contig-U15456-1 VFF511P (Link to Original ... 57_1( DQ868657 |pid:none) Cucumis sativus aspartic proteinas ... 183 1e-80 (Q805F2) RecName: Full=Cathepsin E-B; ...

  4. Influence of hot bending on microstructure changes of thick-walled P92 steel pipe

    Czech Academy of Sciences Publication Activity Database

    Král, Petr; Sklenička, Václav; Kuchařová, Květa; Kvapilová, Marie; Svobodová, M.

    Toulouse : Institut Carnot CIRIMAT, 2015. s. 182-183. [CREEP 2015 - International Conference on Creep and Fracture of Engineering Materials and Structures /13./. 31.05.2015-04.06.2015, Toulouse] R&D Projects: GA TA ČR TA02010260 Institutional support: RVO:68081723 Keywords : hot bending * P92 steel pipe * creep behaviour * microstructure * EBSD Subject RIV: JG - Metallurgy

  5. AcEST: DK952948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0015_H15 490 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H15. 5' end seq ... VMGKGGVGKSSTVNSVIGEKAAAVSTFQS 71 Query: 186 ETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDRLDGY ... VMGKGGVGKSSTVNSIIGERVVSISPFQ 71 Query: 183 SETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDRLDG 3 ... VLGKGGVGKSSTVNSLIGEQVVRVSPFQA 69 Query: 186 ETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDRLDGY ... (2%) Frame = +3 Query: 138 NSLVGERVAVVSAFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLF---VNDHALDTIRR 308 NS+ E AFQ T ...

  6. Percepce a image malých měst

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Pokluda, František

    Brno: Regiograph, 2004 - (Vaishar, A.), s. 174-183 ISBN 80-86377-12-1 R&D Projects: GA AV ČR IAA3086301 Institutional research plan: CEZ:AV0Z3086906 Keywords : perception * city in mind * image * small towns * urban liveability Subject RIV: AO - Sociology, Demography

  7. Sociálna inteligencia vo vzťahu k interpersonálnym črtám

    Czech Academy of Sciences Publication Activity Database

    Baumgartner, František

    2009-01-01

    Roč. 53, č. 2 (2009), s. 172-183. ISSN 0009-062X R&D Projects: GA ČR GA406/09/2096 Institutional research plan: CEZ:AV0Z70250504 Keywords : social intelligence * interpersonal traits * gender differences Subject RIV: AN - Psychology Impact factor: 0.226, year: 2009

  8. China's Oil Imports and Exports in 2007

    Institute of Scientific and Technical Information of China (English)

    Tian Chunrong

    2008-01-01

    @@ The net imports of oil increased by 8.4% in China in 2007, hitting the record of 183.48 million tons (Fig.l).The net imports of crude oil and other oil products including paraffin wax, oil coke, and asphalt increased and balanced out the decrease of the net imports of product oil and liquefied petroleum gas (LPG).

  9. 76 FR 44388 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-07-25

    ...), 75 FR 47335 (August 5, 2010) (SR-BATS-2010-020) (notice of filing and immediate effectiveness...), 76 FR 8793 (February 15, 2011) (SR-Phlx-2010-183) (order granting approval of expansion of short term... Exchange Act Release Nos. 64009 (March 2, 2011), 76 FR 12771 (March 8, 2011) (SR-BX-2011-014) (notice...

  10. Growth and yield response of calendula (Calendula officinalis) to sowing date in the northern U.S.

    Science.gov (United States)

    Calendula (Calendula officinalis L.) seed is a rich source of the conjugated C18:3 fatty acid calendic acid and can serve as a replacement for VOCs in many industrial chemicals such as paints, coatings and adhesives. Calendula is widely adapted to temperate climates and may be a beneficial rotationa...

  11. Seed germination of calendula in response to temperature

    Science.gov (United States)

    Calendula (Calendula officinalis L.) has been used historically for herbal medicinal purposes and as an ornamental plant. With the discovery that calendula seeds contain high concentrations of calendic acid (C18:3) in the 1980s it began to be investigated as an oilseed crop for use in paint, coating...

  12. Calendula: A Potential New Oilseed Crop for the Northern U.S.

    Science.gov (United States)

    Seeds of calendula (Calendula officinalis) are a rich source of calendic acid (conjugated C18:3), a highly oxidative fatty acid that can be used to replace volatile organic compounds (VOC) as a drying agent in many industrial chemicals including paints and adhesives. Calendula flourishes in temperat...

  13. Svatováclavský cyklus a další obrazy pro klášter na Zderaze. [Úvodní studie a katalogová hesla

    Czech Academy of Sciences Publication Activity Database

    Dobalová, Sylva

    Praha : Národní galerie, 2010 - (Stolárová, L.; Vlnas, V.), s. 156-159, 160-177, 183-193, 196-197 ISBN 978-80-7035-458-2 Institutional research plan: CEZ:AV0Z80330511 Keywords : baroque painting * St Wenceslas * Antonio Tempesta * Discalced Augustinians Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. The Academic Preparation Recommended by Public Relations Employers.

