WorldWideScience

Sample records for alloy-ehi 183

  1. 33 CFR 183.510 - Fuel tanks.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fuel tanks. 183.510 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Equipment Standards § 183.510 Fuel tanks. (a) Each fuel tank in a boat must have been tested by its manufacturer under § 183.580 and not leak when...

  2. 7 CFR 1150.183 - Personal liability.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Personal liability. 1150.183 Section 1150.183 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Order Miscellaneous § 1150.183 Personal liability. No member or employee of the Board shall be held...

  3. 33 CFR 183.524 - Fuel pumps.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fuel pumps. 183.524 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Equipment Standards § 183.524 Fuel pumps. (a) Each diaphragm pump must not leak fuel from the pump if the primary diaphragm fails. (b) Each electrically...

  4. 46 CFR 183.230 - Temperature ratings.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Temperature ratings. 183.230 Section 183.230 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION General Requirements § 183.230 Temperature ratings. Temperature ratings of electrical...

  5. 33 CFR 183.584 - Shock test.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Shock test. 183.584 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Tests § 183.584 Shock test. A fuel tank is tested by... surface of the tank. The duration of each vertical acceleration pulse is measured at the base of the shock...

  6. 46 CFR 183.378 - Ungrounded systems.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.378 Ungrounded systems. Each ungrounded system must be provided with a suitably sensitive ground detection system located at the respective... 46 Shipping 7 2010-10-01 2010-10-01 false Ungrounded systems. 183.378 Section 183.378 Shipping...

  7. 46 CFR 183.310 - Power sources.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.310 Power sources. (a)(1) Each vessel that relies on electricity to power the following loads must be arranged so that the loads can be... 46 Shipping 7 2010-10-01 2010-10-01 false Power sources. 183.310 Section 183.310 Shipping COAST...

  8. 33 CFR 183.590 - Fire test.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fire test. 183.590 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Tests § 183.590 Fire test. (a) A piece of equipment is... A2” hoses and hose clamps are tested in a fire chamber. (2) Fuel filters, strainers, and pumps are...

  9. 10 CFR 60.183 - Criminal penalties.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Criminal penalties. 60.183 Section 60.183 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN GEOLOGIC REPOSITORIES Violations § 60.183 Criminal penalties. (a) Section 223 of the Atomic Energy Act of 1954, as amended...

  10. 46 CFR 183.390 - Shore power.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Shore power. 183.390 Section 183.390 Shipping COAST...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.390 Shore power. A vessel with an electrical system operating at more than 50 volts, which is provided with a means to connect to shore power...

  11. 47 CFR 95.183 - Prohibited communications.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Prohibited communications. 95.183 Section 95.183 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PERSONAL RADIO SERVICES General Mobile Radio Service (GMRS) § 95.183 Prohibited communications. (a) A...

  12. 46 CFR 183.540 - Elevators.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Elevators. 183.540 Section 183.540 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION Miscellaneous Systems and Requirements § 183.540 Elevators. Each elevator on a vessel must meet...

  13. 21 CFR 133.183 - Romano cheese.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Romano cheese. 133.183 Section 133.183 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.183 Romano cheese. (a) Romano cheese is the food prepared from cow's milk or sheep's milk or...

  14. 33 CFR 183.572 - Grounding.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Grounding. 183.572 Section 183.572 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Manufacturer Requirements § 183.572 Grounding. Each...

  15. 33 CFR 183.415 - Grounding.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Grounding. 183.415 Section 183.415 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Electrical Systems Manufacturer Requirements § 183.415 Grounding...

  16. 14 CFR 183.17 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 183.17 Section 183.17 Aeronautics... REGULATIONS REPRESENTATIVES OF THE ADMINISTRATOR Certification of Representatives § 183.17 Reports. Each representative designated under this part shall make such reports as are prescribed by the Administrator. ...

  17. 46 CFR 183.392 - Radiotelephone installations.

    Science.gov (United States)

    2010-10-01

    ... TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.392 Radiotelephone installations. A separate circuit, with overcurrent protection at the main distribution panel, must be provided...

  18. 33 CFR 117.183 - Old River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Old River. 117.183 Section 117... OPERATION REGULATIONS Specific Requirements California § 117.183 Old River. The draw of the California... notice is given to the drawtender at the Rio Vista bridge across the Sacramento River, mile 12.8. ...

  19. 14 CFR 183.53 - Procedures manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures manual. 183.53 Section 183.53... manual. No ODA Letter of Designation may be issued before the Administrator approves an applicant's procedures manual. The approved manual must: (a) Be available to each member of the ODA Unit; (b) Include a...

  20. 33 CFR 183.715 - Exception.

    Science.gov (United States)

    2010-07-01

    ... SAFETY BOATS AND ASSOCIATED EQUIPMENT Start-in-Gear Protection § 183.715 Exception. Outboard motors... information must be displayed on the motor: “Warning—Ensure shift control is in neutral before starting motor...

  1. 46 CFR 183.380 - Overcurrent protection.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.380 Overcurrent protection. (a... gear control system circuits must be protected against short circuit. (f) Each steering gear feeder...

  2. 46 CFR 183.322 - Multiple generators.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.322 Multiple generators. When a vessel is equipped with two or more generators to supply ship's service power, the following requirements...

  3. 183-H Basin sludge treatability test report

    International Nuclear Information System (INIS)

    Biyani, R.K.

    1995-01-01

    This document presents the results from the treatability testing of a 1-kg sample of 183-H Basin sludge. Compressive strength measurements, Toxic Characteristic Leach Procedure, and a modified ANSI 16.1 leach test were conducted

  4. 33 CFR 183.5 - Incorporation by reference.

    Science.gov (United States)

    2010-07-01

    ..., Warrendale, PA 15096: SAE J378 Marine Engine Wiring—1984 § 183.430 SAE J557 High Tension Ignition Cable—1968 § 183.440 SAE J1127 Battery Cable—1980 § 183.430 SAE J1128 Low Tension Primary Cable—1975 § 183.430 SAE... 08854: IEEE 45 IEEE Recommended Practice for Electrical Installations on Shipboard—1983. Cable...

  5. 38 CFR 18.3 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Discrimination prohibited... THE CIVIL RIGHTS ACT OF 1964 General § 18.3 Discrimination prohibited. (a) General. No person in the..., be denied the benefits of, or be otherwise subjected to discrimination under any program to which...

  6. 33 CFR 183.705 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... SAFETY BOATS AND ASSOCIATED EQUIPMENT Start-in-Gear Protection § 183.705 Definitions. For the purposes of this subpart: (a) Outboard motor means a self-contained propulsion system of any horsepower rating... or backward thrust developed by an outboard motor and associated propulsion unit while stationary. (c...

  7. Reference: 183 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 183 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15737939i Booker Jon...noid-derived branch-inhibiting hormone. 3 443-9 15737939 2005 Mar Developmental cell Booker Jonathan|Goddard

  8. 33 CFR 183.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... defined by a series of points of contact, with the boat structure, by straight lines at 45 degree angles..., measured from end to end over the deck excluding sheer, and measured parallel to the centerline. Bow sprits... measured as a projection on the centerline plane of the boat. See Figure 183.3. Permanent appurtenances...

  9. Dicty_cDB: VSC183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSC183 (Link to dictyBase) - G00947 DDB0215258 Contig-U06423-1... VSC183E (Link to Original site) - - - - - - VSC183E 432 Show VSC183 Library VS (Link to library) Clone ID VSC183 (Link to dict...yBase) Atlas ID - NBRP ID G00947 dictyBase ID DDB0215258 Link to Contig Contig-U06423-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSC1-D/VSC183Q.Seq.d/ ....22 Translated Amino Acid sequence lffhs**IIHTHTTIMSDNGAKLRDAAKSGNEELVKSLIAEGPSSILDYKDRSGFTPLHM AAMFGHQNICTI

  10. Prolate yrast cascade in 183Tl

    International Nuclear Information System (INIS)

    Reviol, W.; Carpenter, M. P.; Janssens, R. V. F.; Jenkins, D.; Toth, K. S.; Bingham, C. R.; Riedinger, L. L.; Weintraub, W.; Cizewski, J. A.; Lauritsen, T.

    2000-01-01

    The yrast sequence in 183 Tl has been studied for the first time in recoil-mass selected γ-ray spectroscopic measurements. A rotational-like cascade of seven transitions is established down to the band head with probable spin and parity (13/2 + ). Unlike in the adjacent odd-mass Tl nuclei, prompt γ decay from the yrast band to a lower lying weakly deformed (oblate) structure is not observed. These features are consistent with the predicted drop of the prolate band head in 183 Tl compared to 185 Tl. The implications for the prolate energy minimum in odd-mass Tl nuclei at the neutron i 13/2 midshell (N=103) are discussed. (c) 2000 The American Physical Society

  11. 27 CFR 19.183 - Change of trade name.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Change of trade name. 19.183 Section 19.183 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... After Original Qualification § 19.183 Change of trade name. If there is to be a change in, or addition...

  12. 46 CFR 183.340 - Cable and wiring requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Cable and wiring requirements. 183.340 Section 183.340 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.340 Cable and wiring...

  13. 46 CFR 183.360 - Semiconductor rectifier systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Semiconductor rectifier systems. 183.360 Section 183.360... TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.360 Semiconductor rectifier systems. (a) Each semiconductor rectifier system must have an adequate heat removal system that prevents...

  14. 33 CFR 183.540 - Hoses: Standards and markings.

    Science.gov (United States)

    2010-07-01

    ...) SAE Standard J1527DEC85, Class 1 and the fire test in § 183.590; or (2) Underwriters' Laboratories... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hoses: Standards and markings. 183.540 Section 183.540 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY...

  15. 46 CFR 183.320 - Generators and motors.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Generators and motors. 183.320 Section 183.320 Shipping...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.320 Generators and motors. (a) Each generator and motor must be: (1) In a location that is accessible, adequately ventilated, and as dry as...

  16. 46 CFR 201.183 - Ex parte communications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Ex parte communications. 201.183 Section 201.183... PRACTICE AND PROCEDURE Judicial Standards of Practice (Rule 19) § 201.183 Ex parte communications. (a) Requests for expeditious treatment of matters pending with the Administration are deemed communications on...

  17. 46 CFR 183.370 - General grounding requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false General grounding requirements. 183.370 Section 183.370... TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.370 General grounding... more, must have a grounding pole and a grounding conductor in the portable cord. (c) Each nonmetallic...

  18. 27 CFR 24.183 - Use of distillates containing aldehydes.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of distillates containing aldehydes. 24.183 Section 24.183 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... the fermentation of wine and then returned to the distilled spirits plant from which distillates were...

  19. 33 CFR 183.562 - Metallic fuel lines.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Metallic fuel lines. 183.562...) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Manufacturer Requirements § 183.562 Metallic fuel lines. (a) Each metallic fuel line that is mounted to the boat structure must be connected to the...

  20. 37 CFR 1.83 - Content of drawing.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Content of drawing. 1.83... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions The Drawings § 1.83 Content of drawing. (a) The drawing in a nonprovisional application must show every feature of the...

  1. 33 CFR 183.566 - Fuel pumps: Placement.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fuel pumps: Placement. 183.566...) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Manufacturer Requirements § 183.566 Fuel pumps: Placement. Each fuel pump must be on the engine it serves or within 12 inches of the engine, unless it is a...

  2. 46 CFR 183.330 - Distribution panels and switchboards.

    Science.gov (United States)

    2010-10-01

    ... (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.330 Distribution panels and switchboards. (a) Each distribution panel and switchboard must be in as dry a location... 46 Shipping 7 2010-10-01 2010-10-01 false Distribution panels and switchboards. 183.330 Section...

  3. 33 CFR 183.610 - Powered ventilation system.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Powered ventilation system. 183... (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Ventilation § 183.610 Powered ventilation system... must: (1) Be open to the atmosphere, or (2) Be ventilated by an exhaust blower system. (b) Each exhaust...

  4. 33 CFR 183.620 - Natural ventilation system.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Natural ventilation system. 183... (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Ventilation § 183.620 Natural ventilation system. (a) Except for compartments open to the atmosphere, a natural ventilation system that meets the...

  5. Examining the role of glutamic acid 183 in chloroperoxidase catalysis

    NARCIS (Netherlands)

    Yi, X.; Conesa, A.; Punt, P.J.; Hager, L.P.

    2003-01-01

    Site-directed mutagenesis has been used to investigate the role of glutamic acid 183 in chloroperoxidase catalysis. Based on the x-ray crystallographic structure of chloroperoxidase, Glu-183 is postulated to function on distal side of the heme prosthetic group as an acid-base catalyst in

  6. 33 CFR 183.556 - Plugs and fittings.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Plugs and fittings. 183.556 Section 183.556 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... fittings. (a) A fuel system must not have a fitting for draining fuel. (b) A plug used to service the fuel...

  7. 49 CFR 173.183 - Nitrocellulose base film.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Nitrocellulose base film. 173.183 Section 173.183 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Nitrocellulose base film. Films, nitrocellulose base, must be packaged in packagings conforming to the...

  8. 46 CFR 183.372 - Equipment and conductor grounding.

    Science.gov (United States)

    2010-10-01

    ... 100 GROSS TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.372 Equipment and... adhesive labels. (e) Cable armor must not be used to ground electrical equipment or systems. [CGD 85-080...

  9. 33 CFR 183.810 - Navigation light certification requirements.

    Science.gov (United States)

    2010-07-01

    ...) Identification and specifications of the bulb used in the compliance test. (b) If a light is too small to attach... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Navigation light certification... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Navigation Lights § 183.810 Navigation...

  10. 33 CFR 183.607 - Incorporation by reference.

    Science.gov (United States)

    2010-07-01

    ... Conshohocken, PA 19428-2959. (3) UL Standard 1128, Underwriters Laboratories, Incorporated, 12 Laboratory Drive....607 Section 183.607 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY.... (a) The following standards are incorporated by reference. Copies may be obtained from the sources...

  11. 46 CFR 183.350 - Batteries-general.

    Science.gov (United States)

    2010-10-01

    ...) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.350 Batteries—general. (a) Where... charging circuit. (g) If the batteries are not adjacent to a distribution panel or switchboard that distributes power to the lighting, motor, and appliance circuits, the battery lead must have a fuse in series...

  12. 46 CFR 183.376 - Grounded distribution systems (neutral grounded).

    Science.gov (United States)

    2010-10-01

    ....376 Section 183.376 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER... propulsion, power, lighting, or distribution system having a neutral bus or conductor must have the neutral... generator to ground before the generator is connected to the bus, except the neutral of an emergency power...

  13. 33 CFR 183.552 - Plastic encased fuel tanks: Installation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Plastic encased fuel tanks... § 183.552 Plastic encased fuel tanks: Installation. (a) Each fuel tank encased in cellular plastic foam or in fiber reinforced plastic must have the connections, fittings, and labels accessible for...

  14. Physical property characterization of 183-H Basin sludge

    International Nuclear Information System (INIS)

    Biyani, R.K.; Delegard, C.H.

    1995-01-01

    This document describes the characterization of 183-H Basin sludge physical properties, e.g. bulk density of sludge and absorbent, and determination of free liquids. Calcination of crucible-size samples of sludge was also done and the resulting 'loss-on-ignition' was compared to the theoretical weight loss based on sludge analysis obtained from Weston Labs

  15. 46 CFR 183.210 - Protection from wet and corrosive environments.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Protection from wet and corrosive environments. 183.210... (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION General Requirements § 183.210 Protection from wet and... corrosion-resistant. ...

  16. Observations of interstellar H2O emission at 183 Gigahertz

    International Nuclear Information System (INIS)

    Waters, J.W.; Gustincic, J.J.; Kakar, R.K.; Kuiper, T.B.H.; Roscoe, H.K.; Swanson, P.N.; Rodriguez Kuiper, E.N.; Kerr, A.R.; Thaddeus, P.

    1980-01-01

    Line emission at 183 GHz by the 3 13 --2 20 rotational transition of water vapor has been detected from the Orion Nebula with the NASA Kuiper Airborne Observatory 91 cm telescope. The peak antenna temperature of the line is 15 K, its LSR velocity is 8 km s -1 , and its width is 15 km s -1 . The velocity profile has characteristics similar to those for CO:a narrow (approx.4 km s -1 ) ''spike'' centered at 9.5 km s -1 and a broad ''plateau'' with flaring wings centered at approx.8 km s -1 . Our 7'.5 antenna beam did not resolve the source. The 183 GHz H 2 O plateau emission appears enhanced above that expected for thermal excitation if it originates from the no greater than 1' region characteristic of plateau emission from all other observed molecules. The spike emission is consistent with an optically thick source of the approximated size of the well-known molecular ridge in Orion having the H 2 O in thermal equilibrium at Tapprox. =50 K. If this is the case, then the H 2 O column density giving rise to the spike is N/sub H/2/sub O/> or =3 x 10 17 cm -2 . An excitation calculation implies N/sub H/2/sub O/approx. =10 18 cm -2 for a source the size of the molecular ridge. These results imply that H 2 O is one of the more abundant species in the Orion Molecualr Cloud.H 2 O emission at 183 GHz was not detected in Sgr A, Sgr B2, W3, W43, W49, W51, DR 21, NGC 1333, NGC 7027, GL 2591, or the rho Oph cloud; it may have been detected in M17

  17. 183-H Basin Mixed Waste Analysis and Testing Report

    International Nuclear Information System (INIS)

    1995-01-01

    The purpose of this sampling and analysis report is to provide data necessary to support treatment and disposal options for the low-level mixed waste from the 183-H solar evaporation ponds. In 1973, four of the 16 flocculation and sedimentation basins were designated for use as solar evaporation basins to provide waste reduction by natural evaporation of liquid chemical wastes from the 300 Area fuel fabrication facilities. The primary purpose of this effort is to gather chemical and bulk property data for the waste in the drums/boxes of sediment removed from the basin at Central Waste Complex

  18. microRNA-183 is Essential for Hair Cell Regeneration after Neomycin Injury in Zebrafish.

    Science.gov (United States)

    Kim, Chang Woo; Han, Ji Hyuk; Wu, Ling; Choi, Jae Young

    2018-01-01

    microRNAs (miRNAs) are non-coding RNAs composed of 20 to 22 nucleotides that regulate development and differentiation in various organs by silencing specific RNAs and regulating gene expression. In the present study, we show that the microRNA (miR)-183 cluster is upregulated during hair cell regeneration and that its inhibition reduces hair cell regeneration following neomycin-induced ototoxicity in zebrafish. miRNA expression patterns after neomycin exposure were analyzed using microarray chips. Quantitative polymerase chain reaction was performed to validate miR-183 cluster expression patterns following neomycin exposure (500 μM for 2 h). After injection of an antisense morpholino (MO) to miR-183 (MO-183) immediately after fertilization, hair cell regeneration after neomycin exposure in neuromast cells was evaluated by fluorescent staining (YO-PRO1). The MO-183 effect also was assessed in transgenic zebrafish larvae expressing green fluorescent protein (GFP) in inner ear hair cells. Microarray analysis clearly showed that the miR-183 cluster (miR-96, miR-182, and miR-183) was upregulated after neomycin treatment. We also confirmed upregulated expression of the miR-183 cluster during hair cell regeneration after neomycin-induced ototoxicity. miR-183 inhibition using MO-183 reduced hair cell regeneration in both wild-type and GFP transgenic zebrafish larvae. Our work demonstrates that the miR-183 cluster is essential for the regeneration of hair cells following ototoxic injury in zebrafish larvae. Therefore, regulation of the miR-183 cluster can be a novel target for stimulation of hair cell regeneration. © Copyright: Yonsei University College of Medicine 2018

  19. 27 CFR 1.83 - Acquiring or receiving distilled spirits in bulk for addition to wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Acquiring or receiving distilled spirits in bulk for addition to wine. 1.83 Section 1.83 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BASIC PERMIT REQUIREMENTS UNDER THE FEDERAL ALCOHOL ADMINISTRATION ACT...

  20. Final decommissioning report for the 183-C Filter Building/Pumproom facility

    International Nuclear Information System (INIS)

    Marske, S.G.

    1997-04-01

    This report documents the decommissioning and demolition (D ampersand D) of the 183-C Filter Building/Pumproom facility (located at the Hanford Site in Richland, Washington). The 183-C Facility D ampersand D involved the performance of characterization to support the development of a project plan and final hazard classification

  1. 14 CFR 135.183 - Performance requirements: Land aircraft operated over water.

    Science.gov (United States)

    2010-01-01

    ... operated over water. 135.183 Section 135.183 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... AND OPERATIONS OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND RULES GOVERNING PERSONS... operated over water. No person may operate a land aircraft carrying passengers over water unless— (a) It is...

  2. Final hazard classification for the 183-C D ampersand D project

    International Nuclear Information System (INIS)

    Zimmer, J.J.

    1995-01-01

    The intent of this document is to provide a final Hazard Classification for the Decontamination and Decommissioning (D ampersand D) activities associated with the 183-C Filter Plant/Pump Room facility. The Hazard Classification was determined based upon DOE-EM-STD-5502-94, ''DOE Limited Standard, Hazard Baseline Documentation,'' issued by the US Department of Energy. The 183-C Filter Plant/Pump Room facility was constructed to support operations of the 105-B and 105-C Reactors at the Hanford Site. Since shutdown of the 105-C Reactor in April 1969, the 183-C facility has been kept in a safe storage condition

  3. HF183/BFDrev and HumM2 qPCR data

    Data.gov (United States)

    U.S. Environmental Protection Agency — Concentration estimates for HF183/BFDrev and HumM2 qPCR genetic markers in raw sewage collected from 54 geographic locations across the United States. This dataset...

  4. 12 CFR 303.183 - Investment by insured state nonmember banks in foreign organization.

    Science.gov (United States)

    2010-01-01

    ... PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES International Banking § 303.183 Investment by insured... why they should be approved; and (vii) If the applicant seeks approval to engage in underwriting or...

  5. Dysregulated miR-183 inhibits migration in breast cancer cells

    Directory of Open Access Journals (Sweden)

    Dwyer Roisin M

    2010-09-01

    Full Text Available Abstract Background The involvement of miRNAs in the regulation of fundamental cellular functions has placed them at the fore of ongoing investigations into the processes underlying carcinogenesis. MiRNA expression patterns have been shown to be dysregulated in numerous human malignancies, including breast cancer, suggesting their probable involvement as novel classes of oncogenes or tumour suppressor genes. The identification of differentially expressed miRNAs and elucidation of their functional roles may provide insight into the complex and diverse molecular mechanisms of tumorigenesis. MiR-183 is located on chromosome 7q32 and is part of a miRNA family which are dysregulated in numerous cancers. The aims of this study were to further examine the expression and functional role of miR-183 in breast cancer. Methods MiR-183 expression was quantitated in primary breast tumours, tumour associated normal tissue and breast cancer cell lines using RQ-PCR. Gain of function analysis was performed in breast cancer cells using pre-miR-183 and the effect of miR-183 overexpression on cell viability, proliferation, apoptosis and migration was examined. Customized Taqman Low Density Arrays (TLDA were used to identify dysregulated genes in breast cancer cells transfected with pre-miR-183. Results We demonstrate that miR-183 is dysregulated in breast cancer and expression correlates with estrogen receptor and HER2/neu receptor expression. Induced overexpression of miR-183 inhibited migration of breast cancer cells. This finding was substantiated by RQ-PCR of mRNA from cells overexpressing miR-183 which showed dysregulation of several migration and invasion related genes. Specifically, the VIL2-coding protein Ezrin was confirmed as a target of miR-183 and downregulation of this protein was confirmed with immunocytochemistry. Conclusions These findings indicate that miR-183 targets VIL2 and may play a central role in the regulation of migration and metastasis in

  6. MiR-183 regulates milk fat metabolism via MST1 in goat mammary epithelial cells.

    Science.gov (United States)

    Chen, Zhi; Shi, HuaiPing; Sun, Shuang; Luo, Jun; Zhang, Wei; Hou, Yu; Loor, Juan J

    2018-03-10

    The nutritional value of goat milk largely depends on its fatty acid content and composition. MicroRNAs (miRNAs) are a class of RNA molecules 18-25nt in length that regulate gene expression and play crucial roles in several biological processes, including fatty acid metabolism. In this study, we analyzed the correlation between differentially expressed miRNAs in goat mammary tissue and the fatty acid composition of goat milk by using Pearson correlations. Results revealed that levels of miR-183 were highly and positively correlated with the fatty acid content in the milk. In addition, we demonstrated that overexpression of miR-183 inhibits milk fat metabolism and inhibition of miR-183 promotes milk fat metabolism. Using Western blot, we demonstrate that MST1, one of the major elements of the Hippo signaling pathway, is a target of miR-183. Immunofluorescence assays revealed that miR-183 targets MST1 in the cytoplasm. In summary, data indicate that miR-183 inhibits the metabolism of milk fat by targeting the MST1 gene in the cytoplasm in goat mammary epithelial cells. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. The 183-WSL Fast Rain Rate Retrieval Algorithm. Part II: Validation Using Ground Radar Measurements

    Science.gov (United States)

    Laviola, Sante; Levizzani, Vincenzo

    2014-01-01

    The Water vapour Strong Lines at 183 GHz (183-WSL) algorithm is a method for the retrieval of rain rates and precipitation type classification (convectivestratiform), that makes use of the water vapor absorption lines centered at 183.31 GHz of the Advanced Microwave Sounding Unit module B (AMSU-B) and of the Microwave Humidity Sounder (MHS) flying on NOAA-15-18 and NOAA-19Metop-A satellite series, respectively. The characteristics of this algorithm were described in Part I of this paper together with comparisons against analogous precipitation products. The focus of Part II is the analysis of the performance of the 183-WSL technique based on surface radar measurements. The ground truth dataset consists of 2.5 years of rainfall intensity fields from the NIMROD European radar network which covers North-Western Europe. The investigation of the 183-WSL retrieval performance is based on a twofold approach: 1) the dichotomous statistic is used to evaluate the capabilities of the method to identify rain and no-rain clouds; 2) the accuracy statistic is applied to quantify the errors in the estimation of rain rates.The results reveal that the 183-WSL technique shows good skills in the detection of rainno-rain areas and in the quantification of rain rate intensities. The categorical analysis shows annual values of the POD, FAR and HK indices varying in the range 0.80-0.82, 0.330.36 and 0.39-0.46, respectively. The RMSE value is 2.8 millimeters per hour for the whole period despite an overestimation in the retrieved rain rates. Of note is the distribution of the 183-WSL monthly mean rain rate with respect to radar: the seasonal fluctuations of the average rainfalls measured by radar are reproduced by the 183-WSL. However, the retrieval method appears to suffer for the winter seasonal conditions especially when the soil is partially frozen and the surface emissivity drastically changes. This fact is verified observing the discrepancy distribution diagrams where2the 183-WSL

  8. NMR-ON of 182Ta and 183Ta in Fe

    International Nuclear Information System (INIS)

    Allsop, A.L.; Chaplin, D.H.; Murray, D.W.; Stone, N.J.

    1980-01-01

    Nuclear magnetic resonance has been observed on radioactive 182 Ta and 183 Ta oriented at low temperature in an Fe host, by detection of the change in spatial anisotropy of γ-rays emitted during nuclear decay. By measuring the resonant frequencies of 183 Ta in four different applied magnetic fields the nuclear magnetic moment and hyperfine field have been deduced. These are: vertical stroke μ( 183 Ta;I = 7/2) = 2.28(3)μsub(N) and Bsub(h)sub(f)(TaFe at 0 K) = -67.2(1.3)T. The sin of the ground state of 182 Ta has been determined as I = 3 by comparing resonance results with those obtained in a thermal equilibrium nuclear orientation study. The ratio of the resonant frequencies observed for 182 Ta and 183 Ta at one applied field value yields a magnetic moment for the former of vertical stroke μ( 182 Ta;I = 3) vertical stroke = 2.91(3)μsub(N). The spin lattice relaxation time for 183 TaFe (0.12 at% Ta) at 18 mK in an applied field of 0.5 T has been found to be 40(10)s. (orig.)

  9. MicroRNA-183 promotes cell proliferation via regulating programmed cell death 6 in pediatric acute myeloid leukemia.

    Science.gov (United States)

    Wang, Xiang; Zuo, Dongjian; Yuan, Yufang; Yang, Xiaochun; Hong, Ze; Zhang, Rongrong

    2017-01-01

    The aim of this study was to investigate roles of microRNA (miR)-183 in pediatric acute myeloid leukemia (AML). miR-183 expression in bone marrow and patients' sera of childhood AML was detected by real-time quantitative PCR. Functions of miR-183 in malignant phenotypes of two leukemia cell lines were then evaluated. Additionally, putative targets of miR-183 were predicted using three miRNA target prediction algorithms and validated by luciferase reporter assay. Clinical relevance of miR-183 and its target gene were further determined. miR-183 expression in bone marrow and patients' sera of childhood AML was both significantly higher than those in the corresponding normal controls (both P leukemia cells. Bioinformatics prediction and luciferase reporter assay identified programmed cell death 6 (PDCD6) as a direct target gene of miR-183. Moreover, high serum miR-183 combined with low serum PDCD6 mRNA was significantly associated with French-American-British classification subtype M7 (P = 0.01) and unfavorable karyotypes (P = 0.006). Further multivariate analysis identified the combination of serum miR-183 and PDCD6 levels as an independent prognostic factor for both relapse-free and overall survivals. Functionally, re-introduction of PDCD6 markedly reversed the effects of miR-183 in cell cycle, proliferation and apoptosis of two leukemia cell lines. Combined serum miR-183 and PDCD6 mRNA may serve as a novel prognostic biomarker for pediatric AML. Interestingly, miR-183 may function as an oncogene and may enhance cell proliferation by targeting PDCD6, implying a potential therapeutic target for this malignancy.

  10. Effect of NaCl Salts on the Activation Energy of Excited-State Proton Transfer Reaction of Coumarin 183.

    Science.gov (United States)

    Joung, Joonyoung F; Kim, Sangin; Park, Sungnam

    2015-12-17

    Coumarin 183 (C183) was used as a photoacid to study excited-state proton transfer (ESPT) reactions. Here, we studied the effect of ions on the ESPT of C183 in aqueous NaCl solutions using a steady-state fluorescence spectroscopy and time-correlated single photon counting (TCSPC) method. The acid dissociation equilibrium of excited-state C183 and the activation energy for the ESPT of C183 were determined as a function of NaCl concentration. The change in the equilibrium constant was found to be correlated with the solvation energy of deprotonated C183. Frequency-resolved TCSPC signals measured at several temperatures were analyzed by using a global fitting analysis method which enabled us to extract all the rate constants involving the ESPT reaction and the spectra of individual species. The activation energy for the ESPT reaction of C183 was highly dependent on NaCl concentration. Quantum chemical calculations were used to calculate the local hydrogen-bond (H-bond) configurations around C183 in aqueous NaCl solutions. It was found that the activation energy for the ESPT was determined by the local H-bond configurations around C183 which were significantly influenced by the dissolved ions.

  11. 25 CFR 224.183 - What other administrative appeals processes also apply?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What other administrative appeals processes also apply... DETERMINATION ACT General Appeal Procedures § 224.183 What other administrative appeals processes also apply? The administrative appeal processes in 25 CFR part 2 and 43 CFR part 4, subject to the limitations in...

  12. 33 CFR 183.710 - Start-in-gear protection required.

    Science.gov (United States)

    2010-07-01

    ... starting must have a built-in start-in-gear protection device. (2) Outboard motors designed for remote... this motor must comply with USCG requirements for start-in-gear protection in 33 CFR Part 183, Subpart... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Start-in-gear protection required...

  13. 1995 Phase 1 concrete sampling at the decontaminated 183-H basins

    International Nuclear Information System (INIS)

    Kramer, C.D.

    1996-01-01

    This report provides a consolidated reference for 1995 concrete sampling data associated with the Hanford Site's 183-H Solar Evaporation Basins (located at the Hanford Site in Richland, Washington). In 1995, the basins were decontaminated and dismantled. Sampling efforts began after completion of concrete decontamination efforts. Soil and water samples were collected and are described in chronological order in this report

  14. Adhikari SD Some zero-sum constants with weights183 Adsul ...

    Indian Academy of Sciences (India)

    AUTHOR INDEX. Adhikari S D. Some zero-sum constants with weights183. Adsul Bharat. A geometric approach to the Kronecker problem I: The two row case. 213. Arapura Donu. The motive of the moduli stack of. G-bundles over the universal curve 389. Athreya Krishna B. Growth of preferential attachment random.

  15. 33 CFR 183.516 - Cellular plastic used to encase fuel tanks.

    Science.gov (United States)

    2010-07-01

    ... the following liquids for 24 hours at 29 °C: (i) Reference fuel B ASTM D 471 (incorporated by... plastic used to encase metallic fuel tanks must have a density of at least 2.0 pounds per cubic foot, measured under ASTM D 1622 (incorporated by reference, see § 183.5), “Apparent Density of Rigid Cellular...

  16. and its Isotopic mm/Submillimeter Lines from Dark Cloud Lynds 183 ...

    Indian Academy of Sciences (India)

    envelope. The spectrum of L183, suggests the presence of several molecular species including. 12CO and 13CO (Caldwell 1979); H2CO. +. (Guêlin et al. 1982); CS (Snell et al. 1982);. C18O, CS, H13CO. +. , SO, NH3, C3H2 (Swade 1989a, 1989b); ...

  17. Draft Genome Sequences of 1,183 Salmonella Strains from the 100K Pathogen Genome Project.

    Science.gov (United States)

    Kong, Nguyet; Davis, Matthew; Arabyan, Narine; Huang, Bihua C; Weis, Allison M; Chen, Poyin; Thao, Kao; Ng, Whitney; Chin, Ning; Foutouhi, Soraya; Foutouhi, Azarene; Kaufman, James; Xie, Yi; Storey, Dylan B; Weimer, Bart C

    2017-07-13

    Salmonella is a common food-associated bacterium that has substantial impact on worldwide human health and the global economy. This is the public release of 1,183 Salmonella draft genome sequences as part of the 100K Pathogen Genome Project. These isolates represent global genomic diversity in the Salmonella genus. Copyright © 2017 Kong et al.

  18. 78 FR 68814 - Subzone 183B; Authorization of Production Activity; Samsung Austin Semiconductor, LLC...

    Science.gov (United States)

    2013-11-15

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-70-2013] Subzone 183B; Authorization of Production Activity; Samsung Austin Semiconductor, LLC (Semiconductors); Austin, Texas On June 26, 2013, Samsung Austin Semiconductor, LLC submitted a notification of proposed export production activity to the...

  19. 76 FR 73587 - Foreign-Trade Zone 183-Austin, Tx; Site Renumbering Notice

    Science.gov (United States)

    2011-11-29

    ... Partners w/n Global Business Park, Rutherford Lane/Cameron Road, Austin; Site 14 (91 acres)--Corridor Park.../East Riverside Drive, Austin; Site 10 (22.6 acres)--Ben White Business Park, South Industrial Drive/Business Center Drive, Austin; Site 11 (64.5 acres)--Walnut Business Park, US 290/US 183, Austin; Site 12...

  20. 26 CFR 1.183-1 - Activities not engaged in for profit.

    Science.gov (United States)

    2010-04-01

    ... which are operated primarily to furnish services, facilities, or goods to members, see section 277 and... for capital gains and losses—(i) In general. For purposes of section 183 and the regulations thereunder, the gross income from any activity not engaged in for profit includes the total of all capital...

  1. Field screening sampling and analysis strategy and methodology for the 183-H Solar Evaporation Basins: Phase 2, Soils

    International Nuclear Information System (INIS)

    Antipas, A.; Hopkins, A.M.; Wasemiller, M.A.; McCain, R.G.

    1996-01-01

    This document provides a sampling/analytical strategy and methodology for Resource Conservation and Recovery Act (RCRA) closure of the 183-H Solar Evaporation Basins within the boundaries and requirements identified in the initial Phase II Sampling and Analysis Plan for RCRA Closure of the 183-H Solar Evaporation Basins

  2. Overexpression of a heat shock protein (ThHSP18.3) from Tamarix hispida confers stress tolerance to yeast.

    Science.gov (United States)

    Gao, Caiqiu; Jiang, Bo; Wang, Yucheng; Liu, Guifeng; Yang, Chuanping

    2012-04-01

    It is well known that plant heat shock proteins (HSPs) play important roles both in response to adverse environmental conditions and in various developmental processes. However, among plant HSPs, the functions of tree plant HSPs are poorly characterized. To improve our understanding of tree HSPs, we cloned and characterized an HSP gene (ThHSP18.3) from Tamarix hispida. Sequence alignment reveals that ThHSP18.3 belongs to the class I small heat shock protein family. A transient expression assay showed that ThHSP18.3 protein was targeted to the cell nucleus. Treatment of Tamarix hispida with cold and heat shock highly induced ThHSP18.3 expression in all studied leaves, roots and stems, whereas, treatment of T. hispida with NaCl, NaHCO(3), and PEG induced ThHSP18.3 expression in leaves and decreased its expression in roots and stems. Further, to study the role of ThHSP18.3 in stress tolerance under different stress conditions, we cloned ThHSP18.3 into the pYES2 vector, transformed and expressed the vector in yeast Saccharomyces cerevisiae. Yeast cells transformed with an empty pYES2 vector were employed as a control. Compared to the control, yeast cells expressing ThHSP18.3 showed greater tolerance to salt, drought, heavy metals, and both low and high temperatures, indicating that ThHSP18.3 confers tolerance to these stress conditions. These results suggested that ThHSP18.3 is involved in tolerance to a variety of stress conditions in T. hispida.

  3. Dysregulated miR-183 inhibits migration in breast cancer cells.

    LENUS (Irish Health Repository)

    Lowery, Aoife J

    2010-01-01

    The involvement of miRNAs in the regulation of fundamental cellular functions has placed them at the fore of ongoing investigations into the processes underlying carcinogenesis. MiRNA expression patterns have been shown to be dysregulated in numerous human malignancies, including breast cancer, suggesting their probable involvement as novel classes of oncogenes or tumour suppressor genes. The identification of differentially expressed miRNAs and elucidation of their functional roles may provide insight into the complex and diverse molecular mechanisms of tumorigenesis. MiR-183 is located on chromosome 7q32 and is part of a miRNA family which are dysregulated in numerous cancers. The aims of this study were to further examine the expression and functional role of miR-183 in breast cancer.

  4. ARE ENTEROCOCCUS FAECIUM CRL 183 AND LACTOBACILLUS HELVETICUS SSP. JUGURTI 416 ABLE TO PRODUCE ANTIMICROBIAL SUBSTANCE?

    Directory of Open Access Journals (Sweden)

    R. BEDANI

    2008-12-01

    Full Text Available

    Production of antimicrobial substance by E. faecium CRL 183 and L. helveticus ssp jugurti 416 was tested against pathogenic bacteria and microorganisms isolated from Wistar rat faeces, using a spot-on-the-lawn assay. Three pathogenic bacteria (Listeria monocytogenes 1/2a, Salmonella enteridites 193/95, Escherichia coli O157:H7 and twenty-fi ve colonies, isolated from animal faeces, belonging to the following groups Enterococcus, Lactobacillus, Clostridium, Bacteroides and Enterobacteriaceae, were used as indicator microorganisms. The results showed that E. faecium CRL 183 and L. helveticus ssp jugurti 416 did not produce signifi cant antimicrobial activity against the indicator microorganisms tested. More tests needed to be carried out with other indicator bacteria and other culture media to confi rm the lack of antimicrobial production.

  5. Measurement of the W mass in $e^+ e^-$ collisions at 183 GeV

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Alemany, R; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Park, I C; Riu, I; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Becker, U; Boix, G; Cattaneo, M; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Leroy, O; Loomis, C; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Tournefier, E; Vreeswijk, M; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Cerutti, F; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Curtis, L; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Raine, C; Smith, D; Teixeira-Dias, P; Thompson, A S; Ward, J J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Onk, A L; Putzer, A; Schmidt, G; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Nowell, J; Sedgbeer, J K; Spagnolo, P; Thomson, E; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Williams, M; Van Gemmeren, P; Giehl, I; Hölldorfer, F; Hoffmann, C; Jakobs, K; Kleinknecht, K; Kröcker, M; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Motsch, F; Payre, P; Talby, M; Thulasidas, M; Tilquin, A; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Kado, M; Kim, D W; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; D'Onofrio, G; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Chambers, J T; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Przysiezniak, H; Rander, J; Renardy, J F; Rosowsky, A; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Kelly, M S; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Foss, J; Grupen, Claus; Misiejuk, A; Prange, G; Sieler, U; Smolik, L; Stephan, F; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; Mamier, G; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Vogt, M; Walsh, J; Wu Sau Lan; Wu, X; Zobernig, G

    1999-01-01

    The mass of the W boson is obtained from reconstructed invariant mass distributions in W-pair events. The sample of W pairs is selected from 57 pb$^{-1}$ collected with the ALEPH detector in 1997 at a centre-of-mass energy of 183 GeV. The invariant mass distributions of reweighted Monte Carlo events are fitted separately to the experimental distributions in the $qqbarqqbar$ and all $l\

  6. Integration of photocatalysis and biological treatment for azo dye removal--application to AR183.

    Science.gov (United States)

    Chebli, Derradji; Fourcade, Florence; Brosillon, Stephan; Nacef, Saci; Amrane, Abdeltif

    2011-04-01

    The feasibility of coupling photocatalysis with biological treatment to treat effluents containing azo dyes was examined in this work. With this aim, the degradation of Acid Red 183 was investigated. The very low biodegradability of AR183 was confirmed beforehand by measuring the biological oxygen demand (BOD5). Photocatalysis experiments were carried out in a closed-loop step photoreactor. The reactor walls were covered by TiO2 catalyst coated on non-woven paper, and the effluent flowed over the photocatalyst as a thin falling film. The removal of the dye was 82.7% after 4 h, and a quasi-complete decolorization (98.5%) was obtained for 10 h of irradiation (initial concentration 100 mg L(-1)). The decrease in concentration followed pseudo-first-order kinetics, with a constant k of 0.47 h(-1). Mineralization and oxidation yields were 80% and 75%, respectively, after 10 h of pretreatment. Therefore, even if target compound oxidation occurs (COD removal), indicating a modification to the chemical structure, the concomitant high mineralization was not in favour of subsequent microbial growth. The BOD5 measurement confirmed the non-biodegradability of the irradiated solution, which remained toxic since the EC50 decreased from 35 to 3 mg L(-1). The proposed integrated process appeared, therefore, to be not relevant for the treatment of AR183. However, this result should be confirmed for other azo dyes.

  7. 1996 Phase 2 soil sampling at the 183-H Solar Evaporation Basin site

    International Nuclear Information System (INIS)

    Kramer, C.D.

    1996-10-01

    This report consolidates 1996 soil sampling data collected from the 183-H Solar Evaporation Basin Site. This report is intended to be a data reference and does not make comparisons or conclusions regarding specific regulatory criteria. Chemical and radiological data were collected to support cleanup activities at the Hanford Site; soil sampling occurred beneath and next to the former basin structures. The 183-H Solar Evaporation Basins, which consisted of four adjoining concrete basins, were located in the 100 Area of the Hanford Site, north of the retired 105-H Reactor. Originally, the basins were built as part of the 100-H water treatment structures. The four basins were inactive from the mid-1960's until 1973 when radioactive and dangerous (mixed) waste from the 300 Area Fuel Fabrication Facility was shipped to the basins for storage and treatment. The basins were used for solar evaporation of the waste. The last shipment of waste to the 183-H Basins took place in November 1985. Decontamination of the cement structure took place in 1995. The structure has subsequently been dismantled and disposed. Chapters 2.0 through 4.0 present summary information about sampling (1) beneath the loading ramp and berm piles, (2) in shallow soils beneath the former basin floor, and (3) deep vadose soils. Detailed data are provided in the appendices

  8. 78 FR 40427 - Foreign-Trade Zone (FTZ) 183-Austin, Texas; Notification of Proposed Production Activity; Samsung...

    Science.gov (United States)

    2013-07-05

    ..., Texas; Notification of Proposed Production Activity; Samsung Austin Semiconductor, LLC (Semiconductors); Austin, Texas Samsung Austin Semiconductor, LLC (Samsung), operator of Subzone 183B, submitted a... June 26, 2013. Samsung currently has authority to produce semiconductor memory devices for export...

  9. Wnt/catenin β1/microRNA 183 predicts recurrence and prognosis of patients with colorectal cancer.

    Science.gov (United States)

    Chen, Yuzhuo; Song, Weiliang

    2018-04-01

    The present study assessed the association between the Wnt/catenin β1 (CTNNB1)/microRNA (miR)183 signaling pathway and the recurrence and prognosis of colorectal cancer. The expression of Wnt, CTNNB1 and miR183 in primary colorectal cancer tissue was increased compared with that in the paracarcinoma tissue. Disease-free survival and overall survival were decreased in patients with colorectal cancer and increased miR183 expression compared with those in patients with colorectal cancer and decreased miR183 expression. The human colorectal cancer cell line HCT-116 was treated with 5 µM inhibitor of Wnt response (IWR-2) for 24 h to inhibit Wnt protein expression. Downregulating Wnt and CTNNB1 expression inhibited the viability of, and induced cell death and caspase 3 protein expression in, HCT-116 cells. The expression of BCL2 associated X protein and miR183 was increased, and cyclin D1 protein expression was suppressed, by the downregulation of Wnt and CTNNB1 expression in HCT-116 cells. Collectively, the results of the present study suggested that the Wnt/CTNNB1/miR183 signaling pathway may represent a promising biomarker for the recurrence and prognosis of colorectal cancer.

  10. WWLLN lightning and satellite microwave radiometrics at 37 to 183 GHz: Thunderstorms in the broad tropics

    Science.gov (United States)

    Solorzano, N. N.; Thomas, J. N.; Hutchins, M. L.; Holzworth, R. H.