    Science.gov (United States)

    Wakefield, Gay; Cottone, Laura Perkins

    Questionnaires were mailed to 261 agencies involved in public relations and publicity services, 56 agencies involved in advertising, and public relations directors of 183 corporations and other nonagency organizations in order to determine the knowledge and skill areas important to agency and organizational public relations employers. In an effort…

  15. Communication Curricula and Ethics.

    Science.gov (United States)

    Harrison, S. L.

    A study examined the role of ethics in advertising and public relations courses. A questionnaire was sent to 183 colleges and universities that offer major fields of studies in advertising or public relations, and 134 institutions responded for a return rate of 73%. Results indicated that: (1) nearly all (97%) of the respondents affirm that the…

  16. Pedagogical Ethics: A Review of the Literature for Public Relations and Advertising.

    Science.gov (United States)

    Harrison, Stanley L.

    Ethics is of increasing concern to United States colleges and universities, according to a survey of 183 institutions on this issue focusing on two areas--public relations and advertising. A 75% return from 134 institutions disclosed that some 25% offer an ethics course but less than half require one. Overwhelmingly (93%), most respondents…

  17. Preconditions of an Intercultural Dialogue on Human Rights

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2010-01-01

    Roč. 55, č. 1 (2010), s. 183-205. ISSN 0042-3955 R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : intercultural dialogue * human rights * civilization Subject RIV: AA - Philosophy ; Religion

  18. Comparison of single and boosted protease inhibitor versus nonnucleoside reverse transcriptase inhibitor-containing cART regimens in antiretroviral-naïve patients starting cART after January 1, 2000

    DEFF Research Database (Denmark)

    Mocroft, A; Horban, A; Clumeck, N;

    2006-01-01

    increase) response in antiretroviral-naïve patients starting either a single protease inhibitor (PI; n = 183), a ritonavir-boosted PI regimen (n = 197), or a nonnucleoside reverse transcriptase inhibitor (NNRTI)-based cART regimen (n = 447) after January 1, 2000, and the odds of lack of virologic or...

  19. Drawing on Stereotypes: Using Undergraduates' Sketches of Elders as a Teaching Tool

    Science.gov (United States)

    Barrett, Anne E.; Cantwell, Laura E.

    2007-01-01

    Using data collected from undergraduates at two large, public universities (N = 183), we examined features of student drawings (e.g., facial expressions) as reflections of dominant views of the elderly. Sketches depicted both negative (e.g., frailty) and positive stereotypes (e.g., kindness). They also illustrate gender inequality; for example,…

  20. Drug: D04564 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04564 Drug Iodipamide sodium I 131 (USAN); Radio -cholografin (TN) C20H12I6N2O6. 2Na 1207.4858 1 ... 183.7254 D04564.gif Radio active agent CAS: 24360-85-8 PubChem: 47206408 Liga ...

  1. Content and Timing of Feedback in a Web-based Learning Environment: Effects on Learning as a function of prior knowledge.

    OpenAIRE

    Smits, Marieke; Boon, Jo; Sluijsmans, Dominique; van Gog, Tamara

    2008-01-01

    Smits, M. H. S. B., Boon, J., Sluijsmans, D. M. A., & Van Gog, T. (2008). Content and timing of feedback in a web-based learning environment: Effects on learning as a function of prior knowledge. Interactive Learning Environments, 16, 183-193.

  2. Estimating average tree crown size using high-resolution airborne data

    Czech Academy of Sciences Publication Activity Database

    Brovkina, Olga; Latypov, I.; Cienciala, E.

    2015-01-01

    Roč. 9, may 13 (2015), 096053-1-096053-13. ISSN 1931-3195 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk OC09001 Institutional support: RVO:67179843 Keywords : crown size * airborne data * spruce * granulometry Subject RIV: EH - Ecology, Behaviour Impact factor: 1.183, year: 2014

  3. Processing of images acquired at the Ondřejov double solar refractor

    Czech Academy of Sciences Publication Activity Database

    Klvaňa, Miroslav; Bumba, Václav; Sobotka, Michal

    Garching : European Southern Observatory, 1994 - (Albrecht, M.; Pasian, F.), s. 179-183 - (ESO Conference and Workshop Proceedings. No.50). [ESO- OAT International Workshop Handling and Archiving Data from Ground-based Telescopes. Trieste (IT), 21.04.1993-23.04.1993

  4. Čeští fašisté ve spisech Archivu ministerstva vnitra České republiky

    Czech Academy of Sciences Publication Activity Database

    Krejča, Otomar L.

    Praha : Ústav pro soudobé dějiny AV ČR, 2002 - (Borák, E.), s. 173-183 ISBN 80-86224-35-X R&D Projects: GA AV ČR IAA9063902 Keywords : Fascism * Protectorate of Bohemia and Moravia Subject RIV: AB - History

  5. AcEST: DK951652 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0011_P15 647 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_P15. 5' end seq ... FHEQQRGDKIIVFADNLFALTEYA 541 Query: 183 TKLRKPCIYGATSH QERTHILNAFKHNPQVNTVFLSKVGDNSIDIPEANVIIQISSHAGS 362 ... KLRKP IYGATSH ... ERT IL AFK + VNTVFLSKVGDNSIDIPEANVIIQISSHAGS Sbjct ...

  6. Past and future impacts of land use and climate change on agricultural ecosystem services in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lorencová, E.; Frélichová, J.; Nelson, E.; Vačkář, David

    2013-01-01

    Roč. 33, JUL (2013), s. 183-194. ISSN 0264-8377 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : climate change * scenarios * land use change * ecosystem services * agriculture * assessment Subject RIV: EH - Ecology, Behaviour Impact factor: 3.134, year: 2013

  7. Imagining Recovery, Resilience, and Vulnerability at 75: Perceptions of Social Work Students

    Science.gov (United States)

    Kane, Michael N.

    2008-01-01

    BSW and MSW students (N = 183) read one of three vignettes and were asked to respond to 21 items investigating their perceptions about depression, anxiety, and resilience of the vignette's character. While the incidents in each vignette were identical, the main character was (a) a 75-year-old Mr. Jones, (b) a 75-year-old Ms. Jones, or (c) "Imagine…

  8. 46 CFR 182.460 - Ventilation of spaces containing machinery powered by, or fuel tanks for, gasoline.

    Science.gov (United States)

    2010-10-01

    ... accordance with ABYC H-2 (incorporated by reference; see 46 CFR 175.600) or 33 CFR 183, subpart K... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation of spaces containing machinery powered by... SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) MACHINERY INSTALLATION...

  9. Effect and Improvement Areas for Port State Control Inspections to Decrease the Probability of Casualty

    NARCIS (Netherlands)

    S. Knapp (Sabine); Ph.H.B.F. Franses (Philip Hans)

    2006-01-01

    textabstractThis report is the fourth part of a PhD project called "The Econometrics of Maritime Safety – Recommendations to Enhance Safety at Sea" and is based on 183,000 port state control inspections and 11,700 casualties from various data sources. Its overall objective is to provide recommendati

  10. Novel modular approach to C-nucleosides

    Czech Academy of Sciences Publication Activity Database

    Hocek, Michal; Urban, Milan; Joubert, Nicolas

    Kyoto : The Kinki Chemical Society, 2006. s. 183. [International Kyoto Conference on New Aspects of Organic Chemistry /10./. 13.11.2006-17.11.2006, Kyoto] R&D Projects: GA MŠk(CZ) LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : purines * cross-couplings * nucleosides Subject RIV: CC - Organic Chemistry

  11. Impact of Teachers' Beliefs on Mathematics Education

    Science.gov (United States)

    Bayaga, Anass; Wadesango, Newman; Wadesango, Ongayi Vongai

    2015-01-01

    The objective of the current study was to analyse the impact of teachers' personal theory and beliefs (PTB) towards Mathematics teaching. A total of 183 respondents were involved in this study, using the stratified random sampling method with Cronbach's alpha of 0.87. Due to the objective of the research and the hypothesis, it was positioned…

  12. Differential gene expresison in umbilical cord blood and maternal peripheral blood

    Czech Academy of Sciences Publication Activity Database

    Merkerová, M.; Vasiková, A.; Bruchová, H.; Líbalová, Helena; Topinka, Jan; Balaščak, I.; Šrám, Radim; Brdička, R.

    2009-01-01

    Roč. 83, č. 3 (2009), s. 183-190. ISSN 0902-4441 R&D Projects: GA MŠk 2B06088 Institutional research plan: CEZ:AV0Z50390512 Keywords : gene expression * umbilical cord blood * peripheral blood Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 2.345, year: 2009

  13. Clinical Efficacy of Proton Pump Inhibitor versus Prompt Endoscopy for Management of People with Dyspepsia

    DEFF Research Database (Denmark)

    Kjeldsen, Hans Christian; Lauritzen, Torsten; Christensen, Bo

    .   Setting: June 2000 to August 2002, 41 GPs, Aarhus County, Denmark   Methods: 368 people with dyspepsia (epigastric pain/discomfort, no alarm symptoms) were randomly assigned to treatment with omeprazol 40 mg/day for two weeks (PPI group, n:185) or endoscopy (endoscopy group, n:183). Due to migration...