    2016-10-01

    We investigate lightning strokes and deep convection through the examination of cloud-to-ground (CG) lightning from the World Wide Lightning Location Network (WWLLN) and passive microwave radiometer data. Microwave channels at 37 to 183.3 GHz are provided by the Tropical Rainfall Measuring Mission satellite (TRMM) Microwave Imager (TMI) and the Special Sensor Microwave Imager/Sounder (SSMIS) on the Defense Meteorological Satellite Program (DMSP) satellite F16. The present study compares WWLLN stroke rates and minimum radiometer brightness temperatures (Tbs) for two Northern Hemisphere and Southern Hemisphere summers (2009-2011) in the broad tropics (35°S to 35°N). To identify deep convection, we use lightning data and Tbs derived from all channels and differences in the Tbs (ΔTbs) of the three water vapor channels near 183.3 GHz. We find that stroke probabilities increase with increasing Tb depressions for all frequencies examined. Moreover, we apply methods that use the 183.3 GHz channels to pinpoint deep convection associated with lightning. High lightning stroke probabilities are found over land regions for both intense and relatively weak convective systems, although the TMI 85 GHz results should be used with caution as they are affected by a 7 km gap between the conical scans. Over the ocean, lightning is associated mostly with larger Tb depressions. Generally, our results support the noninductive thundercloud charging mechanism but do not rule out the inductive mechanism during the mature stages of storms. Lastly, we present a case study in which lightning stroke rates are used to reconstruct microwave radiometer Tbs.

  11. MicroRNA-183 family members regulate sensorineural fates in the inner ear.

    Science.gov (United States)

    Li, Haiqiong; Kloosterman, Wigard; Fekete, Donna M

    2010-03-03

    Members of the microRNA (miRNA) 183 family (miR-183, miR-96, and miR-182) are expressed abundantly in specific sensory cell types in the eye, nose, and inner ear. In the inner ear, expression is robust in the mechanosensory hair cells and weak in the associated statoacoustic ganglion (SAG) neurons; both cell types can share a common lineage during development. Recently, dominant-progressive hearing loss in humans and mice was linked to mutations in the seed region of miR-96, with associated defects in both development and maintenance of hair cells in the mutant mice. To understand how the entire triplet functions in the development of mechanosensory hair cells and neurons of the inner ear, we manipulated the levels of these miRNAs in zebrafish embryos using synthesized miRNAs and antisense morpholino oligonucleotides (MOs). Overexpression of miR-96 or miR-182 induces duplicated otocysts, ectopic or expanded sensory patches, and extra hair cells, whereas morphogenesis of the SAG is adversely affected to different degrees. In contrast, knockdown of miR-183, miR-96, and miR-182 causes reduced numbers of hair cells in the inner ear, smaller SAGs, defects in semicircular canals, and abnormal neuromasts on the posterior lateral line. However, the prosensory region of the posterior macula, where the number of hair cells is reduced by approximately 50%, is not significantly impaired. Our findings suggest both distinct and common roles for the three miRNAs in cell-fate determination in the inner ear, and these principles might apply to development of other sensory organs.

  12. Occurrence of cancer in a cohort of 183 persons with constitutional chromosome 7 abnormalities

    DEFF Research Database (Denmark)

    Hasle, H; Olsen, J H; Hansen, J

    1998-01-01

    with constitutional abnormalities involving chromosome 7, including 16 patients with Williams syndrome. By linkage to the Danish Cancer Registry, we found five persons with cancer, including one thyroid carcinoma, three carcinomas of the digestive tract, and one malignant melanoma. There were no cases of leukemia......Cytogenetic abnormalities in human malignancies frequently involve chromosome 7. The existence of several tumor suppressor genes on the long arm of chromosome 7 has been suggested in both epithelial and hematologic malignancies. From the Danish Cytogenetic Register, we identified 183 persons...

  13. microRNA-183 plays as oncogenes by increasing cell proliferation, migration and invasion via targeting protein phosphatase 2A in renal cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Qiu, Mingning, E-mail: lcuzfy@163.com; Liu, Lei, E-mail: leiliulab@163.com; Chen, Lieqian, E-mail: lieqianchen@163.com; Tan, Guobin, E-mail: guobintan@163.com; Liang, Ziji, E-mail: zijilianglab@163.com; Wang, Kangning, E-mail: kangningwanglab@163.com; Liu, Jianjun, E-mail: jianjunliulab@163.com; Chen, Hege, E-mail: hegechen@163.com

    2014-09-12

    Highlights: • miR-183 was up-regulated in renal cancer tissues. • Inhibition of endogenous miR-183 suppressed renal cancer cell growth and metastasis. • miR-183 increased cell growth and metastasis. • miR-183 regulated renal cancer cell growth and metastasis via directly targeting tumor suppressor protein phosphatase 2A. - Abstract: The aim of this study was to investigate the function of miR-183 in renal cancer cells and the mechanisms miR-183 regulates this process. In this study, level of miR-183 in clinical renal cancer specimens was detected by quantitative real-time PCR. miR-183 was up- and down-regulated in two renal cancer cell lines ACHN and A498, respectively, and cell proliferation, Caspase 3/7 activity, colony formation, in vitro migration and invasion were measured; and then the mechanisms of miR-183 regulating was analyzed. We found that miR-183 was up-regulated in renal cancer tissues; inhibition of endogenous miR-183 suppressed in vitro cell proliferation, colony formation, migration, and invasion and stimulated Caspase 3/7 activity; up-regulated miR-183 increased cell growth and metastasis and suppressed Caspase 3/7 activity. We also found that miR-183 directly targeted tumor suppressor, specifically the 3′UTR of three subunits of protein phosphatase 2A (PP2A-Cα, PP2A-Cβ, and PP2A-B56-γ) transcripts, inhibiting their expression and regulated the downstream regulators p21, p27, MMP2/3/7 and TIMP1/2/3/4. These results revealed the oncogenes role of miR-183 in renal cancer cells via direct targeting protein phosphatase 2A.

  14. Tank Farm WM-182 and WM 183 Heel Slurry Samples PSD Results

    Energy Technology Data Exchange (ETDEWEB)

    Batcheller, Thomas Aquinas

    2000-09-01

    Particle size distribution (PSD) analysis of INTEC Tank Farm WM-182 and WM-183 heel slurry samples were performed using a modified Horiba LA-300 PSD analyzer at the RAL facility. There were two types of testing performed: typical PSD analysis, and setting rate testing. Although the heel slurry samples were obtained from two separate vessels, the particle size distribution results were quite similar. The slurry solids were from approximately a minimum particle size of 0.5 mm to a maximum of 230 mm-with about 90% of the material between 2-to-133 mm, and the cumulative 50% value at approximately 20 mm. This testing also revealed that high frequency sonication with an ultrasonic element may break-up larger particles in the WM-182 and WM-183 tank from heel slurries. This finding represents useful information regarding ultimate tank heel waste processing. Settling rate testing results were also fairly consistent with material from both vessels in that it appears that most of the mass of solids settle to an agglomerated, yet easily redispersed layer at the bottom. A dispersed and suspended material remained in the "clear" layer above the settled layer after about one-half an hour of settling time. This material had a statistical mode of approximately 5 mm and a maximum particle size of 30 mm.

  15. Biosynthesis of digalactosyldiacylglycerol in plastids from 16:3 and 18:3 plants

    International Nuclear Information System (INIS)

    Heemskerk, J.W.M.; Heinz, E.; Storz, T.; Schmidt, R.R.

    1990-01-01

    Intact chloroplasts isolated from leaves of eight species of 16:3 and 18:3 plants and chromoplasts isolated from Narcissus pseudonarcissus L. flowers synthesize galactose-labeled mono-, di-, and trigalactosyldiacylglycerol (MGDG, DGDG, and TGDG) when incubated with UDP-[6- 3 H]galactose. In all plastids, galactolipid synthesis, and especially synthesis of DGDG and TGDG, is reduced by treatment of the organelles with the nonpenetrating protease thermolysin. Envelope membranes isolated from thermolysin-treated chloroplasts of Spinacia oleracea L. (16:3 plant) and Pisum sativum L. (18:3 plant) or membranes isolated from thermolysin-treated chromoplasts are strongly reduced in galactolipid:galactolipid galactosyltransferase activity, but not with regard to UDP-Gal:diacylglycerol galactosyltransferase. For the intact plastids, this indicates that thermolysin treatment specifically blocks DGDG (and TGDG) synthesis, whereas MGDG synthesis is not affected. Neither in chloroplast nor in chromoplast membranes is DGDG synthesis stimulated by UDP-Gal. DGDG synthesis in S. oleracea chloroplasts is not stimulated by nucleoside 5'-diphospho digalactosides. Therefore, galactolipid:galactolipid galactosyltransferase is so far the only detectable enzyme synthesizing DGDG

  16. Consistency in the host specificity and host sensitivity of the Bacteroides HF183 marker for sewage pollution tracking.

    Science.gov (United States)

    Ahmed, W; Masters, N; Toze, S

    2012-10-01

    The host specificity (H-SPF) and host sensitivity (H-SNV) values of the sewage-associated HF183 Bacteroides marker in the current study were compared with the previously published studies in South East Queensland (SEQ), Australia, by testing a large number of wastewater and faecal DNA samples (n=293) from 11 target and nontarget host groups. This was carried out to obtain information on the consistency in the H-SPF and H-SNV values of the HF183 marker for sewage pollution tracking in SEQ. Polymerase chain reaction (PCR) analysis was used to determine the presence/absence of the HF183 marker in wastewater and faecal DNA samples. Among the human composite wastewater (n=59) from sewage treatment plants and individual human (n=20) faecal DNA samples tested, 75 (95%) were PCR positive for the HF183 marker. The overall H-SNV of this marker in target host group was 0·95 (maximum of 1·00). Among the 214 nontarget animal faecal DNA samples tested, 201 (94%) samples were negative for the HF183 marker. Six chicken, five dog and two bird faecal DNA samples, however, were positive for the marker. The overall H-SPF of the HF183 marker to differentiate between target and nontarget faecal DNA samples was 0·94 (maximum of 1·00). The H-SNV (0·95) and H-SPF (0·94) values obtained in this study was slightly lower than previous studies (H-SNV value of 1·00 in 2007 and 1·00 in 2009; H-SPF value of 1·00 in 2007 and 0·99 in 2009). Nonetheless, the overall high H-SNV (0·98) and H-SPF (0·97) values of the HF183 marker over the past 4 years (i.e. 2007-2011) suggest that the HF183 marker can be reliably used for the detection of sewage pollution in environmental waters in SEQ. In the current study, the HF183 marker was detected in small number nontarget animal faecal samples. Care should be taken to interpret results obtained from catchments or waterways that might be potentially contaminated with dog faecal matter or poultry litter. © 2012 The Authors. Letters in Applied

  17. Absolute Transition Probabilities from the 453.1 keV Level in {sup 183}W

    Energy Technology Data Exchange (ETDEWEB)

    Malmskog, S.G.

    1966-10-15

    The half life of the 453.1 keV level in {sup 183}W has been measured by the delayed coincidence method to 18.4 {+-} 0.5 nsec. This determines twelve absolute M1 and E2 transition probabilities, out of which nine are K-forbidden. All transition probabilities are compared with the single particle estimate. The three K-allowed E2, {delta}K = 2 transition rates to the 1/2{sup -} (510) rotational band are furthermore compared with the Nilsson model. An attempt to give a quantitative explanation of the observed transition rates has been made by including the effects from admixtures into the single particle wave functions.

  18. Photon Events with Missing Energy at $\\sqrt{s}$= 183 to 189 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Azhinenko, I.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Beilliere, P.; Belokopytov, Yu.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Bertrand, D.; Besancon, M.; Bigi, M.; Bilenky, Mikhail S.; Bizouard, M.A.; Bloch, D.; Blom, H.M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borgland, A.W.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bourdarios, C.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buran, T.; Buschbeck, B.; Buschmann, P.; Cabrera, S.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chabaud, V.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Shlyapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Crawley, H.B.; Crennell, D.; Crepe-Renaudin, Sabine; Crosetti, G.; Cuevas Maestro, J.; Czellar, S.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Dolbeau, J.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Duperrin, A.; Durand, J.D.; Eigen, G.; Ekelof, T.; Ekspong, G.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Harris, Elisabeth Falk; Fanourakis, G.; Fassouliotis, D.; Fayot, J.; Feindt, M.; Ferrari, P.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Fichet, S.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Gerdyukov, L.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Gouz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Gris, P.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hansen, J.; Harris, F.J.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Hessing, T.L.; Heuser, J.M.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Huber, M.; Huet, K.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Janik, R.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovansky, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Klein, Hansjorg; Kluit, P.; Kokkinias, P.; Kostyukhin, V.; Kourkoumelis, C.; Kuznetsov, O.; Krammer, M.; Kriznic, E.; Krumshtein, Z.; Kubinec, P.; Kurowska, J.; Kurvinen, K.; Lamsa, J.W.; Lane, D.W.; Lapin, V.; Laugier, J.P.; Lauhakangas, R.; Leder, G.; Ledroit, Fabienne; Lefebure, V.; Leinonen, L.; Leisos, A.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Loerstad, B.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Malmgren, T.G.M.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Martinez-Vidal, F.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Meroni, C.; Meyer, W.T.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjornmark, U.; Moa, T.; Moch, M.; Moller, Rasmus; Monig, Klaus; Monge, M.R.; Moraes, D.; Moreau, X.; Morettini, P.; Morton, G.; Muller, U.; Munich, K.; Mulders, M.; Mulet-Marquis, C.; Muresan, R.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Naraghi, F.; Nassiakou, M.; Navarria, F.L.; Navas, Sergio; Nawrocki, K.; Negri, P.; Neufeld, N.; Nicolaidou, R.; Nielsen, B.S.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.; Olshevsky, A.G.; Onofre, A.; Orava, R.; Orazi, G.; Osterberg, K.; Ouraou, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Papageorgiou, K.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Pavel, T.; Pegoraro, M.; Peralta, L.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdnyakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Rames, J.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Rohne, O.; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Royon, C.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salt, J.; Sampsonidis, D.; Sannino, M.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Yu.; Segar, A.M.; Seibert, N.; Sekulin, R.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnov, N.; Smirnova, O.; Smith, G.R.; Sokolov, A.; Sopczak, A.; Sosnowski, R.; Spassoff, T.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanic, S.; Stanitzki, M.; Stevenson, K.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Thomas, J.; Timmermans, Jan; Tinti, N.; Tkachev, L.G.; Tobin, M.; Todorova, S.; Tomaradze, A.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Transtromer, G.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Van Den Boeck, W.; Van Eldik, J.; Van Lysebetten, A.; Van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Walck, C.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zinchenko, A.; Zoller, P.; Zucchelli, G.C.; Zumerle, G.

    2000-01-01

    The production of single photons has been studiedin the reaction e+e- --> gamma+ invisible particles at centre-of-mass energies of 183~GeV and 189~GeV.A previously published analysis of events with multi-photonfinal states accompanied by missing energy has been updated with 189 GeV data.The data were collected with the DELPHI detector and correspondto integrated luminosities of about 51~pb^{-1}and 158~pb^{-1}at thetwo energies.The number of light neutrino families is measured to be2.86\\pm0.13(stat)\\pm0.14(syst)$. The absence ofan excess of events beyond that expected from Standard Modelprocesses is used to set limits on new physicsas described by supersymmetric and composite models.A limit on the gravitational scale is also determined.

  19. Absolute Transition Probabilities from the 453.1 keV Level in 183W

    International Nuclear Information System (INIS)

    Malmskog, S.G.

    1966-10-01

    The half life of the 453.1 keV level in 183 W has been measured by the delayed coincidence method to 18.4 ± 0.5 nsec. This determines twelve absolute M1 and E2 transition probabilities, out of which nine are K-forbidden. All transition probabilities are compared with the single particle estimate. The three K-allowed E2, ΔK = 2 transition rates to the 1/2 - (510) rotational band are furthermore compared with the Nilsson model. An attempt to give a quantitative explanation of the observed transition rates has been made by including the effects from admixtures into the single particle wave functions

  20. A review of sources of systematic errors and uncertainties in observations and simulations at 183 GHz

    Science.gov (United States)

    Brogniez, Helene; English, Stephen; Mahfouf, Jean-Francois; Behrendt, Andreas; Berg, Wesley; Boukabara, Sid; Buehler, Stefan Alexander; Chambon, Philippe; Gambacorta, Antonia; Geer, Alan; Ingram, William; Kursinski, E. Robert; Matricardi, Marco; Odintsova, Tatyana A.; Payne, Vivienne H.; Thorne, Peter W.; Tretyakov, Mikhail Yu.; Wang, Junhong

    2016-05-01

    Several recent studies have observed systematic differences between measurements in the 183.31 GHz water vapor line by space-borne sounders and calculations using radiative transfer models, with inputs from either radiosondes (radiosonde observations, RAOBs) or short-range forecasts by numerical weather prediction (NWP) models. This paper discusses all the relevant categories of observation-based or model-based data, quantifies their uncertainties and separates biases that could be common to all causes from those attributable to a particular cause. Reference observations from radiosondes, Global Navigation Satellite System (GNSS) receivers, differential absorption lidar (DIAL) and Raman lidar are thus overviewed. Biases arising from their calibration procedures, NWP models and data assimilation, instrument biases and radiative transfer models (both the models themselves and the underlying spectroscopy) are presented and discussed. Although presently no single process in the comparisons seems capable of explaining the observed structure of bias, recommendations are made in order to better understand the causes.

  1. Let-7, mir-98 and mir-183 as biomarkers for cancer and schizophrenia [corrected].

    Directory of Open Access Journals (Sweden)

    Emmanouil Rizos

    Full Text Available Recent evidence supports a role of microRNAs in cancer and psychiatric disorders such as schizophrenia and bipolar disorder, through their regulatory role on the expression of multiple genes. The rather rare co-morbidity of cancer and schizophrenia is an old hypothesis which needs further research on microRNAs as molecules that might exert their oncosuppressive or oncogenic activity in the context of their role in psychiatric disorders. The expression pattern of a variety of different microRNAs was investigated in patients (N = 6 suffering from schizophrenia termed control, patients with a solid tumor (N = 10 and patients with both schizophrenia and tumor (N = 8. miRNA profiling was performed on whole blood samples using the miRCURY LNA microRNA Array technology (6th & 7th generation. A subset of 3 microRNAs showed a statistically significant differential expression between the control and the study groups. Specifically, significant down-regulation of the let-7p-5p, miR-98-5p and of miR-183-5p in the study groups (tumor alone and tumorand schizophrenia was observed (p<0.05. The results of the present study showed that let-7, miR-98 and miR-183 may play an important oncosuppressive role through their regulatory impact in gene expression irrespective of the presence of schizophrenia, although a larger sample size is required to validate these results. Nevertheless, further studies are warranted in order to highlight a possible role of these and other micro-RNAs in the molecular pathways of schizophrenia.

  2. Biased agonism and allosteric modulation of GPR183- a 7TM receptor also known as EBV-induced EBI2

    DEFF Research Database (Denmark)

    Daugvilaite, Viktorija; Madsen, Christian Medom; Lückmann, Michael

    2017-01-01

    BACKGROUND AND PURPOSE: The G protein-coupled receptor Epstein Barr virus-induced gene 2 (EBI2, also known as GPR183) is activated by oxysterols and plays a pivotal role for proper B cell migration during immune responses. While the molecular basis of agonist binding has been addressed in several...

  3. [Analysis of short-term respiratory adverse events in 183 bronchial thermoplasty procedures].

    Science.gov (United States)

    Nong, Y; Lin, J T; Su, N; Chen, X; Zhao, Q; Han, C Y; Qiu, R F

    2017-03-12

    Objective: To analyze the short-term (3 weeks) adverse respiratory events after bronchial thermoplasty(BT) in patients with severe asthma. Methods: The China-Japan Friendship Hospital recruited 62 patients with severe asthma for BT treatment from March 2014 to July 2016, with a total of 183 BT procedures. The data of adverse respiratory events within 3 weeks after procedure were collected to analyze the factors that might potentially influence the occurrence of adverse events. Results: Forty-three patients (69.4%) experienced adverse respiratory events within 3 weeks after treatment. Totally 153 adverse respiratory events occurred after 87 procedures(47.5%). The main adverse events were cough (15 events, 8.20%), sputum production (37 events, 20.22%), temporary PEF reduction (37 events, 20.22%), chest distress (12 events, 6.56%), blood in sputum (11 events, 6.01%), asthma exacerbation (10 events, 5.46%), and pneumonia(6 events, 3.28%). Most events were relieved or resolved with standard therapy in 1 week. No severe adverse events including tracheal intubation, malignant arrhythmias or death occurred within 3 weeks after procedure. The baseline eosinophil percentage in induced sputum and blood, operation times, and preoperative FEV(1) (% predicted) might influence the occurrence of adverse events after treatment. Patients with preoperative FEV(1) (% predicted) ≥60% had lower risk of adverse events. Conclusion: BT showed a good security profile in treating patients with severe asthma within 3 weeks after procedure.

  4. Fe(Co)SiBPCCu nanocrystalline alloys with high Bs above 1.83 T

    Science.gov (United States)

    Liu, Tao; Kong, Fengyu; Xie, Lei; Wang, Anding; Chang, Chuntao; Wang, Xinmin; Liu, Chain-Tsuan

    2017-11-01

    Fe84.75-xCoxSi2B9P3C0.5Cu0.75 (x = 0, 2.5 and 10) nanocrystalline alloys with excellent magnetic properties were successfully developed. The fully amorphous alloy ribbons exhibit wide temperature interval of 145-156 °C between the two crystallization events. It is found that the excessive substitution of Co for Fe greatly deteriorates the magnetic properties due to the non-uniform microstructure with coarse grains. The alloys with x = 0 and 2.5 exhibit high saturation magnetization (above 1.83 T), low core loss and relatively low coercivity (below 5.4 A/m) after annealing. In addition, the Fe84.75Si2B9P3C0.5Cu0.75 nanocrystalline alloy also exhibits good frequency properties and temperature stability. The excellent magnetic properties were explained by the uniform microstructure with small grain size and the wide magnetic domains of the alloy. Low raw material cost, good manufacturability and excellent magnetic properties will make these nanocrystalline alloys prospective candidates for transformer and motor cores.

  5. Stem subsidence after total hip revision: 183 cases at 5.9 years follow-up.

    Science.gov (United States)

    Girard, J; Roche, O; Wavreille, G; Canovas, F; Le Béguec, P

    2011-04-01

    Secondary subsidence of a revision femoral stem is often a negative predictive sign for successful osseointegration and perfect long-term stability. We performed a retrospective study in a series of 183 revision total hip replacements between 1996 and 2000 to evaluate the importance and risk factors of secondary subsidence with a cementless press-fit design femoral stem as well as this subsidence's consequences to osseointegration. Secondary subsidence did not occur in 80 cases (53%), was between 0 and 4mm in 41 cases (27%); between 5 and 10mm in 17 cases (12%) and was greater than 10mm in 12 cases (8%). Mean subsidence of all patients was 3mm (0-30). There was a statistically significant negative correlation between subsidence and the quality of osseointegration (P=0.03). There was no significant relationship between component diameter and stem subsidence (P=0.9). The presence of preoperative bone deficiencies did not increase the risk of secondary subsidence (P=0.2). In the case of revision with press-fit stems, the importance of secondary subsidence should not be overestimated, because it usually does not negatively affect satisfactory osseointegration. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  6. "Effect of the drug transporters ABCB1, ABCC2, and ABCG2 on the disposition and brain accumulation of the taxane analog BMS-275,183"

    NARCIS (Netherlands)

    Marchetti, Serena; Pluim, Dick; Beijnen, Jos H; Mazzanti, Roberto; van Tellingen, Olaf; Schellens, Jan H M

    2014-01-01

    BMS-275,183 is a novel oral C-4 methyl carbonate analogue of paclitaxel. Recently, a drug-drug interaction between BMS-275,183 and benzimidazole proton pump inhibitors (PPIs) was suggested in clinical trials resulting in elevated drug exposure and toxicity. We explored whether the interaction takes

  7. miR-183 inhibits TGF-β1-induced apoptosis by downregulation of PDCD4 expression in human hepatocellular carcinoma cells

    International Nuclear Information System (INIS)

    Li, Jipeng; Fu, Hanjiang; Xu, Chengwang; Tie, Yi; Xing, Ruiyun; Zhu, Jie; Qin, Yide; Sun, Zhixian; Zheng, Xiaofei

    2010-01-01

    In recent years, some miRNAs have been reported to be connected closely with the development of human hepatocellular carcinoma. In our previous studies, a set of miRNAs were revealed to be dysregulated in HCC tissues. However, the functions of these miRNAs in HCC remain largely undefined. The expression profiles of miR-183 were compared between HCC tissues and adjacent normal liver tissues using qRT-PCR method. This method was used to screen the potential target genes of miR-183. A luciferase reporter assay was conducted to confirm target association. Finally, the functional effect of miR-183 in hepatoma cells was examined. Among the 25 HCC samples analyzed, microRNA-183 was significantly up-regulated (twofold to 367-fold) in 17 samples compared with the matching nontumoral liver tissues. Programmed cell death 4 (PDCD4) was identified as the target gene of miR-183. Moreover, PDCD4 is a proapoptotic molecule involved in TGF-β1-induced apoptosis in human HCC cells, we found that miR-183 transfectants were resistant to apoptosis induced by TGF-β1. We conclude that miR-183 can inhibit apoptosis in human HCC cells by repressing the PDCD4 expression, and miR-183 may play an important role in HCC development

  8. Simulation of VANAM M3 test using MELCOR 1.8.3

    International Nuclear Information System (INIS)

    Cho, Sung Won; Kim, Hee Dong

    1996-07-01

    A standard problem is defined as a comparison between experimental and analytical results in the field of reactor safety research. The detailed comparison of the data permits conclusions for the reliability and precision of computer simulations of postulated accidents and contributions to the development and improvement of reactor safety computer codes. Following a suggestion of the Federal Republic of Germany, the OECD-CSNI agreed to offer the experiment VANAM M3 at the Battelle Model Containment (BMC), an experiment on thermohydraulics and aerosol behavior in a containment, as International Standard Problem No. 37 (ISP 37). The general objectives of the ISP 37 are to analyse the thermohydraulics of a containment atmosphere and the distribution and settlement of aerosol after a high pressure path with depressurization by pressurizer relief valve discharge. Steam condensation at the aerosol particles(condensation in volume) is enhanced by the hygroscopic properties of the aerosol materials, even in case of limited steam supply. The originally small, low-density NaOH particles are converted to solution droplets by steam condensation, the increasing droplet mass significantly enhancing aerosol depletion by gravity settlement. As a result, higher depletion rate have been obtained for the NaOH aerosol than for the SnO 2 aerosol in M2. The MELCOR code, version 1.8.3, has been used for the simulation of this experiment, and the results are compared with the results of other calculations at GRS. The objectives of this report are to contribute to the efficient use of MELCOR code and understanding of the aerosol behavior. 12 tabs., 19 figs., 11 refs. (Author)

  9. High-latitude dust clouds LDN 183 and LDN 169: distances and extinctions

    Science.gov (United States)

    Straižys, V.; Boyle, R. P.; Zdanavičius, J.; Janusz, R.; Corbally, C. J.; Munari, U.; Andersson, B.-G.; Zdanavičius, K.; Kazlauskas, A.; Maskoliūnas, M.; Černis, K.; Macijauskas, M.

    2018-03-01

    Interstellar extinction is investigated in a 2°× 2° area containing the dust and molecular clouds LDN 183 (MBM 37) and LDN 169, which are located at RA = 15h 54m, Dec = - 3°. The study is based on a photometric classification in spectral and luminosity classes of 782 stars selected from the catalogs of 1299 stars down to V = 20 mag observed in the Vilnius seven-color system. For control, the MK types for the 18 brightest stars with V between 8.5 and 12.8 mag were determined spectroscopically. For 14 stars, located closer than 200 pc, distances were calculated from trigonometric parallaxes taken from the Gaia Data Release 1. For about 70% of the observed stars, two-dimensional spectral types, interstellar extinctions AV, and distances were determined. Using 57 stars closer than 200 pc, we estimate that the front edge of the clouds begins at 105 ± 8 pc. The extinction layer in the vicinities of the clouds can be about 20 pc thick. In the outer parts of the clouds and between the clouds, the extinction is 0.5-2.0 mag. Behind the Serpens/Libra clouds, the extinction range does not increase; this means that the dust layer at 105 pc is a single extinction source. Full Tables 1 and 2 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/611/A9

  10. Retrospective evaluation of borderline ovarian tumors: single center experience of 183 cases.

    Science.gov (United States)

    Gungor, Tayfun; Cetinkaya, Nilufer; Yalcin, Hakan; Ozdal, Bulent; Ozgu, Emre; Baser, Eralp; Uygur, Dilek; Caglar, Mete; Sirvan, Levent; Erkaya, Salim

    2015-01-01

    Borderline ovarian tumors (BOTs) constitute about a quarter of epithelial ovarian malignancies and require different treatment approaches. The present study aims to document the experience of a single center on the treatment outcome of women who had conservative or comprehensive surgery for BOTs. One hundred eighty-three patients with BOTs, diagnosed and/or treated in our center between January of 2000 and March of 2013, were reviewed retrospectively. The mean age at diagnosis was 40.6 years old (range 17-78). Ninety-five patients (51 %) were ≤40 years. Comprehensive surgical staging and fertility sparing surgery were performed in 49 % (n = 91) and 48 % of patients (n = 89) respectively. A hundred and forty-seven patients had stage IA disease (80 %). The most common type of BOT was serous in histology with 18 % bilateralism. CA-125 and CA-199 levels were increased in 29 (19 %) and 15 (10 %) patients with stage IA disease. Non-invasive tumor implants were diagnosed in 9 patients (4 %) and uterine involvement was 2 % among BOT patients that underwent hysterectomies. The mean post-operative follow-up period was 20.4 months (range 6-78 months). Disease recurrence was seen in 5 patients indicating overall recurrence rate of 2.7 %. In our study, we evaluated a large data pool of 183 patients diagnosed with borderline epithelial ovarian tumors. BOTs have a relatively better prognosis than invasive epithelial ovarian cancer. Surgery with proper staging is the cornerstone of treatment. Patients with BOTs at the early stage can undergo fertility sparing surgery with close follow-up.

  11. Melting of size-selected gallium clusters with 60-183 atoms.

    Science.gov (United States)

    Pyfer, Katheryne L; Kafader, Jared O; Yalamanchali, Anirudh; Jarrold, Martin F

    2014-07-10

    Heat capacities have been measured as a function of temperature for size-selected gallium cluster cations with between 60 and 183 atoms. Almost all clusters studied show a single peak in the heat capacity that is attributed to a melting transition. The peaks can be fit by a two-state model incorporating only fully solid-like and fully liquid-like species, and hence no partially melted intermediates. The exceptions are Ga90(+), which does not show a peak, and Ga80(+) and Ga81(+), which show two peaks. For the clusters with two peaks, the lower temperature peak is attributed to a structural transition. The melting temperatures for clusters with less than 50 atoms have previously been shown to be hundreds of degrees above the bulk melting point. For clusters with more than 60 atoms the melting temperatures decrease, approaching the bulk value (303 K) at around 95 atoms, and then show several small upward excursions with increasing cluster size. A plot of the latent heat against the entropy change for melting reveals two groups of clusters: the latent heats and entropy changes for clusters with less than 94 atoms are distinct from those for clusters with more than 93 atoms. This observation suggests that a significant change in the nature of the bonding or the structure of the clusters occurs at 93-94 atoms. Even though the melting temperatures are close to the bulk value for the larger clusters studied here, the latent heats and entropies of melting are still far from the bulk values.

  12. Measurement on K-electron capture probabilities in the decay of [sup 183]Re and [sup 168]Tm

    Energy Technology Data Exchange (ETDEWEB)

    Prasad, N.V.S.V.; Rao, M.V.S.C.; Reddy, S.B.; Satyanarayana, G.; Sastry, D.L. (Andhra Univ., Visakhapatnam (India). Swami Jnanananda Labs. for Nuclear Research); Murty, G.S.K. (UNDNJ, Newark, NJ (United States). Dept. of Radiology); Chintalapudi, S.N. (Inter University Consortium for DAE Facilities, Calcutta (India))

    1994-03-01

    The K-electron capture probabilities for the 5/2[sup +] to 3/2[sup -]transition in the electron capture decay of [sup 183]Re to the 208.805 keV level in the daughter [sup 183]W and for the 3[sup (+)] to 3[sup -]and 3[sup (+)] to 4[sup -] transitions in the electron capture decay of [sup 168]Tm to the 1541.4 keV and 1093.0 keV levels, respectively, in the daughter [sup 168]Er were measured for the first time using an x-[gamma] summing method. The experimental P[sub K] values are reported in this paper, together with those due to theory, and discussed. (Author).

  13. A Study of Single W Production in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 161 - 183 GeV

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Przysiezniak, H; Alemany, R; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Park, I C; Riu, I; Colaleo, A; Creanza, D; De Palma, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Becker, U; Boix, G; Cattaneo, M; Cerutti, F; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Greening, T C; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Leroy, O; Loomis, C; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Spagnolo, P; Tejessy, W; Teubert, F; Tomalin, I R; Tournefier, E; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Curtis, L; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Raine, C; Smith, D; Teixeira-Dias, P; Thompson, A S; Ward, J J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Nowell, J; Sedgbeer, J K; Thomson, E; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bowdery, C K; Buck, P G; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Smizanska, M; Williams, M; Giehl, I; Hölldorfer, F; Jakobs, K; Kleinknecht, K; Kröcker, M; Müller, A S; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Motsch, F; Payre, P; Rousseau, D; Talby, M; Thulasidas, M; Tilquin, A; Aleppo, M; Antonelli, M; Ragusa, F; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Kado, M; Kim, D W; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Chambers, J T; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Kelly, M S; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Foss, J; Grupen, Claus; Hess, J; Misiejuk, A; Prange, G; Sieler, U; Smolik, L; Stephan, F; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Vogt, M; Walsh, J; Wu Sau Lan; Wu, X; Zobernig, G

    1999-01-01

    Single W production is studied in the data recorded with the ALEPH detector at LEP at centre-of-mass energies between 161 and 183 GeV. The cross section is measured to be sigma_W=0.41+-0.17 (stat) +-0.04 (syst) pb at 183 GeV, consistent with the Standard Model expectation. Limits on non-standard WWgamma couplings are deduced as -1.6 < kg < 1.5 (lg=0) and -1.6 < lg < 1.6 (kg=1) at 95% C.L. A search for effectively invisible decays of the W boson in W pair production is performed, leading to an upper limit on the branching ratio of 1.3% (\\Gamma_inv= 27 MeV) at 95% C.L.

  14. Description of Work for Drilling at the 183-DR Site in Support of the In Situ Gaseous Reduction Test

    Energy Technology Data Exchange (ETDEWEB)

    Thornton, Edward C.; Olsen, Khris B.; Schalla, Ronald

    2000-06-26

    In Situ Gaseous Reduction is a technology currently being developed by DOE for the remediation of soil waste sites contaminated with hexavalent chromium. Prior work suggests that a candidate for application of this approach is the 183-DR site at Hanford. However, deep vadose zone drilling is needed to verify the presence of a hexavalent chromium source and to determine the concentration levels and spatial distribution of contamination. This document presents the requirements associated with drilling one to two vadose zone boreholes at the 183-DR site to obtain this information. If hexavalent chromium is determined to be present at levels of at least 10 ppm in the vadose zone in one of the initial boreholes, this hole will be completed for gas injection and six additional gas extraction boreholes will be drilled and completed. This network will be used as a flowcell for performing a gas treatment test at the site.

  15. Engineering evaluation/cost analysis for disposal of structural concrete and soil from the 183-H Solar Evaporation Basin

    International Nuclear Information System (INIS)

    Badden, J.W.; Miller, L.R.

    1996-08-01

    This engineering evaluation/cost analysis is intended to aid the US Department of Energy, Richland Operations Office in selecting a preferred response action alternative for removing contaminated structural concrete and soils stockpiled next to the 183-H evaporation basin, which was conducted under the Resource Conservation and Recovery Act of 1976. This EE/CA evaluates possible alternative response actions and documents the decision making process

  16. Single intermediate vector boson production in $e^{+}e^{-}$ collisions at $\\sqrt{s}$ = 183 - 209 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, B P; Kerzel, U; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2006-01-01

    The production of single charged and neutral intermediate vector bosons in e+e- collisions has been studied in the data collected by the DELPHI experiment at LEP at centre-of-mass energies between 183 and 209 GeV, corresponding to an integrated luminosity of about 640 pb^{-1}. The measured cross-sections for the reactions, determined in limited kinematic regions, are in agreement with the Standard Model predictions.

  17. Photosystem II repair and plant immunity: Lessons learned from Arabidopsis mutant lacking the THYLAKOID LUMEN PROTEIN 18.3

    Directory of Open Access Journals (Sweden)

    Sari eJärvi

    2016-03-01

    Full Text Available Chloroplasts play an important role in the cellular sensing of abiotic and biotic stress. Signals originating from photosynthetic light reactions, in the form of redox and pH changes, accumulation of reactive oxygen and electrophile species or stromal metabolites are of key importance in chloroplast retrograde signaling. These signals initiate plant acclimation responses to both abiotic and biotic stresses. To reveal the molecular responses activated by rapid fluctuations in growth light intensity, gene expression analysis was performed with Arabidopsis thaliana wild type and the tlp18.3 mutant plants, the latter showing a stunted growth phenotype under fluctuating light conditions (Biochem. J, 406, 415-425. Expression pattern of genes encoding components of the photosynthetic electron transfer chain did not differ between fluctuating and constant light conditions, neither in wild type nor in tlp18.3 plants, and the composition of the thylakoid membrane protein complexes likewise remained unchanged. Nevertheless, the fluctuating light conditions repressed in wild-type plants a broad spectrum of genes involved in immune responses, which likely resulted from shade-avoidance responses and their intermixing with hormonal signaling. On the contrary, in the tlp18.3 mutant plants there was an imperfect repression of defense-related transcripts upon growth under fluctuating light, possibly by signals originating from minor malfunction of the photosystem II (PSII repair cycle, which directly or indirectly modulated the transcript abundances of genes related to light perception via phytochromes. Consequently, a strong allocation of resources to defense reactions in the tlp18.3 mutant plants presumably results in the stunted growth phenotype under fluctuating light.

  18. Photosystem II Repair and Plant Immunity: Lessons Learned from Arabidopsis Mutant Lacking the THYLAKOID LUMEN PROTEIN 18.3.

    Science.gov (United States)

    Järvi, Sari; Isojärvi, Janne; Kangasjärvi, Saijaliisa; Salojärvi, Jarkko; Mamedov, Fikret; Suorsa, Marjaana; Aro, Eva-Mari

    2016-01-01

    Chloroplasts play an important role in the cellular sensing of abiotic and biotic stress. Signals originating from photosynthetic light reactions, in the form of redox and pH changes, accumulation of reactive oxygen and electrophile species or stromal metabolites are of key importance in chloroplast retrograde signaling. These signals initiate plant acclimation responses to both abiotic and biotic stresses. To reveal the molecular responses activated by rapid fluctuations in growth light intensity, gene expression analysis was performed with Arabidopsis thaliana wild type and the tlp18.3 mutant plants, the latter showing a stunted growth phenotype under fluctuating light conditions (Biochem. J, 406, 415-425). Expression pattern of genes encoding components of the photosynthetic electron transfer chain did not differ between fluctuating and constant light conditions, neither in wild type nor in tlp18.3 plants, and the composition of the thylakoid membrane protein complexes likewise remained unchanged. Nevertheless, the fluctuating light conditions repressed in wild-type plants a broad spectrum of genes involved in immune responses, which likely resulted from shade-avoidance responses and their intermixing with hormonal signaling. On the contrary, in the tlp18.3 mutant plants there was an imperfect repression of defense-related transcripts upon growth under fluctuating light, possibly by signals originating from minor malfunction of the photosystem II (PSII) repair cycle, which directly or indirectly modulated the transcript abundances of genes related to light perception via phytochromes. Consequently, a strong allocation of resources to defense reactions in the tlp18.3 mutant plants presumably results in the stunted growth phenotype under fluctuating light.

  19. Clinical value and potential pathways of miR-183-5p in bladder cancer: A study based on miRNA-seq data and bioinformatics analysis.

    Science.gov (United States)

    Gao, Jia-Min; Huang, Lin-Zhen; Huang, Zhi-Guang; He, Rong-Quan

    2018-04-01

    The clinicopathological value and exploration of the potential molecular mechanism of microRNA-183-5p (miR-183-5p) have been investigated in various cancers; however, to the best of the author's knowledge, no similar research has been reported for bladder cancer. In the present study, it was revealed that the expression level of miR-183-5p was notably increased in bladder cancer tissues compared with adjacent non-cancerous tissues (P=0.001) and was markedly increased in the tissue samples of papillary, pathological T stage (T0-T2) and pathological stage (I-II) compared with tissue samples of their counterparts (P=0.05), according to data from The Cancer Genome Atlas. Receiver operating characteristic analysis revealed the robust diagnostic value of miR-183-5p for distinguishing bladder cancer from non-cancerous bladder tissues (area under curve=0.948; 95% confidence interval: 0.919-0.977). Amplification and deep deletion of miR-183-5p were indicated by cBioPortal, accounting for 1% (4/412) of bladder cancer cases. Data from YM500v3 demonstrated that compared with other cancers, bladder cancer exhibited high expression levels of miR-183-5p, and miR-183-5p expression in primary solid tumors was much higher compared with solid normal tissues. A meta-analysis indicated that miR-183-5p was more highly expressed in bladder cancer samples compared with normal counterparts. A total of 88 potential target genes of miR-183-5p were identified, 13 of which were discerned as hub genes by protein-protein interaction. The epithelial-to-mesenchymal transition pathway was the most significantly enriched pathway by FunRich (P=0.0001). In summary, miR-183-5p may participate in the tumorigenesis and development of bladder cancer via certain signaling pathways, particularly the epithelial-to-mesenchymal transition pathway. However, the exact molecular mechanism of miR-183-5p in bladder cancer must be validated by in vitro and in vivo experiments.

  20. Measurement and Interpretation of Fermion-Pair Production at LEP Energies of 183 and 189 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Beilliere, P.; Belokopytov, Yu.; Belous, K.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Bilenky, Mikhail S.; Bizouard, M.A.; Bloch, D.; Blom, H.M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bourdarios, C.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buran, T.; Buschbeck, B.; Buschmann, P.; Cabrera, S.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Shlyapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Crosetti, G.; Cuevas Maestro, J.; Czellar, S.; D'Hondt, J.; Dalmau, J.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Dolbeau, J.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Guz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Gris, P.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hansen, J.; Harris, F.J.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Huber, M.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Janik, R.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovansky, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Kluit, P.; Kokkinias, P.; Kostyukhin, V.; Kourkoumelis, C.; Kuznetsov, O.; Krammer, M.; Kriznic, E.; Krumshtein, Z.; Kubinec, P.; Kurowska, J.; Kurvinen, K.; Lamsa, J.W.; Lane, D.W.; Lapin, V.; Laugier, J.P.; Lauhakangas, R.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leisos, A.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Lorstad, B.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Merle, E.; Meroni, C.; Meyer, W.T.; Myagkov, A.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjornmark, U.; Moa, T.; Moch, M.; Moller, Rasmus; Monig, Klaus; Monge, M.R.; Moraes, D.; Morettini, P.; Morton, G.; Muller, U.; Munich, K.; Mulders, M.; Mulet-Marquis, C.; Mundim, L.M.; Muresan, R.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Naraghi, F.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Neufeld, N.; Nicolaidou, R.; Nielsen, B.S.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.; Olshevsky, A.G.; Onofre, A.; Orava, R.; Orazi, G.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Pavel, T.; Pegoraro, M.; Peralta, L.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdnyakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Rames, J.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinertsen, P.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salt, J.; Sampsonidis, D.; Sannino, M.; Savoy-Navarro, A.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Yu.; Segar, A.M.; Seibert, N.; Sekulin, R.; Sette, G.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnova, O.; Smith, G.R.; Sopczak, A.; Sosnowski, R.; Spassoff, T.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanitzki, M.; Stevenson, K.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Chikilev, O.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkachev, L.G.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Transtromer, G.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Van Den Boeck, W.; Van Doninck, Walter; Van Eldik, J.; Van Lysebetten, A.; Van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zinchenko, A.; Zoller, P.; Zumerle, G.; Zupan, M.

    2000-01-01

    An analysis of the data collected in 1997 and 1998 with the DELPHIdetector at $e^+e^-$ collision energies close to 183 and 189GeV was performed in order to extract the hadronic and leptonic fermion--paircross--sections, as well as the leptonic forward--backward asymmetries andangular distributions.The data are used to put limit on contact interactions between fermions,the exchange of R-parity violating SUSY sneutrinos, $\\Zprime$ bosons and the existence of gravity in extra dimensions.

  1. Search for Spontaneous R-parity violation at $\\sqrt{s}$ = 183 GeV and 189 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Esman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Y.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Belokopytov, Yu.; Belous, K.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Besson, N.; Bilenky, Mikhail S.; Bloch, D.; Blom, H.M.; Bol, L.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Brodet, E.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buschmann, P.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chapkin, M.; Charpentier, Ph.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Chliapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Croix, J.; Cuevas Maestro, J.; Czellar, S.; D'Hondt, J.; Dalmau, J.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, Ph.; Gazis, Evangelos; Gele, D.; Geralis, T.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Gouz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hamilton, K.; Hansen, J.; Harris, F.J.; Haug, S.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Hertz, O.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Jarlskog, Ch.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovanski, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Kluit, P.; Kokkinias, P.; Kostioukhine, V.; Kourkoumelis, C.; Kouznetsov, O.; Krammer, M.; Kriznic, E.; Krumstein, Z.; Kubinec, P.; Kucharczyk, M.; Kurowska, J.; Lamsa, J.W.; Laugier, J.P.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leisos, A.; Leitner, R.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; Merle, E.; Meroni, C.; Meyer, W.T.; Miagkov, A.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjoernmark, U.; Moa, T.; Moch, M.; Monig, Klaus; Monge, M.R.; Montenegro, J.; Moraes, D.; Morettini, P.; Morton, G.; Mueller, U.; Muenich, K.; Mulders, M.; Mundim, L.M.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Nemecek, S.; Neufeld, N.; Nicolaidou, R.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.; Olshevski, A.G.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, Th.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdniakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salmi, L.; Salt, J.; Sampsonidis, D.; Sannino, M.; Savoy-Navarro, A.; Schwanda, C.; Schwemling, Ph.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Sedykh, Y.; Segar, A.M.; Sekulin, R.; Sette, G.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnova, O.; Smith, G.R.; Sokolov, A.; Solovianov, O.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkatchev, L.G.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Van den Boeck, W.; Van Eldik, J.; Van Lysebetten, A.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zintchenko, A.; Zoller, Ph.; Zumerle, G.; Zupan, M.