  14. Variability of Butyrivibrio fibrosolvens estimated with cellular fatty acids content, DNA restriction analysis and fermentation patterns

    Czech Academy of Sciences Publication Activity Database

    Marníšek, L. R.; Kopečný, Jan

    2000-01-01

    Roč. 40, č. 2 (2000), s. 182-183. ISSN 0926-5287 R&D Projects: GA ČR GA524/99/0602 Institutional research plan: CEZ:AV0Z5045916 Keywords : butyrivibrio fibrosolvens Subject RIV: ED - Physiology Impact factor: 1.351, year: 2000

  15. Analyzing Teaching Quality in Botswana and South Africa

    Science.gov (United States)

    Sapire, Ingrid; Sorto, M. Alejandra

    2012-01-01

    This study focuses on quantifying the quality of mathematics teaching in 183 randomly selected sixth grade classrooms: 100 from the North West province of South Africa and 83 from South East Botswana. The teaching quality is measured by coding videotaped lessons for three different components: mathematical proficiency, level of cognitive demand,…

  16. Biological response of soybean and cotton to aerial glyphosate drift

    Science.gov (United States)

    An aerial application drift study was conducted in 2009 to determine biological effects of glyphosate on cotton (Gossypium hirsutum L.) and soybean [Glycine max (L.) Merr.]. Glyphosate at 866 g ae/ha was applied using an Air Tractor 402B agricultural aircraft in an 18.3 m spray swath to crops at the...

  17. Ethical Decision-Making among Business Students: A Two-Country Analysis.

    Science.gov (United States)

    Smith, David E.; Skalnik, J. Robert; Skalnik, Patricia C.

    2000-01-01

    The ethical tendencies of university business students from Denmark (n=297) and the United States (n=183) were examined by analyzing their responses to ethical dilemmas on issues of coercion and control, conflict of interest, physical environment, paternalism, and personal integrity. Findings indicated that students from both countries had similar…

  18. Noble Metal/Ceramic Composites in Flame Processes

    DEFF Research Database (Denmark)

    Schultz, Heiko; Madler, Lutz; Strobel, Reto;

    . Figuéras, J. Mol. Catal., 79, (1993), 253. [2] M. Arai, Y. Takada, T. Ebina, M. Shirai, Appl. Catal. A: General, 183, (1999), 365. [3] R. Strobel, W. J. Stark, L. Mädler, S. E. Pratsinis, A. Baiker, J. Catal., 213, (2003) 296. [4] T. Johannessen, S. Koutsopoulos, J. Catal., 205, (2003) 404. [5] R. Strobel...

  19. Texting, Textese and Literacy Abilities: A Naturalistic Study

    Science.gov (United States)

    Drouin, Michelle; Driver, Brent

    2014-01-01

    In this study, we examined texting behaviours, text message characteristics (textese) of actual sent text messages and the relationships between texting, textese and literacy abilities in a sample of 183 American undergraduates. As compared to previous naturalistic and experimental studies with English-speaking adults, both texting frequency and…

  20. Drug: D01085 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01085 Drug Saccharin (JP16/NF); Sweeta (TN) C7H5NO3S 182.999 183.1845 D01085.gif Pharmaceutic a ... n hsa04973(80834+83756) Carbohydrate digestion and absorption ... Target-based classification of drugs [BR:br08310] ...

  1. Translating Greek Drama: Three Czech Electras

    Czech Academy of Sciences Publication Activity Database

    Sarkissian, Alena

    Cambridge : Cambridge Scholars Press, 2007 - (Šípová, P.; Sarkissian, A.), s. 183-195 ISBN 978-1-84718-318-7 Institutional research plan: CEZ:AV0Z90090514 Keywords : drama * translation * theatre Subject RIV: AB - History

  2. THERMO-MECHANICALLY PROCESSED ROLLED WIRE FOR HIGH

    Directory of Open Access Journals (Sweden)

    V. A. Lutsenko

    2015-06-01

    Full Text Available It is shown that at twisting of wire of diameter 1,83 mm, produced by direct wire drawing of thermomechanically processed rolled wire of diameter 5,5 mm of steel 90, metal stratification is completely eliminated at decrease of carbon, manganese and an additional alloying of chrome.

  3. A bait for locust (Locusta migratoria migratorioides) suitable for oral application of juvenile hormone analogues

    Czech Academy of Sciences Publication Activity Database

    Němec, Václav

    2003-01-01

    Roč. 58, č. 1 (2003), s. 287-290. ISSN 0006-3088 Institutional research plan: CEZ:AV0Z5007907 Keywords : locust control * bait * oral application Subject RIV: ED - Physiology Impact factor: 0.183, year: 2003

  4. An in vivo study on brain microstructure in biological and chronological ageing

    DEFF Research Database (Denmark)

    Altmann-Schneider, Irmhild; de Craen, Anton J M; van den Berg-Huysmans, Annette A;

    2015-01-01

    phenotype of familial longevity. Moreover, we aimed to describe cerebral ageing effects on MTI parameters in an elderly cohort. All subjects were included from the Leiden Longevity Study and underwent 3 Tesla MTI of the brain. In total, 183 offspring of nonagenarian siblings, who are enriched for familial...

  5. New chronological evidence for the Middle to Upper Palaeolithic transition in the Czech Republic and Slovakia: New optically stimulated luminescence dating results

    Czech Academy of Sciences Publication Activity Database

    Nejman, L.; Rhodes, E.; Škrdla, Petr; Tostevin, G.; Neruda, P.; Nerudová, Z.; Valoch, K.; Oliva, M.; Kaminská, Ľ.; Svoboda, J.; Grün, R.

    2011-01-01

    Roč. 53, č. 5 (2011), s. 1044-1066. ISSN 0003-813X R&D Projects: GA AV ČR IAA800010801 Institutional research plan: CEZ:AV0Z80010507 Keywords : Middle–Upper Palaeolithic Transition * Central Europe * Neanderthals Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.183, year: 2011

  6. Chronological review of the Middle to Upper Palaeolithic transition in the Czech republic and Slovakia. New optically stimulated luminescence results

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr

    2011-01-01

    Roč. 53, č. 5 (2011), s. 1044-1066. ISSN 0003-813X R&D Projects: GA AV ČR IAA800010801 Institutional research plan: CEZ:AV0Z80010507 Keywords : Middle Upper Palaeolithic * central europe * neanderthals Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.183, year: 2011

  7. Parallel iterative solution of the incompressible Navier-Stokes equations with application to rotating wings

    Czech Academy of Sciences Publication Activity Database

    Šístek, Jakub; Cirak, F.

    2015-01-01

    Roč. 122, 20 November (2015), s. 165-183. ISSN 0045-7930 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : Navier-Stokes * incompressible flow * Krylov subspace methods Subject RIV: BA - General Mathematics Impact factor: 1.619, year: 2014 http://www.sciencedirect.com/science/article/pii/S0045793015003023

  8. 46 CFR 182.450 - Vent pipes for fuel tanks.

    Science.gov (United States)

    2010-10-01

    ... fill pipe if the tank is filled under pressure. (d) The discharge ends of fuel tank vent pipes must... by reference; see 46 CFR 175.600), or 33 CFR 183, subpart J, or with diesel fuel tank vents built in accordance with ABYC H-33 (incorporated by reference; see 46 CFR 175.600), will be considered as meeting...

  9. AcEST: DK961201 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0009_H13 651 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_H13. 5' end seq ... = +3 Query: 3 TIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWPYEPF FVPEDVKSHWSRHTKLGAEFE 182 TIG+GSPNKANSYSVHGSALGAKEV ... = +3 Query: 3 TIGYGSPNKANSYSVHGSALGAKEVDATRQNLGWPYEPF FVPEDVKSHWSRHTKLGAEFE 182 TIG+GSPNKANSYSVHGS LGAKEV ... +ATR NLGWPYEPF ... VPEDVKSHWSRHT GA E Sbjct: 325 TIGFGSPNKANSYSVHGSGL ... GAKEVEATRNNLGWPYEPF HVPEDVKSHWSRHTPEGAALE 384 Query: 183 AKWQEDLAAYEKKY ...

  10. Úvodní iluminace Smíškovského graduálu jako klíč k interpretaci rukopisu

    Czech Academy of Sciences Publication Activity Database

    Studničková, Milada

    Praha : Arte factum, 2002 - (Prix, D.), s. 183-189 ISBN 80-903230-1-4 R&D Projects: GA ČR GA408/01/0616 Institutional research plan: CEZ:AV0Z8033913 Keywords : manuscript * illumination * iconography Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. Core of Romanticism

    Directory of Open Access Journals (Sweden)

    Monika Milosavljević

    2016-02-01

    Full Text Available Review of the book: Isaija Berlin, 2012. Koreni romantizma, Melonova predavanja u Nacionalnoj umetničkoj galeriji, 1965. Vašington, DS (urednik britanskog izdanja: Henri Hardi; preveo sa engleskog: Branimir Gligorić; stihove prevela: Nataša Tučev. Službeni glasnik: Beograd, 183 str.

  12. Polymorphism, linkage mapping, and association analysis with carcass traits of four porcine candidate genes selected from gene-expression profiles of Czech Large White and Wild Boar muscles

    Czech Academy of Sciences Publication Activity Database

    Chalupová, P.; Dvořáková, Věra; Knoll, A.; Stratil, Antonín; Bartenschlager, H.; Stupka, R.; Čítek, J.; Šprysl, M.; Palánová, Anna; Horák, Pavel; Geldermann, H.