    2001-01-01

    Searches for spontaneous $R$-parity violating signals at $\\sqrt{s}=183$\\,GeV and \\mbox{$\\sqrt{s}=189$\\,GeV} have been performed using 1997 and 1998 DELPHI data, under the assumption of $R$-parity breaking in the third lepton family. The expected topology for the decay of a pair of charginos into two acoplanar taus plus missing energy was investigated and no evidence for a signal was found. The results were used to derive a limit on the chargino mass and to constrain the allowed domains of the MSSM parameter sp.

  2. Search for the Standard Model Higgs boson at the LEP2 collider near $\\sqrt{s}$ = 183 GeV

    CERN Document Server

    Barate, R; Décamp, D; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Lucotte, A; Martin, F; Merle, E; Minard, M N; Nief, J Y; Perrodo, P; Pietrzyk, B; Alemany, R; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Park, I C; Pascual, A; Riu, I; Sánchez, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Becker, U; Boix, G; Cattaneo, M; Cerutti, F; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Hagelberg, R; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Leroy, O; Maley, P; Mato, P; Minten, Adolf G; Moneta, L; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Tournefier, E; Vreeswijk, M; Wachsmuth, H W; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Tanaka, R; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Curtis, L; Lynch, J G; Negus, P; O'Shea, V; Raine, C; Scarr, J M; Teixeira-Dias, P; Thompson, A S; Thomson, E; Ward, J J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Sedgbeer, J K; Spagnolo, P; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Williams, M; Van Gemmeren, P; Giehl, I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Kröcker, M; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Zeitnitz, C; Ziegler, T; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Motsch, F; Payre, P; Talby, M; Thulasidas, M; Tilquin, A; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Kado, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Chambers, J T; Coles, J; Cowan, G D; Green, M G; Medcalf, T; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Przysiezniak, H; Rander, J; Renardy, J F; Rosowsky, A; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Foss, J; Grupen, Claus; Prange, G; Smolik, L; Stephan, F; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; Mamier, G; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Vogt, M; Walsh, J; Wu Sau Lan; Wu, X; Zobernig, G

    2000-01-01

    During 1997 the ALEPH experiment at LEP gathered $57 \\pb$ of data at centre-of-mass energies near $183 ~\\G$. These data are used to look for possible signals from the production of the Standard Model Higgs boson in the reaction $\\ee\\r\\H\\Z$. No evidence of a signal is found in the data; seven events are selected, in agreement with the expectation of 7.2 events from background processes. This observation results in an improved lower limit on the mass of the Higgs boson: $\\mH > 87.9 \\Gcs$ at 95\\% confidence level.

  3. Preparation of {sup 183,184}Re samples for modelling a rapid gas phase chemistry of Nielsbohrium (Ns), element 107

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R.; Gaeggeler, H.W.; Eichler, B.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    Chemical gas phase reactions of the heavier group 7 elements in the system O{sub 2}/H{sub 2}O are presumably best suited for a separation of Nielsbohrium from the lighter transactinides. We expect a higher reaction velocity using the more reactive gas system O{sub 3}/H{sub 2}O{sub 2}. For the experimental verification of this idea we prepared {sup 183}Re/{sup 184}Re samples for thermochromatography experiments with both gas systems. (author) 8 refs.

  4. Immunoscintigraphy of septic loosening of knee endoprosthesis: a retrospective evaluation of the antigranulocyte antibody BW 250/183

    Energy Technology Data Exchange (ETDEWEB)

    Klett, Rigobert; Khalisi, Alexander; Puille, Maximillian; Steiner, Dagmar; Bauer, Richard [Clinic of Nuclear Medicine, University Hospital Giessen, Friedrichstrasse 25, 35385, Giessen (Germany); Kordelle, Jens [Orthopedic Clinic, University Hospital Giessen (Germany); Stahl, Ulrich [Department of Pathology, University Hospital Giessen (Germany)

    2003-11-01

    Immunoscintigraphy with the use of the antigranulocyte antibody BW 250/183 is a reliable method for detecting infection, especially in septic loosening of hip prostheses, for which purpose quantitative interpretation of the time-activity course is employed. Therefore, we retrospectively studied whether similar results could be achieved in knee prostheses. We verified 28 scintigraphic examinations in 26 patients by histology. Scintigraphy was performed during an early (4-6 h post injection) and a late phase (23-25 h post injection). Infection was diagnosed when activity around the knee prosthesis increased by more than 10% compared with bone marrow. We found a sensitivity and a negative predictive value of 100%, a specificity of 80%, a positive predictive value of 81% and an accuracy of 89%. Specificity and accuracy are lower than in the evaluation of hip prostheses; however, in comparison to other scintigraphic modalities, scintigraphy with the antigranulocyte antibody BW 250/183 is superior in excluding infection and has better specificity and accuracy. Therefore, as in the case of hip prostheses, the described methodology appears to be the scintigraphic modality of choice for knee prostheses. (orig.)

  5. Detection of lung and bone infection with anti-granulocyte monoclonal antibody BW 250/183 radiolabelled with 99Tcm.

    Science.gov (United States)

    Peltier, P; Potel, G; Lovat, E; Baron, D; Chatal, J F

    1993-09-01

    Twenty-four patients with suspected infection (eight bone, 16 lung) were studied using monoclonal antibody BW250/183 which recognizes epitopes present on the surface of granulocytes. Bronchofibroscopic samples (microbiological studies and alveolar cell counts) were obtained from 14/16 patients with lung disease. Bronchofibroscopy isolated a micro-organism nine times. In two other cases, the diagnosis of infection was based on clinical course data. Infection was confirmed by surgical biopsy in the eight patients with bone pathology. Scans were performed 2 and 24 h after injection of 1 mg BW 250/183 labelled with 99Tcm. For lung disease, immunoscintigraphy was positive six times (five true positive, one false positive) and negative 10 times (six false negative, four true negative). Immunoscintigraphy was false negative when the lung infection was not systematized or no granulocytes were mobilized in the infectious site. Immunoscintigraphy was falsely positive when noninfectious lung disease mobilized granulocytes. It was positive in all patients with bone infection. Images recorded at 24 h had better sensitivity (five false negative) than those at 2 h (eight false negative).

  6. Remaining Sites Verification Package for the 126-F-2, 183-F Clearwells, Waste Site Reclassification Form 2006-017

    International Nuclear Information System (INIS)

    Carlson, R.A.

    2006-01-01

    The 126-F-2 site is the clearwell facility formerly used as part of the reactor cooling water treatment at the 183-F facility. During demolition operations in the 1970s, potentially contaminated debris was disposed in the eastern clearwell structure. The site has been remediated by removing all debris in the clearwell structure to the Environmental Restoration Disposal Facility. The results of radiological surveys and visual inspection of the remediated clearwell structure show neither residual contamination nor the potential for contaminant migration beyond the clearwell boundaries. The results of verification sampling at the remediation waste staging area demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River

  7. Study of Fermion Pair Production in $e^{+}e^{-}$ Collisions at 130-183 GeV

    CERN Document Server

    Barate, R.; Ghez, Philippe; Goy, C.; Jezequel, S.; Lees, J.P.; Martin, F.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Alemany, R.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Morawitz, P.; Pacheco, A.; Park, I.C.; Riu, I.; Colaleo, A.; Creanza, D.; De Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Becker, U.; Boix, G.; Cattaneo, M.; Ciulli, V.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Halley, A.W.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Leroy, O.; Loomis, C.; Maley, P.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Teubert, F.; Tomalin, I.R.; Tournefier, E.; Vreeswijk, M.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Dessagne, S.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Rensch, B.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.C.; Machefert, F.; Rouge, A.; Swynghedauw, M.; Tanaka, R.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Chalmers, M.; Curtis, L.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raeven, B.; Raine, C.; Smith, D.; Teixeira-Dias, P.; Thompson, A.S.; Ward, J.J.; Buchmuller, O.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Goodsir, S.; Marinelli, N.; Martin, E.B.; Nash, J.; Nowell, J.; Sciaba, A.; Sedgbeer, J.K.; Spagnolo, P.; Thomson, Evelyn J.; Williams, M.D.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Betteridge, A.P.; Bowdery, C.K.; Buck, P.G.; Colrain, P.; Crawford, G.; Ellis, G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Williams, M.I.; van Gemmeren, P.; Giehl, I.; Holldorfer, F.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Krocker, M.; Nurnberger, H.A.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Aubert, J.J.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Ealet, A.; Fouchez, D.; Motsch, F.; Payre, P.; Talby, M.; Thulasidas, M.; Tilquin, A.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Buescher, Volker; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Kado, M.; Lefrancois, J.; Serin, L.; Veillet, J.J.; Videau, I.; de Viviede Regie, J.B.; Zerwas, D.; Bagliesi, Giuseppe; Bettarini, S.; Boccali, T.; Bozzi, C.; Calderini, G.; Dell'Orso, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P.S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sguazzoni, G.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Coles, J.; Cowan, G.; Green, M.G.; Hutchcroft, D.E.; Jones, L.T.; Medcalf, T.; Strong, J.A.; von Wimmersperg-Toeller, J.H.; Botterill, D.R.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Thompson, J.C.; Bloch-Devaux, Brigitte; Colas, P.; Fabbro, B.; Faif, G.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Przysiezniak, H.; Rander, J.; Renardy, J.F.; Rosowsky, A.; Trabelsi, A.; Tuchming, B.; Vallage, B.; Black, S.N.; Dann, J.H.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Hodgson, P.N.; Kelly, M.S.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R.W.; Armstrong, S.R.; Charles, E.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Greening, T.C.; Hayes, O.J.; Hu, H.; Jin, S.; McNamara, P.A., III; Nachtman, J.M.; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.

    2000-01-01

    The cross sections and forward-backward asymmetries of hadronic and leptonic events produced in e+e- collisions at centre-of-mass energies of 130-183 GeV are presented. Results for ee, mumu, tautau, qq, bb and cc production show no significant deviation from the Standard Model predictions. This enable constraints to be set upon physics beyond the Standard Model such as four-fermion contact interactions, leptoquarks, Z' bosons and R-parity violating squarks and sneutrinos. Limits on the energy scale Lambda of eeff contact interactions are typically in the range from 2-10 TeV. Limits on R-parity violating sneutrinos reach masses of a few hundred GeV for large values of their Yukawa couplings.

  8. Remaining Sites Verification Package for the 126-F-2, 183-F Clearwells, Waste Site Reclassification Form 2006-017

    Energy Technology Data Exchange (ETDEWEB)

    R. A. Carlson

    2006-05-04

    The 126-F-2 site is the clearwell facility formerly used as part of the reactor cooling water treatment at the 183-F facility. During demolition operations in the 1970s, potentially contaminated debris was disposed in the eastern clearwell structure. The site has been remediated by removing all debris in the clearwell structure to the Environmental Restoration Disposal Facility. The results of radiological surveys and visual inspection of the remediated clearwell structure show neither residual contamination nor the potential for contaminant migration beyond the clearwell boundaries. The results of verification sampling at the remediation waste staging area demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  9. $Z\\gamma*$ production in $e^+ e^-$ interactions at $\\sqrt{s}$ = 183 - 209 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Kokkinias, P; Leinonen, L; Katsoufis, E; Kernel, G; Kersevan, B P; Krumshtein, Z; Lesiak, T; Kerzel, U; Liebig, W; King, B T; Lamsa, J; Liko, D; Kjaer, N J; Leder, G; Kluit, P; Kourkoumelis, C; Leitner, R; Kuznetsov, O; Kucharczyk, M; Ledroit, F; Lopes, J H; Lemonne, J; Lepeltier, V; Lipniacka, A; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou12, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Paganoni, M; Nassiakou, M; Paiano, S; Navarria, F; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Ouraou, A; Parkes, C; Oblakowska-Mucha, A; Oyanguren, A; Obraztsov, V F; Olshevskii, A G; Palacios, J P; Onofre, A; Palka, H; Orava, R; Österberg, K; Pape, L; Papadopoulou, T D; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G

    2007-01-01

    Measurements of Zgamma* production are presented using data collected by the DELPHI detector at centre-of-mass energies ranging from 183 to 209 GeV, corresponding to an integrated luminosity of about 667 pb^{-1}. The measurements cover a wide range of the possible final state four-fermion configurations: hadronic and leptonic (e+ e- q qbar, mu+ mu- q qbar, q qbar nu nubar), fully leptonic (l+ l- l'+ l'-) and fully hadronic final states (q qbar q qbar, with a low mass q qbar pair). Measurements of the Zgamma* cross-section for the various final states have been compared with the Standard Model expectations and found to be consistent within the errors. In addition, a total cross-section measurement of the l+ l- l'+ l'- cross-section is reported, and found to be in agreement with the prediction of the Standard Model.

  10. Search for Charged Excited Leptons in $e^+ e^-$ Collisions at $\\sqrt{s}$ = 183-209 GeV

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Cammin, J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Cohen, I.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Elfgren, E.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hauschildt, J.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Homer, R.J.; Horvath, D.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kormos, Laura L.; Kowalewski, Robert V.; Kramer, T.; Kress, T.; Krieger, P.; von Krogh, J.; Krop, D.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Rick, H.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trefzger, T.; Tricoli, A.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vachon, B.; Vollmer, C.F.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.; Zivkovic, Lidija

    2002-01-01

    A search for charged excited leptons decaying into a lepton and photon has been performed using approximately 680 pb-1 of e+e- collision data collected by the OPAL detector at LEP at centre-of-mass energies between 183 GeV and 209 GeV. No evidence for their existence was found. Upper limits on the product of the cross-section and the branching fraction are inferred. Using results from the search for singly produced excited leptons, upper limits on the ratio of the excited lepton coupling constant to the compositeness scale are calculated. From pair production searches, 95% confidence level lower limits on the masses of excited electrons, muons and taus are determined to be 103.2 GeV.

  11. Search for charginos, neutralinos and gravitinos in $e^{+} e^{-}$ interactions at $\\sqrt{s}$=183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Damgaard, G; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Fichet, S; Firestone, A; Fischer, P A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; García, J; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kucewicz, W; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Masik, J; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rakoczy, D; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schneider, H; Schwemling, P; Schwickerath, U; Schyns, M A E; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Shellard, R C; Sheridan, A; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Skaali, T B; Smadja, G; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stampfer, D; Stanescu, C; Stanic, S; Stapnes, Steinar; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tegenfeldt, F; Terranova, F; Thomas, J; Tilquin, A; Timmermans, J; Tinti, N; Tkatchev, L G; Todorova, S; Toet, D Z; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Vulpen, I B; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Vollmer, C F; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G

    1999-01-01

    An update of the searches for charginos and neutralinos is presented, basedon a data sample corresponding to the 53.9 pb$^{-1}$ recorded by the DELPHIdetector in 1997, at a centre-of-mass energy of 183 GeV. No evidence for asignal was found. The lower mass limits are 4-5 GeV/$c^2$ higher than thoseobtained at a centre-of-mass energy of 172 GeV.The ($\\mu$,M$_2$) domain excludedby combining the neutralino and chargino searches implies a limit on the mass ofthe lightest neutralino which, for a heavy sneutrino, is constrained to beabove 29.1 GeV/$c^2$ for $\\tan{\\beta}\\geq$ 1.

  12. Verification of the HDR-test V44 using the computer program RALOC-MOD1/83

    International Nuclear Information System (INIS)

    Jahn, H.; Pham, T. v.; Weber, G.; Pham, B.T.

    1985-01-01

    RALOC-MOD1/83 was extended by a drainage and sump level modul and several component models to serve as a containment systems code for various LWR types. One such application is to simulate the blowdown in a full pressure containment which is important for the short and long term hydrogen distribution. The post test calculation of the containment standard problem experiment HDR-V44 shows a good agreement, to the test data. The code may be used for short and long term predictions, but it was learned that double containments need the representation of the gap between the inner and outer shell into several zones to achieve a good long-term temperature prediction. The present work completes the development, verification and documentation of RALOC-MOD1. (orig.) [de

  13. Heteroepitaxial growth of strained multilayer superconducting thin films of Nd1.83Ce0.17CuOx/YBa2Cu3O7-δ

    International Nuclear Information System (INIS)

    Gupta, A.; Gross, R.; Olsson, E.; Segmueller, A.; Koren, G.; Tsuei, C.C.

    1990-01-01

    Heteroepitaxial growth of strained multilayer thin films of YBa 2 Cu 3 O 7-δ /Nd 1.83 Ce 0.17 CuO x by pulsed-laser deposition is reported. The coherency strain results in biaxial compression of the tetragonal Nd 1.83 Ce 0.17 CuO x layers, whereas the biaxial tension in the YBa 2 Cu 3 O 7-δ layers removes the orthorhombic distortion and makes the unit cell isotropic in the basal plane (a=b). Depending on their oxygen content, either the YBa 2 Cu 3 O 7-δ or the Nd 1.83 Ce 0.17 CuO x layers are superconducting in these multilayers. The strain-induced structural modification has a significant influence on the superconducting transition temperature of the YBa 2 Cu 3 O 7-δ layers

  14. The clinical application study of bone marrow immunoscintigraphy using 99Tcm-BW250/183 in evaluating patients with aplastic anemia

    International Nuclear Information System (INIS)

    Liu Zengli; Wu Jinchang; Tang Jun; Wang Wei

    2002-01-01

    Objective: To study the clinical value of bone marrow immunoscintigraphy for evaluation of patients with aplastic anemia. Methods: Twelve patients with aplastic anemia underwent bone marrow immunoscintigraphy using 99 Tc m labelled anti-granulocyte monoclonal antibody BW250/183, 10 of them also underwent bone marrow imaging using 99 Tc m -sulfur colloid (SC) 2 - 3 days later. The semiquantitative indexes of bone marrow immunoscintigraphy of the patients were compared with those of control patients. Results: Bone marrow immunoscintigraphy was superior to 99 Tc m -SC bone marrow imaging. In patients with aplastic anemia, the accumulation of 99 Tc m -BW250/183 in bone marrow and spleen was lower and in liver and kidney was higher than those of control patients. Nine patients were found with multiple focal accumulation in bone marrow. Conclusion: Bone marrow immunoscintigraphy with 99 Tc m -BW250/183 plays an important role in evaluating patients with aplastic anemia

  15. RESULTS OF GROUNDWATER MONITORING FOR THE 183-H SOLAR EVAPORATION BASINS AND 300 AREA PROCESS TRENCHES JANUARY - JUNE 2008

    International Nuclear Information System (INIS)

    Hartman, M.J.

    2008-01-01

    This is one of a series of reports on Resource Conservation and Recovery Act of 1976 (RCRA) monitoring at the 183-H solar evaporation basins and the 300 Area process trenches. It fulfills the requirement of Washington Administrative Code (WAC) 173-303-645(11)(g), 'Release from Regulated Units', to report twice each year on the effectiveness of the corrective action program. This report covers the period from January through June 2008. The current objective of corrective action monitoring the 183-H basins is simply to track trends. Although there is short-term variability in contaminant concentrations, trends over the past 10 years are downward. The current Hanford Facility RCRA Permit (Dangerous Waste Portion of the Resource Conservation and Recovery Act Permit for the Treatment, Storage, and Disposal of Dangerous Waste (Permit No. WA 7890008967)) and monitoring plan remain adequate for the objective of tracking trends. The objective of groundwater monitoring at the 300 Area process trenches is to demonstrate the effectiveness of the corrective action program by examining the trend of the constituents of interest to confirm that they are attenuating naturally. The overall concentration of uranium in network wells remained above the 30 (micro)g/L drinking water standard in the three downgradient wells screened at the water table. Fluctuations of uranium concentration are caused by changes in river stage. The concentration of cis-1,2-dichloroethene remained above the 70 (micro)g/L drinking water standard in one well (399-1-16B). Concentrations are relatively steady at this well and are not affected by river stage. Trichloroethene and tetrachloroethene concentrations were below detection limits in all wells during the reporting period

  16. Effects of chemically or technologically treated linseed products and docosahexaenoic acid addition to linseed oil on biohydrogenation of C18:3n-3 in vitro.

    Science.gov (United States)

    Sterk, A; Hovenier, R; Vlaeminck, B; van Vuuren, A M; Hendriks, W H; Dijkstra, J

    2010-11-01

    Rumen biohydrogenation kinetics of C18:3n-3 from several chemically or technologically treated linseed products and docosahexaenoic acid (DHA; C22:6n-3) addition to linseed oil were evaluated in vitro. Linseed products evaluated were linseed oil, crushed linseed, formaldehyde treated crushed linseed, sodium hydroxide/formaldehyde treated crushed linseed, extruded whole linseed (2 processing variants), extruded crushed linseed (2 processing variants), micronized crushed linseed, commercially available extruded linseed, lipid encapsulated linseed oil, and DHA addition to linseed oil. Each product was incubated with rumen liquid using equal amounts of supplemented C18:3n-3 and fermentable substrate (freeze-dried total mixed ration) for 0, 0.5, 1, 2, 4, 6, 12, and 24h using a batch culture technique. Disappearance of C18:3n-3 was measured to estimate the fractional biohydrogenation rate and lag time according to an exponential model and to calculate effective biohydrogenation of C18:3n-3, assuming a fractional passage rate of 0.060/h. Treatments showed no differences in rumen fermentation parameters, including gas production rate and volatile fatty acid concentration. Technological pretreatment (crushing) followed by chemical treatment applied as formaldehyde of linseed resulted in effective protection of C18:3n-3 against biohydrogenation. Additional chemical pretreatment (sodium hydroxide) before applying formaldehyde treatment did not further improve the effectiveness of protection. Extrusion of whole linseed compared with extrusion of crushed linseed was effective in reducing C18:3n-3 biohydrogenation, whereas the processing variants were not different in C18:3n-3 biohydrogenation. Crushed linseed, micronized crushed linseed, lipid encapsulated linseed oil, and DHA addition to linseed oil did not reduce C18:3n-3 biohydrogenation. Compared with the other treatments, docosahexaenoic acid addition to linseed oil resulted in a comparable trans11,cis15-C18

  17. Cost effectiveness of a government supported policy strategy to decrease sodium intake: global analysis across 183 nations.

    Science.gov (United States)

    Webb, Michael; Fahimi, Saman; Singh, Gitanjali M; Khatibzadeh, Shahab; Micha, Renata; Powles, John; Mozaffarian, Dariush

    2017-01-10

     To quantify the cost effectiveness of a government policy combining targeted industry agreements and public education to reduce sodium intake in 183 countries worldwide.  Global modeling study.  183 countries.  Full adult population in each country.  A "soft regulation" national policy that combines targeted industry agreements, government monitoring, and public education to reduce population sodium intake, modeled on the recent successful UK program. To account for heterogeneity in efficacy across countries, a range of scenarios were evaluated, including 10%, 30%, 0.5 g/day, and 1.5 g/day sodium reductions achieved over 10 years. We characterized global sodium intakes, blood pressure levels, effects of sodium on blood pressure and of blood pressure on cardiovascular disease, and cardiovascular disease rates in 2010, each by age and sex, in 183 countries. Country specific costs of a sodium reduction policy were estimated using the World Health Organization Noncommunicable Disease Costing Tool. Country specific impacts on mortality and disability adjusted life years (DALYs) were modeled using comparative risk assessment. We only evaluated program costs, without incorporating potential healthcare savings from prevented events, to provide conservative estimates of cost effectiveness MAIN OUTCOME MEASURE:  Cost effectiveness ratio, evaluated as purchasing power parity adjusted international dollars (equivalent to the country specific purchasing power of US$) per DALY saved over 10 years.  Worldwide, a 10% reduction in sodium consumption over 10 years within each country was projected to avert approximately 5.8 million DALYs/year related to cardiovascular diseases, at a population weighted mean cost of I$1.13 per capita over the 10 year intervention. The population weighted mean cost effectiveness ratio was approximately I$204/DALY. Across nine world regions, estimated cost effectiveness of sodium reduction was best in South Asia (I$116/DALY); across the world

  18. Investigation of adsorption and inhibitive effect of acid red GRE (183 dye on the corrosion of carbon steel in hydrochloric acid media

    Directory of Open Access Journals (Sweden)

    M. Abd El-raouf

    2015-09-01

    Full Text Available The adsorption and corrosion inhibitive effect of acid red GRE (183 dye on carbon steel alloy in 1 M HCl solutions was studied using various techniques. Results of weight loss, Tafel polarization measurements and electrochemical impedance spectroscopy (EIS techniques show that this compound has fairly good inhibiting properties for steel corrosion in acidic bath; with efficiency around 96% at a concentration of 50 ppm. The inhibition is of a mixed anodic–cathodic nature. Factors affecting the corrosion process have been calculated and discussed. Acid red GRE (183 dye was shown to be an inhibitor in the acidic corrosion. Inhibition efficiency increased with acid red GRE (183 dye concentration but decreased with rise in temperature, corrosion inhibition is attributed to the adsorption of acid red GRE (183 dye on the carbon steel surface via a physical adsorption mechanism. Langmuir isotherm is found to provide an accurate description of the adsorption behavior of the investigated azo compound. The nature of the protective film was investigated using SEM and EDX techniques.

  19. The potential of miR-183 family expression in inner ear for regeneration, treatment, diagnosis and prognosis of hearing loss

    Directory of Open Access Journals (Sweden)

    Mohammad-Reza Mahmoodian-sani

    2017-06-01

    Full Text Available miRNA-183 family, in normal biology, is expressed in a harmonious and stable manner in the neurosensory organs and cells. Studies have also shown that miRNA-183 family, in different pathways, affects the neurosensory development, maintenance, survival and function. In addition, it has potential neuroprotective effects in response to neurosensory destructive stimulations. miRNA-96 mutation causes hereditary deafness in humans and mice, and therefore affects the inner ear activity and its maintenance. Certain roles have been identified for miR-96 in the maintenance and function of the inner ear. The comparison of the target genes of family-183 in transcriptomes of newborn and adult hair cells shows that hundreds of target genes in this family may affect development and maintenance of the ears. Identifying the genes that are regulated by miRNA-183 family provides researchers with important information about the complex development and environmental regulation of the inner ear, and can offer new approaches to the maintenance and regeneration of hair cells and auditory nerve.

  20. Measurements of the Trilinear Gauge Boson Couplings WWV $(V \\equiv \\gamma,Z)$ in $e^+ e^-$ Collisions at 183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pegoraro, M; Peralta, L; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schneider, H; Schwemling, P; Schwering, B; Schwickerath, U; Schyns, M A E; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Shellard, R C; Sheridan, A; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stanic, S; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Vollmer, C F; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G

    1999-01-01

    Measurements of the trilinear gauge boson couplings $WW\\gamma$ and $WWZ$ are presented from data taken by DELPHI in 1997 at an energy of 183 GeV. From a study of the reactions $e^+ e^- \\to W^+ W^-, e^+ e^- \\to We\

  1. Effects of chemically or technologically treated linseed products and docosahexaenoic acid addition to linseed oil on biohydrogenation of C18:3n-3 in vitro

    NARCIS (Netherlands)

    Sterk, A.R.; Hovenier, R.; Vlaeminck, B.; Vuuren, van A.M.; Hendriks, W.H.; Dijkstra, J.

    2010-01-01

    Rumen biohydrogenation kinetics of C18:3n-3 from several chemically or technologically treated linseed products and docosahexaenoic acid (DHA; C22:6n-3) addition to linseed oil were evaluated in vitro. Linseed products evaluated were linseed oil, crushed linseed, formaldehyde treated crushed

  2. Search for chargino pair production in scenarios with gravitino LSP and stau NLSP at $\\sqrt{s} \\sim$ 183 GeV at LEP

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Royon, C; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanic, S; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Thomas, J; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Dam, P; Van den Boeck, W; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zucchelli, G C; Zumerle, G

    1999-01-01

    Promptly decaying lightest charginos were searched for in the context of scenarios with gravitino LSP. It was assumed that the stau is the next to lightest supersymmetric particle (NLSP). Data collected with the DELPHI detector at a centre-of-mass energy near 183~{~mbox{${mathrm{GeV}}$}}\

  3. Effect of a Mycoplasma hominis-like Mycoplasma on the infection of HEp-2 cells by the TW-183 strain of Chlamydia pneumoniae.

    Science.gov (United States)

    Castilla, E A; Wadowsky, R M

    2000-02-01

    We isolated a Mycoplasma hominis-like mycoplasma from a stock culture of Chlamydia pneumoniae TW-183 obtained from the American Type Culture Collection and eradicated the contaminant by treating the stock suspension with a nonionic detergent, Igepal CA-630. The M. hominis-like mycoplasma neither inhibits nor enhances the infectivity of C. pneumoniae for HEp-2 cells.

  4. Effect of a Mycoplasma hominis-Like Mycoplasma on the Infection of HEp-2 Cells by the TW-183 Strain of Chlamydia pneumoniae

    OpenAIRE

    Castilla, Elias A.; Wadowsky, Robert M.

    2000-01-01

    We isolated a Mycoplasma hominis-like mycoplasma from a stock culture of Chlamydia pneumoniae TW-183 obtained from the American Type Culture Collection and eradicated the contaminant by treating the stock suspension with a nonionic detergent, Igepal CA-630. The M. hominis-like mycoplasma neither inhibits nor enhances the infectivity of C. pneumoniae for HEp-2 cells.

  5. Autocrine/Paracrine Human Growth Hormone-stimulated MicroRNA 96-182-183 Cluster Promotes Epithelial-Mesenchymal Transition and Invasion in Breast Cancer*

    Science.gov (United States)

    Zhang, Weijie; Qian, Pengxu; Zhang, Xiao; Zhang, Min; Wang, Hong; Wu, Mingming; Kong, Xiangjun; Tan, Sheng; Ding, Keshuo; Perry, Jo K.; Wu, Zhengsheng; Cao, Yuan; Lobie, Peter E.; Zhu, Tao

    2015-01-01

    Human growth hormone (hGH) plays critical roles in pubertal mammary gland growth, development, and sexual maturation. Accumulated studies have reported that autocrine/paracrine hGH is an orthotopically expressed oncoprotein that promotes normal mammary epithelial cell oncogenic transformation. Autocrine/paracrine hGH has also been reported to promote mammary epithelial cell epithelial-mesenchymal transition (EMT) and invasion. However, the underlying mechanism remains largely obscure. MicroRNAs (miRNAs) are reported to be involved in regulation of multiple cellular functions of cancer. To determine whether autocrine/paracrine hGH promotes EMT and invasion through modulation of miRNA expression, we performed microarray profiling using MCF-7 cells stably expressing wild type or a translation-deficient hGH gene and identified miR-96-182-183 as an autocrine/paracrine hGH-regulated miRNA cluster. Forced expression of miR-96-182-183 conferred on epithelioid MCF-7 cells a mesenchymal phenotype and promoted invasive behavior in vitro and dissemination in vivo. Moreover, we observed that miR-96-182-183 promoted EMT and invasion by directly and simultaneously suppressing BRMS1L (breast cancer metastasis suppressor 1-like) gene expression. miR-96 and miR-182 also targeted GHR, providing a potential negative feedback loop in the hGH-GHR signaling pathway. We further demonstrated that autocrine/paracrine hGH stimulated miR-96-182-183 expression and facilitated EMT and invasion via STAT3 and STAT5 signaling. Consistent with elevated expression of autocrine/paracrine hGH in metastatic breast cancer tissue, miR-96-182-183 expression was also remarkably enhanced. Hence, we delineate the roles of the miRNA-96-182-183 cluster and elucidate a novel hGH-GHR-STAT3/STAT5-miR-96-182-183-BRMS1L-ZEB1/E47-EMT/invasion axis, which provides further understanding of the mechanism of autocrine/paracrine hGH-stimulated EMT and invasion in breast cancer. PMID:25873390

  6. Meckel's scan in children: a review of 183 cases referred to two paediatric surgery specialist centres over 18 years.

    Science.gov (United States)

    Sinha, C K; Pallewatte, A; Easty, M; De Coppi, P; Pierro, A; Misra, D; Biassoni, L

    2013-05-01

    To review our practice of Meckel's Tc-99m pertechnetate scans over 18 years with regard to indications for the test, sensitivity and specificity in our particular referral patients' population. This is a retrospective review of Meckel's scans performed in two paediatric tertiary care teaching hospitals from April 1993 to March 2011 and followed up till October 2011. The scan was performed according to published international guidelines. 183 patients were included in this study. We classified the patients into two groups: group 1, which included 77 patients (42 %) presenting with painless per rectum bleeding, and group 2, which included 106 patients (58 %) presenting with other non-specific symptoms (e.g. abdominal pain, possibly associated with nausea and/or vomiting, failure to thrive). Data were analysed using Chi square test, considering P value less than 0.05 as significant. The age of the patients ranged from 4 days to 16.5 years (median 3 years). 161 of the total 183 children on the study (88 %) had a negative Meckel's scan, and 22 children (12 %) had a positive scan. In the group with a positive Meckel's scan (22 children), all patients underwent surgical exploration and ectopic gastric mucosa was found in 17 cases (77 %, true positives). In the remaining 5 cases (23 %), there was no evidence of ectopic gastric mucosa (false positives). Within the group with a negative scan, 8 children (5 %) underwent surgery; only 1 child had a ectopic gastric mucosa detected following surgery (false negative). In other 52 children (32 %) of the group with a negative Meckel's scan, an endoscopy was done, which showed a normal result in 21 children and was abnormal in 31 children. Of the remaining 101 (63 %) children with a negative Meckel's scan, 74 children (46 %) improved without any further intervention. In 13 cases (8 %), other pathologies were identified. The sensitivity and specificity of the Meckel's scan for ectopic gastric mucosa were 94 and 97 %, respectively. The

  7. Molecular characterization of oxysterol binding to the Epstein-Barr virus-induced gene 2 (GPR183)

    DEFF Research Database (Denmark)

    Benned-Jensen, Tau; Norn, Christoffer; Laurent, Stephane

    2012-01-01

    , the family of G protein-coupled seven transmembrane-spanning receptors (7TM receptors) was added to this group. Specifically, the Epstein-Barr virus-induced gene 2 (EBI2 or GPR183) was shown to be activated by several oxysterols, most potently by 7α,25-dihydroxycholesterol (7α,25-OHC). Nothing is known about...... the binding mode, however. Using mutational analysis, we identify here four key residues for 7α,25-OHC binding: Arg-87 in TM-II (position II:20/2.60), Tyr-112 and Tyr-116 (positions III:09/3.33 and III:13/3.37) in TM-III, and Tyr-260 in TM-VI (position VI:16/6.51). Substituting these residues with Ala and....../or Phe results in a severe decrease in agonist binding and receptor activation. Docking simulations suggest that Tyr-116 interacts with the 3β-OH group in the agonist, Tyr-260 with the 7α-OH group, and Arg-87, either directly or indirectly, with the 25-OH group, although nearby residues likely also...

  8. MELCOR computer code manuals: Primer and user`s guides, Version 1.8.3 September 1994. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Summers, R.M.; Cole, R.K. Jr.; Smith, R.C.; Stuart, D.S.; Thompson, S.L. [Sandia National Labs., Albuquerque, NM (United States); Hodge, S.A.; Hyman, C.R.; Sanders, R.L. [Oak Ridge National Lab., TN (United States)

    1995-03-01

    MELCOR is a fully integrated, engineering-level computer code that models the progression of severe accidents in light water reactor nuclear power plants. MELCOR is being developed at Sandia National Laboratories for the US Nuclear Regulatory Commission as a second-generation plant risk assessment tool and the successor to the Source Term Code Package. A broad spectrum of severe accident phenomena in both boiling and pressurized water reactors is treated in MELCOR in a unified framework. These include: thermal-hydraulic response in the reactor coolant system, reactor cavity, containment, and confinement buildings; core heatup, degradation, and relocation; core-concrete attack; hydrogen production, transport, and combustion; fission product release and transport; and the impact of engineered safety features on thermal-hydraulic and radionuclide behavior. Current uses of MELCOR include estimation of severe accident source terms and their sensitivities and uncertainties in a variety of applications. This publication of the MELCOR computer code manuals corresponds to MELCOR 1.8.3, released to users in August, 1994. Volume 1 contains a primer that describes MELCOR`s phenomenological scope, organization (by package), and documentation. The remainder of Volume 1 contains the MELCOR Users` Guides, which provide the input instructions and guidelines for each package. Volume 2 contains the MELCOR Reference Manuals, which describe the phenomenological models that have been implemented in each package.

  9. Water vapor profiling over ocean surface with 90 GHz and 183 GHz measurements under clear and cloudy conditions

    Science.gov (United States)

    Wang, J. R.; Sharma, A. K.

    1992-01-01

    Radiometric measurements at 90 GHz and three sideband frequencies near the peak water vapor absorption line of 183.3 GHz were made with the Advanced Microwave Moisture Sounder (AMMS) aboard the NASA DC-8 aircraft over some regions of the Pacific Ocean. These measurements were used to retrieve atmospheric water vapor profiles over ocean surface using the algorithm developed by Schaerer and Wilheit (1979). The algorithm incorporates a mechanism to estimate cloud liquid water when the estimated relative humidity is greater than 95 percent. The results are compared with estimated values from measurements taken by the Special Sensor Microwave/Imager (SSMI) and TIROS Operational Vertical Sounder (TOVS). The water vapor profiles estimated from AMMS are generally higher at low altitudes and lower at high altitudes than those from the TOVS measurements. Cloud liquid water is retrieved from both AMMS and SSM/I measurements over the same general regions. The retrieved water vapor profiles show more fluctuations in these regions. It is concluded that the AMMS with only four channels of measurements may not be able to retrieve both water vapor and cloud information with authority.

  10. Exposed necrotic bone in 183 patients with bisphosphonate-related osteonecrosis of the jaw: Associated clinical characteristics.

    Science.gov (United States)

    Bagan, L; Jiménez, Y; Leopoldo, M; Murillo-Cortes, J; Bagan, J

    2017-09-01

    The main objective of our study was to identify oral symptoms and signs most likely to be associated with the exposure of necrotic bone in bisphosphonate-related osteonecrosis of the jaw (BRONJ). The study group consisted of 183 patients with BRONJ. We recorded data on the underlying disease, bisphosphonate used, location of osteonecrosis, symptoms, pain, fistula development, suppuration, infection, exposed necrotic bone, and BRONJ stage. The mean age of the patients was 68.22 ± 12.19 years. The sample included 118 (64.5%) women. Breast cancer and multiple myeloma were the most common underlying diseases, and 50 patients received oral bisphosphonates for osteoporosis. Dental extractions (69.4%) and mandibular location (74.3%) predominated. The only two variables influencing the possibility of necrotic bone exposure were intravenous bisphosphonate administration and the presence of an intraoral fistula (p < 0.05). Intravenous bisphosphonate use and intraoral fistula presence were associated with a major predisposition to bone exposure in patients with BRONJ.

  11. Search for sleptons in $e^+ e^-$ collisions at $\\sqrt{s}$= 183 to 189 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bol, L; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Croix, J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Haug, S; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hertz, O; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kucharczyk, M; Kurowska, J; Lamsa, J; Laugier, J P; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, M R; Montenegro, J; Moraes, D; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Nicolaidou, R; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Perepelitsa, V F; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salmi, L; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwanda, C; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M

    2001-01-01

    Data taken by the {\\tt DELPHI} experiment at centre-of-mass energies of 183~\\GeV\\ and 189~\\GeV\\ with a total integrated luminosity of 212 pb$^{-1} have been used to search for the supersymmetric partners of the electrons, muons, and taus in the context of the Minimal Supersymmetric Standard Model (MSSM). The decay topologies searched for were the direct decay ({\\tilde \\ell} -> \\ell {\\tilde\\chi_1^0}), producing acoplanar lepton pairs plus missing energy, and the cascade decay ({\\tilde \\ell} -> \\ell {\\tilde \\chi_2^0} -> \\ell\\gamma {\\tilde \\chi_1^0}), producing acoplanar lepton and photon pairs plus missing energy. The observed number of events is in agreement with Standard Model predictions. The 95% CL excluded mass limits for selectrons, smuons and staus are m_{\\tilde {e}\\leq 87 GeV/c^2, m_{\\tilde {\\mu}} \\leq 80 GeV/c^2 and m_{\\tilde {\\tau}} \\leq 75 GeV/c^2, respectively, for values of \\mu=-200 GeV/c^2 and tan(beta)=1.5.

  12. List of Participants 183

    Indian Academy of Sciences (India)

    List of participants. Sen D, BARC, Mumbai, India. Sequeira A, Mumbai, India. Shaikh A M, BARC, Mumbai, India. Sharma Daksha, AMU, Aligarh, India. Sharma K S, MS University of Baroda,. Vadodara, India. Sharma S M, BARC, Mumbai, India. Shinde A B, BARC, Mumbai, India. Shukla A, Martin-Luther University,. Germany.

  13. 183 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    using sterile 0.85% saline. After mixing with a Vortex mixer, turbidity was adjusted to match 0.5 McFarland turbidity standards and inoculated onto RPMI 1640 agar ..... for continuous surveillance of the various Candida species resistance pattern. Only few studies tested the six antifungal agents used for fungal chemotherapy ...

  14. List of Participants 183

    Indian Academy of Sciences (India)

    Narasimhan S L, BARC, Mumbai,. India. Nisha C K, IICT, Hyderabad, India. Pal O R, UICT, Mumbai, India. Pande S S, BARC, Mumbai, India. Paranjpe A S, BARC, Mumbai, India. Paranjpe S K, IAEA, Vienna, Austria. Parmar Rohini N, Saurashtra Univer- sity, Rajkot, India. Patil S R, MS University of Baroda,. Vadodara, India.

  15. Expression of Functional Anti-p24 scFv 183-H12-5C in HEK293T and Jurkat T Cells.

    Science.gov (United States)

    Che Omar, Mohammad Tasyriq

    2017-06-01

    Purpose: More than half of the diagnostic and therapeutic recombinant protein production depends on mammalian-based expression system. However, the generation of recombinant antibodies remains a challenge in mammalian cells due to the disulfide bond formation and reducing cytoplasm. Therefore, the production of functional recombinant antibodies in target cell line is necessary to be evaluated before used in therapeutic application such intrabodies against HIV-1. Methods: The work was to test expression of a single-chain variable fragment (scFv) antibody against HIV-1 Capsid p24 protein in a human mammalian-based expression system using HEK293T and Jurkat T cells as a model. Three expression plasmid vectors expressing scFv 183-H12-5C were generated and introduced into HEK293T. Expression of the scFv was analyzed, while ELISA and immunoblotting analysis verified its binding. The evaluation of the recombinant antibody was confirmed by HIV-1 replication and MAGI infectivity assay in Jurkat T cells. Results: Three plasmid vectors expressing scFv 183-H12-5C was successfully engineered in this study. Recombinant antibodies scFv (~29 kDa) and scFv-Fc (~52 kDa) in the cytoplasm of HEK293T were effectively obtained by transfected the cells with engineered pCDNA3.3-mu-IgGk-scFv 183-H12-5C and pCMX2.5-scFv 183-H12-5C-hIgG1-Fc plasmid vectors respectively. scFv and scFv-Fc are specifically bound recombinant p24, and HIV-1 derived p24 (gag) evaluated by ELISA and Western blot. Jurkat T cells transfected by pCDNA3.3-scFv 183-H12-5C inhibit the replication-competent NL4-3 viral infectivity up to 60%. Conclusion: Anti-p24 scFv 183-H12-5C antibody generated is suitable to be acted as intrabodies and may serve as a valuable tool for the development of antibody-based biotherapeutics against HIV-1.

  16. Radiological dose assessment for the decontaminated concrete removed from 183-H solar evaporation basins at the Hanford site, Richland, Washington

    International Nuclear Information System (INIS)

    Kamboj, S.; Faillace, E.; Yu, C.

    1997-01-01

    Potential maximum radiation dose rates over a 1,000-year time horizon were calculated for exposure to the decontaminated concrete removed from the 183-H Solar Evaporation Basins at the Hanford Site, Richland, Washington. The RESRAD computer code, Version 5.62, which implements the methodology described in the US Department of Energy's manual for developing residual radioactive material guidelines, was used in this evaluation. Currently, the concrete is not being used. Four potential exposure scenarios were developed for the land area where the decontaminated concrete will be stored. In Scenario A industrial use of the land is assumed; in Scenario B recreational use of the land is assumed; in Scenario C residential use of the land is assumed; and in Scenario D (a plausible but unlikely land-use scenario), the presence of a subsistence farmer in the immediate vicinity of the land is assumed. For Scenarios A and B, water used for drinking is assumed to be surface water from the Columbia River; for Scenarios C and D, groundwater drawn from a well located at the downgradient edge of the storage area is the only source of water for drinking, irrigation, and raising livestock. Conservative parameters values were used to estimate the radiation doses. The results of the evaluation indicate that the US Department of Energy's dose limit of 100 mrem/yr would not be exceeded for any of the scenarios analyzed. The potential maximum dose rates for Scenarios A, B, C, and D are 0.75, 0.022, 29, 29 mrem/yr, respectively. An uncertainty analysis was performed to determine which parameters have the greatest impact on the estimated doses. The doses in Scenarios C and D were found to be very sensitive to the magnitude of the irrigation rate

  17. Biodegradation of azo dyes acid red 183, direct blue 15 and direct red 75 by the isolate Penicillium oxalicum SAR-3.

    Science.gov (United States)

    Saroj, Samta; Kumar, Karunesh; Pareek, Nidhi; Prasad, R; Singh, R P

    2014-07-01

    Soils contaminated with dyes were collected and screened for obtaining potential fungal strains for the degradation of azo dyes. A strain that demonstrated broad spectrum ability for catabolizing different azo dyes viz. Acid Red 183 (AR 183), Direct Blue 15 (DB 15) and Direct Red 75 (DR 75) at 100 mg L(-1) concentration was subsequently identified as Penicillium oxalicum SAR-3 based on 18S and internal transcribed spacer (ITS) rDNA gene sequence analysis. The strain has shown remarkably higher levels of degradation (95-100%) for almost all the dyes within 120 h at 30°C at pH 7.0. Notable levels of manganese peroxidase (659.4 ± 20 UL(-1)) during dye decolorization indicated the involvement of this enzyme in the decolorization process. The dyes following decolorization were catabolized as evident by spectroscopic analyses. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Remaining Sites Verification Package for the 100-D-50:5 Process Sewers (183-DR Sedimentation Basin Drains). Attachment to Waste Site Reclassification Form 2006-025

    International Nuclear Information System (INIS)

    Dittmer, L.M.