    2014-01-01

    Roč. 59, č. 3 (2014), s. 116-127. ISSN 1212-1819 R&D Projects: GA ČR GA523/09/0844 Institutional support: RVO:67985904 Keywords : pig * single nucleotide polymorphism * DNA markers Subject RIV: GI - Animal Husbandry ; Breeding Impact factor: 1.183, year: 2014

  13. A Study on Reproductive Morbidity and Menstrual Hygiene among Adolescent Girls of Urban Slum Area of Chitradurga

    Directory of Open Access Journals (Sweden)

    Ramya V

    2016-03-01

    Conclusion: The problems of adolescent girls like early marriage, school dropout and teenage pregnancy are still prevalent in the community. Health care seeking behavior during period of reproductive illness was found to be very poor. " [Natl J Community Med 2016; 7(3.000: 180-183

  14. Symbiotic and Growth Performance of Supernodulating Forage Pea Lines

    Czech Academy of Sciences Publication Activity Database

    Novák, Karel; Biedermannová, E.; Vondrys, J.

    2009-01-01

    Roč. 49, č. 4 (2009), s. 1227-1234. ISSN 0011-183X R&D Projects: GA ČR GA521/06/0590 Institutional research plan: CEZ:AV0Z50200510 Keywords : NITROGEN-FIXATION * NODULE NUMBER * MEDICAGO-TRUNCATULA Subject RIV: EE - Microbiology, Virology Impact factor: 1.735, year: 2009

  15. Relative importance of cohesion and adhesion for sensory stickiness of semisolid foods

    NARCIS (Netherlands)

    Dunnewind, B.; Janssen, A.M.; Vliet, T. van; Weenen, H.

    2004-01-01

    The relative importance of cohesion and adhesion for sensory stickness of semisolid foods was investigated using a texture analyzers. Products included commercial mayon-naises, custard desserts and warm sauces which varied in apparent viscosity between 0.3 and 18.3 Pa.s. It was observed that the pre

  16. The manifestation of spin-phonon coupling in CaMnO.sub.3./sub..

    Czech Academy of Sciences Publication Activity Database

    Goian, Veronica; Kamba, Stanislav; Borodavka, Fedir; Nuzhnyy, Dmitry; Savinov, Maxim; Belik, A.A.

    2015-01-01

    Roč. 117, č. 16 (2015), "164103-1"-"164103-6". ISSN 0021-8979 R&D Projects: GA ČR GP14-14122P Institutional support: RVO:68378271 Keywords : phonons * multiferroics * spin-phonon coupling Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  17. ZZ production at LEP

    CERN Document Server

    Sánchez-Álvaro, E

    2000-01-01

    The process e/sup +/e/sup -/ to ZZ is studied at LEP at center-of- mass energies near 183 and 189 GeV. Cross sections are measured and found to be in agreement with the standard model expectations. Limits on anomalous ZZZ and ZZ gamma couplings are set. (6 refs).

  18. Dispersion properties and low infrared optical losses in epitaxial AlN on sapphire substrate in the visible and infrared range

    Czech Academy of Sciences Publication Activity Database

    Soltani, A.; Stolz, A.; Charrier, J.; Mattalah, M.; Gerbedoen, J.-C.; Barkad, H.A.; Mortet, Vincent; Rousseau, M.; Bourzgui, N.; BenMoussa, A.; De Jaeger, J.-C.

    2014-01-01

    Roč. 115, č. 16 (2014), "163515-1"-"163515-6". ISSN 0021-8979 Institutional support: RVO:68378271 Keywords : III-V semiconductors * AlN films * surface scattering * refractive index * optical properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  19. Addendum to "Semistable reduction of G-bundles on curves''

    NARCIS (Netherlands)

    J. Heinloth

    2010-01-01

    In this note we give a variation of the last step of the proof of the semistable reduction theorem of [J. Algebraic Geom. 17 (2008), 167-183], which allows us to remove the assumptions on the characteristic of the ground field.

  20. 29 CFR 2570.155 - Service.

    Science.gov (United States)

    2010-07-01

    ...) § 2570.155 Service. For section 3(40) proceedings, this section shall apply instead of 29 CFR 18.3. (a... 29 Labor 9 2010-07-01 2010-07-01 false Service. 2570.155 Section 2570.155 Labor Regulations... represented by an attorney, service shall be made upon the attorney. Service of any document upon any...