    2007-01-01

    The 100-D-50:5 subsite encompasses the southern process sewers formerly servicing the 183-DR coagulation and sedimentation basins and proximate surface runoff collection drains. The results of confirmatory sampling of pipeline sediments and underlying soils at the 100-D-50:5 subsite demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River

  19. Remaining Sites Verification Package for the 100-D-50:5 Process Sewers (183-DR Sedimentation Basin Drains), Waste Site Reclassification Form 2006-025

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-11-06

    The 100-D-50:5 subsite encompasses the southern process sewers formerly servicing the 183-DR coagulation and sedimentation basins and proximate surface runoff collection drains. The results of confirmatory sampling of pipeline sediments and underlying soils at the 100-D-50:5 subsite demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  20. Growth and transport properties of multilayer superconducting films of Nd1.83Co0.17CuOx/YBa2Cu3O7-δ

    International Nuclear Information System (INIS)

    Gupta, A.; Gross, R.; Olsson, E.; Segmuller, A.; Koren, G.

    1990-01-01

    This paper reports on strained multilayer thin films of YBa 2 Cu 3 O 7-δ /Nd 1.83 Ce 0.17 CuO x that have been prepared by laser ablation deposition. For individual layers below a critical layer thickness of about 250 Angstrom, coherency strain compresses the Nd 1.83 Ce 0.17 CuO x lattice and expands the YBa 2 Cu 3 O 7-δ lattice. The orthorhombic distortion in the YBa 2 Cu 3 O 7-δ layers is also removed. Depending on their oxygen content, either the YBa 2 Cu 3 O 7-δ , or the Nd 1.83 Ce 0.17 CuO x layers are superconducting in these multilayers. The strain-induced structural modification has a significant influence on the superconducting transition temperature and critical current density of the YBa 2 Cu 3 O 7-δ layers. Zero field critical current densities as high as 1.1 x 10 7 A/cm 2 at 77K have been measured for the YBa 2 Cu 3 O 7-δ layers

  1. Fermentation by gut microbiota cultured in a simulator of the human intestinal microbial ecosystem is improved by probiotic Enterococcus faecium CRL 183

    Directory of Open Access Journals (Sweden)

    Elizeu A. Rossi

    2011-10-01

    Full Text Available Background: Enterococci are used in a large number of dairy products, such as starter cultures in food supplements and in foods considered functional. In vitro gut fermentation models present an unmatched opportunity of performing studies frequently allenged in humans and animals owing to ethical concerns. A dynamic model of the human intestinal microbial ecosystem (SHIME was designed to better simulate conditions intestinal microbiota.Methods: The SHIME model was used to study the effect of Enterococuus faecium CRL 183 on the fermentation pattern of the colon microbiota. Initially, an inoculum prepared from human feces was introduced into the reactor vessels and stabilized over 2 wk using a culture medium. This stabilization period was followed by a 2-wk control period during which the microbiota were monitored. The microbiota were then subjected to a 4-wk treatment period by adding 108 CFU/mL of the Enterococcus faecium CRL 183 to vessel one (the stomach compartment.Results: The addition resulted into an overall increase of bacterial marker populations (Enterobacteriaceae, Lactobacillus spp., Bifidobacterium spp. and Clostridium spp., with a significant increase of the Lactobacillus sp. and Bifidobacterium sp populations. The short-chain fatty acid (SCFA concentration increased during the supplementation period; this was due mainly to a significant increase in the levels of acetic, butyric and propionic acids. Ammonium concentrations increased during the supplementation period.Conclusions: Results showed that the major effect of E. faecium CRL 183 was found in the ascendant and transverse colonFunctional Foods in Health and Disease 2011; 10:389-402

  2. Z Boson Pair Production in e^+ e^- Collisions at √s between 183 and 202, GeV with the OPAL detector at LEP

    Science.gov (United States)

    Kim, Dae Hwan; Strom, David

    2000-05-01

    A study of Z boson pair production in e^+ e^- annihilation at center-of-mass energies between 183, GeV and 202, GeV is reported. Final states containing only leptons, (l l l l and l l ν ν), quark and lepton pairs, (qq l l, qq ν ν) and the all-hadronic final state (qqqq) are considered. In all states with at least one Z boson decaying hadronically, q barq and b barb final states are considered separately using lifetime and event-shape tags, thereby improving the cross-section measurement. Limits on anomalous ZZγ and ZZZ couplings are derived.

  3. Measurement of Isolated Prompt Photon Production in Photon-Photon Collisions at $\\sqrt{s_{ee}}$=183-209 GeV

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Boeriu, O.; Bock, P.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Csilling, A.; Cuffiani, M.; Dado, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Horvath, D.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kormos, Laura L.; Kramer, T.; Krieger, P.; von Krogh, J.; Kruger, K.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Lettso, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Martin, A.J.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Nanjo, H.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vollmer, C.F.; Vannerem, P.; Vertesi, R.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija

    2004-01-01

    For the first time at LEP the production of prompt photons is studied in the collisions of quasi-real photons using the OPAL data taken at e+e- centre-of-mass energies between 183 GeV and 209 GeV. The total inclusive production cross-section for isolated prompt photons in the kinematic range of photon transverse momentum larger than 3.0 GeV and absolute photon pseudorapidity less than 1 is determined to be 0.32 +- 0.04 (stat) +- 0.04 (sys) pb. Differential cross-sections are compared to the predictions of a next-to-leading-order (NLO) calculation.

  4. A search for heavy stable and long-lived squarks and sleptons in $e^+ e^-$ collisions at energies from 130 to 183 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amato, S.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Beilliere, P.; Belokopytov, Yu.; Belous, K.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Bertini, D.; Bertrand, D.; Besancon, M.; Bianchi, F.; Bigi, M.; Bilenky, Mikhail S.; Bizouard, M.A.; Bloch, D.; Blom, H.M.; Bonesini, M.; Bonivento, W.; Boonekamp, M.; Booth, P.S.L.; Borgland, A.W.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bourdarios, C.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Branchini, P.; Brenke, T.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buran, T.; Burgsmuller, T.; Buschmann, P.; Cabrera, S.; Caccia, M.; Calvi, M.; Camacho Rozas, A.J.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chabaud, V.; Chapkin, M.; Charpentier, P.; Chaussard, L.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Chliapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Collins, P.; Colomer, M.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Cowell, J.H.; Crawley, H.B.; Crennell, D.; Crosetti, G.; Cuevas Maestro, J.; Czellar, S.; Damgaard, G.; Davenport, M.; Da Silva, W.; Deghorain, A.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Brabandere, S.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Dolbeau, J.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Duperrin, A.; Durand, J.D.; Eigen, G.; Ekelof, T.; Ekspong, G.; Ellert, M.; Elsing, M.; Engel, J.P.; Erzen, B.; Espirito Santo, M.C.; Harris, Elisabeth Falk; Fanourakis, G.; Fassouliotis, D.; Fayot, J.; Feindt, M.; Fenyuk, A.; Ferrari, P.; Ferrer, A.; Ferrer-Ribas, E.; Fichet, S.; Firestone, A.; Fischer, P.A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Garcia, J.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Gorski, M.; Gouz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Green, C.; Grimm, H.J.; Gris, P.; Grzelak, K.; Gunther, M.; Guy, J.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Harris, F.J.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Hessing, T.L.; Heuser, J.M.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Holthuizen, D.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Huet, K.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Janik, R.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kersevan, B.P.; Khomenko, B.A.; Khovansky, N.N.; Kiiskinen, A.; King, B.; Kjaer, N.J.; Klapp, O.; Klein, Hansjorg; Kluit, P.; Kokkinias, P.; Koratzinos, M.; Kostioukhine, V.; Kourkoumelis, C.; Kouznetsov, O.; Krammer, M.; Kreuter, C.; Kriznic, E.; Krstic, J.; Krumshtein, Z.; Kubinec, P.; Kucewicz, W.; Kurvinen, K.; Lamsa, J.W.; Lane, D.W.; Langefeld, P.; Lapin, V.; Laugier, J.P.; Lauhakangas, R.; Leder, G.; Ledroit, Fabienne; Lefebure, V.; Leinonen, L.; Leisos, A.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liko, D.; Lipniacka, A.; Lippi, I.; Lorstad, B.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Malmgren, T.G.M.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Martinez-Vidal, F.; Marti i Garcia, S.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazik, J.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Meroni, C.; Meyer, W.T.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjoernmark, U.; Moa, T.; Moller, Rasmus; Monig, Klaus; Monge, M.R.; Moreau, X.; Morettini, P.; Morton, G.; Muller, U.; Muenich, K.; Mulders, M.; Mulet-Marquis, C.; Muresan, R.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Naraghi, F.; Navarria, F.L.; Navas, Sergio; Nawrocki, K.; Negri, P.; Neufeld, N.; Neumeister, N.; Nicolaidou, R.; Nielsen, B.S.; Nikolenko, M.; Nomokonov, V.; Normand, A.; Nygren, A.; Obraztsov, V.; Olshevski, A.G.; Onofre, A.; Orava, R.; Orazi, G.; Osterberg, K.; Ouraou, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Papageorgiou, K.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passon, O.; Pegoraro, M.; Peralta, L.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdniakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Rakoczy, D.; Rames, J.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Reid, D.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Rohne, O.; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salt, J.; Sampsonidis, D.; Sannino, M.; Schneider, H.; Schwemling, P.; Schwickerath, U.; Schyns, M.A.E.; Scuri, Fabrizio; Seager, P.; Sedykh, Yu.; Segar, A.M.; Sekulin, R.; Shellard, R.C.; Sheridan, A.; Siebel, M.; Silvestre, R.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Skaali, T.B.; Smadja, G.; Smirnov, N.; Smirnova, O.; Smith, G.R.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Spiriti, E.; Sponholz, P.; Squarcia, S.; Stampfer, D.; Stanescu, C.; Stanic, S.; Stapnes, S.; Stevenson, K.; Stocchi, A.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Tegenfeldt, F.; Terranova, F.; Thomas, J.; Tilquin, A.; Timmermans, Jan; Tkachev, L.G.; Todorova, S.; Toet, D.Z.; Tomaradze, A.; Tome, B.; Tonazzo, A.; Tortora, L.; Transtromer, G.; Treille, D.; Tristram, G.; Troncon, C.; Tsirou, A.; Turluer, M.L.; Tyapkin, I.A.; Tzamarias, S.; Uberschar, B.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Vander Velde, C.; Van Apeldoorn, G.W.; Van Dam, Piet; Van Doninck, Walter; Van Eldik, J.; Van Lysebetten, A.; Van Vulpen, I.; Vassilopoulos, N.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Vollmer, C.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Walck, C.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zaitsev, A.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zucchelli, G.C.; Zumerle, G.

    1998-01-01

    A search for stable and long-lived heavy charged particles used the data taken by the DELPHI experiment at energies from 130 to 183 GeV. The Cherenkov light detected in the Ring Imaging Cherenkov Detector and the ionization loss measured in the Time Projection Chamber identify heavy particles from masses of 2 to nearly 89 GeV/c$^2$. Upper limits are given on the production cross-section and masses of sleptons, free squarks with a charge of $q = \\pm 2/3e$ and hadronizing squarks.

  5. Experimental research on the contrast production of the chemical elements with the atomic numbers 1-83 in a computer-totalbody-tomogram

    International Nuclear Information System (INIS)

    Kirschner, H.; Burmester, U.; Stringaris, K.

    1979-01-01

    The contrast production for the chemical elements with the atomic numbers Z=1-83 were determined by computer-tomography. With the formula relation of the Δ-number and the atomic number can one compute the contrast production of any chosen chemical compound. Iodine-free and inorganic iodine-containing contrast media are examined for their contrast production and compared with presently used organic iodine-containing contrast media. The contrast enhancement of organic contrast media in tissue are discussed. (orig.) [de

  6. Pathogenic Variant in ACTB, p.Arg183Trp, Causes Juvenile-Onset Dystonia, Hearing Loss, and Developmental Delay without Midline Malformation

    Directory of Open Access Journals (Sweden)

    Erin Conboy

    2017-01-01

    Full Text Available ACTB encodes the β-actin, and pathogenic variations in this gene have typically been associated with Baraitser-Winter cerebrofrontofacial syndrome, a congenital malformation syndrome characterized by short stature, craniofacial anomalies, and cerebral anomalies. Here, we describe the third case with the p.Arg183Trp variant in ACTB causing juvenile-onset dystonia. Our patient has severe, intractable dystonia, developmental delay, and sensorineural hearing loss, besides hyperintensities in the caudate nuclei and putamen on the brain MRI, which is a distinct but overlapping phenotype with the previously reported case of identical twins with the same alteration in ACTB.

  7. Evaluation of the 183-D Water Filtration Facility for Bat Roosts and Development of a Mitigation Strategy, 100-D Area, Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Lindsey, C. T.; Gano, K. A.; Lucas, J. G.

    2011-03-07

    The 183-D Water Filtration Facility is located in the 100-D Area of the Hanford Site, north of Richland, Washington. It was used to provide filtered water for cooling the 105-D Reactor and supplying fire-protection and drinking water for all facilities in the 100-D Area. The facility has been inactive since the 1980s and is now scheduled for demolition. Therefore, an evaluation was conducted to determine if any part of the facility was being used as roosting habitat by bats.

  8. ESTUDIO DE SENSIBILIDAD ANTIMICROBIANA DE 183 CEPAS DE STREPTOCOCCUS AGALACTIAE AISLADAS EN REGION VAGINO-PERINEAL DE EMBARAZADAS EN EL TERCER TRIMESTRE

    OpenAIRE

    Belmar J.,Cristián; Abarzúa C.,Fernando; Beker V.,Jorge; Guzmán,Ana María; García C.,Patricia; Oyarzún E.,Enrique

    2002-01-01

    fluctúa entre 1 y 3 por 1000 recién nacidos vivos. Se han entregado pautas dirigidas a reducir las tasas de sepsis precoz con la administración de antibióticos intraparto. Se ha propuesto como antibiótico de primera elección la Penicilina o Ampicilina, y Clindamicina para pacientes alérgicos a las primeras, pero también se ha planteado el uso de Eritromicina o Cefazolina. Se estudia la sensibilidad a estas drogas, en 183 cepas de Streptococcus Grupo B, aisladas en 917 embarazadas, al final de...

  9. Hadronization properties of b quarks compared to light quarks in $e^{+}e^{-} \\to q\\overline{q}$ from 183 to 200 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Beilliere, P.; Belokopytov, Yu.; Belous, K.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Bertrand, D.; Besancon, M.; Bigi, M.; Bilenky, Mikhail S.; Bizouard, M.A.; Bloch, D.; Blom, H.M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bourdarios, C.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buran, T.; Buschbeck, B.; Buschmann, P.; Cabrera, S.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chabaud, V.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Shlyapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Crepe-Renaudin, Sabine; Crosetti, G.; Cuevas Maestro, J.; Czellar, S.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.A.; Demaria, N.; De Angelis, A.; de Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Dolbeau, J.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Duperrin, A.; Durand, J.D.; Eigen, G.; Ekelof, T.; Ekspong, G.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Fayot, J.; Feindt, M.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Fichet, S.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Guz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Gris, P.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hansen, J.; Harris, F.J.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Hessing, T.L.; Heuser, J.M.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Huber, M.; Huet, K.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Janik, R.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovanskii, N.N.; Kiiskinen, A.; King, B.J.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Klein, Hansjorg; Kluit, P.; Kokkinias, P.; Kostyukhin, V.; Kourkoumelis, C.; Kuznetsov, O.; Krammer, M.; Kriznic, E.; Krumshtein, Z.; Kubinec, P.; Kurowska, J.; Kurvinen, K.; Lamsa, J.W.; Lane, D.W.; Lapin, V.; Laugier, J.P.; Lauhakangas, R.; Leder, G.; Ledroit, Fabienne; Lefebure, V.; Leinonen, L.; Leisos, A.; Leitner, R.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Loerstad, B.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Malmgren, T.G.M.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Meroni, C.; Meyer, W.T.; Myagkov, A.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjornmark, U.; Moa, T.; Moch, M.; Moller, Rasmus; Monig, Klaus; Monge, M.R.; Moraes, D.; Moreau, X.; Morettini, P.; Morton, G.; Muller, U.; Muenich, K.; Mulders, M.; Mulet-Marquis, C.; Muresan, R.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Naraghi, F.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Neufeld, N.; Nicolaidou, R.; Nielsen, B.S.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.F.; Olshevskii, A.G.; Onofre, A.; Orava, R.; Orazi, G.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Pavel, T.; Pegoraro, M.; Peralta, L.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdnyakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Rames, J.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinertsen, P.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Rohne, O.; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Royon, C.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovskii, A.; Sajot, G.; Salt, J.; Sampsonidis, D.; Sannino, M.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Yu.; Segar, A.M.; Seibert, N.; Sekulin, R.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnova, O.; Smith, G.R.; Solovianov, O.; Sopczak, A.; Sosnowski, R.; Spassoff, Tz.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanic, S.; Stanitzki, M.; Stevenson, K.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli de Fatis, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Thomas, J.; Timmermans, Jan; Tinti, N.; Tkatchev, L.G.; Tobin, M.; Todorova, S.; Tomaradze, A.G.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Transtromer, G.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Vanden Boeck, W.; Van Eldik, J.; Van Lysebetten, A.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Walck, C.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zintchenko, A.; Zoller, P.; Zucchelli, G.C.; Zumerle, G.

    2000-01-01

    The DELPHI detector at LEP has collected 54 pb$^{-1}$ of dataat a centre-of-mass energy around 183 GeV during 1997,158 pb$^{-1}$ around 189 GeV during 1998,and 187 pb$^{-1}$ between 192 and 200 GeV during 1999.These data were used tomeasure the average charged particle multiplicity in $e^+e^-ightarrow bar{b}$ events, $langle nangle_b$, and the difference $delta_{bl}$between $langle nangle_b$ and themultiplicity, $langle nangle_ll$, in generic light quark (u,d,s) events:egin{eqnarray*}delta_{bl}m{(183 , GeV)} &=& 4.55 pm 1.31 (stat) pm 0.73 (syst) \\delta_{bl}m{(189 , GeV)} &=& 4.43 pm 0.85 (stat) pm 0.61 (syst) \\delta_{bl}m{(200 , GeV)} &=& 3.42 pm 0.89 (stat) pm 1.01 (syst) , .end{eqnarray*}This result is consistent with QCD predictions, while it isinconsistent with calculations assuming that themultiplicity accompanying the decay of a heavy quark is independent of the mass ofthe quark itself.

  10. Idaho HWMA/RCRA Closure Plan for Idaho Nuclear Technology and Engineering Center Tanks WM-182 and WM-183 - Rev. 2

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Susan Kay; unknown

    2000-12-01

    This document presents the plan for the closure of the Idaho Nuclear Technology and Engineering Center Tank Farm Facility tanks WM-182 and WM-183 in accordance with Idaho Hazardous Waste Management Act/Resource Conservation and Recovery Act interim status closure requirements. Closure of these two tanks is the first in a series of closures leading to the final closure of the eleven 300,000-gal tanks in the Tank Farm Facility. As such, closure of tanks WM-182 and WM-183 will serve as a proof-of-process demonstration of the waste removal, decontamination, and sampling techniques for the closure of the remaining Tank Farm Facility tanks. Such an approach is required because of the complexity and uniqueness of the Tank Farm Facility closure. This plan describes the closure units, objectives, and compliance strategy as well as the operational history and current status of the tanks. Decontamination, closure activities, and sampling and analysis will be performed with the goal of achieving clean closure of the tanks. Coordination with other regulatory requirements, such as U.S. Department of Energy closure requirements, is also discussed.

  11. Granulocyte-specific monoclonal antibody technetium-99m-BW 250/183 and indium-111 oxine-labelled leucocyte scintigraphy in inflammatory bowel disease.

    Science.gov (United States)

    Segarra, I; Roca, M; Baliellas, C; Vilar, L; Ricart, Y; Mora, J; Puchal, R; Martin-Comin, J

    1991-01-01

    Thirty-three patients suspected of suffering from inflammatory bowel disease were studied. Autologous leucocytes were labelled with indium 111 oxine and re-injected simultaneously with 0.3-0.5 mg of technetium 99m granulocyte-specific monoclonal antibody BW 250/183. Two scans were obtained, the early scan 3-4 h postinjection (p.i.) and the late scan 18-24 h p.i. Using the endoscopy study as standard, the diagnostic accuracy of both agents was determined. Sensitivity, specificity and accuracy of 111In scans was 88.8%, 100.0% and 93.7% at 4 h and 94.7%, 100.0% and 96.9% at 24 h, respectively. Concerning the results using antibodies, the values were 61.1%, 100.0% and 78.1% at 4 h and 78.9%, 92.8% and 84.8% at 24 h, respectively. Segmental analysis showed concordance in 89.3% and 93.3% of the cases at 4 and 24 h, respectively. Though less sensitive and less accurate than scanning employing indium 111 leucocytes, BW 250/183 granulocyte-specific scintigraphy can be used for inflammatory bowel disease diagnosis and localization.

  12. Granulocyte-specific monoclonal antibody technetium-99m-BW 250/183 and indium-111 oxine-labelled leukocyte scintigraphy in inflammatory bowel disease

    Energy Technology Data Exchange (ETDEWEB)

    Segarra, I.; Roca, M.; Ricart, Y.; Mora, J.; Puchal, R.; Martin-Comin, J. (Hospital de Bella Vista, Barcelona (Spain). Servicio de Medicina Nuclear); Baliellas, C.; Vilar, L. (Hospital de Bella Vista, Barcelona (Spain). Servicio de Gastroenterologia)

    1991-09-01

    Thirty-three patients suspected of suffering from inflammatory bowel disease were studied. Autologous leukocytes were labelled with indium 111 oxine and re-injected simultaneously with 0.3-0.5 mg of {sup 99m}Tc-labelled granulocyte-specific monoclonal antibody BW 250/183. Two scans were obtained, the early scan 3-4 h post-injection (p.i.) and the late scan 18-24 h p.i. Using the endoscopy study as standard, the diagnostic accuracy of both agents was determined. Sensitivity, specificity and accuracy of {sup 111}In-scans was 88.8%, 100.0% and 93.7% at 4 h and 94.7%, 100.0% and 96.9% and 24 h, respectively. Concerning the results using antibodies, the values were 61.1%, 100.0% and 78.1% at 4 h and 78.9%, 92.8% and 84.8% at 24 h, respectively. Segmental analysis showed concordance in 89.3% and 93.3% of the cases at 4 and 24 h, respectively. Though less sensitive and less accurate than scanning employing indium 111 leukocytes, the BW 250/183 granulocyte-specific scintigraphy can be used for inflammatory bowel disease diagnosis and localization. (orig.).

  13. Search for Anomalous Production of Di-lepton Events with Missing Transverse Momentum in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 183-209 GeV

    CERN Document Server

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Kramer, T; Krieger, P; Von Krogh, J; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2004-01-01

    In total 1317 di-lepton events with significant missing transverse momentum were identified in a total data sample of 680 pb-1 collected at e+e- centre-of-mass energies ranging from 183 GeV to 209 GeV. The number of di-lepton events, the dependence on centre-of-mass energy, and the event properties are consistent with expectations from Standard Model processes, predominantly W+W- production with both W bosons decaying leptonically. This topology is also an experimental signature for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. No evidence for new phenomena is apparent. Upper limits are presented on the production cross-section multiplied by the relevant branching ratio squared for sleptons, leptonically decaying charginos and charged Higgs bosons. Mass limits are also given.

  14. Calculations of neutron-induced production cross-sections of {sup 180,182,183,184,186}W up to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Sarer, B. [Gazi Universitesi, Fen-Edebiyat Fakueltesi, Fizik Boeluemue, 06500 Ankara (Turkey)], E-mail: sarer@gazi.edu.tr; Aydin, A. [Kirikkale Universitesi, Fen-Edebiyat Fakueltesi, Fizik Boeluemue, Kirikkale (Turkey); Guenay, M. [Inoenue Universitesi, Fen-Edebiyat Fakueltesi, Fizik Boeluemue, Malatya (Turkey); Korkmaz, M.E.; Tel, E. [Gazi Universitesi, Fen-Edebiyat Fakueltesi, Fizik Boeluemue, 06500 Ankara (Turkey)

    2009-05-01

    Neutron-induced cross-sections for the stable isotopes {sup 180,182,183,184,186}W in the energy region up to 20 MeV have been calculated. Calculations were made with the codes CEM03.01 and ALICE/ASH, using the following models: the Dubna version of the intranuclear cascade model for the cascade stage of interaction; the hybrid, the geometry dependent hybrid and the exciton model for the pre-equilibrium component; the Hauser-Feshbach and the Weisskopf-Ewing statistical models for the equilibrium component. Effects of some important model parameters such as level density parameter and pairing correction were investigated. Calculated cross-sections were compared with available experimental data in the literature and with ENDF/B-VI T = 300 K and JENDL-3.3 T = 300 K evaluated data libraries.

  15. Calculations of neutron-induced production cross-sections of 180,182,183,184,186W up to 20 MeV

    International Nuclear Information System (INIS)

    Sarer, B.; Aydin, A.; Guenay, M.; Korkmaz, M.E.; Tel, E.

    2009-01-01

    Neutron-induced cross-sections for the stable isotopes 180,182,183,184,186 W in the energy region up to 20 MeV have been calculated. Calculations were made with the codes CEM03.01 and ALICE/ASH, using the following models: the Dubna version of the intranuclear cascade model for the cascade stage of interaction; the hybrid, the geometry dependent hybrid and the exciton model for the pre-equilibrium component; the Hauser-Feshbach and the Weisskopf-Ewing statistical models for the equilibrium component. Effects of some important model parameters such as level density parameter and pairing correction were investigated. Calculated cross-sections were compared with available experimental data in the literature and with ENDF/B-VI T = 300 K and JENDL-3.3 T = 300 K evaluated data libraries.

  16. Critical current density of strained multilayer thin films of Nd1.83Ce0.17CuOx/YBa2Cu3O7-δ

    International Nuclear Information System (INIS)

    Gross, R.; Gupta, A.; Olsson, E.; Segmueller, A.; Koren, G.

    1990-01-01

    The superconducting transport properties of strained multilayer thin films of YBa 2 Cu 3 O 7-δ / Nd 1.83 Ce 0.17 CuO x , grown heteroepitaxially by laser ablation deposition, are reported. For individual layer thicknesses below a critical layer thickness of about 250 A, coherency strain removes the orthorhombic distortion in the YBa 2 Cu 3 O 7-δ layers and makes them twin-free. Zero-field critical current densities as high as 1.1x10 7 A/cm 2 at 77 K have been measured for the YBa 2 Cu 3 O 7-δ layers. Flux pinning energies at zero temperature and zero magnetic field in the range of 80--140 meV have been found

  17. A tentative detection of the 183-GHz water vapor line in the martian atmosphere: Constraints upon the H2O abundance and vertical distribution

    Science.gov (United States)

    Encrenaz, TH.; Lellouch, E.; Cernicharo, J.; Paubert, G.; Gulkis, S.

    1995-01-01

    The 183-GHz water vapor line was tentatively detected on Mars in January 1991, with the IRAM 30-m millimeter antenna, under extremely dry atmospheric conditions. The measurement refers to the whole disk. The spectral line, although marginally detected, can be fit with a constant H2O mixing ratio of 1.0 x 10(exp -5), which corresponds to a water abundance of 1 pr-microns; in any case, an upper limit of 3 pr-microns is inferred. This value is comparable to the very small abundances measured by Clancy (1992) 5 weeks before our observation and seems to imply both seasonal and long-term variations in the martian water cycle.

  18. Search for supersymmetry with R-parity violating $LL\\overline{E}$ couplings at $\\sqrt{s}$ = 183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Masik, J; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D

    2000-01-01

    Searches for pair production of supersymmetric particles in e$^{+}$e$^{-}$ collisions at centre-of-mass energy of 183~GeV have been performed on DELPHI data under the assumption that $R$-parity is not conserved. Only one $R$-parity violating coupling of $\\lambda$ type, which couples the sleptons to the leptons ($LL \\bar{E}$ term), is considered to be dominant at a time. Since in models with $R$-parity violation any supersymmetric particle can be the lightest one, searches for charginos, neutralinos, sleptons and squarks have been performed both for direct $R$-parity violating decays and for indirect cascade decays. Morever, it is assumed that the strength of the $R$-parity violating couplings is such that the lifetimes can be neglected. The present study?base=prep

  19. Search for charginos and neutralinos in $e^+ e^-$ collisions at centre-of-mass energies near 183 GeV and constraints on the MSSM parameter space

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Nief, J Y; Pietrzyk, B; Alemany, R; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Park, I C; Pascual, A; Riu, I; Sánchez, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Becker, U; Boix, G; Cattaneo, M; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Leroy, O; Loomis, C; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Tournefier, E; Vreeswijk, M; Wright, A E; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Cerutti, F; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Curtis, L; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Raine, C; Smith, D; Teixeira-Dias, P; Thompson, A S; Ward, J J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Nowell, J; Sedgbeer, J K; Spagnolo, P; Thomson, E; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Williams, M; Van Gemmeren, P; Giehl, I; Hölldorfer, F; Hoffmann, C; Jakobs, K; Kleinknecht, K; Kröcker, M; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Motsch, F; Payre, P; Talby, M; Thulasidas, M; Tilquin, A; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Kado, M; Kim, D W; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Chambers, J T; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Norton, P R; Thompson, J C; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Przysiezniak, H; Rander, J; Renardy, J F; Rosowsky, A; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Kelly, M S; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Foss, J; Grupen, Claus; Misiejuk, A; Prange, G; Sieler, U; Smolik, L; Stephan, F; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; Mamier, G; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Vogt, M; Walsh, J; Wu Sau Lan; Wu, X; Zobernig, G

    1999-01-01

    Searches for charginos and neutralinos are performed with the data collected by the ALEPH detector at LEP at centre-of-mass energies near 183 GeV. In these searches, it is assumed that R-parity is conserved and that the lightest neutralino is the LSP. No evidence of a signal is observed in the 57 pb-1 accumulated, which excludes chargino and associated neutralino production up to the kinematic limit over large regions of the MSSM parameter space. Under the assumptions of common gaugino and common sfermion masses at the unification scale, the interplay between the chargino, neutralino and slepton exclusions allows a lower limit of 27 GeV/c2 to be set on the mass of the lightest neutralino. Tighter constraints on the MSSM parameter space are obtained using in addition exclusions in the Higgs sector. Finally, the results are interpreted within the framework of minimal supergravity.

  20. Effect of a probiotic beverage consumption (Enterococcus faecium CRL 183 and Bifidobacterium longum ATCC 15707 in rats with chemically induced colitis.

    Directory of Open Access Journals (Sweden)

    Larissa Sbaglia Celiberto

    Full Text Available Some probiotic strains have the potential to assist in relieving the symptoms of inflammatory bowel disease. The impact of daily ingestion of a soy-based product fermented by Enterococcus faecium CRL 183 and Lactobacillus helveticus 416 with the addition of Bifidobacterium longum ATCC 15707 on chemically induced colitis has been investigated thereof within a period of 30 days.Colitis was induced by dextran sulfate sodium. The animals were randomly assigned into five groups: Group C: negative control; Group CL: positive control; Group CLF: DSS with the fermented product; Group CLP: DSS with the non-fermented product (placebo; Group CLS: DSS with sulfasalazine. The following parameters were monitored: disease activity index, fecal microbial analyses, gastrointestinal survival of probiotic microorganisms and short-chain fatty acids concentration in the feces. At the end of the protocol the animals' colons were removed so as to conduct a macroscopical and histopathological analysis, cytokines and nitrite quantification.Animals belonging to the CLF group showed fewer symptoms of colitis during the induction period and a lower degree of inflammation and ulceration in their colon compared to the CL, CLS and CLP groups (p<0.05. The colon of the animals in groups CL and CLS presented severe crypt damage, which was absent in CLF and CLP groups. A significant increase in the population of Lactobacillus spp. and Bifidobacterium spp. at the end of the protocol was verified only in the CLF animals (p<0.05. This group also showed an increase in short-chain fatty acids (propionate and acetate. Furthermore, the intestinal survival of E. faecium CRL 183 and B. longum ATCC 15707 in the CLF group has been confirmed by biochemical and molecular analyzes.The obtained results suggest that a regular intake of the probiotic product, and placebo to a lesser extent, can reduce the severity of DSS-induced colitis on rats.

  1. Precision neutron-diffraction investigation of the high-temperature superconductor La1.83Sr0.17CuO4 by means of full-profile analysis

    International Nuclear Information System (INIS)

    Lyakhovitskaya, O.I.; Nozik, Yu.Z.

    1990-01-01

    The structural information contained in a powder pattern is practically equivalent to that obtainable using diffraction data from a monocrystalline specimen. In this article the authors given the results of refining by the Rietveld method the structural parameters of a HTSC of the composition La 1.83 Sr 0.17 CuO 4 at T = 80 K. In this investigation they give the results of processing neutron diffraction patterns of a polycrystalline specimen of La 1.83 Sr 0.17 CuO 4 taken with monochromatic neutrons with a wavelength of 1.750 angstrom

  2. The co-existence of the IL-18+183 A/G and MMP-9 -1562 C/T polymorphisms is associated with clinical events in coronary artery disease patients.

    Directory of Open Access Journals (Sweden)

    Trine B Opstad

    Full Text Available Interleukin (IL-18 has been associated with severity of atherosclerosis and discussed to predict cardiovascular (CV events. We have previously shown that the IL-18+183 G-allele significantly reduces IL-18 levels. This study was aimed to investigate the prognostic significance of the IL-18+183 A/G polymorphism (rs5744292, single and in coexistence with the matrix metalloproteinase (MMP-9 -1562 C/T (rs3918242 polymorphism, in patients with stable coronary artery disease (CAD. Serum levels of IL-18, MMP-9 and tissue inhibitor of matrix metalloproteinase (TIMP-1 were additionally assessed.1001 patients with angiographically verified CAD were genotyped and the biomarkers were measured accordingly. After two years follow-up, 10.6% experienced new clinical events; acute myocardial infarction (AMI, stroke, unstable angina pectoris and death.The IL-18+183 G-allele associated with 35% risk reduction in composite endpoints after adjusting for potential covariates (p = 0.044. The IL-18+183 AA/MMP-9 -1562 CT/TT combined genotypes associated with a significant increase in risk of composite endpoints (OR = 1.87; 95% CI = 1.13-3.11, p = 0.015, adjusted. Patients with clinical events presented with significantly higher IL-18 levels as compared to patients without (p = 0.011, adjusted. The upper tertile of IL-18 levels associated with an increase in risk of AMI as compared to lower tertiles (OR = 2.36; 95% CI = 1.20-4.64, p = 0.013, adjusted.The IL-18+183 A/G polymorphism, single and in combination with MMP-9 genotypes, may influence the risk of clinical events in stable CAD patients.

  3. The Stress Corrosion Resistance and the Cryogenic Temperature Mechanical Behavior of 18-3 Mn (Nitronic 33) Stainless Steel Parent and Welded Material

    Science.gov (United States)

    Montano, J. W.

    1976-01-01

    The ambient and cryogenic temperature mechanical properties and the ambient temperature stress corrosion results of 18-3 Mn (Nitronic 33)stainless steel, longitudinal and transverse, as received and as welded (TIG) material specimens manufactured from 0.063 inch thick sheet material, were described. The tensile test results indicate an increase in ultimate tensile and yield strengths with decreasing temperature. The elongation remained fairly constant to -200 F, but below that temperature the elongation decreased to less than 6.0% at liquid hydrogen temperature. The notched tensile strength (NTS) for the parent metal increased with decreasing temperature to liquid nitrogen temperature. Below -320 F the NTS decreased rapidly. The notched/unnotched (N/U) tensile ratio of the parent material specimens remained above 0.9 from ambient to -200 F, and decreased to approximately 0.65 and 0.62, respectively, for the longitudinal and transverse directions at liquid hydrogen temperature. After 180 days of testing, only those specimens exposed to the salt spray indicated pitting and some degradation of mechanical properties.

  4. Scaling violations of quark and gluon jet fragmentation functions in $e^{+}e{-}$ annihilations at $\\sqrt{s}$ = 91.2 and 183-209 GeV

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barillari, T.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Boeriu, O.; Bock, P.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, D.G.; Ciocca, C.; Csilling, A.; Cuffiani, M.; Dado, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harel, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Horvath, D.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karlen, D.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kramer, T.; Krieger, P.; von Krogh, J.; Kruger, K.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Lellouch, D.; Lettso, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, A.; Ludwig, J.; Mader, W.; Marcellini, S.; Martin, A.J.; Masetti, G.; Mashimo, T.; Mattig, Peter; McKenna, J.; McPherson, R.A.; Meijers, F.; Menges, W.; Merritt, F.S.; Mes, H.; Meyer, Niels T.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Nanjo, H.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Roney, J.M.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schorner-Sadenius, T.; Schroder, Matthias; Schumacher, M.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vollmer, C.F.; Vannerem, P.; Vertesi, R.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija

    Flavour inclusive, udsc and b fragmentation functions in unbiased jets, and flavour inclusive, udsc, b and gluon fragmentation functions in biased jets are measured in e+e- annihilations from data collected at centre-of-mass energies of 91.2, and 183-209 GeV with the OPAL detector at LEP. The unbiased jets are defined by hemispheres of inclusive hadronic events, while the biased jet measurements are based on three-jet events selected with jet algorithms. Several methods are employed to extract the fragmentation functions over a wide range of scales. Possible biases are studied in the results are obtained. The fragmentation functions are compared to results from lower energy e+e- experiments and with earlier LEP measurements and are found to be consistent. Scaling violations are observed and are found to be stronger for the fragmentation functions of gluon jets than for those of quarks. The measured fragmentation functions are compared to three recent theoretical next-to-leading order calculations and to the p...

  5. Search for invisibly decaying Higgs bosons in $e^{+}e^{-} \\rightarrow Z^{0}h^{0}$ production at $\\sqrt{s} = 183 - 209 GeV$

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Anagnostou, G.; Anderson, K.J.; Asai, S.; Axen, D.; Bailey, I.; Barberio, E.; Barillari, T.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, K.W.; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Boeriu, O.; Bock, P.; Boutemeur, M.; Braibant, S.; Brown, R.M.; Burckhart, H.J.; Campana, S.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, D.G.; Ciocca, C.; Csilling, A.; Cuffiani, M.; Dado, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Etzion, E.; Fabbri, F.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Gagnon, P.; Gary, J.W.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, M.; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harel, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Herten, G.; Heuer, R.D.; Hill, J.C.; Horvath, D.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanzaki, J.; Karlen, D.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kramer, T.; Krasznahorkay, A., Jr.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lellouch, D.; Letts, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, A.; Ludwig, J.; Mader, W.; Marcellini, S.; Martin, A.J.; Mashimo, T.; Mattig, P.; McKenna, J.; McPherson, R.A.; Meijers, F.; Menges, W.; Merritt, F.S.; Mes, H.; Meyer, N.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Nanjo, H.; Neal, H.A.; O'Neale, S.W.; Oh, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Pilcher, J.E.; Pinfold, J.; Plane, D.E.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Roney, J.M.; Rossi, A.M.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schorner-Sadenius, T.; Schroder, M.; Schumacher, M.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Strom, D.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vollmer, C.F.; Vannerem, P.; Vertesi, R.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, L.

    2010-01-01

    A search is performed for Higgs bosons decaying into invisible final states, produced in association with a Zo boson in e+e- collisions at energies between 183 and 209 GeV. The search is based on data samples collected by the OPAL detector at LEP corresponding to an integrated luminosity of about 660 pb-1. The analysis aims to select events containing the hadronic decay products of the Zo boson and large missing momentum, as expected from Higgs boson decay into a pair of stable weakly interacting neutral particles, such as the lightest neutralino in the Minimal Supersymmetric Standard Model. The same analysis is applied to a search for nearly invisible Higgs boson cascade decays into stable weakly interacting neutral particles. No excess over the expected background from Standard Model processes is observed. Limits on the production of invisibly decaying Higgs bosons produced in association with a Zo boson are derived. Assuming a branching ratio BR(ho->invisible)=1, a lower limit of 108.2 GeV is placed on the...

  6. Search for Pair-Produced Neutralinos in Events with Photons and Missing Energy from $e^{+}e^{-}$ Collisions at $\\Sqrt{s}=130-183$ GeV

    CERN Document Server

    Abreu, P; Adzic, P; Ajinenko, I; Alekseev, G D; Alemany, R; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Cerruti, C; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Collins, P; Colomer, M; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Damgaard, G; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Di Diodato, A; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Fichet, S; Firestone, A; Fischer, P A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; García, J; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gerdyukov, L N; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Gris, P; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Knoblauch, D; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Krstic, J; Krumshtein, Z; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Masik, J; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neufeld, N; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nikolaenko, V; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rakoczy, D; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Schneider, H; Schwemling, P; Schwickerath, U; Schyns, M A E; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Sekulin, R L; Shellard, R C; Sheridan, A; Siebel, M; Silvestre, R; Simard, L C; Simonetto, F; Sissakian, A N; Skaali, T B; Smadja, G; Smirnova, O G; Smith, G R; Sokolov, A; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stampfer, D; Stanescu, C; Stanic, S; Stapnes, Steinar; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Chikilev, O G; Tegenfeldt, F; Terranova, F; Thomas, J; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Todorova, S; Toet, D Z; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Van Vulpen, I B; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G

    1999-01-01

    The events with two photons and missing (transverse) energy collected by the DELPHI detector at centre-of-mass energies between 130~GeV and 183~GeV have been studied to search for processes of the type $\\mbox{e}^+\\mbox{e}^- \\to \\mbox{Y} \\mbox{Y}$ with the subsequent decay $\\mbox{Y} \\to \\mbox{X} \\gamma$, where X is an undetectable neutral particle. Reactions of this kind are expected in supersymmetric models, where the Y particle can be either the lightest neutralino, decaying to a photon and a gravitino, or the next-to-lightest neutralino, decaying to a photon and the lightest neutralino. To study the case of long-lived Y particles, a search for single-photon events with the reconstructed photon axis pointing far from the beam interaction region has also been performed. No evidence for a deviation from Standard Model expectations has been observed in the data and upper limits have been derived on the signal cross-section as a function of the the X and Y masses and of the Y mean decay path.

  7. CloudSat-Constrained Cloud Ice Water Path and Cloud Top Height Retrievals from MHS 157 and 183.3 GHz Radiances

    Science.gov (United States)

    Gong, J.; Wu, D. L.

    2014-01-01

    Ice water path (IWP) and cloud top height (ht) are two of the key variables in determining cloud radiative and thermodynamical properties in climate models. Large uncertainty remains among IWP measurements from satellite sensors, in large part due to the assumptions made for cloud microphysics in these retrievals. In this study, we develop a fast algorithm to retrieve IWP from the 157, 183.3+/-3 and 190.3 GHz radiances of the Microwave Humidity Sounder (MHS) such that the MHS cloud ice retrieval is consistent with CloudSat IWP measurements. This retrieval is obtained by constraining the empirical forward models between collocated and coincident measurements of CloudSat IWP and MHS cloud-induced radiance depression (Tcir) at these channels. The empirical forward model is represented by a lookup table (LUT) of Tcir-IWP relationships as a function of ht and the frequency channel.With ht simultaneously retrieved, the IWP is found to be more accurate. The useful range of the MHS IWP retrieval is between 0.5 and 10 kg/sq m, and agrees well with CloudSat in terms of the normalized probability density function (PDF). Compared to the empirical model, current operational radiative transfer models (RTMs) still have significant uncertainties in characterizing the observed Tcir-IWP relationships. Therefore, the empirical LUT method developed here remains an effective approach to retrieving ice cloud properties from the MHS-like microwave channels.

  8. Reliability and Validity Measurement of Sagittal Lumbosacral Quiet Standing Posture with a Smartphone Application in a Mixed Population of 183 College Students and Personnel

    Directory of Open Access Journals (Sweden)

    George A. Koumantakis

    2016-01-01

    Full Text Available Accurate recording of spinal posture with simple and accessible measurement devices in clinical practice may lead to spinal loading optimization in occupations related to prolonged sitting and standing postures. Therefore, the purpose of this study was to establish the level of reliability of sagittal lumbosacral posture in quiet standing and the validity of the method in differentiating between male and female subjects, establishing in parallel a normative database. 183 participants (83 males and 100 females, with no current low back or pelvic pain, were assessed using the “iHandy Level” smartphone application. Intrarater reliability (3 same-day sequential measurements was high for both the lumbar curve (ICC2,1: 0.96, SEM: 2.13°, and MDC95%: 5.9° and the sacral slope (ICC2,1: 0.97, SEM: 1.61°, and MDC95%: 4.46° sagittal alignment. Data analysis for each gender separately confirmed equally high reliability for both male and female participants. Correlation between lumbar curve and sacral slope was high (Pearson’s r=0.86, p<0.001. Between-gender comparisons confirmed the validity of the method to differentiate between male and female lumbar curve and sacral slope angles, with females generally demonstrating greater lumbosacral values (p<0.001. The “iHandy Level” application is a reliable and valid tool in the measurement of lumbosacral quiet standing spinal posture in the sagittal plane.

  9. Messung der Myonpaarproduktion im Prozess e+ e- --> mu+ mu- (gamma) bei Schwerpunktsenergien von 89 GeV bis 183 GeV

    CERN Document Server

    Siedenburg, Thorsten

    2000-01-01

    Presented are the total cross-sections and forward-backward-asymmetries of the reaction at center of mass energies between 89 GeV and 183 GeV at the LEP-accelerator measured with the L3-Detector from 1995 to 1997. These data include measurements from LEP I on the Z-resonance and from LEP II above the W-pairproduction-threshhold. The myonselection acceptance was increased from polar angles above up to Compared to previous measurements, uncertainties are reduced regarding the assumption of lepton-universality and the determination of the Z-mass and width: Fitting the myonpair-data using a parametrisation in effective coupling constants and yields = (91.196Þ0.013) GeV and = (2.497Þ0.021) GeV. Additionally the Z-mass is determined using the S-matrix-parametrisation without restrictions on the -Z interference term. Adding LEP II data to the LEP I results halves the error on the Z-mass. The results presented in this thesis are obtained by using the FB myonchambersystem - installed before 1995 LEP running - to its...