  1. Lattice dynamics and broad-band dielectric properties of multiferroic Pb(Fe.sub.1/2./sub.Nb.sub.1/2./sub.)O.sub.3./sub. ceramics

    Czech Academy of Sciences Publication Activity Database

    Mackeviciute, R.; Goian, Veronica; Greicius, S.; Grigalaitis, R.; Nuzhnyy, Dmitry; Holc, J.; Banys, J.; Kamba, Stanislav

    2015-01-01

    Roč. 117, č. 8 (2015), "084101-1"-"084101-6". ISSN 0021-8979 R&D Projects: GA ČR GAP204/12/1163 Institutional support: RVO:68378271 Keywords : relaxor ferroelectrics * phonons * soft mode Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  2. On the solvability of the Dirichlet problem for nonlinear second-order functional-differential equations

    Czech Academy of Sciences Publication Activity Database

    Mukhigulashvili, Sulkhan; Šremr, Jiří

    2005-01-01

    Roč. 41, č. 10 (2005), s. 1425-1435. ISSN 0012-2661 R&D Projects: GA ČR GP201/04/P183 Institutional research plan: CEZ:AV0Z10190503 Keywords : second order nonlinear functional differential equation * Dirichlet problem * solvability Subject RIV: BA - General Mathematics Impact factor: 0.231, year: 2005

  3. On a two-point boundary value problem for the second order linear functional differential equations with monotone operators

    Czech Academy of Sciences Publication Activity Database

    Mukhigulashvili, Sulkhan; Šremr, Jiří

    2006-01-01

    Roč. 13, 3-4 (2006), s. 519-537. ISSN 0793-1786 R&D Projects: GA ČR(CZ) GP201/04/P183 Institutional research plan: CEZ:AV0Z10190503 Keywords : functional differential equation * monotone operator * Dirichlet problem Subject RIV: BA - General Mathematics

  4. Computer Modeling of Induction Heating-Based Assembly and Disassembly of Shrink Fits

    Czech Academy of Sciences Publication Activity Database

    Shulzhenko, M.; Gontarowskiy, P.; Matyukhin, Y.; Pantelyat, M.; Doležel, Ivo; Ulrych, B.; Beneš, K.

    2004-01-01

    Roč. 49, č. 2 (2004), s. 169-183. ISSN 0001-7043 R&D Projects: GA ČR GA102/01/0184 Keywords : coupled problems * numerical analysis * thermocontact interaction Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  5. Two Eimerian Coccidia (Apicomplexa : Eimeriidae) from the critically endangered Arakan forest turtle Heosemys depressa (Testudines: Geoemydidae), with description of Eimeria arakanensis n. sp.

    Czech Academy of Sciences Publication Activity Database

    Široký, P.; Modrý, David

    2006-01-01

    Roč. 45, č. 2 (2006), s. 183-189. ISSN 0065-1583 R&D Projects: GA ČR GP524/03/D104 Institutional research plan: CEZ:AV0Z60220518 Keywords : Eimeria * Apicomplexa * Heosemys Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.162, year: 2006

  6. 77 FR 51809 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2012-08-27

    ... relationship (e.g., fear, concern for safety, post-traumatic stress disorder (PTSD) symptom, injury, crisis... collection, NISVS data indicated that approximately 6.9 million women and 5.6 million men experienced rape... that 18.3% of women and 1.4% of men in the U.S. experienced rape in their lifetime. In addition,...

  7. The NaNO2-NaNO3 system – a revised phase diagram

    DEFF Research Database (Denmark)

    Berg, Rolf W.; Kerridge, D.H.; Larsen, Peter Halvor

    2004-01-01

    %. A sub-solidus transition was detected at 183 oC and a second at 159 oC by Raman spectroscopy measurements over a range of temperatures, showing an abrupt change of slope at around 150 oC when the wavenumber position of two bands (NO2- symmetric bending and stretching) is plotted versus temperature...

  8. Asbestos cement pipes in aggressive media. CEOCOR study

    Energy Technology Data Exchange (ETDEWEB)

    1979-02-01

    This study has been carried out by commission no. 6 of CEOCOR (asbestos-cement) during 28 sessions in the time from November 1968 until May 1976. The original text in French language was published in 'La Tribune du CEBEDEAU', April 1978, p. 167/183.

  9. Strategic Planning Effectiveness in Jordanian Universities: Faculty Members' and Academic Administrators' Perspectives

    Science.gov (United States)

    Al-Omari, Aieman Ahmad; Salameh, Kayed M.

    2009-01-01

    This study aims to explore the faculty and academic administrators' perception of strategic planning effectiveness (SPE) in a reform environment, measuring the impact of university type, gender, and job role. A total of 338 faculty members and 183 academic administrators who enrolled during the first semester of the 2007-08 term at a public and a…

  10. Změny volných radikálů u bolesti měřených in vivo metodou elektronové paramagnetické rezonance

    Czech Academy of Sciences Publication Activity Database

    Rokyta, R.; Holeček, V.; Stopka, Pavel

    Bratislava : Asklepios, 2004, s. 183-184. ISBN 80-7167-081-2. [Výročie vzniku fyziologického ústavu LFUK v Bratislave /80./. Bratislava (SK), 08.12.2004] Institutional research plan: CEZ:AV0Z4032918 Keywords : EPR * In vivo * pain Subject RIV: CA - Inorganic Chemistry

  11. Adjustment Scales for Children and Adolescents and Native American Indians: Factorial Validity Generalization for Ojibwe Youths

    Science.gov (United States)

    Canivez, Gary L.