  10. Propuesta de actividades físico-recreativas para el adulto mayor, de la Circunscripción 183 del Consejo Popular Hermanos Cruz

    Directory of Open Access Journals (Sweden)

    Olga Lidia Díaz Somonte

    2009-06-01

    Full Text Available Las actividades físico-recreativas y deportivas son de suma importancia en la tercera edad, con el proceso de envejecimiento el adulto mayor sufre cambios a nivel físico, psíquico y social, ya que a la vez estas actividades tienen un papel fundamental que es el mantenimiento, mejoramiento de su salud y el bienestar del adulto mayor o sea mejorar su estilo de vida. Se realiza una propuesta de actividades físico recreativas para la tercera edad Que tiene como objetivo principal proponer un grupo de actividades físico-recreativas y deportivas en función de lograr un mejor estilo de vida del adulto mayor perteneciente al Consultorio Médico No. 40 de la Circunscripción No 183 del Consejo Popular Hermanos Cruz del Municipio Pinar del Río, motivado esto por el diagnóstico realizado que nos demostró la existencia de dificultades para la ocupación del tiempo libre de los ancianos de la comunidad ya mencionada.

  11. Search for stable and long-lived massive charged particles in $e^{+} e^{-}$ collisions at $\\sqrt{s}$ = 130-183 GeV

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; de Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Feld, L.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Kanzaki, J.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; List, B.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rembser, C.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Strohmer, R.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Utzat, P.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1998-01-01

    A search for stable and long-lived massive particles of electric charge |Q/e| = 1 or 2/3, pair-produced in e+e- collisions at centre-of-mass energies from 130 to 183 GeV, is reported by the OPAL collaboration at LEP. No evidence for production of these particles was observed in a mass range between 45 and 89.5 GeV. Model-independent upper limits on the production cross-section between 0.05 and 0.19 pb have been derived for scalar and spin-1/2 particles with charge +/-1. Within the framework of the minimal supersymmetric model (MSSM), this implies a lower limit of 82.5 (83.5) GeV on the mass of long-lived right- (left-)handed scalar muons and scalar taus. Long-lived charged leptons and charginos are excluded for masses below 89.5 GeV. For particles with charge +/-2/3 the upper limits on the production cross-section vary between 0.05 and 0.2 pb. All limits, on masses and on cross-sections, are valid at the 95% confidence level for particles with lifetimes longer than 10^{-6} s.

  12. Reliability and Validity Measurement of Sagittal Lumbosacral Quiet Standing Posture with a Smartphone Application in a Mixed Population of 183 College Students and Personnel.

    Science.gov (United States)

    Koumantakis, George A; Nikoloudaki, Maria; Thacheth, Sara; Zagli, Kalliroi; Bitrou, Konstantina; Nigritinos, Andreas; Botton, Leon

    2016-01-01

    Accurate recording of spinal posture with simple and accessible measurement devices in clinical practice may lead to spinal loading optimization in occupations related to prolonged sitting and standing postures. Therefore, the purpose of this study was to establish the level of reliability of sagittal lumbosacral posture in quiet standing and the validity of the method in differentiating between male and female subjects, establishing in parallel a normative database. 183 participants (83 males and 100 females), with no current low back or pelvic pain, were assessed using the "iHandy Level" smartphone application. Intrarater reliability (3 same-day sequential measurements) was high for both the lumbar curve (ICC 2,1 : 0.96, SEM: 2.13°, and MDC 95% : 5.9°) and the sacral slope (ICC 2,1 : 0.97, SEM: 1.61°, and MDC 95% : 4.46°) sagittal alignment. Data analysis for each gender separately confirmed equally high reliability for both male and female participants. Correlation between lumbar curve and sacral slope was high (Pearson's r = 0.86, p < 0.001). Between-gender comparisons confirmed the validity of the method to differentiate between male and female lumbar curve and sacral slope angles, with females generally demonstrating greater lumbosacral values ( p < 0.001). The "iHandy Level" application is a reliable and valid tool in the measurement of lumbosacral quiet standing spinal posture in the sagittal plane.

  13. Single- and multi-photon production in $e^{+}e^{-}$ collisions at a centre-of-mass energy of 183 GeV

    CERN Document Server

    Barate, R; Décamp, D; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Lucotte, A; Martin, F; Merle, E; Minard, M N; Nief, J Y; Pietrzyk, B; Alemany, R; Boix, G; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Becker, U; Bright-Thomas, P G; Casper, David William; Cattaneo, M; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Maley, P; Mato, P; Minten, Adolf G; Moneta, L; Qi, N; Pacheco, A; Ranjard, F; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Vreeswijk, M; Wachsmuth, H W; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Tanaka, R; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Cerutti, F; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Curtis, L; Halley, A W; Lynch, J G; Negus, P; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Ward, J J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Marinelli, N; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Williams, M I; Giehl, I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Tilquin, A; Trabelsi, K; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Kroha, H; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Kado, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Serin, L; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Coles, J; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Przysiezniak, H; Rander, J; Renardy, J F; Rosowsky, A; Roussarie, A; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Foss, J; Grupen, Claus; Smolik, L; Stephan, F; Giannini, G; Gobbo, B; Musolino, G; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Zobernig, G

    1998-01-01

    The production of final states involving one or more energetic photons from e+e- collisions is studied in a sample of 58.5 pb-1 of data recorded at a centre-of-mass energy of 183 GeV by the ALEPH detector at LEP. The $\\reenunug$ and $\\reeggg$ cross sections are measured. The data are in good agreement with predictions based on the Standard Model and are used to set upper limits on the cro ss sections for anomalous photon production in the context of two supersymmetric models and for various extensions to QED. In particular in the context of a super-light gravitino model a cross s ection upper limit of 0.38 pb is placed on the process $\\reeGGg$, allowing a lower limit to be set on the mass of the gravitino. Limits are also set on the mass of the lightest neutralino in Gauge Mediated Supersymmetry Breaking models. In the case of equal ee*$\\gamma$ and ee$\\gamma$ couplings a 95\\% C.L. lower limit on $\\mestar$ of $250\\gevcc$ is obtained.

  14. Armazenamento refrigerado sob atmosfera modificada de pedúnculos de cajueiro-anão-precoce dos clones CCP-76, end-157, end-183 e end-189 Storage of cashew apples from dwarf clones CCP-76, end-157, end-183 and end-189 under refrigeration and modified atmosphere

    Directory of Open Access Journals (Sweden)

    Auricélia de Souza Morais

    2002-12-01

    Full Text Available Pedúnculos de clones de cajueiro-anão-precoce, dos clones CCP-76, END-157, END-183 e END-189, foram armazenados durante 25 dias, sob refrigeração associada a atmosfera modificada, com o objetivo de avaliar o efeito das condições atualmente utilizadas (5ºC e 85-90% de UR para conservação, transporte e comercialização de cajus in natura. Os pedúnculos foram avaliados a cada 5 dias quanto às seguintes características: perda de peso, firmeza, cor (antocianinas, sólidos e açúcares solúveis, acidez, pH, vitamina C e compostos fenólicos. O uso da refrigeração (5ºC e 85% U.R, associada a atmosfera modificada, proporcionou uma vida útil pós-colheita de 10 dias para o clone END 189, de até 15 dias para o clone END 157 e de até 25 dias para os clones CCP 76 e END 183. A temperatura de 5ºC não se mostrou adequada para armazenamento de pedúnculos de coloração mais intensa (END 157 e END 189 que a testemunha (CCP 76, provocando perda de cor (antocianinas a partir do 10º dia de armazenamento. A atmosfera modificada reduziu significativamente a perda de peso, favorecendo a aparência do produto para comercialização, independentemente do clone estudado.Apples or false fruits from early dwarf cashew clones CCP-76, END-157, END-183 and END-189 were stored for 25 days under refrigeration associated to modified atmosphere with the aim of evaluating the effect of the conditions presently adopted (5ºC and 85-90% RH for conservation, storage and commercialization of fresh cashew apples. The cashew apples were evaluated every 5 days for the following characteristics: weight loss, pulp firmness, color (anthocyannins, acidity, pH, soluble solids, vitamin C and phenolic contents. With the use of refrigeration and modified atmosphere it was possible to attain postharvest storage life of 10 days for clone END 189, 15 days for clone END 157 and up to 25 days for clones CCP 76 and END 183. It was found that 5ºC was not an adequate

  15. Kinyua 183-194.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    00800, Nairobi, Kenya. 1The Food and ... 2CABI-Bioscience - Africa Regional Centre, P. O. Box 633, Village Market, Nairobi, Kenya ... cultural and morphological examinations, and restricted fragment length polymorphism and taxon-specific PCR.

  16. Is Office-Based Surgery Safe? Comparing Outcomes of 183,914 Aesthetic Surgical Procedures Across Different Types of Accredited Facilities.

    Science.gov (United States)

    Gupta, Varun; Parikh, Rikesh; Nguyen, Lyly; Afshari, Ashkan; Shack, R Bruce; Grotting, James C; Higdon, K Kye

    2017-02-01

    There has been a dramatic rise in office-based surgery. However, due to wide variations in regulatory standards, the safety of office-based aesthetic surgery has been questioned. This study compares complication rates of cosmetic surgery performed at office-based surgical suites (OBSS) to ambulatory surgery centers (ASCs) and hospitals. A prospective cohort of patients undergoing cosmetic surgery between 2008 and 2013 were identified from the CosmetAssure database (Birmingham, AL). Patients were grouped by type of accredited facility where the surgery was performed: OBSS, ASC, or hospital. The primary outcome was the incidence of major complication(s) requiring emergency room visit, hospital admission, or reoperation within 30 days postoperatively. Potential risk factors including age, gender, body mass index (BMI), smoking, diabetes, type of procedure, and combined procedures were reviewed. Of the 129,007 patients (183,914 procedures) in the dataset, the majority underwent the procedure at ASCs (57.4%), followed by hospitals (26.7%) and OBSS (15.9%). Patients operated in OBSS were less likely to undergo combined procedures (30.3%) compared to ASCs (31.8%) and hospitals (35.3%, P risk of developing a complication in an OBSS compared to an ASC (RR 0.67, 95% CI 0.59-0.77, P cosmetic procedures. Plastic surgeons should continue to triage their patients carefully based on other significant comorbidities that were not measured in this present study. LEVEL OF EVIDENCE 3. © 2016 The American Society for Aesthetic Plastic Surgery, Inc. Reprints and permission: journals.permissions@oup.com.

  17. A 1.83 μJ/Classification, 8-Channel, Patient-Specific Epileptic Seizure Classification SoC Using a Non-Linear Support Vector Machine.

    Science.gov (United States)

    Bin Altaf, Muhammad Awais; Yoo, Jerald

    2016-02-01

    A non-linear support vector machine (NLSVM) seizure classification SoC with 8-channel EEG data acquisition and storage for epileptic patients is presented. The proposed SoC is the first work in literature that integrates a feature extraction (FE) engine, patient specific hardware-efficient NLSVM classification engine, 96 KB SRAM for EEG data storage and low-noise, high dynamic range readout circuits. To achieve on-chip integration of the NLSVM classification engine with minimum area and energy consumption, the FE engine utilizes time division multiplexing (TDM)-BPF architecture. The implemented log-linear Gaussian basis function (LL-GBF) NLSVM classifier exploits the linearization to achieve energy consumption of 0.39 μ J/operation and reduces the area by 28.2% compared to conventional GBF implementation. The readout circuits incorporate a chopper-stabilized DC servo loop to minimize the noise level elevation and achieve noise RTI of 0.81 μ Vrms for 0.5-100 Hz bandwidth with an NEF of 4.0. The 5 × 5 mm (2) SoC is implemented in a 0.18 μm 1P6M CMOS process consuming 1.83 μ J/classification for 8-channel operation. SoC verification has been done with the Children's Hospital Boston-MIT EEG database, as well as with a specific rapid eye-blink pattern detection test, which results in an average detection rate, average false alarm rate and latency of 95.1%, 0.94% (0.27 false alarms/hour) and 2 s, respectively.

  18. Geological interpretation of volcanism and segmentation of the Mariana back-arc spreading center between 12.7°N and 18.3°N

    Science.gov (United States)

    Anderson, Melissa O.; Chadwick, William W.; Hannington, Mark D.; Merle, Susan G.; Resing, Joseph A.; Baker, Edward T.; Butterfield, David A.; Walker, Sharon L.; Augustin, Nico

    2017-06-01

    The relationships between tectonic processes, magmatism, and hydrothermal venting along ˜600 km of the slow-spreading Mariana back-arc between 12.7°N and 18.3°N reveal a number of similarities and differences compared to slow-spreading mid-ocean ridges. Analysis of the volcanic geomorphology and structure highlights the complexity of the back-arc spreading center. Here, ridge segmentation is controlled by large-scale basement structures that appear to predate back-arc rifting. These structures also control the orientation of the chains of cross-arc volcanoes that characterize this region. Segment-scale faulting is oriented perpendicular to the spreading direction, allowing precise spreading directions to be determined. Four morphologically distinct segment types are identified: dominantly magmatic segments (Type I); magmatic segments currently undergoing tectonic extension (Type II); dominantly tectonic segments (Type III); and tectonic segments currently undergoing magmatic extension (Type IV). Variations in axial morphology (including eruption styles, neovolcanic eruption volumes, and faulting) reflect magma supply, which is locally enhanced by cross-arc volcanism associated with N-S compression along the 16.5°N and 17.0°N segments. In contrast, cross-arc seismicity is associated with N-S extension and increased faulting along the 14.5°N segment, with structures that are interpreted to be oceanic core complexes—the first with high-resolution bathymetry described in an active back-arc basin. Hydrothermal venting associated with recent magmatism has been discovered along all segment types.

  19. Significance of fragmented QRS complexes for identifying culprit lesions in patients with non-ST-elevation myocardial infarction: a single-center, retrospective analysis of 183 cases

    Directory of Open Access Journals (Sweden)

    Guo Rong

    2012-06-01

    Full Text Available Abstract Background Fragmented QRS (fQRS complexes are novel electrocardiographic signals, which reflect myocardial conduction delays in patients with coronary artery disease (CAD. The importance of fQRS complexes in identifying culprit vessels was evaluated in this retrospective study. Methods A 12-lead surface electrocardiogram was obtained in 183 patients who had non-ST-elevation myocardial infarction (NSTEMI and subsequently underwent coronary angiography (CAG. On the basis of the frequency of fQRS complexes, indices such as sensitivity, specificity, positive and negative predictive values, and likelihood ratio were evaluated to determine the ability of fQRS complexes to identify the culprit vessels. Results Among the patients studied, elderly patients (age ≥ 65 years and those with diabetes had a significantly higher frequency of fQRS complexes (p = 0.005, p = 0.003, respectively. The fQRS complexes recorded in the 4 precordial leads had the highest specificity (81.8% for indentifying the culprit vessel (left anterior descending artery. However, the specificity of fQRS complexes to identify lesions in the left circumflex and right coronary arteries was lower for the inferior and lateral leads than for the limb leads (65.5% versus 71.7%; however, the limb leads had higher sensitivity (92.3% versus 89.4%. And the total sensitivity and specificity of fQRS (77.1% and 71.5% were higher than those values for ischemic T-waves. Conclusions The frequency of fQRS complexes was higher in elderly and diabetic patients with NSTEMI. The frequency of fQRS complexes recorded in each of the ECG leads can be used to identify culprit vessels in patients with NSTEMI.

  20. Effects of dietary supplementation of coriander oil, in canola oil diets, on the metabolism of [1-(14)C] 18:3n-3 and [1-(14)C] 18:2n-6 in rainbow trout hepatocytes.

    Science.gov (United States)

    Randall, K M; Drew, M D; Øverland, M; Østbye, T-K; Bjerke, M; Vogt, G; Ruyter, B

    2013-09-01

    The aim of this study was to investigate the effects of petroselinic acid, found in coriander oil, on the ability of rainbow trout hepatocytes to increase the production of eicosapentaenoic acid (20:5n-3; EPA) and docosahexaenoic acid (22:6n-3; DHA) from [1-(14)C] α-linolenic acid (18:3n-3; ALA) and to reduce the production of arachidonic acid (20:4n-6; ARA) from [1-(14)C] 18:2n-6. Addition of coriander oil increased the production of 22:6n-3, from [1-(14)C] 18:3n-3, at the 0.5 and 1.0% inclusion levels and reduced the conversion of [1-(14)C] 18:2n-6 to 20:4n-6. β-Oxidation was significantly increased at the 1.5% inclusion level for [1-(14)C] 18:2n-6, however β-oxidation for [1-(14)C] 18:3n-3 only showed an increasing trend. Acetate, a main breakdown product of fatty acids (FA) via peroxisomal β-oxidation, decreased three-fold for [1-(14)C] 18:2n-6 and nearly doubled for [1-(14)C] 18:3n-3 when coriander was added at a 1.5% inclusion level. Acyl coenzyme A oxidase (ACO) enzyme activity showed no significant differences between treatments. Relative gene expression of ∆6 desaturase decreased with addition of coriander oil compared to the control. The addition of petroselinic acid via coriander oil to vegetable oil (VO) based diets containing no fishmeal (FM) or fish oil (FO), significantly increased the production of anti-inflammatory precursor 22:6n-3 (P=0.011) and decreased pro-inflammatory precursor 20:4n-6 (P=0.023) in radiolabelled hepatocytes of rainbow trout. © 2013.

  1. Simultaneous substitution of Gly96 to Ala and Ala183 to Thr in 5-enolpyruvylshikimate-3-phosphate synthase gene of E. coli (k12) and transformation of rapeseed (Brassica napus L.) in order to make tolerance to glyphosate.

    Science.gov (United States)

    Kahrizi, Danial; Salmanian, Ali Hatef; Afshari, Afsoon; Moieni, Ahmad; Mousavi, Amir

    2007-01-01

    Glyphosate is a non-selective broad-spectrum herbicide that inhibits 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS). This is a key enzyme in the aromatic amino acid biosynthesis pathway of microorganisms and plants. The manipulation of bacterial EPSPS gene in order to reduce its affinity for glyphosate, followed by its transfer to plants is one of the most effective approaches for the production of glyphosate-tolerant plants. In this study, we chose to focus on amino acid residues glycine96 and alanine183 of the E. coli (k12) EPSPS enzyme. These two amino acids are important residues for glyphosate binding. We used site directed mutagenesis (SDM) to induce point mutations in the E. coli EPSPS gene, in order to convert glycine96 to alanine (Gly96Ala) and alanine183 to threonine (Ala183Thr). After confirming the mutation by sequencing, the altered EPSPS gene was transferred to rapeseed (Brassica napus L.) via Agrobacterium-mediated transformation. The transformed explants were screened in shoot induction medium containing 25 mg L-1 kanamycin. Glyphosate tolerance was assayed in putative transgenic plants. Statistical analysis of data showed that there was a significant difference between the transgenic and control plants. It was observed that transgenic plants were resistant to glyphosate at a concentration of 10 mM whereas the non-transformed control plants were unable to survive 1 mM glyphosate. The presence and copy numbers of the transgene were confirmed with PCR and Southern blotting analysis, respectively.

  2. Determination of the human cytochrome P450 monooxygenase catalyzing the enantioselective oxidation of 2,2',3,5',6-pentachlorobiphenyl (PCB 95) and 2,2',3,4,4',5',6-heptachlorobiphenyl (PCB 183).

    Science.gov (United States)

    Nagayoshi, Haruna; Kakimoto, Kensaku; Konishi, Yoshimasa; Kajimura, Keiji; Nakano, Takeshi

    2017-10-17

    2,2',3,5',6-Pentachlorobiphenyl (PCB 95) and 2,2',3,4,4',5',6-heptachlorobiphenyl (PCB 183) possess axial chirality and form the aS and aR enantiomers. The enantiomers of these congeners have been reported to accumulate in the human body enantioselectively via unknown mechanisms. In this study, we determined the cytochrome P450 (CYP) monooxygenase responsible for the enantioselective oxidization of PCB 95 and PCB 183, using a recombinant human CYP monooxygenase. We evaluated 13 CYP monooxygenases, namely CYP1A1, CYP1A2, CYP1B1, CYP2A6, CYP2B6, CYP2C8, CYP2C19, CYP2E1, CYP2J2, CYP3A4, CYP3A5, CYP4F2, and aromatase (CYP19), and revealed that CYP2A6 preferably oxidizes aS-PCB 95 enantioselectively; however, it did not oxidize PCB 183. The enantiomer composition was elevated from 0.5 (racemate) to 0.54. In addition, following incubation with CYP2A6, the enantiomer fraction (EF) of PCB 95 demonstrated a time-dependent increase.

  3. The Fatty Acid Profile Analysis of Cyperus laxus Used for Phytoremediation of Soils from Aged Oil Spill-Impacted Sites Revealed That This Is a C18:3 Plant Species.

    Directory of Open Access Journals (Sweden)

    Noemí Araceli Rivera Casado

    Full Text Available The effect of recalcitrant hydrocarbons on the fatty acid profile from leaf, basal corm, and roots of Cyperus laxus plants cultivated in greenhouse phytoremediation systems of soils from aged oil spill-impacted sites containing from 16 to 340 g/Kg total hydrocarbons (THC was assessed to investigate if this is a C18:3 species and if the hydrocarbon removal during the phytoremediation process has a relationship with the fatty acid profile of this plant. The fatty acid profile was specific to each vegetative organ and was strongly affected by the hydrocarbons level in the impacted sites. Leaf extracts of plants from uncontaminated soil produced palmitic acid (C16, octadecanoic acid (C18:0, unsaturated oleic acids (C18:1-C18:3, and unsaturated eichosanoic (C20:2-C20:3 acids with a noticeable absence of the unsaturated hexadecatrienoic acid (C16:3; this finding demonstrates, for the first time, that C. laxus is a C18:3 plant. In plants from the phytoremediation systems, the total fatty acid contents in the leaf and the corm were negatively affected by the hydrocarbons presence; however, the effect was positive in root. Interestingly, under contaminated conditions, unusual fatty acids such as odd numbered carbons (C15, C17, C21, and C23 and uncommon unsaturated chains (C20:3n6 and C20:4 were produced together with a remarkable quantity of C22:2 and C24:0 chains in the corm and the leaf. These results demonstrate that weathered hydrocarbons may drastically affect the lipidic composition of C. laxus at the fatty acid level, suggesting that this species adjusts the cover lipid composition in its vegetative organs, mainly in roots, in response to the weathered hydrocarbon presence and uptake during the phytoremediation process.

  4. The Fatty Acid Profile Analysis of Cyperus laxus Used for Phytoremediation of Soils from Aged Oil Spill-Impacted Sites Revealed That This Is a C18:3 Plant Species.

    Science.gov (United States)

    Rivera Casado, Noemí Araceli; Montes Horcasitas, María del Carmen; Rodríguez Vázquez, Refugio; Esparza García, Fernando José; Pérez Vargas, Josefina; Ariza Castolo, Armando; Ferrera-Cerrato, Ronald; Gómez Guzmán, Octavio; Calva Calva, Graciano

    2015-01-01

    The effect of recalcitrant hydrocarbons on the fatty acid profile from leaf, basal corm, and roots of Cyperus laxus plants cultivated in greenhouse phytoremediation systems of soils from aged oil spill-impacted sites containing from 16 to 340 g/Kg total hydrocarbons (THC) was assessed to investigate if this is a C18:3 species and if the hydrocarbon removal during the phytoremediation process has a relationship with the fatty acid profile of this plant. The fatty acid profile was specific to each vegetative organ and was strongly affected by the hydrocarbons level in the impacted sites. Leaf extracts of plants from uncontaminated soil produced palmitic acid (C16), octadecanoic acid (C18:0), unsaturated oleic acids (C18:1-C18:3), and unsaturated eichosanoic (C20:2-C20:3) acids with a noticeable absence of the unsaturated hexadecatrienoic acid (C16:3); this finding demonstrates, for the first time, that C. laxus is a C18:3 plant. In plants from the phytoremediation systems, the total fatty acid contents in the leaf and the corm were negatively affected by the hydrocarbons presence; however, the effect was positive in root. Interestingly, under contaminated conditions, unusual fatty acids such as odd numbered carbons (C15, C17, C21, and C23) and uncommon unsaturated chains (C20:3n6 and C20:4) were produced together with a remarkable quantity of C22:2 and C24:0 chains in the corm and the leaf. These results demonstrate that weathered hydrocarbons may drastically affect the lipidic composition of C. laxus at the fatty acid level, suggesting that this species adjusts the cover lipid composition in its vegetative organs, mainly in roots, in response to the weathered hydrocarbon presence and uptake during the phytoremediation process.

  5. Measurement of the Cross-Section for the Process $\\gamma\\gamma \\to p \\overline{p}$ at $\\sqrt{s}_{ee}$=183-189 GeV at LEP

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barillari, T.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Elfgren, E.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hauschildt, J.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Homer, R.J.; Horvath, D.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kormos, Laura L.; Kowalewski, Robert V.; Kramer, T.; Kress, T.; Krieger, P.; von Krogh, J.; Krop, D.; Kruger, K.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Rick, H.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trefzger, T.; Tricoli, A.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vachon, B.; Vollmer, C.F.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija

    2003-01-01

    The exclusive production of proton-antiproton pairs in the collisions of two quasi-real photons had been studied using data taken at sqrt(s)_ee=183 GeV and 189 GeV with the OPAL detector at LEP. Results are presented for Ppbar invariant masses, W, in the range 2.15 W< <3.95 GeV. The cross-section measurements are compared with previous data and with recent analytic calculations based on the quark-diquark model.

  6. Remaining Sites Verification Package for the 100-F-26:10, 1607-F3 Sanitary Sewer Pipelines (182-F, 183-F, and 151-F Sanitary Sewer Lines), Waste Site Reclassification Form 2007-028

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-12-03

    The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  7. Localization of the human RNA polymerase I transcription factor gene (UBTF) to the D17S183 locus on chromosome 17q21 and construction of a long-range restriction map of the region

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.A.; Black, D.M.; Griffiths, B.L.; Solomon, E. [Somatic Cell Genetics Lab., London (United Kingdom)

    1995-12-10

    Human upstream binding factor (hUBF) is a sequence-specific DNA-binding protein that is essential for the activation of human 18s and 28s rRNA gene transcription. We have isolated and localized the gene (UBTF) encoding hUBF to the D17S183 locus on chromosome 17q21 by analyzing a cosmid from the region and carrying out Southern analysis on a previously constructed chromosome 17 somatic cell hybrid mapping panel using a probe from the hUBF cDNA. Confirmation of its location at this region was obtained from the results of pulsed-field gel electrophoresis analysis of genomic DNA using the hUBF cDNA and other probes from the region. These data also enabled the construction of a long-range restriction map of the region. 13 refs., 2 figs., 1 tab.

  8. Food sources of total omega 3 fatty acids (18:3 + 20:5 + 22:6), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of total omega 3 fatty acids (18:3 + 20:5 + 22:6), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  9. [Determination of trans fatty acid C18:1, C18:2 and C18:3 isomers in milk fat by silver ion solid phase extraction-gas chromatography].

    Science.gov (United States)

    Rui, Li; Xu, Xiaomin; Li, Yali; Song, Guoliang; Han, Jianlong; Ren, Yiping

    2010-12-01

    A method for the determination of trans fatty acids C18:1, C18:2 and C18:3 in milk fat was developed by silver ion solid phase extraction-gas chromatography (Ag+ -SPE/GC). The fatty acid methyl esters derived from total milk fat were loaded onto an Ag+ -SPE cartridge, and then eluted with 9 mL of toluene-hexane (5:95, v/v), 8 mL of toluene-hexane (17:83, v/v), 6 mL of toluene-ethyl acetate (17:83, v/v) and 10 mL of toluene-ethyl acetate (30:70, v/v) in sequence. The fraction from each step was analyzed by GC. The average recoveries of trans fatty acids ranged from 88.4% to 107.2% with the relative standard deviations (RSDs) from 1.2% to 11.9% except trans linolenic acid with the recoveries from 69.9% to 101.0% and the RSDs from 11.0% to 18.1%. Comparing with the traditional methods, the developed approach can avoid the interference of cis and saturated fatty acids. The method was successfully applied to analyze dairy products. Satisfactory results were shown.

  10. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    www.ees.elsevier.com/afju www.sciencedirect.com. Pattern of presentation and management of patients with undescended testis at Kilimanjaro Christian Medical. Center, Tanzania. G. Afrika Gasana , K.A. Mteta. Kilimanjaro Christian Medical University College, P.O. Box 2240, Moshi, Tanzania. Received 19 February 2012; ...

  11. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    enhanced computed tomography (NCCT) and intravenous urography (IVU) performed in the same patient in the diagnosis of urolithiasis and ureteric obstruction. Subjects and methods: This is a retrospective review of radiological and clinical data of ...

  12. Coho Abundance - Linear Features [ds183

    Data.gov (United States)

    California Natural Resource Agency — The CalFish Abundance Database contains a comprehensive collection of anadromous fisheries abundance information. Beginning in 1998, the Pacific States Marine...

  13. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    Additionally workers in automobile industry, leather and apparel and petrochemical industries are associating with ..... registered cases. In Japan urothelial cell carcinoma was detected in. 92. 1%, squamous cell carcinoma in ..... The global burden of urinary bladder cancer. Scandinavian. Journal of Urology and Nephrology ...

  14. Experiment information: 183 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available 1f88A NP_001124527.1 The C-terminus region is not involved in the formation of these oligo...mers H2 receptors are present as oligomers and that the C-terminal region is not involved in the formation of these oligomers. 9202162

  15. 28 CFR 18.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... provisions of part D of the Crime Control Act; part B, subpart I of the Juvenile Justice Act; and sections 1403 and 1404 of the Victims of Crime Act. (b) Categorical grant recipient means a public or private... Omnibus Crime Control and Safe Streets Act of 1968, 42 U.S.C. 3701, et seq., as amended. (f) Juvenile...

  16. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    The aim of this review is to shed more light on the importance of recognizing the fairly common testosterone deficiency syndrome. (TDS), making the diagnosis and successfully treating patients in a holistic, practical approach. Physiologic or naturally occurring TDS is different from acquired TDS caused by androgen ...

  17. 183-IJBCS-Article-Dr Bulus Adzu

    African Journals Online (AJOL)

    RHUMSIKI

    diazepam (Sigma Chemical Co., USA) and sodium chloride (BDH, England) were used. Acute toxicity test. The acute toxicity potential of the extract was evaluated by determining the LD50 using Lorke's (1983) method. The extracts were administered at the doses of 10, 100,. 1000 and 2000mg/kg i.p. to four groups of mice.

  18. Coho Abundance - Linear Features [ds183

    Data.gov (United States)

    California Department of Resources — The CalFish Abundance Database contains a comprehensive collection of anadromous fisheries abundance information. Beginning in 1998, the Pacific States Marine...

  19. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    Abstract. Objectives: To compare the results of anastomotic versus augmentation urethroplasty (buccal mucosa graft. (BMG) onlay), as well as dorsal versus ventral BMG techniques. Methods: A retrospective audit of 69 patients who underwent urethroplasty at Eersteriver Hospital in Cape. Town, South Africa between ...

  20. 186 183 Potassium Bromate Content of Bread

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... nutritional quality of bread. This leads to degradation of vitamin A, B1, B2 , E and niacin. Results obtained from in-vivo and in-vitro mutagenic studies show that potassium bromate is a potential cancer initiator. In humans, acute intoxication of this substance leads to renal failure and loss of hearing (Sai et al., ...

  1. Publications | Page 183 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Energy-water nexus in the context of climate change in developing countries : experiences from Latin America, East and Southern Africa; synthesis report (open access). Decentralized renewable energy technologies can help address vulnerability, food security, health, education, and rural-urban migration and resettlement.

  2. 50 CFR 218.183 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... scan for approximately five seconds in as many small steps as possible across the field seen through... the marine observer shall search back across the sector with the naked eye. (vi) After sunset and... mammals. (vi) Navy aircraft participating in RDT&E activities at sea shall conduct and maintain...

  3. 50 CFR 18.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... as no large-scale mass-production industry results. Traditional native handicrafts include, but are... Native for purposes of this part. Authentic native articles of handicrafts and clothing means items made... fashioned in the exercise of traditional native handicrafts without the use of pantographs, multiple carvers...

  4. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    visual internal urethrotomy (n = 86), endoscopic cystolitholapaxy (n = 10), and rigid retrograde endoscopic realignment (n = 7) for posterior urethral injury. The main anaesthesia was caudal block in 472 patients and topical 2% xylocaine jelly with sedation in 86 patients. Conclusions: There is a steady increase in therapeutic ...

  5. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    On average follow-up of 13.5 months all patients were pain free and renal dynamic scan showed non-obstructed clearance. Conclusions: Robotic retrocaval ureter repair .... ureter with an S-shaped, fish hook, or shepherd's crook appearance as type I and a less angulated “sickle-shaped” ureteral deformity as type II [7].

  6. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    hypospadias in 2 (6.7%) and a hydrocele in 1 (3.3%). The UDT was detected by the parents in 13 cases. (43.3%), by the patient himself in 9 (30%) and by health care staff in 8 cases (26.7%). Only 10 parents. (33.3%) received advice from health care staff: 6 were advised for surgery and 4 were advised to await spontaneous ...

  7. 49 CFR 572.183 - Neck assembly.

    Science.gov (United States)

    2010-10-01

    ... assembly and the neck angle with respect to the pendulum shall be measured with potentiometers specified in... velocity of 3.4±0.1 m/s measured at the center of the pendulum accelerometer (Figure 22 as set forth in 49 CFR 572.33) at the time the pendulum makes contact with the decelerating mechanism. The velocity-time...

  8. Publications | Page 183 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Antiretroviral therapy to prevent HIV transmission in serodiscordant couples in China (2003-11) : a national observational cohort study (restricted access). The World Health Organization (WHO) has recommended that antiretroviral therapy be offered to all HIV-infected individuals with uninfected partners of the opposite sex ...

  9. Publications | Page 183 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fishers (Paraty, RJ) and fish manipulation time : a variable associated to the choice for consumption and sale (open access). When bones need to be removed from fish, especially when caring for children eating the fish, time is taken up to manipulate their food. The type of fish chosen by fishermen''s families is important ...

  10. A Rapid Method for Determination of the Main Conjugated Linoleic Acid Precursors (C18:2 n-6 and C18:3 n-3) in Forage by Capillary Zone Electrophoresis with Ultraviolet Detection Using Gas Chromatography with Flame Ionization Detection as a Comparative Method.

    Science.gov (United States)

    de Jesus Coelho Castro, Renata; Sobrinho, Fausto Souza; Sundfeld da Gama, Marco Antônio; Takabayashi Sato, Renata; Lavorato Lima, Larissa; Leal de Oliveira, Marcone Augusto

    2015-01-01

    A rapid method has been proposed for determination of the main conjugated linoleic acid precursors such as linoleic (C18:2 n-6) and linolenic (C18:3 n-3) acids in forages by capillary zone electrophoresis (CZE) with direct UV detection at 200 nm. Among the fatty acids found in forages, C18:2 n-6 and C18:3 n-3 have received particular attention due to their roles as precursors for the synthesis of conjugated linoleic acid, a class of health-enhancing compounds that is predominantly found in dairy products. The electrolyte background consisted of 12.0 mmol/L tetraborate buffer (pH 9.2) added to 12.0 mmol/L Brij 35®, 17% acetonitrile, and 33% methanol. Under the optimized conditions, the baseline separation of C18:2 n-6 and C18:3 n-3 was achieved within 4 min. The CZE-UV method was compared to GC with a flame ionization detector, which is the American Oil Chemists' Society (AOCS 996.06) official method for fatty acid analysis. The methods did not show any evidence of significant differences within 95% confidence interval (P>0.05). The CZE-UV method was successfully applied to the analysis of 80 genotypes of Brachiaria ruzizienses clones submitted to a genetic improvement program in agricultural research.

  11. 77 FR 28255 - Safety Zone; Upper Mississippi River, Mile 183.0 to 183.5

    Science.gov (United States)

    2012-05-14

    ... down bound crane barge striking the Merchants Bridge resulted in structural damage to the bridge... vicinity of the Merchants Bridge and extending the entire width of the river. This safety zone is needed to protect repair workers and vessels transiting the area on the Upper Mississippi River to complete bridge...

  12. Avaliação do simbiótico fermentado com Enterococcus faecium CRL 183 e Lactobacillus helveticus ssp jugurti 416, à base de extratos aquosos de soja e de yacon (Smallanthus sonchifolius) no controle do desenvolvimento do Diabetes Mellitus

    OpenAIRE

    Roselino, Mariana Nougalli [UNESP

    2012-01-01

    O presente trabalho avaliou os efeitos do simbiótico fermentado com Enterococcus faecium CRL 183 e Lactobacillus helveticus ssp jugurti 416, à base de extratos de soja e de yacon produzidos em ratos com Diabetes mellitus, cuja indução foi feita quimicamente pela administração intraperitoneal de estreptozotocina (50mg/kg de peso corporal). Os animais foram divididos em quatro grupos experimentais (n=10): I - animais não diabéticos que receberam somente ração (controle negativo); II - animais d...

  13. Combining results of two GC separations partly achieves determination of all cis and trans 16:1, 18:1, 18:2 and 18:3 except CLA isomers of milk fat as demonstrated using Ag-ion SPE fractionation.

    Science.gov (United States)

    Kramer, John K G; Hernandez, Marta; Cruz-Hernandez, Cristina; Kraft, Jana; Dugan, Michael E R

    2008-03-01

    Milk fat is a complex mixture of geometric and positional isomers of monounsaturated and polyunsaturated, including short-, long- and branch-chain fatty acids (FAs). There has been partial success to resolve this mixture of FAs using different GC temperature programs, or a combination of GC isothermal and temperature programs. To overcome the problem associated with overlapping isomers prior silver-ion separation was recommended. However, this procedure is time consuming and not practical for routine analysis. In addition, previous methods focused mainly on the trans and cis isomers of 18:1. The present method takes advantage of differences in the relative elution times between different types of FAs. The method involved analyzing each milk fat using the same highly polar 100-m capillary column and GC instrument, and conducting two separations using temperature programs that plateau at 175 and 150 degrees C. The relative shift among the geometric and positional isomers at these two temperature settings was enough to permit identification of most of the trans and cis 16:1, 18:1 and 20:1, the c/t-18:2 and the c/c/t-18:3 isomers found in milk fat. The identity of these FAs was confirmed by prior separation of the total fatty acid methyl esters (FAMEs) of milk fat using Ag(+)-SPE columns, and comparing the fractions to the total milk fat. The Ag(+)-SPE technique was modified to obtain pure saturated, trans- and cis-monounsaturated and diunsaturated FAMEs. By combining the results from these two separate GC analyses, knowing the elution order, it was possible to determine most of the geometric and positional isomers of 16:1, 18:1, 20:1, 18:2 and 18:3 without a prior silver-ion separation. Only few minor FAs could not be resolved, notable the conjugated linoleic acid isomers that still required the complimentary Ag(+)-HPLC separation. The two GC temperature programs have been successfully used to routinely analyze most FA isomers in total milk and beef fats in about 200

  14. 7 CFR 28.183 - Fees and costs; payment.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD CONTAINER... payment shall apply to services performed with respect to cotton produced outside the continental United...

  15. All projects related to | Page 183 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: SURVEYS, STATISTICAL ANALYSIS, POLICY MAKING, LOW INCOME GROUPS, SOCIAL PROBLEMS, TAXATION, HEALTH POLICY, DISEASES, MARKETING. Region: Argentina, Bolivia, Chile, Peru, United States. Program: Food, Environment, and Health. Total Funding: CA$ 251,500.00. The Impact of Price, Tax, ...

  16. MELCOR 1.8.3 assessment: CSE containment spray experiments

    Energy Technology Data Exchange (ETDEWEB)

    Kmetyk, L.N.

    1994-12-01

    MELCOR is a fully integrated, engineering-level computer code, being developed at Sandia National Laboratories for the USNRC, that models the entire spectrum of severe accident phenomena in a unified framework for both BWRs and PWRS. As part, of an ongoing assessment program, the MELCOR computer code has been used to analyze a series of containment spray tests performed in the Containment Systems Experiment (CSE) vessel to evaluate the performance of aqueous sprays as a means of decontaminating containment atmospheres. Basecase MELCOR results are compared with test data, and a number of sensitivity studies on input modelling parameters and options in both the spray package and the associated aerosol washout and atmosphere decontamination by sprays modelled in the radionuclide package have been done. Time-step and machine-dependency calculations were done to identify whether any numeric effects exist in these CSE assessment analyses. A significant time-step dependency due to an error in the spray package coding was identified and eliminated. A number of other code deficiencies and inconveniences also are noted.

  17. 19 CFR 122.183 - Denial of access.

    Science.gov (United States)

    2010-04-01

    ...) Destruction of an aircraft or aircraft facility (18 U.S.C. 32); (xiii) Murder; (xiv) Assault with intent to murder; (xv) Espionage; (xvi) Sedition; (xvii) Kidnapping or hostage taking; (xviii) Treason; (xix) Rape...

  18. 27 CFR 40.183 - Record of tobacco products.

    Science.gov (United States)

    2010-04-01

    ...) Transfer from other factories, (2) Release from customs custody, (3) Transfer from export warehouses, and (4) Transfer from foreign trade zone; (c) Received by return to bond; (d) Disclosed as an overage by inventory; (e) Removed subject to tax (itemize large cigars by sale price in accordance with § 40.22, except...

  19. Far East Asia | Page 183 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    For observers elsewhere in the world, the most striking feature of distance education (DE) in Asia is the mega-universities and mega-schools that have added many millions to the global tally of distance learners in recent decades. These are institutions such as China's radio and television universities (now called the Open ...

  20. Russian Basic Course: Dialogue Cartoon Guides, Lessons 1-83.

    Science.gov (United States)

    Defense Language Inst., Washington, DC.

    This booklet of cartoon guides contains 83 units of instructional materials prepared by the Defense Language Insitute for use in an intensive, conversational, Russian course. Included are cartoon guides to dialogues and dialogue recombinations which focus on social concerns and military matters. (RL)

  1. State Waste Discharge Permit application, 183-N Backwash Discharge Pond

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    As part of the Hanford Federal Facility Agreement and Consent Order negotiations (Ecology et al. 1994), the US Department of Energy, Richland Operations Office, the US Environmental Protection Agency, and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground on the Hanford Site which affect groundwater or have the potential to affect groundwater would be subject to permitting under the structure of Chapter 173--216 (or 173--218 where applicable) of the Washington Administrative Code, the State Waste Discharge Permit Program. As a result of this decision, the Washington State Department of Ecology and the US Department of Energy, Richland Operations Office entered into Consent Order No. DE91NM-177, (Ecology and DOE-RL 1991). The Consent Order No. DE91NM-177 requires a series of permitting activities for liquid effluent discharges. Liquid effluents on the Hanford Site have been classified as Phase I, Phase II, and Miscellaneous Streams. The Consent Order No. DE91NM-177 establishes milestones for State Waste Discharge Permit application submittals for all Phase I and Phase II streams, as well as the following 11 Miscellaneous Streams as identified in Table 4 of the Consent Order No. DE91NM-177.

  2. 33 CFR 183.25 - Display of markings.

    Science.gov (United States)

    2010-07-01

    ...; and (iv) The minimum space between the numbers shall be one stroke width. (3) The words in the line... persons capacity number and of a color contrasting with yellow. (4) All remaining words and numbers... height, but no larger than one-half the height of the persons capacity number. (5) All other words and...

  3. 46 CFR 183.324 - Dual voltage generators.

    Science.gov (United States)

    2010-10-01

    ... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS... neutral of a dual voltage system must be solidly connected at the switchboard's neutral bus; and (2) The neutral bus shall be connected to ground. (b) The neutral of a dual voltage system must be accessible for...

  4. MELCOR 1.8.3 assessment: CSE containment spray experiments

    International Nuclear Information System (INIS)

    Kmetyk, L.N.

    1994-12-01

    MELCOR is a fully integrated, engineering-level computer code, being developed at Sandia National Laboratories for the USNRC, that models the entire spectrum of severe accident phenomena in a unified framework for both BWRs and PWRS. As part, of an ongoing assessment program, the MELCOR computer code has been used to analyze a series of containment spray tests performed in the Containment Systems Experiment (CSE) vessel to evaluate the performance of aqueous sprays as a means of decontaminating containment atmospheres. Basecase MELCOR results are compared with test data, and a number of sensitivity studies on input modelling parameters and options in both the spray package and the associated aerosol washout and atmosphere decontamination by sprays modelled in the radionuclide package have been done. Time-step and machine-dependency calculations were done to identify whether any numeric effects exist in these CSE assessment analyses. A significant time-step dependency due to an error in the spray package coding was identified and eliminated. A number of other code deficiencies and inconveniences also are noted

  5. Publications | Page 183 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  6. Dicty_cDB: VHB183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QNPVAIADRSIKQDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiyli fiifllsfinnkinfq Translated Amino Acid sequence...QDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiyli fiifllsfinnkinfq Homology vs CSM-cDNA Score E Sequences pro

  7. Dicty_cDB: VHD183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence ---xmvxqxplkslelxhln*LLPXILHXKQXVNYXWMMVNXFKXMXXINXXSSNSMXXP XPX...rame A: ---xmvxqxplkslelxhln*LLPXILHXKQXVNYXWMMVNXFKXMXXINXXSSNSMXXP XPXSFAYKLQSTILNNNYNGTXXLIINSIQIXGSPSVXQ...pfsitiimvpxx*slilskyxxrhqfxksfvkw*pnqfi*ccf*fnsxx fxf Frame C: ---dgixxttkisrtxpfeliiaxxss

  8. 10 CFR 26.183 - Medical review officer.

    Science.gov (United States)

    2010-01-01

    ... services. The MRO shall be a physician holding either a Doctor of Medicine or Doctor of Osteopathy degree... in the field of medical review of Federally mandated drug tests. (b) Relationships. The MRO may be an... licensee testing facility for whom the MRO reviews drug test results. Additionally, the MRO may not derive...

  9. 183 Legal/Judicial Enforcement Approaches towards Prevention ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... This flaw could be attributed to non-functionality of the family court that was envisaged by the Act. The African charter on Human and people's Rights contains provisions on protection of child's rights to health and based on the fact that the provisions of this law have been signed into law in Nigeria under.

  10. Publications | Page 183 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Globalization, Labor Markets and Inequality in India. L'Inde s'est lancée dans un train de réformes au milieu des années ... Récupérer l'espoir. En octobre 2007, André Casault, professeur d'architecture à l'Université Laval, a invité deux collègues et une douzaine d'étudiants des cycles supérieurs à le rejoindre dans une.

  11. 76 FR 183 - NASA Advisory Council; Aeronautics Committee; Meeting

    Science.gov (United States)

    2011-01-03

    ... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice: (10-172)] NASA Advisory Council... the NASA Advisory Council. The meeting will be held for the purpose of soliciting from the aeronautics... 20546, (202) 358-0566, or [email protected]nasa.gov . SUPPLEMENTARY INFORMATION: The meeting will be open...

  12. 183 Legal/Judicial Enforcement Approaches towards Prevention ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Abstract. The issue of children living with HIV is a serious problem in Nigeria. This paper will assess the problem of children living /infected with HIV including the underlying reasons for increase in the number infected yearly. It is also going to discuss current measures to be employed by all the stakeholders ...

  13. China Report: Science and Technology, No. 209. China Addresses Environmental Issues -- 1/83

    Science.gov (United States)

    1983-10-12

    summarized or extracted. Unfamiliar names rendered phonetically or transliterated are enclosed in parentheses. Words or names preceded by a ques - tion mark...economic conditions and technical conditions, we must also consider ques - tions of fuel, raw materials, water, electricity, transportation and consumption...mix and easily produce photochemical smog under conditions of atmospheric temperature inver- sion, stationary wind and sufficient sunshine. Some

  14. 183 Analyse des précipitations annuelles à la station de Yaoundé ...

    African Journals Online (AJOL)

    NJAMI

    Mots-clés : Yaoundé, précipitations, saisons, sécheresse, El Niño. Abstract. Analysis of the annual rainfalls in the Yaounde station from 1895 to 2006. In the context of climate change, we propose for the Yaounde weather station, in the area of the classic equatorial climate, to study the behavior of interannual rainfalls.

  15. 33 CFR 183.435 - Conductors in circuits of 50 volts or more.

    Science.gov (United States)

    2010-07-01

    ... moisture resistant and flame retardant in Article 310, NFPA No. 70, National Electric Code; (2) A flexible cord type SO, STO, ST, SJO, SJT, or SJTO listed in Article 400, NFPA No. 70, National Electric Code; (3... HOMELAND SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Electrical Systems Manufacturer...

  16. Measurement of W-pair production in $e^{+}e^{-}$ collisions at 183 GeV

    CERN Document Server

    Barate, R.; Ghez, Philippe; Goy, C.; Jezequel, S.; Lees, J.P.; Martin, F.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Alemany, R.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Morawitz, P.; Pacheco, A.; Park, I.C.; Riu, I.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Becker, U.; Boix, G.; Cattaneo, M.; Ciulli, V.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Halley, A.W.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Leroy, O.; Loomis, C.; Maley, P.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Teubert, F.; Tomalin, I.R.; Tournefier, E.; Vreeswijk, M.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Dessagne, S.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Rensch, B.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.C.; Machefert, F.; Rouge, A.; Swynghedauw, M.; Tanaka, R.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Chalmers, M.; Curtis, L.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raeven, B.; Raine, C.; Smith, D.; Teixeira-Dias, P.; Thompson, A.S.; Ward, J.J.; Buchmuller, O.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Goodsir, S.; Marinelli, N.; Martin, E.B.; Nash, J.; Nowell, J.; Sciaba, A.; Sedgbeer, J.K.; Spagnolo, P.; Thomson, Evelyn J.; Williams, M.D.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Betteridge, A.P.; Bowdery, C.K.; Buck, P.G.; Colrain, P.; Crawford, G.; Ellis, G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Williams, M.; van Gemmeren, P.; Giehl, I.; Holldorfer, F.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Krocker, M.; Nurnberger, H.A.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Aubert, J.J.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Ealet, A.; Fouchez, D.; Motsch, F.; Payre, P.; Talby, M.; Thulasidas, M.; Tilquin, A.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Buescher, Volker; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, Ph.; Jacholkowska, A.; Kado, M.; Lefrancois, J.; Serin, L.; Veillet, J.J.; Videau, I.; de Vivie de Regie, J.B.; Zerwas, D.; Bagliesi, Giuseppe; Bettarini, S.; Boccali, T.; Bozzi, C.; Calderini, G.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P.S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sciaba, A.; Sguazzoni, G.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Chambers, J.T.; Coles, J.; Cowan, G.; Green, M.G.; Hutchcroft, D.E.; Jones, L.T.; Medcalf, T.; Strong, J.A.; Von Wimmersperg-Toeller, J.H.; Botterill, D.R.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Thompson, J.C.; Bloch-Devaux, Brigitte; Colas, P.; Fabbro, B.; Faif, G.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Przysiezniak, H.; Rander, J.; Renardy, J.F.; Rosowsky, A.; Trabelsi, A.; Tuchming, B.; Vallage, B.; Black, S.N.; Dann, J.H.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.L.; Combley, F.; Hodgson, P.N.; Kelly, M.S.; Lehto, M.H.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Foss, J.; Grupen, C.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Putz, J.; Rothberg, J.E.; Wasserbaech, S.; Williams, R.W.; Armstrong, S.R.; Charles, E.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Greening, T.C.; Hayes, O.J.; Hu, H.; Jin, S.; Mamier, G.; McNamara, P.A.; Nachtman, J.M.; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Vogt, M.; Walsh, J.; Wu, S.L.; Wu, X.; Zobernig, G.

    1999-01-01

    The production of W+W- pairs is analysed in a data sample collected by ALEPH at a mean centre-of-mass energy of 182.7 GeV, corresponding to an integrated luminosity of 57 pb-1. Cross sections are given for different topologies of W decays into leptons or hadrons. Under Standard Model assumptions for the W-pair production and decay, the W-pair cross section is measured to be 15.57+-0.62(stat.)+-0.29(syst.) pb. Using also the W-pair data samples collected by ALEPH at lower centre-of-mass energies, the decay branching ratio of the W boson into hadrons is measured to be B(W->hadrons)= 68.93+-1.21(stat.)+-0.51(syst.)%, allowing a determination of the CKM matrix element |Vcs|= 1.043 +- 0.058(stat.) +- 0.026(syst.). The agreement of the cross sections with the Standard Model prediction allows a limit to be set on the W decay rate to undetectable final states.

  17. : tous les projets | Page 183 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    De son indépendance acquise en 1960 jusqu'en 1999, la Côte d'Ivoire était l'un des pays les plus stables d'Afrique et connaissait un essor économique continu grâce à ses nombreuses richesses naturelles, agricoles en particulier. Date de début : 1 mars 2012. End Date: 17 juillet 2013. Sujet: RESEARCH CENTRES ...

  18. 77 FR 183 - Federal Acquisition Regulation; Preventing Abuse of Interagency Contracts

    Science.gov (United States)

    2012-01-03

    ... conduct market research for all acquisitions to ensure that the acquisition represents the best interests... Act, the use of a Federally Funded Research and Development Center (FFRDC), the nonsponsoring agency... Schedule orders and open market procurements. Business-case analysis. 1. Best Procurement Approach...

  19. and its Isotopic mm/Submillimeter Lines from Dark Cloud Lynds 183 ...

    Indian Academy of Sciences (India)

    2010-02-19

    Feb 19, 2010 ... Observations suggest steep north-south (direction with respect to the off- set position (0, 0)) temperature gradient in the cloud. These are likely to be caused by non-uniform, Inter Stellar Radiation Field (ISRF) illumina- tion due to the shadow of nearby L134 cloud complex. As the emission of radiation ...

  20. Numerical and Theoretical Considerations for the Design of the AVT-183 Diamond-Wing Experimental Investigations

    Science.gov (United States)

    Boelens, Okko J.; Luckring, James M.; Breitsamter, Christian; Hovelmann, Andreas; Knoth, Florian; Malloy, Donald J.; Deck, Sebatien

    2015-01-01

    A diamond-wing configuration has been developed to isolate and study blunt-leading edge vortex separation with both computations and experiments. The wing has been designed so that the results are relevant to a more complex Uninhabited Combat Air Vehicle concept known as SACCON. The numerical and theoretical development process for this diamond wing is presented, including a view toward planned wind tunnel experiments. This work was conducted under the NATO Science and Technology Organization, Applied Vehicle Technology panel. All information is in the public domain.

  1. 18 CFR 367.1830 - Account 183, Preliminary survey and investigation charges.

    Science.gov (United States)

    2010-04-01

    ... service company can furnish complete information as to the nature and the purpose of the survey, plans, or... HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005...

  2. 50 CFR 300.183 - Permit holder reporting and recordkeeping requirements.

    Science.gov (United States)

    2010-10-01

    ... inspect and copy, for any fish or fish products regulated under this subpart, any import and export... anyone responsible for importing, exporting, storing, packing, or selling fish or fish products regulated... biweekly report of entries for consumption, exports and re-exports of fish and fish products regulated...

  3. Sexospécificités | Page 183 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au moment où l'incarnation même de la lutte contre l'apartheid se bat pour sa vie dans un hôpital de Pretoria, l'ancien président du Centre de recherches pour le développement international (CRDI), organisme canadien, livre ses réflexions sur le partenariat établi par le Centre pour appuyer la démocratie en Afrique du ...

  4. Crystallographic and magnetic structure of the novel compound ErGe 1.83

    Science.gov (United States)

    Oleksyn, O.; Schobinger-Papamantellos, P.; Ritter, C.; de Groot, C. H.; Buschow, K. H. J.

    1997-02-01

    The crystal structure and the magnetic ordering of the novel orthorhombic compound ErGe 2-x has been studied by neutron powder diffraction and magnetic measurements. The crystal structure belongs to the DyGe 1.85-type (space group Cmc2 1)·ErGe 2-x ( x = 0.17 (2)) orders antiferromagnetically below TN = 6 K and displays a metamagnetic behaviour. The magnetic cell has the same size as the chemical unit cell ( q = 0 ). The magnetic space group is Cmc2 1 (Sh 36173). At T = 1.5 K the magnetic moments of the two erbium sites have the same ordered magnetic moment values of 7.63 (6) μB/Er and are antiferromagnetically coupled leading to an uniaxial structure along the a direction.

  5. National Ignition Facility subsystem design requirements target diagnostics subsystem SSDR 1.8.3

    International Nuclear Information System (INIS)

    Lee, D.

    1996-01-01

    This SSDR establishes the performance, design, development and test requirements for the Target Experimental System's Diagnostic, WBS 1.8. 3. This includes the individual diagnostic components, the Target Diagnostic Data Acquisition System (Target DAS), the diagnostic vacuum system, the timing/fiducial system, and the EMI protection system

  6. FCJ-183 iHootenanny: A Folk Archeology of Social Media

    Directory of Open Access Journals (Sweden)

    Henry Adam Svec

    2016-02-01

    Full Text Available This paper excavates two models of communication that can be found littered across the intertwining histories of folk revivalism and digital culture in the United States. First I examine the Hootenanny, initially a form of rent party made popular in New York City in the 1940s by the group the Almanac Singers, which constituted a complex site of convergence of a range interests, styles, media, and performance genres. Second, I explore how the utopian vision of a community joined in song has been taken up recently by ‘social music’ iPhone apps made by the developer Smule. I will ultimately consider how the mediation idealised by the Almanacs has trickled down to a narcissistic will-to-be-‘in touch’ in mainstream digital culture, making the Hootenanny a virtual path untaken in the history of mobile communication.

  7. Nam et al., Afr J Tradit Complement Altern Med. (2018) 15 (1): 183 ...

    African Journals Online (AJOL)

    2017-12-29

    , compared to that of 2- aminoethoxydiphenyl borate (2-APB, 100 µM), a known agonist of TRPV3. Conclusion: Our results suggest that PC and BC extracts have therapeutic potential to improve skin barrier abnormalities in ...

  8. Wang et al., Afr J Tradit Complement Altern Med. (2015) 12(3):183 ...

    African Journals Online (AJOL)

    USER

    polysaccharides has been used to treat liver cancer, colon cancer, lung cancer, and gastric cancer (Liu et al., 2001;Auyeung et al., 2009;Su et al.,. 2009;Auyeung et al., 2012;Law et al., 2012;Li et al., 2012). In present study, we examined the potential effects of Astragaloside III on breast cancer cell lines in vitro as well as ...

  9. A Study of the Impact of Simulated 183 GHZ Water Vapor Retrievals on Numerical Weather Prediction

    Science.gov (United States)

    1989-03-31

    llest resolvable scales as sugge.,ted by Hoffm:n (1988). I " REFERENCES Arnold , C.P., C.H. Dey and W.J. Bostelman, 1985: Results of an observing...System: January 1982-December 1985. Mon. Weather Rev., 113, 304-318. Dev, C., C.P. Arnold , and W. Bostelman, 1985: Design of a windsat observing system...World Climate Research Programme, WMO/TD-No. 100, WMO, Geneva, 86 pp. Wang, J.R., J.L. King, T.T. Wilheit, C. Szejwack, L.H. Gesell , R.A. Nieman, D.S

  10. Extrême-Orient | Page 183 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tim Unwin, UNESCO Chair in ICT4D and Professor of Geography, Royal Holloway, University of London. Read more about Strengthening Rural Livelihoods: The Impact of Information and Communication Technologies in Asia. Langue English. Strengthening Rural Livelihoods dresse un bilan utile et équilibré de l'influence ...

  11. 78 FR 60248 - Foreign-Trade Zone (FTZ) 183-Austin, Texas; Notification of Proposed Production Activity...

    Science.gov (United States)

    2013-10-01

    ... regulations. The facility is used for the machining, assembly, programming, testing, packaging, final stage...; standoffs; lock clamps; fans; input/output structural wall subassemblies; spring latch buttons; exhaust rub...

  12. The physical properties of Santowax 'R' for heat transfer calculations (AERE R/M 183 revised)

    International Nuclear Information System (INIS)

    Bowring, R.W.; Garton, D.A.; Kinneir, J.H.

    1961-03-01

    Values of the following physical properties of Santowax 'R' are presented in graphical and/or tabular form in both English and Metric units: Vapour Pressure, Specific heat, Enthalpy, Density, Dynamic viscosity, Kinematic viscosity, Thermal conductivity, Prandtl number, Surface tension, Latent heat of vaporisation, Critical properties, Gas solubilities. The data were obtained by new experimental measurements, by calculation or from the published literature. Wherever possible an estimate of the probable error is given. Conversion factors and Tables are also presented to facilitate the conversion of any of the properties to convenient units required for calculations. (author)

  13. SU-E-J-183: Quantification of Motion During Hypo-Fractionated Prostate Cancer Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Ravindranath, B; Zhang, P; Xiong, J; Mageras, G; Hunt, M [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)

    2015-06-15

    Purpose: To quantify patient motion during hypo-fractionated prostate cancer treatment as tracked by Calypso™ 4D localization system. Methods: 50 prostate cancer patients with implanted Calypso beacons underwent hypofractionated IMRT treatment. Typical fraction size was 5 with doses of 5–8 Gy/fraction. 213 traces from the 50 patients were analyzed to quantify the probability of motion vs time starting from beam-on. Couch corrections applied by therapists were undone to obtain the natural course of patient motion. The Calypso data was used to identify vector displacements greater than 2 mm from the starting position. The direction of this vector was classified into one of the 26 directions (combinations of L/R, A/P, S/I). The probability of motion >2mm was estimated by computing the fraction of traces that exceed the 2mm threshold at each time point. The violating motion points were also binned by direction in order to identify specific directions that were more prone to movement. Results: The overall probability of motion greater than 2 mm at 5 and 10 minutes from beam-on were 27 % and 50% respectively. The primary directions in which motion occurred were Posterior-Inferior (PI) and Inferior (I) with a probability of 8.5% and 4% at 5 minutes and 10% for both at 10 minutes. Motion was classified into the following bins: 0–2, 2–3, 3–4, 4–5, 5–6, 6–7, 7–8 and greater than 8 mm. It is observed that motion < 2mm decreases from the first 5 minutes to the next while the higher magnitude components increase with time. Conclusion: The probability of prostate motion increases with time. The trend seen in the PI and I directions can be attributed to physiological factors like bladder filling. This probability can be factored in for scheduling intrafraction imaging and used to compare dosimetric impact of VMAT vs. IMRT plans. This work is supported in part by Varian Medical Systems.

  14. 25 CFR 183.16 - What information must be included in the Tribe's annual report?

    Science.gov (United States)

    2010-04-01

    ... annual report must contain the following information: (a) An accounting of the expenditures of funds... Council and the Secretary; and (c) Sufficient documentation for us to determine that the Tribe has...

  15. 33 CFR 183.530 - Spud, pipe, and hose fitting configuration.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Spud, pipe, and hose fitting....530 Spud, pipe, and hose fitting configuration. Except when used for a tank fill line, each spud, pipe, or hose fitting used with hose clamps must have: (a) A bead; (b) A flare; or (c) A series of annular...

  16. Occurrence of cancer in a cohort of 183 persons with constitutional chromosome 7 abnormalities

    DEFF Research Database (Denmark)

    Hasle, H; Olsen, J H; Hansen, J

    1998-01-01

    with constitutional abnormalities involving chromosome 7, including 16 patients with Williams syndrome. By linkage to the Danish Cancer Registry, we found five persons with cancer, including one thyroid carcinoma, three carcinomas of the digestive tract, and one malignant melanoma. There were no cases of leukemia....... The overall risk of developing cancer was not increased....

  17. 26 CFR 1.183-2 - Activity not engaged in for profit defined.

    Science.gov (United States)

    2010-04-01

    ... since. The taxpayer recently began raising and racing thoroughbred horses. The losses from the taxpayer's dog and horse activities have increased in magnitude over the years, and he has not made a profit... retailing soft drinks, raises dogs and horses. He began raising a particular breed of dogs many years ago in...

  18. Interim status of closure/post-closure plan for 183-H solar evaporation basins

    International Nuclear Information System (INIS)

    1988-03-01

    This report describes a plan for decommissioning several solar evaporation basins on the Hanford reservation. The document describes procedures for sampling during decommissioning and a plan for certification of the resulting completed landfill. Additional plans deal with the training, security of the site, and post-closure monitoring

  19. sup 99m Tc-labeled monoclonal antibodies against granulocytes (BW 250/183) for the detection of appendicitis. sup 99m Tc-anti-Granulozyten-Antikoerper (BW 250/183) zum Nachweis der Appendizitis

    Energy Technology Data Exchange (ETDEWEB)

    Overbeck, B.; Briele, B.; Hotze, A.; Biersack, H.J. (Bonn Univ. (Germany). Klinik fuer Nuklearmedizin); Kania, U. (Bonn Univ. (Germany). Chirurgische Klinik); Vogel, J. (Bonn Univ. (Germany). Pathologisches Inst.); Lange, L.; Ott, G. (Evangelisches Krankenhaus, Bonn (Germany). Chirurgische Abt.)

    1992-02-01

    Scintigraphy with {sup 99m}Tc-labeled anti-granulocyte antibodies (AGAb) was performed in 50 patients with suspected appendicitis. Sequential and static imaging as well as SPECT of the pelvis and abdomen was performed 2 hp.i. In all patients the diagnosis was confirmed either histologically or by long-term follow-up. 13 patients had histologically proven acute appendicitis. In 11 patients the appendix scan had been positive and in 2 patients the scan had shown no significant tracer uptake in the right lower abdomen. The remaining 37 patients turned out not to have acute appendicitis. 29 out of these patients had negative and 3 had positive scan findings. In 5 patients the scan was equivocal. Out of these patients 2 had pathologic findings on the left side of the abdomen which turned out to be acute diverticulitis in one patient and acute peritonitis in the other. The remaining 3 patients with unclear scintigraphic findings had no acute appendicitis. Scintigraphy with AGAb is fast and easy to perform and thus superior to cell labeling methods for diagnosing acute appendicitis. Sensitivity for the diagnosis of acute appendicitis was 85% with a specifitiy of 91%. Chronic or scarred non-granulocytic appendicitis - in which there is often no definite indication for surgery - was negative in our study expect for two cases. (orig.).

  20. The 1984 Literacy Campaign in the People's Democratic Republic of Yemen. A Case Study. Notes, Comments...No. 183.

    Science.gov (United States)

    Fara, Mohammed Saeed; Fisher, Nigel

    In 1984, the People's Democratic Republic of Yemen undertook a nationwide literacy campaign, which mobilized the entire nation in an effort to reach an estimated 194,000 illiterate people, 77 percent of them women. The campaign plan demanded the full and active participation of formal school teachers and students at secondary level and above as…

  1. 34 CFR 403.183 - Under what circumstances may the Secretary waive the maintenance of effort requirement?

    Science.gov (United States)

    2010-07-01

    ... VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION PROGRAM What Financial Conditions Must Be Met by a State? § 403... following: (1) A natural disaster. (2) An unforeseen and precipitous decline in financial resources. (c) The...

  2. Insufficient intake of alpha-linolenic fatty acid (18:3n-3 during pregnancy and associated factors

    Directory of Open Access Journals (Sweden)

    Letícia Garcia VASCONCELOS

    Full Text Available ABSTRACT Objective: To analyze alpha-linolenic fatty acid intake in two cohorts of pregnant women, and to identify factors associated with alpha-linolenic acid intake. Methods: This is a cohort study involving pregnant women with low obstetric risk (N=353 in public health system from a municipality of São Paulo state, Brazil. In each trimester, two 24-hour food recalls were collected. Descriptive analyses of dietary lipid profiles were performed, followed by a multiple comparison test. According to the trimester of pregnancy, differences were assessed using the mean difference test. To evaluate the adequacy of linoleic fatty acid and alpha-linolenic acid intake, the adequate intake test was used. The association between alpha-linolenic acid intake adequacy and maternal characteristics was investigated using a binary logistic regression model. Results: Total lipids intake and the percentage contribution to dietary energy met recommended levels. One-third of the diets demonstrated a lower than daily recommended intake of alpha-linolenic acid. Overweight pregnant women were twice as likely to have inadequate alpha-linolenic acid intake. Pregnant women from a more disadvantaged socioeconomic situation had greater risks of inadequate intake. Conclusion: Over-intake of lipids is not problematic, but quality is an issue, with one third of the pregnant women and their fetuses exposed to adverse effects due to low intake of omega-3 fatty acids, indicating important nutritional vulnerability in this population.

  3. A human fecal contamination index for ranking impaired recreational watersusing the HF183 quantitative real-time PCR method

    Science.gov (United States)

    Human fecal pollution of surface water remains a public health concern worldwide. As a result, there is a growing interest in the application of human-associated fecal source identification quantitative real-time PCR (qPCR) technologies for recreational water quality risk managem...

  4. W pair production cross-section and W branching fractions in $e^+ e^-$ interactions at 183 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Bonivento, W; Boonekamp, M; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Branchini, P; Brenke, T; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crépé, S; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Duperrin, A; Durand, J D; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Ellert, M; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Fayot, J; Feindt, Michael; Ferrari, P; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Fichet, S; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Green, C; Grimm, H J; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Haider, S; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kersevan, Borut P; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krstic, J; Krumshtein, Z; Kubinec, P; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Lethuillier, M; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Malmgren, T G M; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Meroni, C; Meyer, W T; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moreau, X; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neufeld, N; Nicolaidou, R; Nielsen, B S; Nikolenko, M; Nomokonov, V P; Normand, Ainsley; Nygren, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Palka, H; Papadopoulou, T D

    1999-01-01

    The cross-section for the process $e^+e^-\\rightarrow W^+W^-$ has been measured with the data sample collected by DELPHI at an average centre-of-mass energy of 182.65 GeV and corresponding to an integrated luminosity of 53 pb$^{-1}$. Based on the 770 events selected as $WW$ candidates, the cross-section for the doubly resonant process $ \\sigma (e^+e^-\\rightarrow W^+W^-) = 15.86~{\\pm 0.69}~\\mbox{(stat)} ~\\pm 0.26~\\mbox{(syst)~pb} $ has been measured and found to be in good agreement with the Standard Model expectation. The branching fractions of the $W$ decay were also measured. From these a value of the CKM mixing matrix element $ |V_{cs}| = 0.985 \\pm 0.073~\\mbox{(stat)} \\pm 0.025 ~\\mbox{(syst)}$ was derived. Our previously published $WW$ cross-section measurements and the derived measurement of $m_W$ have been revised and updated with the present cross-section measurement to yield $ m_W = 80.49 \\pm 0.43 \\mbox{(stat)} \\pm 0.09 (\\mathrm{syst}) \\pm 0.03 (\\mathrm{LEP})~{\\mathrm GeV}/{\\it c}^2$.

  5. Measurement of the ZZ cross-section in $e^+ e^-$ interactions at 183-189 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Ajinenko, I.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, Dmitri Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Beilliere, P.; Belokopytov, Yu.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Bilenky, Mikhail S.; Bizouard, M.A.; Bloch, D.; Blom, H.M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bourdarios, C.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buran, T.; Buschmann, P.; Cabrera, S.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Chliapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Croix, J.; Cuevas Maestro, J.; Czellar, S.; D'Hondt, J.; Dalmau, J.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Dolbeau, J.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Gerdyukov, L.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Gouz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Gris, P.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hansen, J.; Harris, F.J.; Haug, S.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Huber, M.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Janik, R.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovanski, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Kluit, P.; Kokkinias, P.; Kostioukhine, V.; Kourkoumelis, C.; Kouznetsov, O.; Krammer, M.; Kriznic, E.; Krumstein, Z.; Kubinec, P.; Kurowska, J.; Kurvinen, K.; Lamsa, J.W.; Lane, D.W.; Laugier, J.P.; Lauhakangas, R.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leisos, A.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Loerstad, B.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Merle, E.; Meroni, C.; Meyer, W.T.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjoernmark, U.; Moa, T.; Moch, M.; Moller, Rasmus; Monig, Klaus; Monge, M.R.; Montenegro, J.; Moraes, D.; Morettini, P.; Morton, G.; Muller, U.; Muenich, K.; Mulders, M.; Mulet-Marquis, C.; Mundim, L.M.; Muresan, R.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Naraghi, F.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Neufeld, N.; Nicolaidou, R.; Nielsen, B.S.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.; Olshevski, A.G.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Pavel, T.; Pegoraro, M.; Peralta, L.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdniakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Rames, J.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinertsen, P.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salt, J.; Sampsonidis, D.; Sannino, M.; Savoy-Navarro, A.; Schwanda, C.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Y.; Segar, A.M.; Seibert, N.; Sekulin, R.; Sette, G.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnov, N.; Smirnova, O.; Smith, G.R.; Sokolov, A.; Solovianov, O.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanitzki, M.; Stevenson, K.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkatchev, L.G.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Transtromer, G.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Van den Boeck, W.; Van Doninck, Walter; Van Eldik, J.; Van Lysebetten, A.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zintchenko, A.; Zoller, P.; Zumerle, G.; Zupan, M.

    2001-01-01

    Measurements of on-shell $ZZ$ production are described, using data collected by DELPHI in 1997 and 1998, at centre-of-mass energies $\\sqrt s$ = 182.6 GeV and 188.6 GeV respectively. Results obtained in each of the final states $q \\bar{q} q \\bar{q}$, $\\mu^+ \\mu^- q \\bar{q}$, $e^+e^- q \\bar{q}$, $\

  6. Single Intermediate Vector Boson Production in $e^+ e^-$ collisions at $\\sqrt{s}$ = 183 and 189 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Ajinenko, I.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, Dmitri Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Bellunato, T.; Belokopytov, Yu.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Besson, N.; Bilenky, Mikhail S.; Bloch, D.; Blom, H.M.; Bol, L.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buschmann, P.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Chliapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Croix, J.; Crosetti, G.; Cuevas Maestro, J.; Czellar, S.; D'Hondt, J.; Dalmau, J.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Gouz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hansen, J.; Harris, F.J.; Haug, S.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Hertz, O.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovanski, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Kluit, P.; Kokkinias, P.; Kostioukhine, V.; Kourkoumelis, C.; Kouznetsov, O.; Krammer, M.; Kriznic, E.; Krumstein, Z.; Kubinec, P.; Kucharczyk, M.; Kurowska, J.; Lamsa, J.W.; Laugier, J.P.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leisos, A.; Leitner, R.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Merle, E.; Meroni, C.; Meyer, W.T.; Miagkov, A.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjoernmark, U.; Moa, T.; Moch, M.; Monig, Klaus; Monge, M.R.; Montenegro, J.; Moraes, D.; Morettini, P.; Morton, G.; Mueller, U.; Muenich, K.; Mulders, M.; Mundim, L.M.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Nemecek, S.; Neufeld, N.; Nicolaidou, R.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.; Olshevski, A.G.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Pavel, T.; Pegoraro, M.; Peralta, L.; Perepelitsa, V.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdniakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salmi, L.; Salt, J.; Sampsonidis, D.; Sannino, M.; Savoy-Navarro, A.; Schwanda, C.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Y.; Segar, A.M.; Sekulin, R.; Sette, G.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnov, N.; Smirnova, O.; Smith, G.R.; Sokolov, A.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Spiriti, E.; Stanescu, C.; Stanitzki, M.; Stevenson, K.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkatchev, L.G.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Van den Boeck, W.; Van Eldik, J.; Van Lysebetten, A.; Van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zintchenko, A.; Zoller, P.; Zumerle, G.; Zupan, M.; Krammer, Manfred

    2001-01-01

    The cross-sections for the production of single charged and neutral intermediate vector bosons were measured using integrated luminosities of 52~pb$^{-1}$ and 154~pb$^{-1}$ collected by the DELPHI experiment at centre-of-mass energies of 182.6~GeV and 188.6~GeV, respectively. The cross-sections for the reactions were determined in limited kinematic regions. The results found are in agreement with the Standard Model predictions for these channels.

  7. 99mTc-labeled monoclonal antibodies against granulocytes (BW 250/183) for the detection of appendicitis

    International Nuclear Information System (INIS)

    Overbeck, B.; Briele, B.; Hotze, A.; Biersack, H.J.; Kania, U.; Vogel, J.; Lange, L.; Ott, G.

    1992-01-01

    Scintigraphy with 99m Tc-labeled anti-granulocyte antibodies (AGAb) was performed in 50 patients with suspected appendicitis. Sequential and static imaging as well as SPECT of the pelvis and abdomen was performed 2 hp.i. In all patients the diagnosis was confirmed either histologically or by long-term follow-up. 13 patients had histologically proven acute appendicitis. In 11 patients the appendix scan had been positive and in 2 patients the scan had shown no significant tracer uptake in the right lower abdomen. The remaining 37 patients turned out not to have acute appendicitis. 29 out of these patients had negative and 3 had positive scan findings. In 5 patients the scan was equivocal. Out of these patients 2 had pathologic findings on the left side of the abdomen which turned out to be acute diverticulitis in one patient and acute peritonitis in the other. The remaining 3 patients with unclear scintigraphic findings had no acute appendicitis. Scintigraphy with AGAb is fast and easy to perform and thus superior to cell labeling methods for diagnosing acute appendicitis. Sensitivity for the diagnosis of acute appendicitis was 85% with a specifitiy of 91%. Chronic or scarred non-granulocytic appendicitis - in which there is often no definite indication for surgery - was negative in our study expect for two cases. (orig.) [de

  8. Nuclear levels of (183)W studied with (n, gamma) and ((d)over-right-arrow, p) reactions

    Czech Academy of Sciences Publication Activity Database

    Bondarenko, V.; Tomandl, Ivo; Honzátko, Jaroslav; Wirth, HF.; von Egidy, T.

    2011-01-01

    Roč. 856, č. 1 (2011), s. 1-45 ISSN 0375-9474 Institutional research plan: CEZ:AV0Z10480505 Keywords : NUCLEAR REACTIONS (182)W * E = thermal * measured E(gamma) Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.540, year: 2011

  9. Defense AT&L Magazine A Publication of the Defense Acquisition University. Volume 34, Number 2, DAU 183

    National Research Council Canada - National Science Library

    Turk, Wayne; Wynn, Michael W; Schaeffer, Mark D; Walsh, John; Kratz, Louise A; Ward, Dan; Brown, David; McVay, Tammi

    2005-01-01

    .... As the flagship publication of the Defense Acquisition University, Defense AT AND L also disseminates information on training and education, continuous learning, and e-Learning to those acquisition...

  10. 77 FR 8806 - Foreign-Trade Zone 183-Austin, TX; Application for Reorganization Under the Alternative Site...

    Science.gov (United States)

    2012-02-15

    ... sites for operators/users located within a grantee's ``service area'' in the context of the Board's... southeast Austin, some 5 miles northwest of the Austin Bergstrom International Airport; Site 9 (56.4 acres...)-- Ben White Business Park, South Industrial Drive/Business Center Drive, Austin; Site 11 (64.5 acres...

  11. Defense AT&L Magazine A Publication of the Defense Acquisition University. Volume 34, Number 2, DAU 183

    Science.gov (United States)

    2005-01-01

    possibilities across the spectrum of human existence are astounding, he noted. Kurzweil offered the example of genetics . It took 15 years to sequence...smaller than the diameter of a strand of hair. Soldiers wearing the suit would have the ability to blend into any envi- ronment, like a chameleon . The

  12. Identification and Protection of a Bat Colony in the 183-F Clearwell: Mitigation of Bat Habitat on the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    K. A. Gano, J. G. Lucas, C. T. Lindsey

    2009-01-06

    An ecological investigation was conducted to evaluate mitigation options for demolition of a retired facility that contained a maternity roost of approximately 2,000 Myotis yumanensis bats. The recommendation from the study was to leave the non-contaminated structure intact and fence the area.

  13. Forest pest conditions in the maritimes in 1992. Information report No. M-X-183E. Annual publication

    Energy Technology Data Exchange (ETDEWEB)

    Magasi, L.P.; Cormier, J.R.

    1993-01-01

    Review of the status of forest insects and diseases in the Maritimes Region in 1992, along with forecast conditions for 1993 when appropriate. Describes pests and problems of conifers, hardwoods, and high value areas such as nurseries, seed orchards, plantations, and Christmas tree areas and summarizes control operations against spruce budworm and Sirococcus shoot blight. A chapter on forest health monitoring brings together the various aspects of work dealing with changes in forest conditions. Forest insect monitoring systems, such as pheromones and light traps, are briefly described. A list of reports and publications relating to forest pest conditions is included.

  14. Comparing Presenting Clinical Features in 48 Children With Microscopic Polyangiitis to 183 Children Who Have Granulomatosis With Polyangiitis (Wegener's)

    DEFF Research Database (Denmark)

    Cabral, David A; Canter, Debra L; Muscal, Eyal

    2016-01-01

    OBJECTIVE: To uniquely classify children with microscopic polyangiitis (MPA), to describe their demographic characteristics, presenting clinical features, and initial treatments in comparison to patients with granulomatosis with polyangiitis (Wegener's) (GPA). METHODS: The European Medicines Agen...

  15. Dakwah STAIN Purwokerto KOMUNIKA ISSN: 1978-1261 Vol.3 No.2 Juli-Desember 2009 pp.167-183 GENDER DALAM KONSTRUKSI MEDIA

    Directory of Open Access Journals (Sweden)

    Hariyanto Hariyanto

    2015-03-01

    Full Text Available Gender issues, the image of the relation of men and women in the media product, located at the position concurrence. While the media products that represent a certain meaning and reality to be submitted by his creator (media workers. Not infrequently, sense of product made through the media has put the position of media products as part of social reality itself.On the other hand, the position of the meaning of media products into the medium for the legitimacy of a change in governance norms and values in society. In other words, the image of the relation of men and women in the media products that contain sexual harassment can be carried still values the old conservative and applicable to the community that Indonesia is very patriarchy

  16. Supplementation of linoleic acid (C18:2n-6) or α-linolenic acid (C18:3n-3) changes microbial agonist-induced oxylipid biosynthesis.

    Science.gov (United States)

    Ryman, V E; Packiriswamy, N; Norby, B; Schmidt, S E; Lock, A L; Sordillo, L M

    2017-03-01

    Oxylipids are derived from polyunsaturated fatty acids (PUFA) in cellular membranes and the relative abundance or balance may contribute to disease pathogenesis. Previous studies documented unique oxylipid profiles from cows with either coliform or Streptococcus uberis mastitis, suggesting that lipid mediator biosynthesis may be dependent on the type of microbial-derived agonist. Changing the fatty acid content of peripheral blood leukocytes also may be critical to the relative expression of oxylipid profiles and the outcome of bacterial infection. No information is available in dairy cows describing how changing cellular PUFA content will modify oxylipids in the context of a microbial agonist challenge. Therefore, the hypothesis for the current study was that PUFA supplementation would change bovine leukocyte fatty acid content and respective oxylipid profiles from ex vivo microbial agonist-challenged leukocytes. Fatty acid content of leukocytes and plasma was quantified in (1) samples from cows not supplemented with PUFA, (2) cows supplemented with linoleic acid (LnA), and (3) cows supplemented with α-linolenic acid (ALA). Plasma oxylipids were assessed after S. uberis or lipopolysaccharide exposure and was compared with unstimulated oxylipid profiles. Fatty acid supplementation with ALA significantly increased ALA content of blood leukocytes and plasma relative to LnA. Fatty acid supplementation affected several S. uberis-induced oxylipids, but only S. uberis-induced 15-oxoETE was greater with ALA supplementation compared with LnA. Notably, only LPS-induced 5,6 LXA 4 was altered with fatty acid supplementation, but no significant effect of LnA vs. ALA treatment was identified. Future studies are needed to understand how leukocyte activation and membrane PUFA availability collectively contribute to differential oxylipid profiles. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  17. Measurement of the $e^{+}e^{-} \\to ZZ$ Production Cross Section at Centre-of-Mass Energies of 183 and 189 GeV

    CERN Document Server

    Barate, R.; Ghez, Philippe; Goy, C.; Jezequel, S.; Lees, J.P.; Martin, F.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Alemany, R.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Morawitz, P.; Pacheco, A.; Riu, I.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Boix, G.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Ciulli, V.; Davies, G.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Greening, T.C.; Halley, A.W.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Leroy, O.; Maley, P.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tournefier, E.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Dessagne, S.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Rensch, B.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.C.; Machefert, F.; Rouge, A.; Swynghedauw, M.; Tanaka, R.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Corden, M.; Georgiopoulos, C.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Chalmers, M.; Curtis, L.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raeven, B.; Raine, C.; Smith, D.; Teixeira-Dias, P.; Thompson, A.S.; Ward, J.J.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E.E.; Putzer, A.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Goodsir, S.; Marinelli, N.; Martin, E.B.; Nash, J.; Nowell, J.; Przysiezniak, H.; Sciaba, A.; Sedgbeer, J.K.; Thomson, Evelyn J.; Williams, M.D.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C.K.; Buck, P.G.; Ellis, G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Smizanska, M.; Williams, M.I.; Giehl, I.; Holldorfer, F.; Jakobs, K.; Kleinknecht, K.; Krocker, M.; Muller, A.S.; Nurnberger, H.A.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Aubert, J.J.; Bonissent, A.; Carr, J.; Coyle, P.; Ealet, A.; Fouchez, D.; Tilquin, A.; Aleppo, M.; Antonelli, M.; Gilardoni, Simone S.; Ragusa, F.; Buescher, Volker; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Kado, M.; Lefrancois, J.; Serin, L.; Veillet, J.J.; Videau, I.; de Vivie de Regie, J.B.; Zerwas, D.; Bagliesi, Giuseppe; Boccali, T.; Bozzi, C.; Calderini, G.; Dell'Orso, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Marrocchesi, P.S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Coles, J.; Cowan, G.; Green, M.G.; Hutchcroft, D.E.; Jones, L.T.; Medcalf, T.; Strong, J.A.; Botterill, D.R.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Thompson, J.C.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Fabbro, B.; Faif, G.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Rosowsky, A.; Seager, P.; Trabelsi, A.; Tuchming, B.; Vallage, B.; Black, S.N.; Dann, J.H.; Loomis, C.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Hodgson, P.N.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Hess, J.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Putz, J.; Rothberg, J.E.; Wasserbaech, S.; Williams, R.W.; Armstrong, S.R.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A.; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; von Wimmersperg-Toeller, J.H.; Wu, S.L.; Wu, X.; Zobernig, G.

    1999-01-01

    The e+e- -> ZZ cross section at sqrt(s)=182.7 and 188.6 GeV has been measured using the ALEPH detector. The analysis covers all of the visible ZZ final states and yields cross section measurements of sigma_ZZ(182.7 GeV) = 0.11 +- (0.16,0.11) (stat.) +- 0.04 (syst.) pb and sigma_ZZ(188.6 GeV) = 0.67 +- 0.13 (stat.) +- 0.04 (syst.) pb consistent with the Standard Model expectations.

  18. Multibeam collection for TN183: Multibeam data collected aboard Thomas G. Thompson from 2005-09-02 to 2005-10-04, Seattle, WA to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. SU-F-T-183: Design of a Beam Shaping Assembly of a Compact DD-Based Boron Neutron Capture Therapy System

    Energy Technology Data Exchange (ETDEWEB)

    Hsieh, M; Liu, Y; Nie, L [Purdue University, West Lafayette, Indiana (United States)

    2016-06-15

    Purpose: To design a beam shaping assembly (BSA) to shape the 2.45-MeV neutrons produced by a deuterium-deuterium (DD) neutron generator and to optimize the beam output for boron neutron capture therapy of brain tumors Methods: MCNP is used for this simulation study. The simulation model consists of a neutron surface source that resembles an actual DD source and is surrounded by a BSA. The neutron source emits 2.45-MeV neutrons isotropically. The BSA is composed of a moderator, reflector, collimator and filter. Various types of materials and geometries are tested for each component to optimize the neutron output. Neutron characteristics are measured with an 2×2×2-cm{sup 3} air-equivalent cylinder at the beam exit. The ideal BSA is determined by evaluating the in-air parameters, which include epithermal neutron per source neutron, fast neutron dose per epithermal neutron, and photon dose per epithermal neutron. The parameter values are compared to those recommended by the IAEA. Results: The ideal materials for reflector and thermal neutron filter were lead and cadmium, respectively. The thickness for reflector was 43 cm and for filter was 0.5 mm. At present, the best-performing moderator has 25 cm of AlF{sub 3} and 5 cm of MgF{sub 2}. This layout creates a neutron spectrum that has a peak at approximately 10 keV and produces 1.35E-4 epithermal neutrons per source neutron per cm{sup 2}. Additional neutron characteristics, fast neutrons per epithermal neutron and photon per epithermal neutron, are still under investigation. Conclusion: Working is ongoing to optimize the final layout of the BSA. The neutron spectrum at the beam exit window of the final configuration will have the maximum number of epithermal neutrons and limited photon and fast neutron contaminations within the recommended values by IAEA. Future studies will also include phantom experiments to validate the simulation results.

  20. How Kindergarten Entry Assessments Are Used in Public Schools and How They Correlate with Spring Assessments. Stated Briefly. REL 2017-183

    Science.gov (United States)

    Shields, Katherine A.; Cook, Kyle DeMeo; Greller, Sara

    2016-01-01

    This "Stated Briefly" report is a companion piece that summarizes the results of another report of the same name. Child development research on the importance of early experiences for later life outcomes has underscored the need for effective early childhood education. With the aim of providing high-quality education, many kindergarten…

  1. A Human Fecal Contamination Score for Ranking Recreational Sites using the HF183/BacR287 Quantitative Real-Time PCR Method

    Science.gov (United States)

    Human fecal pollution of recreational waters remains a public health concern worldwide. As a result, there is a growing interest in the application of human-associated fecal source identification quantitative real-time PCR (qPCR) technologies for water quality research and manag...

  2. A Cultural Resources Sample Survey in the Harlan County Lake Project Lands West of U.S. Highway 183 Harlan County, Nebraska

    Science.gov (United States)

    1988-01-01

    the river valley into the prairie. Corn and hogs appear to have been the focus of early farming activities. Wheat and milo ( sorghum ) also have become...2 piece hinged mold 3 piece hinged mold automatic bottling other Metal Cinder/Clinker Plastic Other Geological/Unmodifled Lithic Faunal Additional...rectangular 138 bottle bases made by the 3-piece hinge mold method, post 1860 (Moore 1983:78); 1 base has "B806" stamped on the kickup 2 shoulder fragments I

  3. Uranium and thorium occurrences in New Mexico: distribution, geology, production, and resources, with selected bibliography. Open-file report OF-183

    International Nuclear Information System (INIS)

    McLemore, V.T.

    1983-09-01

    Over 1300 uranium and thorium occurrences are found in over 100 formational units in all but two counties, in all 1- by 2-degree topographic quadrangles, and in all four geographic provinces in New Mexico. Uranium production in New Mexico has surpassed yearly production from all other states since 1956. Over 200 mines in 18 counties in New Mexico have produced 163,010 tons (147,880 metric tons) of U 3 O 8 from 1948 to 1982, 40% of the total uranium production in the United States. More than 99% of this production has come from sedimentary rocks in the San Juan Basin area in northwestern New Mexico; 96% has come from the Morrison Formation alone. All of the uranium reserves and the majority of the potential uranium resources in New Mexico are in the Grants uranium district. About 112,500 tons (102,058 metric tons) of $30 per pound of U 3 O 8 reserves are in the San Juan Basin, about 55% of the total $30 reserves in the United States. Thorium reserves and resources in New Mexico have not been adequately evaluated and are unknown. Over 1300 uranium and thorium occurrences are described in this report, about 400 of these have been examined in the field by the author. The occurrence descriptions include information on location, commodities, production, development, geology, and classification. Over 1000 citations are included in the bibliography and referenced in the occurrence descriptions. Production statistics for uranium mines that operated from 1948 to 1970 are also included. Mines that operated after 1970 are classified into production categories. 43 figures, 9 tables

  4. Poderemos viver juntos? http://dx.doi.org/10.15601/1983-7631/rt.v3n5p183-188

    Directory of Open Access Journals (Sweden)

    Adilson Schultz

    2011-04-01

    Full Text Available O sociólogo Alain Touraine abre uma instigante pergunta ao tratar da constituição do sujeito na sociedade contemporânea: Poderemos viver juntos? O título do livro é uma pergunta retórica à qual só pode ser dada uma resposta condicionada: poderemos sim, desde que... Ou então: não há outra saída – temos que viver juntos.  Tomado nesses termos, a pergunta de Touraine denuncia uma crise geral do sujeito na sociedade contemporânea, para além da crise ambiental, moral, trabalhista, econômica, etc, ou que qualquer uma de “nossas crises prediletas”, como diz Ignacy Sachs. Sua perspectiva mais bem se enquadra numa crise geral civilizacional, transcendendo condições socioculturais específicas. A pergunta Poderemos viver juntos? é global, e a resposta só pode ser geral

  5. Search for R-Parity Violating Decays of Supersymmetric Particles in $e^{+}e^{-}$ Collisions at Centre-of-Mass Energies near 183 GeV

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Przysiezniak, H; Alemany, R; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Park, I C; Riu, I; Colaleo, A; Creanza, D; De Palma, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Becker, U; Boix, G; Cattaneo, M; Cerutti, F; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Greening, T C; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Leroy, O; Loomis, C; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Spagnolo, P; Tejessy, W; Teubert, F; Tomalin, I R; Tournefier, E; Wright, A E; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Curtis, L; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Raine, C; Smith, D; Teixeira-Dias, P; Thompson, A S; Ward, J J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Nowell, J; Sciabà, A; Sedgbeer, J K; Thomson, E; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bowdery, C K; Buck, P G; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Smizanska, M; Williams, M I; Giehl, I; Hölldorfer, F; Jakobs, K; Kleinknecht, K; Kröcker, M; Müller, A S; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Motsch, F; Payre, P; Rousseau, D; Talby, M; Thulasidas, M; Tilquin, A; Aleppo, M; Antonelli, M; Ragusa, F; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Azzurri, P; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Kado, M; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Bagliesi, G; Bettarini, S; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sguazzoni, G; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Norton, P R; Thompson, J C; Bloch-Devaux, B; Colas, P; Fabbro, B; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Kelly, M S; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Grupen, Claus; Hess, J; Misiejuk, A; Prange, G; Sieler, U; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Zobernig, G

    2000-01-01

    Searches for pair-production of supersymmetric particles under the assumption that R-parity is violated via a single dominant $LL{\\bar E}$, $LQ{\\bar D}$ or ${\\bar U} {\\bar D} {\\bar D}$ coupling are performed using the data collected by the \\ALEPH\\ collaboration at centre-of-mass energies of 181--184~$\\gev$. The observed candidate events in the data are in agreement with the Standard Model expectations. Upper limits on the production cross-sections and lower limits on the masses of charginos, sleptons, squarks and sneutrinos are de rived.