    2006-01-01

    Replication of the core syndrome factor structure of the "Adjustment Scales for Children and Adolescents" (ASCA; P.A. McDermott, N.C. Marston, & D.H. Stott, 1993) is reported for a sample of 183 Native American Indian (Ojibwe) children and adolescents from North Central Minnesota. The six ASCA core syndromes produced an identical two-factor…

  12. Středověká miskovitá (lotová) závaží v českých a moravských nálezech

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jiří

    2008-01-01

    Roč. 49, 1-2 (2008), s. 183-215. ISSN 1211-7250 R&D Projects: GA AV ČR IAA800010501 Institutional research plan: CEZ:AV0Z80010507 Keywords : Nested weights * Late Middle Age * weighing-monetary systems in Bohemia, Moravia and central Europe * numismatic and metrology Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Carbonic anhydrase IX expression in clear cell renal cell carcinomas negatively correlates with the proportion of the granular cell component

    Czech Academy of Sciences Publication Activity Database

    Skapa, P.; Hyršl, L.; Závada, Jan; Soukup, J.; Zámečník, J.

    2008-01-01

    Roč. 26, č. 22 (2008), s. 3811-3812. ISSN 0732-183X Institutional research plan: CEZ:AV0Z40550506 Keywords : carbonic anhydrase IX * CAIX * renal carcinoma Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 17.157, year: 2008

  14. Carbonic anhydrase IX is not an independent predictor of outcome for patients with clear cell renal cell carcinoma

    Czech Academy of Sciences Publication Activity Database

    Leibovich, B. C.; Sheinin, Y.; Lohse, Ch. M.; Thompson, R. H.; Cheville, J. C.; Závada, Jan; Kwon, E. D.

    2007-01-01

    Roč. 25, č. 30 (2007), s. 4757-4764. ISSN 0732-183X Institutional research plan: CEZ:AV0Z40550506 Keywords : renal carcinoma * CAIX antigen * prognostics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 15.484, year: 2007

  15. The resources and methods of hydrogen production

    Czech Academy of Sciences Publication Activity Database

    Bičáková, Olga; Straka, Pavel

    2010-01-01

    Roč. 7, č. 2 (2010), s. 175-183. ISSN 1214-9705 R&D Projects: GA ČR(CZ) GA105/07/1407 Institutional research plan: CEZ:AV0Z30460519 Keywords : hydrogen * pyrolysis * co-pyrolysis Subject RIV: DD - Geochemistry Impact factor: 0.452, year: 2010

  16. SwissProt search result: AK111439 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111439 002-183-A05 (P52708) P-(S)-hydroxymandelonitrile lyase precursor (EC 4.1.2.11) (Hydroxynitrile... lyase) (HNL) [Contains: P-(S)-hydroxymandelonitrile lyase chain A; P-(S)-hydroxymandelonitrile lyase chain B] (Fragment) HNLS_SORBI 9e-15 ...

  17. Mineral nutrient relations in the aquatic carnivorous plant Utricularia australis and its investment in carnivory

    Czech Academy of Sciences Publication Activity Database

    Adamec, Lubomír

    2008-01-01

    Roč. 171, č. 3 (2008), s. 175-183. ISSN 1863-9135 Institutional research plan: CEZ:AV0Z60050516 Keywords : tissue nutrient content * investment in carnivory * mineral nutrient economy Subject RIV: EF - Botanics Impact factor: 0.558, year: 2008

  18. Drug: D02334 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02334 Drug Hypophosphorous acid (NF); Phosphinic acid H3PO2 65.9871 65.9964 D02334.gif Pharmace ... bChem: 7849393 LigandBox: D02334 NIKKAJI: J95.183H ATOM ... 3 1 P1a P 18.9700 -13.8600 2 O3b O 18.9700 -12.460 ...

  19. Comparing Relations of Motivation, Engagement, and Achievement among Struggling and Advanced Adolescent Readers

    Science.gov (United States)

    Klauda, Susan Lutz; Guthrie, John T.

    2015-01-01

    This longitudinal study examined the development of reading motivation, engagement, and achievement in early adolescence by comparing interrelations of these variables in struggling and advanced readers. Participants were 183 pairs of seventh grade students matched in gender, ethnicity, socioeconomic status, and school attended. They completed…

  20. Conformational studies based on the vibrational optical activity

    Czech Academy of Sciences Publication Activity Database

    Kapitán, Josef; Setnička, V.; Baumruk, V.; Urbanová, M.; Maloň, Petr; Bouř, Petr

    Madrid: Universidad Politécnica Ciudad Universitaria , 2001. s. 183. [International Conference on the Applications of the Density Functional Theory in Chemistry and Physics /9./. 10.09.2001-14.09.2001, San Lorenzo de El Escorial] Institutional research plan: CEZ:AV0Z4055905 Subject RIV: CE - Biochemistry