  6. Immediately loaded mandibular fixed implant prostheses using the all-on-four protocol: a report of 183 consecutively treated patients with 1 year of function in definitive prostheses.

    Science.gov (United States)

    Galindo, Daniel F; Butura, Caesar C

    2012-01-01

    The purpose of this study was to evaluate a specific protocol using four implants to support immediately loaded fixed prostheses to restore edentulous and partially edentulous mandibles and report on the outcome after 1 year of function with the definitive prostheses. A retrospective study was conducted of all patients who were treated between June 2008 and December 2010 with fixed prostheses that were loaded immediately after placement of implants. The provisional prostheses were later replaced with computer-aided design/computer-assisted manufacture titanium frames supporting acrylic resin and denture teeth in the definitive prosthesis. All patients were followed for a minimum of 12 months and were assessed for implant survival and prosthetic performance, with descriptive statistics utilized to demonstrate results. One hundred eighty-three consecutive patients received immediately loaded axial and tilted implants according to the defined protocol. One implant failed, resulting in a 99.86% implant success rate. There were two catastrophic prosthetic failures (fracture of the titanium framework), for a 98.9% prosthetic success rate. Three patients (1.6%) presented with fracture of a prosthetic mandibular incisor tooth. No prosthetic screw loosening or fractures were seen. Radiographic evaluation revealed no major bone loss around dental implants. Based on this retrospective study, the following conclusions can be drawn: (1) this technique appears to provide a highly predictable implant performance; (2) it is necessary to critically evaluate framework design, especially around the connectors for cantilever extensions around the most distal implants; and (3) minor complications related to acrylic resin tooth fracture may be anticipated during the early phases of prosthetic treatment.

  7. Search for supersymmetry with R-parity violating LL.OVHBAR.E couplings at űs=183 GeV

    Czech Academy of Sciences Publication Activity Database

    Abreu, P.; Adam, W.; Adye, T.; Calvi, M.; Holt, P. J.; Mašík, Jiří; Němeček, Stanislav; Řídký, Jan; Vrba, Václav; Zumerle, G.

    2000-01-01

    Roč. 13, - (2000), s. 591-608 ISSN 1434-6044 R&D Projects: GA ČR GA202/99/1362 Institutional research plan: CEZ:AV0Z1010920 Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 5.408, year: 2000

  8. Effect of player substitutions on the intensity of second-half soccer match play. DOI:10.5007/1980-0037.2012v14n2p183

    Directory of Open Access Journals (Sweden)

    Daniel Barbosa Coelho

    2012-02-01

    Full Text Available Most soccer matches are conducted by coaches who usually make all player substitutions allowed. Therefore, it is extremely important to study these substitutions and their effects on the intensity of effort required from players. To date, no published studies have reported on this topic using heart rate (HR as an intensity parameter. The objective of this study was to compare effort intensity (EI of soccer players in the following situations: 1 first half (FH-EI; 2 second half (SH-EI; 3 second half with substitutions(SHS-EI. Forty-five male soccer players (18.5±1.2 years old, 74.25±5.79 kg, 182.6±8.55 cm, 9.56±2.47% body fat, 56.3±4.3 mLO2/kg/min were evaluated during 29 official games. EI was considered as the mean HR, expressed as the percentage of each player’s maximal HR (%HRmax and as the time spent in each intensity zone (Z according to %HRmax (Z1<70%; Z2 70-85%; Z3 85-90%; Z4 90-95%; Z5 95-100%. FH-EI (86.3±3.3%HRmax was higher than SH-EI (80.6±4.4%HRmax and SHS-EI (83.6±2.8%HRmax. SHS-EI was higher than SH-EI (p<0.05. Time spent in high-intensity zones was lower in SH-EI than in FH-EI, buthigher in SHS-EI when compared to SH-EI (p<0.05. It was concluded that the decrease in EI in the second half of soccer matches was attenuated by substitutions made at halftime, as evidenced by a longer time spent in high-intensity zones when compared to SH-EI.

  9. The Initial W-182/W-183 and Hf-182/Hf-180 of the Solar System and a Consistent Chronology with Pb-Pb Ages

    Science.gov (United States)

    Yin, Qingzhu; Jacobsen, Stein B.

    2003-01-01

    The utility of the Hf-182 (bar-tau ==13 x 10(exp 6) yr) -W-182 chronometer for early solar system processes is now well established. At the 2002 LPSC meeting we first reported new Hf-W data for chondritic meteorites showing that some crucial data as well as interpretations of Lee and Halliday for chondrites were incorrect. Our results were confirmed by reports of two other groups. This new data imply a much-shorter timescale for the early Solar System evolution and the formation of the Earth s core more consistent with the original conclusions of Harper and Jacobsen. Thus, the chondritic Hf-W evolution is now well established as beginning with epsilon(sub W)(0) = -3.45 +/- 0.25 at the time of origin of the solar system and evolving to -2.2 by 20 Myr and -1.9 +/- 0.20 at present. However, there are a number of iron meteorite data that suggest the existence of initial W lower than those measured for chondrites. If the low epsilon(sub W)(0) of -4 to -5 are correct then we face an embarrassing dilemma of differentiated iron meteorites being older than the primitive chondrites, or we would have to conclude that there is an additional pre-history of 5-10 Myr in primitive chondritic meteorites prior to the closure of the Hf-182 - W-182 system. Such a prolonged early time does not seem reasonable to us. We have therefore initiated a study to resolve this issue.

  10. Oxidative stability of structured lipids containing C18:0, C18:1, C18:2, C18:3 or CLA in sn 2-position - as bulk lipids and in milk drinks

    DEFF Research Database (Denmark)

    Timm Heinrich, Maike; Nielsen, Nina Skall; Xu, Xuebing

    2004-01-01

    In this study, we compared the oxidative stability of a specific structured lipid (SL) containing conjugated linoleic acid (CLA) in the sn2-position with SL containing other C18 fatty acids of different degree of unsaturation (stearic, oleic, linoleic or linolenic acid). SL was produced by enzyma......In this study, we compared the oxidative stability of a specific structured lipid (SL) containing conjugated linoleic acid (CLA) in the sn2-position with SL containing other C18 fatty acids of different degree of unsaturation (stearic, oleic, linoleic or linolenic acid). SL was produced...... by enzymatic interesterification with caprylic acid. Oxidative stability was compared in the five lipids themselves and in milk drinks containing 5% of the different SL. During storage, samples were taken for chemical and physical analyses. Moreover, sensory assessments were performed on milk drinks....... The oxidative stability of our SL was very different when comparing (a) bulk lipids and milk drink and (b) the five different batches of each product. SL based on oleic acid was the most unstable as bulk lipid, while SL based on linoleic acid was the most unstable in milk drink. SL based on CLA was the second...

  11. Can Latin American Oil Companies Free Themselves from the Legacy of Nationalization? (Can Latin American Oil and Gas Companies Break Free of Their Nationalized Past?) - CERI Studies No. 183

    International Nuclear Information System (INIS)

    Rousseau, Isabelle

    2012-01-01

    Latin America's national oil companies, created at various times during the twentieth century, have each evolved in a different way. The two main companies - Petroleos de Mexico (Pemex) and Petroleos de Venezuela (PDVSA) - provide excellent illustrations of the rich diversity of organizational and industrial development. Many factors - such as the importance of earth quakes - explain the diversity. Nevertheless, the role of governments during the period of nationalizations is key. It was then that the relationships between the owners of natural resources, public operators, regulators, the finance ministries, and international operators were defined. This process shaped the companies' institutional structures (path dependency) and set the parameters for future entrepreneurial dynamism. The path by which each of these enterprises developed continues to affect their culture as evidenced by the recent reforms which attempted to restructure Pemex and PDVSA. (author)

  12. Molecular Nickel Phosphide Carbonyl Nanoclusters: Synthesis, Structure, and Electrochemistry of [Ni11P(CO)18]3- and [H6-nNi31P4(CO)39]n- (n = 4 and 5).

    Science.gov (United States)

    Capacci, Chiara; Ciabatti, Iacopo; Femoni, Cristina; Iapalucci, Maria Carmela; Funaioli, Tiziana; Zacchini, Stefano; Zanotti, Valerio

    2018-02-05

    The reaction of [NEt 4 ] 2 [Ni 6 (CO) 12 ] in thf with 0.5 equiv of PCl 3 affords the monophosphide [Ni 11 P(CO) 18 ] 3- that in turn further reacts with PCl 3 resulting in the tetra-phosphide carbonyl cluster [HNi 31 P 4 (CO) 39 ] 5- . Alternatively, the latter can be obtained from the reaction of [NEt 4 ] 2 [Ni 6 (CO) 12 ] in thf with 0.8-0.9 equiv of PCl 3 . The [HNi 31 P 4 (CO) 39 ] 5- penta-anion is reversibly protonated by strong acids leading to the [H 2 Ni 31 P 4 (CO) 39 ] 4- tetra-anion, whereas deprotonation affords the [Ni 31 P 4 (CO) 39 ] 6- hexa-anion. The latter is reduced with Na/naphthalene yielding the [Ni 31 P 4 (CO) 39 ] 7- hepta-anion. In order to shed light on the polyhydride nature and redox behavior of these clusters, electrochemical and spectroelectrochemical studies were carried out on [Ni 11 P(CO) 18 ] 3- , [HNi 31 P 4 (CO) 39 ] 5- , and [H 2 Ni 31 P 4 (CO) 39 ] 4- . The reversible formation of the stable [Ni 11 P(CO) 18 ] 4- tetra-anion is demonstrated through the spectroelectrochemical investigation of [Ni 11 P(CO) 18 ] 3- . The redox changes of [HNi 31 P 4 (CO) 39 ] 5- show features of chemical reversibility and the vibrational spectra in the ν CO region of the nine redox states of the cluster [HNi 31 P 4 (CO) 39 ] n- (n = 3-11) are reported. The spectroelectrochemical investigation of [H 2 Ni 31 P 4 (CO) 39 ] 4- revealed the presence of three chemically reversible reduction processes, and the IR spectra of [H 2 Ni 31 P 4 (CO) 39 ] n- (n = 4-7) have been recorded. The different spectroelectrochemical behavior of [HNi 31 P 4 (CO) 39 ] 5- and [H 2 Ni 31 P 4 (CO) 39 ] 4- support their formulations as polyhydrides. Unfortunately, all the attempts to directly confirm their poly hydrido nature by 1 H NMR spectroscopy failed, as previously found for related large metal carbonyl clusters. Thus, the presence and number of hydride ligands have been based on the observed protonation/deprotonation reactions and the spectroelectrochemical experiments. The molecular structures of the new clusters have been determined by single-crystal X-ray analysis. These represent the first examples of structurally characterized molecular nickel carbonyl nanoclusters containing interstitial phosphide atoms.

  13. Oxidative stability of structured lipids containing C18:0, C18:1, C18:2, C18:3 or CLA in sn 2-position - as bulk lipids and in milk drinks

    DEFF Research Database (Denmark)

    Timm Heinrich, Maike; Nielsen, Nina Skall; Xu, Xuebing

    2004-01-01

    by enzymatic interesterification with caprylic acid. Oxidative stability was compared in the five lipids themselves and in milk drinks containing 5% of the different SL. During storage, samples were taken for chemical and physical analyses. Moreover, sensory assessments were performed on milk drinks....... The oxidative stability of our SL was very different when comparing (a) bulk lipids and milk drink and (b) the five different batches of each product. SL based on oleic acid was the most unstable as bulk lipid, while SL based on linoleic acid was the most unstable in milk drink. SL based on CLA was the second...

  14. Maximum mass ratio of am CVn-type binary systems and maximum white dwarf mass in ultra-compact x-ray binaries (addendum - Serb. Astron. J. No. 183 (2011, 63

    Directory of Open Access Journals (Sweden)

    Arbutina B.

    2012-01-01

    Full Text Available We recalculated the maximum white dwarf mass in ultra-compact X-ray binaries obtained in an earlier paper (Arbutina 2011, by taking the effects of super-Eddington accretion rate on the stability of mass transfer into account. It is found that, although the value formally remains the same (under the assumed approximations, for white dwarf masses M2 >~0.1MCh mass ratios are extremely low, implying that the result for Mmax is likely to have little if any practical relevance.

  15. 183. Evolución de la Insuficiencia Tricuspídea en Cirugía de Insuficiencia Mitral Grave Pura: Factores Predictores de Insuficiencia Tricuspídea Residual

    Directory of Open Access Journals (Sweden)

    M. Pérez Guillén

    2012-04-01

    Conclusiones: conforme a los resultados obtenidos del análisis univariado la reparación agresiva de la insuficiencia tricuspídea debería ser considerada en el periodo inicial de la cirugía mitral en pacientes con insuficiencia tricuspídea moderada, sobre todo en aquellos con AI dilatada o en ACXFA, estando indicado incluso cirugía de la fibrilación auricular.

  16. Os vários tons de uma guerra imaginada: duas visões femininas sobre a guerra colonial de Moçambique DOI - 10.5752/P.2358-3428.2014v18n35p183

    Directory of Open Access Journals (Sweden)

    Denise Borille de Abreu

    2014-10-01

    Full Text Available O presente artigo tem como objetivo comparar e contrastar a maneira imaginada como a protagonista moçambicana Minosse, do romance Ventos do Apocalipse, de Paulina Chiziane, e a portuguesa Eva Lopo, de A costa dos murmúrios, de Lídia Jorge, descrevem a nação moçambicana antes e depois da guerra colonial, e como elas narram o trauma vivenciado na guerra. A hipótese é que a guerra é imaginada por essas mulheres porque o trauma de guerra precisa ser simbolizado para ser processado. Sendo assim, é possível afirmar que escrever sobre o trauma de guerra parece trazer algum tipo de conforto para a mulher afetada pela violência.Palavras-chave: Literaturas de língua portuguesa. Escrita feminina. Escrita feminina de Guerra. Teoria do trauma. Life writing.

  17. Synthesis, Structure, and Photoluminescence of Color-Tunable and White-Light-Emitting Lanthanide Metal-Organic Open Frameworks Composed of AlMo6(OH)6O183-Polyanion and Nicotinate.

    Science.gov (United States)

    Ji, Huanyao; Li, Xiaomin; Xu, Donghua; Zhou, Yunshan; Zhang, Lijuan; Zuhra, Zareen; Yang, Shaowei

    2017-01-03

    A series of isostructural compounds Na(HL)(CH 3 COO)Ln(Al(OH) 6 Mo 6 O 18 )(H 2 O) 6 ·10H 2 O [L = nicotinate; Ln = Eu (1), Tb (2)] and Na(HL)(CH 3 COO)Eu m Tb n La 1-m-n (AlMo 6 (OH) 6 O 18 )(H 2 O) 6 ·10H 2 O (3-8, L = nicotinate), wherein Anderson-type polyanions AlMo 6 (OH) 6 O 18 3- as basic inorganic building blocks are connected by Eu(CH 3 COO)(HL)(H 2 O) 3 ] 2 4+ and [Na 2 (H 2 O) 8 ] 2+ cations, resulting in formation of three-dimensional lanthanide metal-organic open frameworks, were synthesized successfully with AlCl 3 ·6H 2 O, Na 2 MoO 4 ·2H 2 O, nicotinic acid, and lanthanide nitrates as starting materials. The compounds were characterized by UV-vis, IR, elemental analysis, powder XRD, and TG-DTA measurements. The single-crystal structures of compounds 1 and 2 show that the two compounds display three-dimensional open frameworks with 1D channels along the b and c axes. Investigation of the energy transfer mechanism indicated that the organic nicotinate ligand can transfer energy efficiently to Tb 3+ rather than Eu 3+ . The influence of the POM moiety on the fluorescence of the compounds is also studied. Compounds 1-8 exhibit tunable luminescence color, and emitting of white light was realized through adjusting the molar ratio of Eu:Tb:La within the compounds.

  18. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LDKYLVQKIAAGESIDRPCSILRELLDNSIDSGATKIEVFLEEGGIHKILIIDNGIG 60 ... Query: 124 EVENGIEKCFKKQPAINGTIVNVTKIFHNFPARKR...FLKQEPIETKMCLKVLEEKIITHPE 183 ... EVENGIEKCFKKQPAINGTIVNVTKIFHNFPARKRFLKQEPIETKMCLKVLEEKIITHPE Sbjct: 121 EVENGIE

  19. ORF Alignment: NC_003234 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 183 ... Query: 8 ... EVDLIDLCERNPELANSMVLGVSEHPYLSKKVLRKIPCALFTDNACNSKNIN...RIVTVNGT 67 ... EVDLIDLCERNPELANSMVLGVSEHPYLSKKVLRKIPCALFTDNACNSKNINRIVTVNGT Sbjct: 1 ... EVDLIDLCERNPE

  20. ORF Alignment: NC_005072 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EIAMNIAEQAIKDSWPKSLLLNLNIPPCERNKIKELS 183 ... LENVPSMAISVASFKWKNFEFAGEIAMNIAEQAIKDSWPKSLLLNLNIPPCER...NKIKELS Sbjct: 121 LENVPSMAISVASFKWKNFEFAGEIAMNIAEQAIKDSWPKSLLLNLNIPPCERNKIKELS 180

  1. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 124 XXXXQAKDQEIAKEYANGLPKQFDLILLGCGPDGHTCSLFPGHKLLEERDELISYISDSP 183 ... QAKDQEIAKEYANGLPK...QFDLILLGCGPDGHTCSLFPGHKLLEERDELISYISDSP Sbjct: 121 DLVDQAKDQEIAKEYANGLPKQFDLILLGCGPDGHTCSLFPGHKLLEERDELIS

  2. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LVKKETHLEVMAMVRPR 60 ... Query: 124 RAIDVVPDPLKALDELISLGFTRVLTSGQEPTAYEGADLIAKMVKRAKGRIEILPGGGIT 183 ... RAIDVVPDPLKALDELIS...LGFTRVLTSGQEPTAYEGADLIAKMVKRAKGRIEILPGGGIT Sbjct: 121 RAIDVVPDPLKALDELISLGFTRVLTSGQEPTAYEGADLIAKMVKRAKGRIEILPGGGIT 180 ...

  3. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ry: 128 VNXXXXXXXXXXXXKALLSAEQAELVAHGIASLIDGIWLRGTLNPQGIEADKARII 183 ... V...N ... KALLSAEQAELVAHGIASLIDGIWLRGTLNPQGIEADKARII Sbjct: 121 VNERRLLSHLRRELKALLSAEQAELVAHGIASLIDGIWLRGTLNPQGIEADKARII 176

  4. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NILGMPLIKSLDLPGGAGQHFFFDAGNGDCVAFFWFAD 60 ... Query: 147 ESPMQVSATVHPGVYVRSFYFQDPDGITLEFACWVKE 183 ... ESPM...QVSATVHPGVYVRSFYFQDPDGITLEFACWVKE Sbjct: 121 ESPMQVSATVHPGVYVRSFYFQDPDGITLEFACWVKE 157

  5. Master’s Students in History Could Benefit from a Greater Library Sensitivity and Commitment to Interdisciplinarity, and from More Efficient Document Delivery. A Review of: Sherriff, G. (2010. Information use in history research: A citation analysis of master’s level theses. Portal: Libraries and the Academy, 10 (2 165-183. doi: 10.1353/pla.0.0092.

    Directory of Open Access Journals (Sweden)

    R. Laval Hunsucker

    2011-09-01

    Full Text Available Objective – This study sought to determine the characteristics of research materials used by history students in preparing their master’s theses. Of which information resources formats did such students make use, and in what proportions? What was the age distribution of resources used? What was the dispersal over journal titles and over subject classification, i.e., the degree of interdisciplinarity? To what extent did the master’s students make use of non-English-language materials? To what extent did their institution’s library hold the resources in question?The investigator was especially interested in finding quantitative support for what he terms two “hypotheses.” The first of these is that historical research depends to a high degree on monographs, journal articles being far less important to it than they are to research in, especially, the natural sciences and technology. The second is that the age distribution of resources important to historical research is much flatter and longer than that of resources upon which researchers in the natural sciences and technology rely.Design – Citation analysis, supplemented with comprehensive catalogue searches.Setting – Southern Connecticut State University (SCSU, a mid-sized public university located in New Haven, Connecticut, U.S.A.Subjects – MA and MS theses (N=47 successfully submitted to the Department of History over the period from academic year 1998/1999 through academic year 2007/2008, inclusive.Methods – The investigator initially identified the theses through a search of the online catalogue (“Consuls” of the Connecticut State University system, and retrieved all of them in either electronic or hard-copy form. He then subjected all citations (N=3,498 listed in the references sections of these theses to an examination in order to identify for each cited resource the format, the age, the language, and, in the case of scholarly journal articles, the journal of publication. He carried out bibliographic searches in order to rectify any citations which he had noted to be faulty or incomplete. The study took no account of possible additional citations in footnotes or endnotes or in the text, and did not measure citation intensity (whether, for instance, a thesis referred only once, or perhaps many times, to a given resource. Duplicates “were ignored.” He furthermore performed systematic searches in Consuls and in the Library of Congress (LC online catalogue in order to establish, insofar as possible, into which assigned LC Classification class each resource fell, and whether it belonged to the holdings of the SCSU library. “Holdings,” as used here, includes physical resources owned, as well as those resources to which the library has licensed access. Not marked as either “held” or “not held” were: resources available online without restriction or charge, items not identified in either Consuls or the LC catalogue, and all government documents. Ages of cited resources were calculated based on the edition or version date actually given in a student’s citation, without any consideration of a possible earlier date of the original version of the publication or document concerned. Main Results – Format, age distribution, and journal frequency. The local citation analysis found that 53.2% of all cited resources were monographs, 7.8% were scholarly articles, 5.3% were contributed chapters in books, and 0.6% were dissertations or theses. Non-scholarly periodicals accounted for 15.7%, government documents for 6.7%, and freely available web documents for 4.1%. The remainder, approximately 6.5%, comprised archival papers, judicial documents, directories, interviews, posters, audiovisual materials, and 13 other formats. Cited resources, measured back from the date of acceptance of the citing thesis, ranged from 0 to 479 years old; the mode was 3 years, but the median was “25” (p. 170 or “26” (p. 177 years. Just over 70% (i.e., 2,500 cited resources were more than ten years old. Almost one thousand of the cited resources were fifty or more years old. The 274 scholarly journal articles included in the references sections were spread over 153 distinct journal titles, of which 105 titles made only one appearance, and 136 titles three or fewer appearances. The mean was 1.8 appearances.Subject dispersal and language. Of the 2,084 cited resources for which LC classification was locatable, 51.5% had a classification other than history, i.e., other than class C, D, E, or F. Nearly two thirds (66.0% of the cited scholarly journal articles had appeared in journals with a focus other than history. (Note: table 4 is incorrect, precisely reversing the actual ratio. Of all cited items, 98.5% were in the English language. Half (27 of the non-English-language resources cited were in Korean, all cited in the same thesis. Books (i.e., monographs plus compilations from which contributed chapters were cited accounted for 87.0% of foreign-language citations. More than four fifths of the examined theses (83.0% cited not a single non-English-language resource. Local holdings. Of all 3,498 cited items, 3,022 could be coded as either “held” or “not held” by the SCSU library. Of the items so coded (not, as indicated on p. 180, of all cited items, scarcely two fifths (41.0% belonged to the library’s holdings. The holdings percentage was highest (72.6% for the 274 scholarly journal articles cited, followed by the 186 contributed chapters (50.0%, the 550 non-scholarly periodical items (49.5%, and the 1,861 monographs (46.8%. For other cited formats, the percentage was much lower, and in some cases, e.g., for the 55 archival and the 44 judicial documents, it was 0.0%. Of the 54 foreign-language resources cited, the institution’s library held only two. Conclusion – The investigator concludes that his study’s findings do indeed lend quantitative support to his two “hypotheses.” This outcome will surprise few, if any, librarians; it is in accord with what Koenig (1978 long ago saw as a matter of “intuition” and “all conventional wisdom,” something that many subsequent studies have confirmed. Sherriff accordingly recommends, firstly, that collections which strive to support historical research should, in matters of acquisition policy and budget allocation, take serious account of that field’s relatively strong dependence on monographs. Secondly, the data on age distribution carry obvious implications for librarians’ decision-making on matters such as de-accessioning and weeding, relegation to remote storage, and retrospective acquisitions. This finding should also be considered, for instance, in connection with preservation policy and the maintaining of special collections. He even suggests that librarians “need to teach students the value of reviewing literature historically and showing them how to do so effectively” (p. 177.Sherriff considers a number of further (tentative conclusions to be warranted or suggested by the results of this study. First of all, that historical research is now characteristically an interdisciplinary matter, in the sense that it requires extensive access to information resources, including journals, which libraries have traditionally not classified as belonging to the discipline of history itself. For a library supporting such research, this phenomenon “has implications for matters including collection budgets, reference work, bibliographic instruction, and the location of collections and departmental libraries” (p. 168. It also means “that librarians working with history students and history collections need to be aware of the relevant resources in other disciplines. This can improve reference work, research assistance, and bibliographic instruction; it may also help the coordination of acquisitions across departmental lines” (p. 179. Secondly, one may conclude that “there is no ‘core’ collection of journals for history” (p. 178 which will be able to satisfy a large proportion of master’s students’ research needs. Thirdly, the fact that a library such as SCSU’s holds significantly less than half of what master’s students require for preparing their theses “may exercise a narrowing effect on students’ awareness of the existing literature on their topics” (p. 180, “increases the importance of departmental faculty, reference librarians, and subject specialist librarians drawing students’ attention to resources beyond the library’s catalogues and collections” (p. 180, and requires that the library give serious attention to effective document delivery arrangements. Finally, this study’s finding that only a small percentage of master’s students in history made use of non-English-language materials, but then in certain cases used them rather extensively (27 Korean items cited in one thesis, ten Italian in another, nine Spanish in yet another, suggests that acquisition, or at least proactive acquisition, of such materials needn’t be a priority, as long as, once again, the students concerned have easy access to efficient and affordable document delivery services. Sherriff does concede, however, that his finding could indicate “that students are unaware of relevant resources in other languages or are aware of them but lack the language skills necessary to use them” (p. 179.

  6. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  7. Implicações do novo modelo de administração pública na gestão das pessoas na prefeitura municipal de Uberlândia, MG http://dx.doi.org/10.15601/1983-7631/rt.v8n15p163-183

    Directory of Open Access Journals (Sweden)

    Walter Miquelanti Júnior

    2015-12-01

    Full Text Available O objetivo deste trabalho foi identificar e analisar implicações na gestão de pessoas na Prefeitura Municipal de Uberlândia (PMU, no que refere a Integração e Acolhimento, Treinamento e Desenvolvimento, Avaliação de Desempenho, Motivação e Gestão de Carreira. A coleta dos dados foi por meio de questionário respondido por 102 funcionários de sete secretarias. Para as análises foi utilizado a Escala de Likert. Os resultados indicaram que há a utilização de técnicas de gestão de pessoas no âmbito da administração pública para aumentar a produtividade de seus servidores. Contudo, existem problemas na gestão de pessoas, principalmente, no tocante ao Treinamento e Desenvolvimento. Palavras-chave: prefeitura de Uberlândia; gestão de pessoas; administração pública.  

  8. Excitation functions and yields for cyclotron production of radiorhenium via deuteron irradiation. {sup nat}W(d,xn){sup 181,182,(A+B),183,184(m+g),186g}Re nuclear reactions and tests on the production of {sup 186g}Re using enriched {sup 186}W

    Energy Technology Data Exchange (ETDEWEB)

    Manenti, Simone; Persico, Elisa; Bonardi, Mauro L.; Gini, Luigi; Groppi, Flavia [LASA, Univ. degli Studi di Milano, Segrate (Italy); INFN Milano (Italy); Abbas, Kamel; Holzwarth, Uwe; Simonelli, Federica [Institute for Health and Consumer Protection, IHCP, JRC-Ispra, Ispra (Italy)

    2014-10-01

    Excitation functions, thin- and thick-target yields for the {sup 181-186g}Re and {sup 187}W radionuclides were measured by the activation stacked-foil technique on natural tungsten foils for deuteron energies up to 18.0 MeV. These cross sections were validated by comparing the experimental results for thick-target yields with those calculated by integration of the thin-target yields. It was found that the maximum {sup 186g}Re content by irradiation of natural tungsten is about 55%, a higher value compared with the one found for proton beam, but not sufficient to use natural tungsten for medical purposes yet. Thus, in order to have a higher specific activity A{sub S} of {sup 186g}Re, the use of enriched {sup 186}W target is necessary. Therefore the irradiation of a thick target of enriched {sup 186}W by accelerated deuterons was studied and the results for the production of {sup 186g}Re were compared with those obtained from the irradiation of the same target by accelerated protons. It was found that the deuteron irradiation is preferable for three reasons: larger yield, less contamination by tantalum radioisotopes and smaller required amount of the target, which simplify the separation of the {sup 186g}Re from the target itself.

  9. 76 FR 2413 - Notice of Realty Action: Direct Sale of Public Land in Lawrence County, SD

    Science.gov (United States)

    2011-01-13

    ... Dakota, to Keith Sauls for the appraised fair market value of $183. DATES: Comments regarding the... proposes to sell this land to Keith Sauls for the appraised fair market value of $183. The public land is...

  10. ORF Alignment: NC_000868 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASVLNQKFKDFELIVVDDASTDNTPEVVESIEDGRIRYIR 60 ... Query: 124 VSQDGRILGKRLPKHRGDIYSHLLKENFIGSPTLLIRRECFKKAGLFDPRLSSSQDWDM...W 183 ... VSQDGRILGKRLPKHRGDIYSHLLKENFIGSPTLLIRRECFKKAGLFDPRLSSSQDWDM...W Sbjct: 121 VSQDGRILGKRLPKHRGDIYSHLLKENFIGSPTLLIRRECFKKAGLFDPRLSSSQDWDMW 180 ...

  11. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DPQGNATSGLGIEKSEIDQDIYNV Sbjct: 1 ... VISVANQKGGVGKTTTTINLAASIADRGYRVLIVDIDPQGNATSGLGIEKSEIDQDIYNV 60 ... Query: 124 IDCPPSLGQLSINAFTA...SDSILIPVQSEYYAMEGLSQLLNTIRLVQKHFNKDLGVEGVLL 183 ... IDCPPSLGQLSINAFTASDSILIPVQSE...YYAMEGLSQLLNTIRLVQKHFNKDLGVEGVLL Sbjct: 121 IDCPPSLGQLSINAFTASDSILIPVQSEYYAMEGLSQ

  12. 33 CFR Table 4 to Subpart H of... - Weights (Pounds) of Outboard Motor and Related Equipment for Various Boat Horsepower Ratings

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Weights (Pounds) of Outboard Motor and Related Equipment for Various Boat Horsepower Ratings 4 Table 4 to Subpart H of Part 183... or Less Pt. 183, Subpt. H, Table 4 Table 4 to Subpart H of Part 183—Weights (Pounds) of Outboard...

  13. 78 FR 18896 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Cod by Catcher Vessels Less Than 60...

    Science.gov (United States)

    2013-03-28

    ... Catcher Vessels Less Than 60 feet (18.3 meters) Length Overall Using Jig or Hook-and-Line Gear in the... less than 60 feet (18.3 meters (m)) length overall (LOA) using jig or hook-and-line gear in the... (18.3 m) LOA using jig or hook-and-line gear in the Bogoslof Pacific cod exemption area in the BSAI...

  14. The Ecology, Life History, and Phylogeny of the Marine Thecate Heterotrophic Dinoflagellates Protoperidinium and Diplopsalidaceae (Dinophyceae)

    Science.gov (United States)

    2006-09-01

    genero Protoperidinium Bergh, 1881 (Peridinium Ehrenberg, 183 1, Partim). Revista del Museo Argentino de Ciencias Naturales "Bernardino Rivadavia" e...Series 139: 1-3. BALECH, E. 1974. El genero Protoperidinium Bergh, 1881 (Peridinium Ehrenberg, 183 1, Partim). Revista del Museo Argentino de Ciencias...Journal of Phycology 14: 224-234. BALECH, E. 1974. El genero Protoperidinium Bergh, 1881 (Peridinium Ehrenberg, 183 1, Partim). Revista del Museo

  15. ORF Alignment: NC_006055 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Mesoplasma florum L1] ... Length = 183 ... Query: 5 ... QRCDWSSNAILNEYHDNEWSKITQNDDYIFELLILENMQAGLNWLTILLK...REEFKKAFDN 64 ... QRCDWSSNAILNEYHDNEWSKITQNDDYIFELLILENMQAGLNWLTILLKREEFKKAFDN Sbjct: 1 ... QRCDWSSNA...ILNEYHDNEWSKITQNDDYIFELLILENMQAGLNWLTILLKREEFKKAFDN 60 ... Query: 125 KQVINNWNSIDEVPAE

  16. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TVLIRRECFKKAGLFDPKLPSSQDWDM 183 ... VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM Sbjc...t: 121 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM 180 ... Query: 244 GL 245 ... GL Sbjct: 241 GL 242 ...TVSVIIPTHNRAKLLKRAIISVLNQTFEDFEIIVVDDASSDNTPNIIESIKDSRIRYIR 60 ... Query: 124 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSP

  17. ORF Alignment: NC_003076 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available iana ... Length = 144 ... Query: 40 ... ELFQGPNPTDKIVEDATTENLEEPDWDMNLEICDMINQETINSVELIRGIKKRIMMKQPR 99 ... ... ... ELFQGPNPTDKIVEDATTENLEEPDWDMNLEICDMINQETINSVELIRGIKKRIMMKQPR Sbjct: 1 ... E...LFQGPNPTDKIVEDATTENLEEPDWDMNLEICDMINQETINSVELIRGIKKRIMMKQPR 60 ... Query: 160 SELRYLPVFEETYKSLKARGIRFP 183 ... SELRYLPVFEETYKSLKARGIRFP Sbjct: 121 SELRYLPVFEETYKSLKARGIRFP 144

  18. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ase ... [Vibrio vulnificus CMCP6] ... Length = 153 ... Query: 124 DIHEGIEDTLVIFENRLKLHKLTTHYCSLPPIYCQPIALQQVWTNMISNALDAMP...EHGTL 183 ... DIHEGIEDTLVIFENRLKLHKLTTHYCSLPPIYCQPIALQQVWTNMISNALDAMP...EHGTL Sbjct: 1 ... DIHEGIEDTLVIFENRLKLHKLTTHYCSLPPIYCQPIALQQVWTNMISNALDAMPEHGTL 60 ... Query:

  19. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available C 43049] ... Length = 139 ... Query: 45 ... RQLVTTILSQNVADENTRRASEALFTAYSDFAAIESADHDELADTIRVAGLPDQKXXXXX 10...4 ... RQLVTTILSQNVADENTRRASEALFTAYSDFAAIESADHDELADTIRVAGLPDQK ... Sbjct: ...1 ... RQLVTTILSQNVADENTRRASEALFTAYSDFAAIESADHDELADTIRVAGLPDQKAARIQ 60 ... Query: 165 VERVSKRFGLVTESATNKR 183 ... VERVSKRFGLVTESATNKR Sbjct: 121 VERVSKRFGLVTESATNKR 139

  20. ORF Alignment: NC_004567 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QKGGVGKTTTSINLGASLVELGQKVLLIDTDAQGNATSGLGVQKSTIEREIYDV 60 ... Query: 124 XXCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQL...LNTIKLVQKHFNKQLRIEGVLL 183 ... CPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIK...LVQKHFNKQLRIEGVLL Sbjct: 121 IDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVQKHFNKQLRIEGVLL 180 ... Query: 244 ALAKEVLA 251 ... ALAKEVLA Sbjct: 241 ALAKEVLA 248

  1. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available eroides ... thetaiotaomicron VPI-5482] ... Length = 99 ... Query: 183 RIEEAIHYIRKHINETIDLRVLAENSCLSKDHFIR...LFKKETGDTPLKYINRKKIEKAQLI 242 ... RIEEAIHYIRKHINETIDLRVLAENSCLSKDHFIR...LFKKETGDTPLKYINRKKIEKAQLI Sbjct: 1 ... RIEEAIHYIRKHINETIDLRVLAENSCLSKDHFIRLFKKETGDTPLKYINRKKIEKAQLI 60 ...

  2. 76 FR 8892 - Removal of Expired Federal Aviation Administration Regulations and References

    Science.gov (United States)

    2011-02-16

    ... Regulations and References AGENCY: Federal Aviation Administration, DOT. ACTION: Final rule; technical... regulations by removing expired Special Federal Aviation Regulations (SFARs) and cross-references, as well as.... 91.146(b), 121.360, 135.153, 183.61(a)(1), 183.63, and corresponding references. The following tables...

  3. Movement and abundance of barbel, Barbus barbus, in a mesotrophic chalk stream in England

    Czech Academy of Sciences Publication Activity Database

    Vilizzi, L.; Copp, G. H.; Carter, M. G.; Peňáz, Milan

    2006-01-01

    Roč. 55, č. 2 (2006), s. 183-197 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : tagging * habitat fragmentation * log-linear analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.529, year: 2006 http://www.ivb.cz/folia/55/2/183-197.pdf

  4. Measurement of pH micro-heterogeneity in natural cheese matrices by fluorescence lifetime imaging

    Czech Academy of Sciences Publication Activity Database

    Burdikova, Z.; Svindrych, Z.; Pala, J.; Hickey, C. D.; Wilkinson, M. G.; Pánek, Jiří; Auty, M. A. E.; Periasamy, A.; Sheehan, J. J.

    2015-01-01

    Roč. 6, March (2015), 183_1-183_10 ISSN 1664-302X Institutional support: RVO:61389013 Keywords : cheese matrix * C-SNARF-4 * Oregon Green Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.165, year: 2015

  5. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 36; Issue 2. Issue front cover thumbnail. Volume 36, Issue 2. April 2013, pages 183-344. pp 183-188. Antimicrobial coatings — obtaining and characterization · Cornelia Guran Alexandra Pica Denisa Ficai Anton Ficai Cezar Comanescu · More Details Abstract Fulltext ...

  6. Evaluating Anti-SmD1-amino-acid 83-119 Peptide Reactivity in Children with Systemic Lupus Erythematosus and Other Immunological Diseases

    Directory of Open Access Journals (Sweden)

    Hai-Ou Yang

    2016-01-01

    Conclusions: Measurement of anti-SmD183-119in patients with cSLE has a higher sensitivity and a marginally lower specificity than anti-Sm. It has been suggested that inclusion of anti-SmD183-119testing in the integrated laboratory diagnosis of cSLE may significantly improve the overall sensitivity in child populations.

  7. Hepatitis B Virus Core Protein Phosphorylation Sites Affect Capsid Stability and Transient Exposure of the C-terminal Domain.

    Science.gov (United States)

    Selzer, Lisa; Kant, Ravi; Wang, Joseph C-Y; Bothner, Brian; Zlotnick, Adam

    2015-11-20

    Hepatitis B virus core protein has 183 amino acids divided into an assembly domain and an arginine-rich C-terminal domain (CTD) that regulates essential functions including genome packaging, reverse transcription, and intracellular trafficking. Here, we investigated the CTD in empty hepatitis B virus (HBV) T=4 capsids. We examined wild-type core protein (Cp183-WT) and a mutant core protein (Cp183-EEE), in which three CTD serines are replaced with glutamate to mimic phosphorylated protein. We found that Cp183-WT capsids were less stable than Cp183-EEE capsids. When we tested CTD sensitivity to trypsin, we detected two different populations of CTDs differentiated by their rate of trypsin cleavage. Interestingly, CTDs from Cp183-EEE capsids exhibited a much slower rate of proteolytic cleavage when compared with CTDs of Cp183-WT capsids. Cryo-electron microscopy studies of trypsin-digested capsids show that CTDs at five-fold symmetry vertices are most protected. We hypothesize that electrostatic interactions between glutamates and arginines in Cp183-EEE, particularly at five-fold, increase capsid stability and reduce CTD exposure. Our studies show that quasi-equivalent CTDs exhibit different rates of exposure and thus might perform distinct functions during the hepatitis B virus lifecycle. Our results demonstrate a structural role for CTD phosphorylation and indicate crosstalk between CTDs within a capsid particle. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  8. Integrated management of sustainable development and environmental protection along the Indian coasts

    Digital Repository Service at National Institute of Oceanography (India)

    Sawkar, K.

    stream_size 7 stream_content_type text/plain stream_name Proc_South_Asia_Workshop_Estuar_Model_CZM_!999_183.pdf.txt stream_source_info Proc_South_Asia_Workshop_Estuar_Model_CZM_!999_183.pdf.txt Content-Encoding ISO-8859-1 Content-Type...

  9. Application of FFT methods to wind wave data series by adding zeros

    Digital Repository Service at National Institute of Oceanography (India)

    Varkey, M.J.

    stream_size 4 stream_content_type text/plain stream_name Mahasagar_20_183.pdf.txt stream_source_info Mahasagar_20_183.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 183 of 183 ... Vol 8, No 1 (2003), The mathematical economics of the zerorisation principle of white petroleum products transportation in Nigeria, Abstract. KU Nnadi. Vol 17, No 1 (2012), The ... Vol 8, No 2 (2003), The place of finance in visual arts education in Nigeria, Abstract. Okujor Odey. Vol 11, No 1 (2006), The ...

  11. Rapid modification of the insect elicitor N-linolenoyl-glutamate via a lipoxygenase-mediated mechanism on Nicotiana attenuata leaves

    Directory of Open Access Journals (Sweden)

    VanDoorn Arjen

    2010-08-01

    Full Text Available Abstract Background Some plants distinguish mechanical wounding from herbivore attack by recognizing specific constituents of larval oral secretions (OS which are introduced into plant wounds during feeding. Fatty acid-amino acid conjugates (FACs are major constituents of Manduca sexta OS and strong elicitors of herbivore-induced defense responses in Nicotiana attenuata plants. Results The metabolism of one of the major FACs in M. sexta OS, N-linolenoyl-glutamic acid (18:3-Glu, was analyzed on N. attenuata wounded leaf surfaces. Between 50 to 70% of the 18:3-Glu in the OS or of synthetic 18:3-Glu were metabolized within 30 seconds of application to leaf wounds. This heat-labile process did not result in free α-linolenic acid (18:3 and glutamate but in the biogenesis of metabolites both more and less polar than 18:3-Glu. Identification of the major modified forms of this FAC showed that they corresponded to 13-hydroxy-18:3-Glu, 13-hydroperoxy-18:3-Glu and 13-oxo-13:2-Glu. The formation of these metabolites occurred on the wounded leaf surface and it was dependent on lipoxygenase (LOX activity; plants silenced in the expression of NaLOX2 and NaLOX3 genes showed more than 50% reduced rates of 18:3-Glu conversion and accumulated smaller amounts of the oxygenated derivatives compared to wild-type plants. Similar to 18:3-Glu, 13-oxo-13:2-Glu activated the enhanced accumulation of jasmonic acid (JA in N. attenuata leaves whereas 13-hydroxy-18:3-Glu did not. Moreover, compared to 18:3-Glu elicitation, 13-oxo-13:2-Glu induced the differential emission of two monoterpene volatiles (β-pinene and an unidentified monoterpene in irlox2 plants. Conclusions The metabolism of one of the major elicitors of herbivore-specific responses in N. attenuata plants, 18:3-Glu, results in the formation of oxidized forms of this FAC by a LOX-dependent mechanism. One of these derivatives, 13-oxo-13:2-Glu, is an active elicitor of JA biosynthesis and differential

  12. A 6U CubeSat Constellation for Atmospheric Temperature and Humidity Sounding

    OpenAIRE

    Padmanabhan, Sharmila; Brown, Shannon; Kangaslahti, Pekka; Cofield, Richard; Russell, Damon; Stachnik, Robert; Steinkraus, Joel; Lim, Boon

    2013-01-01

    We are currently developing a 118/183 GHz sensor that will enable observations of temperature and precipitation profiles over land and ocean. The 118/183 GHz system is well suited for a CubeSat deployment as ~10cm antenna aperture provides sufficiently small footprint sizes (~25km). This project will enable low cost, compact radiometer instrumentation at 118 and 183 GHz that would fit in a 6U CubeSat with the objective of mass-producing this design to enable a suite of small satellites to ima...

  13. Growth performance, blood profiles and carcass traits of Barbary partridge (Alectoris barbara) fed two different insect larvae meals (Tenebrio molitor and Hermetia illucens)

    Czech Academy of Sciences Publication Activity Database

    Loponte, R.; Nizza, S.; Bovera, F.; De Riu, N.; Fliegerová, Kateřina; Lombardi, P.; Vassalotti, G.; Mastellone, V.; Nizza, A.; Moniello, G.

    2017-01-01

    Roč. 115, č. 3 (2017), s. 183-188 ISSN 0034-5288 Institutional support: RVO:67985904 Keywords : Barbary partridge * Hermetia illucens * Tenebrio molitor Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.298, year: 2016

  14. Ein vermisster Großvater, ein Tango und ein Museum. Erinnern und Vergessen des Zweiten Weltkriegs und der Shoah in der ukrainischen Gegenwartsliteratur (Larysa Denysenko, Jurij Vynnyčuk, Oksana Zabužko)

    Czech Academy of Sciences Publication Activity Database

    Kratochvil, Alexander

    2015-01-01

    Roč. 60, č. 2 (2015), s. 164-183 ISSN 0044-3506 Institutional support: RVO:68378068 Keywords : contemporary ukrainian literature * 2nd world war * shoah * memory * trauma Subject RIV: AJ - Letters, Mass-media, Audiovision

  15. AMMI Analysis of Yields and Oil Content in Some Linseed (Linum ...

    African Journals Online (AJOL)

    environment interaction (GEI) among the varieties for ... environments. The AMMI selections for oil content and yield per environment included Kassa-2 in all ...... of varieties and environments in field pea (Pisum sativum L.). J. Genet. Breed. 54: 183-191.

  16. Patterns, causes and consequences of genome size variation in Restionaceae of the Cape flora

    Czech Academy of Sciences Publication Activity Database

    Linder, H. P.; Suda, Jan; Weiss-Schneeweiss, H.; Trávníček, Pavel; Bouchenak-Khelladi, Y.

    2017-01-01

    Roč. 183, č. 4 (2017), s. 515-531 ISSN 0024-4074 Institutional support: RVO:67985939 Keywords : chromosome numbers * dispersal * ecology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.277, year: 2016

  17. AFRREV IJAH: An International Journal of Arts and Humanities - Vol ...

    African Journals Online (AJOL)

    Effects of Self Esteem, Emotional Health and Social Competence on Romantic Relationship of Adolescents in Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AJ Ogunleye, 183-201 ...

  18. Experiment list: SRX122465 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 6 || chip antibody=Relb || treatment=LPS || time=120 min || chip antibody manufacturer 1=Bethyl || chip antibody catalog... number 1=A302-183A || chip antibody manufacturer 2=Santa Cruz || chip antibody catalog number 2

  19. An investigation of gene action on different traits of tobacco under ...

    African Journals Online (AJOL)

    enoh

    2012-03-13

    Nicotiana tabacum). Information Bulletin Coresta Congress japan. 183. SHoaei DM, Honarnejad R (2003). Gene effects and Combining ability of quantitative and qualitative characteristics of Burley Tobacco. Information Bulletin ...

  20. Indirect photometric detection of boron cluster anions electrophoretically separated in methanol

    Czech Academy of Sciences Publication Activity Database

    Vítová, Lada; Fojt, Lukáš; Vespalec, Radim

    2014-01-01

    Roč. 1338, APR 2014 (2014), s. 174-183 ISSN 0021-9673 Institutional support: RVO:68081707 Keywords : Boron cluster * Capillary electrophoresis * Indirect photometry Subject RIV: BO - Biophysics Impact factor: 4.169, year: 2014

  1. DMSP SSMT/2 - Atmospheric Water Vapor Profiler

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The SSM/T-2 sensor is a five channel, total power microwave radiometer with three channels situated symmetrically about the 183.31 GHz water vapor resonance line and...

  2. Directionally solidified Eu doped CaF.sub.2./sub./Li.sub.3./sub.AlF.sub.6./sub. eutectic scintillator for neutron detection

    Czech Academy of Sciences Publication Activity Database

    Kamada, K.; Hishinuma, K.; Kurosawa, S.; Shoji, Y.; Pejchal, Jan; Ohashi, Y.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 50, Dec (2015), 71-75 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : scintillator * eutectic * micro-pulling down Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  3. Cytochemical and ultrastructural aspects of aquatic carnivorous plant turions

    Czech Academy of Sciences Publication Activity Database

    Plachno, B.J.; Adamec, Lubomír; Kozieradzka-Kiszkurno, M.; Świątek, P.; Kamińska, I.

    2014-01-01

    Roč. 251, č. 6 (2014), s. 1449-1454 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic carnivorous plants * winter buds * storage functions Subject RIV: EF - Botanics Impact factor: 2.651, year: 2014

  4. Genetics Home Reference: dopa-responsive dystonia

    Science.gov (United States)

    ... splicing defect accounts for a new phenotypic variant. Neurogenetics. 2011 Aug;12(3):183-91. doi: 10. ... SPR) in a patient with dopa-responsive dystonia. Neurogenetics. 2004 Sep;5(3):187-90. Epub 2004 ...

  5. Preparation, characterization and photocatalytic properties of cerium doped TiO.sub.2./sub. : On the effect of Ce loading on the photocatalytic reduction of carbon dioxide

    Czech Academy of Sciences Publication Activity Database

    Matějová, L.; Kočí, B.; Reli, M.; Čapek, L.; Hospodková, Alice; Peikertová, P.; Matěj, Z.; Obalová, L.; Wach, A.; Kustrowski, P.; Kotarba, A.

    152-153, JUN (2014), s. 172-183 ISSN 0926-3373 Institutional support: RVO:68378271 Keywords : cerium * titania * nanocrystalline * photocatalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 7.435, year: 2014

  6. Barium enema

    Science.gov (United States)

    ... St Louis, MO: Elsevier Saunders; 2013:183-185. Taylor S, Plumb A. The large bowel. In: Adam A, ... MD, Clinical Professor of Medicine, The George Washington University School of Medicine, Washington, DC. Also reviewed by ...

  7. NAMMA HIGH ALTITUDE MMIC SOUNDING RADIOMETER (HAMSR) V1

    Data.gov (United States)

    National Aeronautics and Space Administration — HAMSR is a 25-channel microwave atmospheric sounder operating as a cross-track scanner. It operates in three frequency bands centered around 53, 118 and 183 GHz....

  8. Assessing Object Relations and Social Cognitive Correlates of Eating Disorder.

    Science.gov (United States)

    Heesacker, Roberta S.; Neimeyer, Greg J.

    1990-01-01

    Investigated relation between eating disorder and disturbances in object relations and cognitive structure in undergraduate female college students (n=183). Results indicated that eating disorder was predicted by measures of object relations disturbance and cognitive structure. (Author/ABL)

  9. Molecular phylogeny, population genetics, and evolution of heterocystous cyanobacteria using nifH gene sequences

    Czech Academy of Sciences Publication Activity Database

    Singh, P.; Singh, S. S.; Elster, Josef; Mishra, A. K.

    2013-01-01

    Roč. 250, č. 3 (2013), s. 751-764 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : evolution * heterocystous cyanobacteria * nifH gene Subject RIV: EH - Ecology, Behaviour Impact factor: 3.171, year: 2013

  10. Nástin rozšíření vybraných ruderálních a synantropních druhů plžů (Gastropoda) v oblasti Šumavy a Pošumaví

    Czech Academy of Sciences Publication Activity Database

    Dvořák, L.; Hlaváč, Jaroslav

    2001-01-01

    Roč. 6, - (2001), s. 183-198 ISSN 1211-7420 Institutional research plan: CEZ:AV0Z3013912 Keywords : distribution * new records * ruderal and synanthropic habitats Subject RIV: DB - Geology ; Mineralogy

  11. Batrachochytrium dendrobatidis not found in rainforest frogs along an altitudinal gradient of Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Dahl, C.; Kiatik, I.; Baisen, I.; Bronikowski, E.; Fleischer, R. C.; Rotzel, N. C.; Lock, J.; Novotný, Vojtěch; Narayan, E.; Hero, J.-M.

    2012-01-01

    Roč. 22, č. 3 (2012), s. 183-186 ISSN 0268-0130 Institutional support: RVO:60077344 Keywords : altitude * amphibians * Batrachochytrium dendrobatidis Subject RIV: EH - Ecology, Behaviour Impact factor: 1.081, year: 2012

  12. Anabaenopsis morphospecies (Cyanobacteria, Nostocales) from Los Patos shallow lake (Province of Buenos Aires, Argentina).

    Czech Academy of Sciences Publication Activity Database

    Aguilera, A.; Komárek, Jiří; Echenique, R. O.

    2016-01-01

    Roč. 272, č. 3 (2016), s. 173-183 ISSN 1179-3155 Institutional support: RVO:67985939 Keywords : biodiversity * cyanobacteria l blooms * Argentine Subject RIV: EA - Cell Biology Impact factor: 1.240, year: 2016

  13. Improving critical thinking : Effects of dispositions and instructions oneconomics students' reasoning skills

    NARCIS (Netherlands)

    Heijltjes, Anita; van Gog, Tamara|info:eu-repo/dai/nl/294304975; Leppink, Jimmie; Paas, Fred

    2014-01-01

    This experiment investigated the impact of critical thinking dispositions and instructions on economics students' performance on reasoning skills. Participants (. N=. 183) were exposed to one of four conditions: critical thinking instruction, critical thinking instruction with self-explanation

  14. GNSS-R concept extended by a fine orbit tuning

    Czech Academy of Sciences Publication Activity Database

    Klokočník, Jaroslav; Bezděk, Aleš; Kostelecký, J.

    2012-01-01

    Roč. 49, č. 5 (2012), s. 957-965 ISSN 0273-1177 Institutional support: RVO:67985815 Keywords : bistatic altimetry * PARIS concept * orbit resonances Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.183, year: 2012

  15. Escape dynamics: a continuous-time approximation

    Czech Academy of Sciences Publication Activity Database

    Kolyuzhnov, D.; Bogomolova, A.; Slobodyan, Sergey

    2014-01-01

    Roč. 38, January (2014), s. 161-183 ISSN 0165-1889 Institutional support: RVO:67985998 Keywords : constant gain adaptive learning * escape dynamics * recursive least squares Subject RIV: AH - Economics Impact factor: 1.018, year: 2014

  16. Luminescence study on Eu or Tb doped lanthanum-gadolinium pyrosilicate crystal

    Czech Academy of Sciences Publication Activity Database

    Kurosawa, S.; Shishido, T.; Sugawara, T.; Nomura, A.; Yubuta, K.; Pejchal, Jan; Murakami, R.; Yokota, Y.; Shoji, Y.; Ohashi, Y.; Kamada, K.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar (2015), s. 80-83 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : scintillator * gadolinium pyrosilicate Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  17. African Journal of Sustainable Development - Vol 4, No 3 (2014)

    African Journals Online (AJOL)

    Urbanization Challenges in Poor Slum Areas of Nairobi and the Role of Sustainability Science in Seeking Practical Solutions · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. OM Mugenda, JN Muriuki, 169-183 ...

  18. Arthropod fauna recorded in flowers of apomictic Taraxacum section Ruderalia

    Czech Academy of Sciences Publication Activity Database

    Honěk, A.; Martínková, Z.; Skuhrovec, J.; Barták, M.; Bezděk, J.; Bogusch, P.; Hadrava, J.; Hájek, J.; Janšta, P.; Jelínek, J.; Kirschner, Jan; Kubáň, V.; Pekár, S.; Průdek, P.; Štys, P.; Šumpich, J.

    2016-01-01

    Roč. 113, č. 1 (2016), s. 173-183 E-ISSN 1802-8829 Institutional support: RVO:67985939 Keywords : plant-herbivore interactions * arthropods * Taraxacum Subject RIV: EF - Botanics Impact factor: 1.167, year: 2016

  19. Jsme nutně tělesní?

    Czech Academy of Sciences Publication Activity Database

    Hříbek, Tomáš

    2011-01-01

    Roč. 59, č. 7 (2011), s. 183-202 ISSN 0015-1831 Institutional research plan: CEZ:AV0Z90090514 Keywords : phenomenology * Kripke * dualism * material constitution Subject RIV: AA - Philosophy ; Religion

  20. Michael Angelo Unterberger und seine Nachfolger im Dienst des böhmischen und mährischen Adels

    Czech Academy of Sciences Publication Activity Database

    Valeš, Tomáš

    2013-01-01

    Roč. 67, 1/2 (2013), s. 174-183 ISSN 0029-9626 Institutional support: RVO:68378033 Keywords : Unterberger * Plandry * Breitenau * Vienna * aristocracy * Zebo * Gedon Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. 37 CFR 41.1 - Policy.

    Science.gov (United States)

    2010-07-01

    ... and 1.181 to 1.183 of this title also apply to practice before the Board, as do other sections of part... Part 41 shall be construed to secure the just, speedy, and inexpensive resolution of every proceeding...

  2. National Security Education Program: Background and Issues

    National Research Council Canada - National Science Library

    Kuenzi, Jeffrey J; Riddle, Wayne C

    2005-01-01

    ... (NSEA, Title VIII of P.L. 102-183), provides aid for international education and foreign language studies by American undergraduate and graduate students, plus grants to institutions of higher education...

  3. Tungsten isotopes in bulk meteorites and their inclusions-Implications for processing of presolar components in the solar protoplanetary disk

    DEFF Research Database (Denmark)

    Holst, Jesper Christian; Paton, Chad; Wielandt, Daniel Kim Peel

    2015-01-01

    isotope variability is correlated. Correlated isotope heterogeneity for elements of distinct nucleosynthetic origin (183W and 58Ni) is best explained by thermal processing in the protoplanetary disk during which thermally labile carrier phases are unmixed by vaporization thereby...

  4. Ethiopian Journal of Health Development - Vol 25, No 3 (2011)

    African Journals Online (AJOL)

    Knowledge, attitude and practice of emergency contraceptives among female college students in Arba Minch Town, Southern Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Worku, 176-183 ...

  5. 75 FR 31347 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-06-03

    ... Seward, Kenai Resurrection Bay. Peninsula Borough. Approximately 1.3 mile None +183 upstream of Nash Road..., MO 63670. McHenry County, North Dakota, and Incorporated Areas Mouse River Approximately 1.25 mile...

  6. Specific Statistics of Czech Legislation

    Czech Academy of Sciences Publication Activity Database

    Novák, František

    2015-01-01

    Roč. 5, č. 3 (2015), s. 162-183 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : legislation * quantitative description of legislation * structure and development of the legislation in the CR Subject RIV: AG - Legal Sciences

  7. July 1998 Sissano, Papua New Guinea Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — At least 2,183 people killed, thousands injured, about 9,500 homeless and about 500 missing as a result of a tsunami generated in the Sissano area. Maximum wave...

  8. Quantitative impedance analysis of solid ionic conductors: Effects of electrode polarization

    Czech Academy of Sciences Publication Activity Database

    Patil, D.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2014-01-01

    Roč. 115, č. 14 (2014), "143707-1"-"143707-6" ISSN 0021-8979 Institutional support: RVO:61389013 Keywords : impedance * conductivity * ion conductors Subject RIV: CA - Inorganic Chemistry Impact factor: 2.183, year: 2014

  9. Sudan Journal of Medical Sciences - Vol 6, No 3 (2011)

    African Journals Online (AJOL)

    Cervical cancer in women diagnosed at the National Health Laboratory, Sudan: A call for screening · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. N Husain, T Helali, M Domi, S Bedri, 183-190 ...

  10. The SIFT and FALP techniques; applications to ionic and electronic reactions studies and their evolution to the SIFT-MS and FA-MS analytical methods

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Španěl, Patrik

    2015-01-01

    Roč. 377, SI (2015), s. 467-478 ISSN 1387-3806 Institutional support: RVO:61388955 Keywords : flow tubes * mass spectrometry * FALP techniques Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.183, year: 2015

  11. Physiological tolerance and stoichiometric potential of cyanobacteria for hydrocarbon fuel production

    Czech Academy of Sciences Publication Activity Database

    Kamarainen, J.; Knoop, H.; Stanford, N.; Guerrero, F.; Akhtar, M. K.; Aro, E. M.; Steuer, Ralf; Jones, P. R.

    2012-01-01

    Roč. 162, č. 1 (2012), s. 67-74 ISSN 0168-1656 Institutional support: RVO:67179843 Keywords : Cyanobacteria * Hydrocarbon * Fuel * Toxicity * Stoichiometric potential Subject RIV: EH - Ecology, Behaviour Impact factor: 3.183, year: 2012

  12. Apoptosis and necrosis during the circadian cycle in the centipede midgut

    Czech Academy of Sciences Publication Activity Database

    Rost-Roszkowska, M.M.; Chajec, Ł.; Vilímová, J.; Tajovský, Karel

    2016-01-01

    Roč. 253, č. 4 (2016), s. 1051-1061 ISSN 0033-183X Institutional support: RVO:60077344 Keywords : cell death * centipede * digestive cells * midgut epithelium * ultrastructure Subject RIV: EG - Zoology Impact factor: 2.870, year: 2016

  13. Diversity of Young Adults’ Living Arrangements: The Role of Ethnicity and Immigration

    Czech Academy of Sciences Publication Activity Database

    Jeong, Y.; Hamplová, Dana; Le Bourdais, C.

    2014-01-01

    Roč. 40, č. 7 (2014), s. 1116-1135 ISSN 1369-183X Institutional support: RVO:68378025 Keywords : Young Adults * Living Arrangments * Ethnicity Subject RIV: AO - Sociology, Demography Impact factor: 1.228, year: 2014

  14. TMFunction data: 1699 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available S344C ... yes drug transport; inter-domain communication TM6 Multidrug transporter, P...183) Helix ... inter-domain communication; drug transport; substrate translocation; ATPase activity

  15. TMFunction data: 1693 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Q347C ... yes drug transport; inter-domain communication TM6 Multidrug transporter, P...183) Helix ... inter-domain communication; drug transport; substrate translocation; ATPase activity

  16. TMFunction data: 1707 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available G346C ... yes drug transport; inter-domain communication TM6 Multidrug transporter, P...183) Helix ... inter-domain communication; drug transport; substrate translocation; ATPase activity

  17. TMFunction data: 1627 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available S344C ... yes drug transport; inter-domain communication TM6 Multidrug transporter, P...183) Helix ... inter-domain communication; drug transport; substrate translocation; ATPase activity

  18. Processing Methodology and Dialectological Aspects of the Dictionary of Moravian and Silesian Anoikonyms (Minor Place Names)

    Czech Academy of Sciences Publication Activity Database

    Čižmárová, Libuše

    2010-01-01

    Roč. 3, č. 1 (2010), s. 183-195 ISSN 1855-6302 Institutional research plan: CEZ:AV0Z90610518 Keywords : onomastics, dialectology * electronic dictionary * anoikonyms * digitization * Moravia * Silesia * minor place names Subject RIV: AI - Linguistics

  19. Constitutive equation of concrete: Mesomechanical isotropic model

    Czech Academy of Sciences Publication Activity Database

    Kafka, Vratislav; Vokoun, David

    2005-01-01

    Roč. 1, č. 2 (2005), s. 183-193 ISSN 1573-6105 Institutional research plan: CEZ:AV0Z20710524 Keywords : plasticity * constitutive modeling * concrete * mesomechanics Subject RIV: JI - Composite Materials

  20. Floating large-volume mesocosms as a simple, low-cost experimental design suitable for the variety of lakes and reservoirs

    Czech Academy of Sciences Publication Activity Database

    Šorf, M.; Brandl, Z.; Znachor, Petr; Vašek, Mojmír

    2013-01-01

    Roč. 183, č. 1 (2013), s. 41-48 ISSN 1863-9135 Institutional support: RVO:60077344 Keywords : mesocosms * enclosures * methods * lakes * reservoirs Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.000, year: 2013

  1. TT2014 meeting report on the 12th Transgenic Technology meeting in Edinburgh: new era of transgenic technologies with programmable nucleases in the foreground

    Czech Academy of Sciences Publication Activity Database

    Beck, Inken; Sedláček, Radislav

    2015-01-01

    Roč. 24, č. 1 (2015), s. 179-183 ISSN 0962-8819 Institutional support: RVO:68378050 Keywords : Transgenic * Nuclease * Gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.054, year: 2015

  2. Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925- 3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  3. Growth and scintillation properties of Eu doped BaCl.sub.2./sub./LiF eutectic scintillator

    Czech Academy of Sciences Publication Activity Database

    Kamada, K.; Hishinuma, K.; Kurosawa, S.; Yamaji, A.; Shoji, Y.; Pejchal, Jan; Yokota, Y.; Ohashi, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 50, Dec (2015), 76-80 ISSN 0925- 3467 Institutional support: RVO:68378271 Keywords : scintillator * eutectic * micro-pulling down Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  4. Growth of Nd doped (Lu, Gd).sub.3./sub.(Ga, Al).sub.5./sub.O.sub.12./sub. single crystal by the micro pulling down method and their scintillation properties

    Czech Academy of Sciences Publication Activity Database

    Kamada, K.; Kurosawa, S.; Yamaji, A.; Shoji, Y.; Pejchal, Jan; Ohashi, Y.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar (2015), s. 32-35 ISSN 0925- 3467 Institutional support: RVO:68378271 Keywords : single crystal growth * scintillator * garnet * neodymium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  5. On reliability of 3D reconstructions of thermal plasma jet radiation by inverse Radon transform

    Czech Academy of Sciences Publication Activity Database

    Sekerešová, Zuzana; Hlína, Jan

    2011-01-01

    Roč. 56, č. 2 (2011), s. 171-183 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20570509 Keywords : thermal plasma jet * tomography * image reconstruction Subject RIV: BL - Plasma and Gas Discharge Physics

  6. Internetová jazyková příručka – příspěvek k elektronizaci jazykového poradenství

    Czech Academy of Sciences Publication Activity Database

    Pravdová, Markéta

    2012-01-01

    Roč. 62, č. 4 (2012), s. 179-183 ISSN 0009-0786 Institutional support: RVO:68378092 Keywords : grammar * orthography * lanugage correctness * language cultivation * sociolinguistics * language consulting centre * Internet Language Reference Book Subject RIV: AI - Linguistics

  7. The fats of life: essential fatty acids in health and disease

    National Research Council Canada - National Science Library

    Lawrence, Glen D

    2010-01-01

    ...: Health Consequences and Dietary Influences Dietary Choices for Comprehensive Health 183 201 Appendix A Appendix B Appendix C Appendix D Appendix E Glossary References Index Fundamentals of Chemical B...

  8. 50 CFR 679.22 - Closures.

    Science.gov (United States)

    2010-10-01

    ...) Bogoslof Pacific cod exemption area. (1) All catcher vessels less than 60 ft (18.3 m) LOA using jig or hook... Pacific cod have been caught by catcher vessels less than 60 ft (18.3 m) LOA using jig or hook-and-line... using jig or hook-and-line gear in the exemption area by notification published in the Federal Register...

  9. 76 FR 12606 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Cod by Catcher Vessels Less Than 60...

    Science.gov (United States)

    2011-03-08

    ... Catcher Vessels Less Than 60 Feet (18.3 m) Length Overall Using Jig or Hook-and-Line Gear in the Bogoslof... less than 60 feet (18.3 m) length overall (LOA) using jig or hook-and-line gear in the Bogoslof Pacific... necessary to prevent exceeding the limit of Pacific cod for catcher vessels less than 60 ft LOA using jig or...

  10. 50 CFR 679.20 - General limitations.

    Science.gov (United States)

    2010-10-01

    ...% (2) Hook-and-line CP and hook-and-line CV ≥60 ft (18.3 m) LOA 60% 40% no C season (3) Jig 40% 20% 40... % Allocation (1) Jig vessels 1.4 (2) Hook-and-line/pot CV jig sector, or to the less than 60 ft (18.3 m) LOA hook-and-line or pot catcher vessel sector, or...

  11. 75 FR 8841 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Cod by Catcher Vessels Less Than 60...

    Science.gov (United States)

    2010-02-26

    ... Vessels Less Than 60 feet (18.3 m) Length Overall Using Jig or Hook-and-Line Gear in the Bogoslof Pacific... less than 60 feet (18.3 m) length overall (LOA) using jig or hook-and-line gear in the Bogoslof Pacific... necessary to prevent exceeding the limit of Pacific cod for catcher vessels less than 60 ft LOA using jig or...

  12. Dynamique de structuration spatio-temporelle des populations de ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2014 ... Station VI. Fev Mar Avr Mai Jui Jul Fev Mar Avr Mai Jui Jul Fev Mar Avr Mai Jui Jul Fev Mar Avr Mai Jui Jul. Coléoptères. Hydrophilidae. 512 311 355 356 511 17 47 469 188 608 600 0 0 165 182 149 0 13 299 0 234 54 13 7. Dytiscidae. 274 279 183 120 109 28 320 250 148 221 108 0 0 183 193 224 85 15 ...

  13. Objective Analysis and Prediction Techniques - 1985

    Science.gov (United States)

    1985-11-30

    Robert G. Hallowell, B.S. Barry A. Kareiro, D. Keith Roberts Climatology - James H. Willand Principal Investigator was Alan x. Gerlach, Ph.D. Subcontracts...AFGL Interactive Meteorological System (AIMS) - Gary B. Gustafson, Charles F. Ivaldi, Jr., and D. Keith Roberts 183 1. Introduction 183 2. System...R. A. Houze , Jr., and J. D. Locatelli, 1977: Real-time wind measurements in extra-tropical cyclones by means of Doppler radar. J. Appl. Meteor., 16

  14. Differences in Therapeutic Approach and Clinical Outcome in Patients over 70 Years with Acute Myocardial Infarction

    Czech Academy of Sciences Publication Activity Database

    Monhart, Z.; Faltus, Václav; Grünfeldová, H.; Charalampidi, K.; Kadlečková, A.; Ryšavá, D.; Velimský, T.; Ballek, J.; Hubač, J.; Janský, P.

    2007-01-01

    Roč. 9, č. 3 (2007), s. 183-183 ISSN 1748-2941. [Intensive Cardiac Care International Meeting /5./. 14.10.2007-16.10.2007, Tel Aviv] R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : acute myocardial infarction * age * in-hospital mortality Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

  15. Possible Reasons for Worse Clinical outcome in Women with Acute Myocardial Infarction

    Czech Academy of Sciences Publication Activity Database

    Monhart, Z.; Faltus, Václav; Grünfeldová, H.; Charalampidi, K.; Kadlečková, A.; Ryšavá, D.; Velimský, T.; Ballek, J.; Hubač, J.; Janský, P.

    2007-01-01

    Roč. 9, č. 3 (2007), s. 183-183 ISSN 1748-2941. [Intensive Cardiac Care International Meeting /5./. 14.10.2007-16.10.2007, Tel Aviv] R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : acute myocardial infarction * gender * in-hospital mortality Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

  16. Fatty acid biomarkers: validation of food web and trophic markers using C-13-labelled fatty acids in juvenile sandeel ( Ammodytes tobianus )

    DEFF Research Database (Denmark)

    Dalsgaard, Anne Johanne Tang; St. John, Michael

    2004-01-01

    :0 followed by 14 days on a formulated diet enriched in (13)C18:3(n - 3). An exponential model was employed to estimate the uptake and clearance rates of recovered labelled fatty acids as a function of growth and fatty acid metabolism. The model predicted a faster uptake of (13)C18:3(n - 3) than (13)C16:0 (0...

  17. Mechanism of Formation of the Major Estradiol Product Ions Following Collisional Activation of the Molecular Anion in a Tandem Quadrupole Mass Spectrometer

    Science.gov (United States)

    Wooding, Kerry M.; Barkley, Robert M.; Hankin, Joseph A.; Johnson, Christopher A.; Bradford, Andrew P.; Santoro, Nanette; Murphy, Robert C.

    2013-01-01

    The importance of the mass spectral product ion structure is highlighted in quantitative assays, which typically use MRM (multiple reaction monitoring), and in the discovery of novel metabolites. Estradiol is an important sex steroid whose quantitation and metabolite identification using tandem mass spectrometry has been widely employed in numerous clinical studies. Negative electrospray ionization tandem mass spectrometry of estradiol (E2) results in several product ions, including the abundant m/z 183 and m/z 169. While m/z 183 is one of the most abundant product ions used in many quantitative assays, the structure of m/z 183 has not been rigorously examined. We suggest a structure for m/z 183 and a mechanism of formation consistent with collision induced dissociation (CID) of E2 and several stable isotopes ([D4]-E2, [13C6]-E2, and [D1]-E2). An additional product ion from E2, namely m/z 169, has also been examined. MS3 experiments indicated that both m/z 183 and m/z 169 originate from only E2 [M-H]− m/z 271. These ions, m/z 183 and m/z 169, were also present in the collision induced decomposition mass spectra of other prominent estrogens, estrone (E1) and estriol (E3), indicating that these two product ions could be used to elucidate the estrogenic origin of novel metabolites. We propose two fragmentation schemes to explain the CID data and suggested a structure of m/z 183 and m/z 169 consistent with several isotopic variants and high resolution mass spectrometric measurements. PMID:23955001

  18. Trends in the enantiomeric composition of polychlorinated biphenyl atropisomers in human breast milk.

    Science.gov (United States)

    Konishi, Yoshimasa; Kakimoto, Kensaku; Nagayoshi, Haruna; Nakano, Takeshi

    2016-02-01

    For the precise estimation of the risk to human health caused by persistent organic pollutants (POPs), it is important to discuss enantiomer fraction value (EF value) because it is reported that behaviors such as stability and toxicity of enantiomers are quite different in human body. Among POPs, polychlorinated biphenyl (PCB) is known as one of the most persistent compounds in human breast milk samples. The main exposure source of PCB for human body is mostly from food especially in seafood. The contamination of fish and shellfish has been a serious problem for the Japanese, who consume a large amount of fish in their diet. PCBs have 19 congeners which are chlorine-substituted in 3- or 4- ortho positions are known to have enantiomers. In this study, we analyzed PCB 183 (2,2',3,4,4',5',6-hepta CB) in human breast milk and fish samples enantioselectively and revealed the time trends of the EF value. Though EF value of PCB 183 in fish samples sustained close to racemate (EF = 0.5) from 1982 to 2012, that in breast milk increased over time. This fact indicates that (+)-PCB-183 has greater bioaccumulation potential than (-)-PCB-183 in human body; therefore, the toxicity of (+)-PCB-183 should be emphasized.

  19. Bacterial meningitis in diabetes patients: a population-based prospective study

    Science.gov (United States)

    van Veen, Kiril E. B.; Brouwer, Matthijs C.; van der Ende, Arie; van de Beek, Diederik

    2016-01-01

    Diabetes mellitus is associated with increased infection rates. We studied clinical features and outcome of community-acquired bacterial meningitis in diabetes patients. Patients were selected from a nationwide, prospective cohort on community-acquired bacterial meningitis performed from March 2006 to October 2014. Data on patient history, symptoms and signs on admission, treatment, and outcome were prospectively collected. A total of 183 of 1447 episodes (13%) occurred in diabetes patients. The incidence of bacterial meningitis in diabetes patients was 3.15 per 100,000 patients per year and the risk of acquiring bacterial meningitis was 2.2-fold higher for diabetes patients. S. pneumoniae was the causative organism in 139 of 183 episodes (76%) and L. monocytogenes in 11 of 183 episodes (6%). Outcome was unfavourable in 82 of 183 episodes (45%) and in 43 of 183 episodes (23%) the patient died. Diabetes was associated with death with an odds ratio of 1.63 (95% CI 1.12–2.37, P = 0.011), which remained after adjusting for known predictors of death in a multivariable analysis (OR 1.98 [95% CI 1.13–3.48], P = 0.017). In conclusion, diabetes is associated with a 2-fold higher risk of acquiring bacterial meningitis. Diabetes is a strong independent risk factor for death in community-acquired adult bacterial meningitis. PMID:27845429

  20. Regional Assessment of Human Fecal Contamination in Southern California Coastal Drainages

    Science.gov (United States)

    Cao, Yiping; Raith, Meredith R.; Smith, Paul D.; Griffith, John F.; Weisberg, Stephen B.; Schriewer, Alexander; Sheldon, Andrew; Crompton, Chris; Gregory, Jason; Guzman, Joe; Othman, Laila; Manasjan, Mayela; Choi, Samuel; Rapoport, Shana; Steele, Syreeta; Nguyen, Tommy; Yu, Xueyuan

    2017-01-01

    Host-associated genetic markers that allow for fecal source identification have been used extensively as a diagnostic tool to determine fecal sources within watersheds, but have not been used in routine monitoring to prioritize remediation actions among watersheds. Here, we present a regional assessment of human marker prevalence among drainages that discharge to the U.S. southern California coast. Approximately 50 samples were analyzed for the HF183 human marker from each of 22 southern California coastal drainages under summer dry weather conditions, and another 50 samples were targeted from each of 23 drainages during wet weather. The HF183 marker was ubiquitous, detected in all but two sites in dry weather and at all sites during wet weather. However, there was considerable difference in the extent of human fecal contamination among sites. Similar site ranking was produced regardless of whether the assessment was based on frequency of HF183 detection or site average HF183 concentration. However, site ranking differed greatly between dry and wet weather. Site ranking also differed greatly when based on enterococci, which do not distinguish between pollution sources, vs. HF183, which distinguishes higher risk human fecal sources from other sources, indicating the additional value of the human-associated marker as a routine monitoring tool. PMID:28777324

  1. Presence of microbial and chemical source tracking markers in roof-harvested rainwater and catchment systems for the detection of fecal contamination.

    Science.gov (United States)

    Waso, M; Ndlovu, T; Dobrowsky, P H; Khan, S; Khan, W

    2016-09-01

    Microbial source tracking (MST) and chemical source tracking (CST) markers were utilized to identify fecal contamination in harvested rainwater and gutter debris samples. Throughout the sampling period, Bacteroides HF183 was detected in 57.5 % of the tank water samples and 95 % of the gutter debris samples, while adenovirus was detected in 42.5 and 52.5 % of the tank water and gutter debris samples, respectively. Human adenovirus was then detected at levels ranging from below the detection limit to 316 and 1253 genome copies/μL in the tank water and debris samples, respectively. Results for the CST markers showed that salicylic acid (average 4.62 μg/L) was the most prevalent marker (100 %) in the gutter debris samples, caffeine (average 18.0 μg/L) was the most prevalent in the tank water samples (100 %) and acetaminophen was detected sporadically throughout the study period. Bacteroides HF183 and salicylic acid (95 %) and Bacteroides HF183 and caffeine (80 %) yielded high concurrence frequencies in the gutter debris samples. In addition, the highest concurrence frequency in the tank water samples was observed for Bacteroides HF183 and caffeine (60 %). The current study thus indicates that Bacteroides HF183, salicylic acid and caffeine may potentially be applied as source tracking markers in rainwater catchment systems in order to supplement fecal indicator analyses.

  2. CHARM: A CubeSat Water Vapor Radiometer for Earth Science

    Science.gov (United States)

    Lim, Boon; Mauro, David; DeRosee, Rodolphe; Sorgenfrei, Matthew; Vance, Steve

    2012-01-01

    The Jet Propulsion Laboratory (JPL) and Ames Research Center (ARC) are partnering in the CubeSat Hydrometric Atmospheric Radiometer Mission (CHARM), a water vapor radiometer integrated on a 3U CubeSat platform, selected for implementation under NASA Hands-On Project Experience (HOPE-3). CHARM will measure 4 channels at 183 GHz water vapor line, subsets of measurements currently performed by larger and more costly spacecraft (e.g. ATMS, AMSU-B and SSMI/S). While flying a payload that supports SMD science objectives, CHARM provides a hands-on opportunity to develop technical, leadership, and project skills. CHARM will furthermore advance the technology readiness level (TRL) of the 183 GHz receiver subsystem from TRL 4 to TRL 6 and the CubeSat 183 GHz radiometer system from TRL 4 to TRL 7.

  3. Apports alimentaires en acides linoléique et alpha-linolénique d’une population d’Aquitaine

    Directory of Open Access Journals (Sweden)

    Combe Nicole

    2001-03-01

    Full Text Available Les apports alimentaires quotidiens en acides linoléique (18:2 n-6 et alpha-linolénique (18:3 n-3 ont fait récemment l’objet de recommandations pour la population française (ANC 2001. Cependant, peu d’informations sont actuellement disponibles sur la situation réelle, en particulier vis-à-vis du 18:3 n-3. Cette étude montre que la consommation de 18:2 n-6, en Aquitaine (n = 140 femmes, représente en moyenne 4,4 % (± 1,8 de l’apport énergétique total (AET, valeur acceptable par rapport aux ANC (4 %. En revanche, l’apport en 18:3 n-3 est insuffisant (0,34 ± 0,1 % au lieu de 0,8 % recommandé. Dans cette population, le 18:3 n-3 est à 75 % d’origine animale. La contribution des huiles est faible (9 %. La teneur moyenne en 18:2 n-6 et 18:3 n-3 du tissu adipeux des sujets est respectivement égale à 14 % et 0,5 % des acides gras totaux. Dans le plasma, ce sont les esters de cholestérol (EC qui en véhiculent le plus (53 % de 18:2 n-6 et 0,42 % de 18:3 n-3. Cette étude met en évidence une corrélation positive entre les pourcentages de 18:2 n-6 dans les EC plasmatiques et ceux du tissu adipeux (r = 0,606 et p < 0,001, confirmant que cette fraction plasmatique est un « marqueur » non invasif des apports en acide linoléique.

  4. Defense Infrastructure: Department of Defense Renewable Energy Initiatives

    Science.gov (United States)

    2010-04-26

    to this report include Harold Reich, Assistant Director; Stacy Bennett; Sharon Reid; Rebecca Rygg; Christopher Turner; and Michael Willems...Photovoltaic Fully Operational 2010 No 2009 1 $37.54 $37.54 Appropriated 183 Dept Navy Naval Base San Diego CA 200 kW PV Carport, McCandless Blvd Sub...Notes from the Department of Defense 183 Dept Navy Naval Base San Diego CA 200 kW PV Carport, McCandless Blvd Sub-Station Parking Lot 0.00 0.00

  5. CDKA and CDKB kinases from Chlamydomonas reinhardtii are able to complement cdc28 temperature-sensitive mutants of Saccharomyces cerevisiae

    Czech Academy of Sciences Publication Activity Database

    Čížková, Mária; Pichová, Alena; Vítová, Milada; Hlavová, Monika; Hendrychová, Jana; Umysová, Dáša; Gálová, E.; Ševčovičová, A.; Zachleder, Vilém; Bišová, Kateřina

    2008-01-01

    Roč. 232, 3-4 (2008), s. 183-191 ISSN 0033-183X R&D Projects: GA ČR GA204/06/0102; GA ČR GA301/03/0289; GA AV ČR IAA5020403; GA AV ČR IAA500200614; GA MŠk ME 938 Institutional research plan: CEZ:AV0Z50200510 Keywords : cell cycle * cdc28 homolog * chlamydomonas reinhardtii Subject RIV: EE - Microbiology, Virology Impact factor: 1.460, year: 2008

  6. Interband transitions in 106Pd, 152Sm, 152Gd and 182W

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Oborovskij, A.I.; Troitskaya, A.G.

    1990-01-01

    Internal transitions in 106 Pd, 152 Sm, 152 Gd, 182 W nuclei, observed during decay of 152,152m Eu, 182,183 Ta, 106m Ag, are studied. The experimental characteristics of E0-transitions and E0-components of E0+M1+E2 type transitions in the studied nuclei, relative intensities of internal conversion electron lines during 182 Ta decay, multipolar composition and forbidden factor for 182 W and 183 W low-energy transitions, characteristics of transitions are presented

  7. Lymphatic Fatty Acid Absorption Profile During 24 Hours After Administration of Triglycerides to Rats

    DEFF Research Database (Denmark)

    Porsgaard, Trine Charlotte; Straarup, Ellen Marie; Høy, Carl-Erik

    1999-01-01

    :0), and linoleic acid (18:2n-6) together witholeic acid (18:1 n-9) after RO had not returned to the transport at baseline. In contrast, the transport of decanoic acid(10:0) and alpha-linolenic acid (18:3n-3) returned to baseline values between 12 and 15 h. This indicated that theabsorption of purely exogenous...... fatty acids (illustrated by 10:0 and 18:3n-3) was complete at 15 h and that the fatty acidstransported between 15 and 24 h were derived mostly from endogenous stores....

  8. Measurement of the cross-section for the process $\\gamma^* \\gamma^* \\to$ hadrons at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G; Zöller, M

    1999-01-01

    Measurements of the two-photon interaction e+e- --> e+e- hadrons at sqrt(s) = 91 GeV and sqrt(s) = 183 GeV are presented. The double-tag events, collected with the L3 detector, correspond to integrated luminosities of 140 pb-1 at 91 GeV and 52 pb-1 at 183 GeV. The cross-section of gamma*gamma* collisions has been measured at = 3.5 GeV^2 and = 14 GeV^2. The data agree well with predictions based on perturbative QCD, while the Quark Parton Model alone is insufficient to describe the data.

  9. Effect of experimental Ricinus communis solution for denture cleaning on the properties of acrylic resin teeth.

    Science.gov (United States)

    Pisani, Marina Xavier; Macedo, Ana Paula; Paranhos, Helena de Freitas Oliveira; Silva, Cláudia Helena Lovato da

    2012-01-01

    This study evaluated Knoop hardness, surface roughness and color alteration of artificial teeth for dentures after immersion in water, 1% sodium hypochlorite and an experimental solution of 2% Ricinus communis (RC). Thirty specimens of Vipi, Biolux and Trilux were analyzed. Tests of Knoop hardness, surface roughness and color alteration were conducted immediately after specimen preparation (T0) and after two immersion protocols for 15 days (ΔT(15)) and 183 days (ΔT(183)). Data variation (ΔT) were subjected to ANOVA and Tukey's test (pproperties. Both immersion protocols caused alterations on the analyzed properties.

  10. Variants of beta-glucosidases

    Science.gov (United States)

    Fidantsef, Ana; Lamsa, Michael; Gorre-Clancy, Brian

    2014-10-07

    The present invention relates to variants of a parent beta-glucosidase, comprising a substitution at one or more positions corresponding to positions 142, 183, 266, and 703 of amino acids 1 to 842 of SEQ ID NO: 2 or corresponding to positions 142, 183, 266, and 705 of amino acids 1 to 844 of SEQ ID NO: 70, wherein the variant has beta-glucosidase activity. The present invention also relates to nucleotide sequences encoding the variant beta-glucosidases and to nucleic acid constructs, vectors, and host cells comprising the nucleotide sequences.

  11. Variants of beta-glucosidase

    Science.gov (United States)

    Fidantsef, Ana [Davis, CA; Lamsa, Michael [Davis, CA; Gorre-Clancy, Brian [Elk Grove, CA

    2009-12-29

    The present invention relates to variants of a parent beta-glucosidase, comprising a substitution at one or more positions corresponding to positions 142, 183, 266, and 703 of amino acids 1 to 842 of SEQ ID NO: 2 or corresponding to positions 142, 183, 266, and 705 of amino acids 1 to 844 of SEQ ID NO: 70, wherein the variant has beta-glucosidase activity. The present invention also relates to nucleotide sequences encoding the variant beta-glucosidases and to nucleic acid constructs, vectors, and host cells comprising the nucleotide sequences.

  12. Prevalence and impact of oral pain on daily life in a group of Danish schoolchildren

    DEFF Research Database (Denmark)

    Østergaard, Birthe; Fuglsang, Marianne; Poulsen, Sven

    of 246 children aged 9-11 yrs in 5 different primary schools in Aarhus, Denmark, 183 (74%) consented to participate. At their regular annual check-up the children were interviewed by their usual dentist using a questionnaire. Children who reported pain within the last four weeks were asked further...... children reported crying, and 6 reported that the pain woke them up during night. No children had missed school because of  pain and none had received painkillers. Five percent of the 183 children  reported pain caused by caries within the last four weeks. Among those who had pain within the last four...

  13. The CCTC Quick-Reacting General War Gaming System (QUICK) Program Maintenance Manual. Volume II. Weapon/Target Identification Subsystem. Change 3.

    Science.gov (United States)

    1980-04-30

    No. Chau No.L *173-175 0 176-178 3 179 3 180-182 1 183 3 184 1 183-186 3 187 1 188 3 189 1 190-190.2 3 191-191.2 3 192-199 3 200 1 201-202 3 4 t,, C...plan generation. Generated w1thin PLANSIT is the chain, LIIT]X of target number records, TAlUSE, which is headed by record TARUN . This chain. contains

  14. Nuclear medicine. Abstracts; Nuklearmedizin 2000. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2000-07-01

    This issue of the journal contains the abstracts of the 183 conference papers as well as 266 posters presented at the conference. Subject fields covered are: Neurology, psychology, oncology, pediatrics, radiopharmacy, endocrinology, EDP, measuring equipment and methods, radiological protection, cardiology, and therapy. (orig./CB) [German] Die vorliegende Zeitschrift enthaelt die Kurzfassungen der 183 auf der Tagung gehaltenen Vortraege sowie der 226 praesentierten Poster, die sich mit den folgenden Themen befassten: Neurologie, Psychiatrie, Onkologie, Paediatrie, Radiopharmazie, Endokrinologie, EDV, Messtechnik, Strahlenschutz, Kardiologie sowie Therapie. (MG)

  15. Vitamin C, E and A levels in maternal and fetal blood for Czech and Gypsy ethnic groups in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Dejmek, Jan; Ginter, E.; Peterková, Kateřina; Stávková, Zdena; Beneš, I.; Šrám, Radim

    2002-01-01

    Roč. 72, č. 3 (2002), s. 183-190 ISSN 0300-9831 R&D Projects: GA MŽP SI/340/2/00 Institutional research plan: CEZ:AV0Z5039906 Keywords : antioxidant vitamins * vitamin C Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.883, year: 2002

  16. Preconditions of an Intercultural Dialogue on Human Rights

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2010-01-01

    Roč. 55, č. 1 (2010), s. 183-205 ISSN 0042-3955 R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : intercultural dialogue * human rights * civilization Subject RIV: AA - Philosophy ; Religion

  17. Mineralogy of Bohemian green earth pigment and its microanalytical evidence in historical paintings

    Czech Academy of Sciences Publication Activity Database

    Hradil, David; Píšková, Anna; Hradilová, J.; Bezdička, Petr; Lehrberger, G.; Gerzer, S.

    2011-01-01

    Roč. 53, č. 3 (2011), s. 563-586 ISSN 0003-813X R&D Projects: GA ČR GA203/07/1324 Institutional research plan: CEZ:AV0Z40320502 Keywords : Bohemian green earth * celadonite * smectite * microanalysis Subject RIV: CA - Inorganic Chemistry Impact factor: 1.183, year: 2011

  18. Pulsed laser deposition of magnesium-doped calcium phosphate coatings on porous polycaprolactone scaffolds produced by rapid prototyping

    Czech Academy of Sciences Publication Activity Database

    Vandrovcová, Marta; Douglas, T.E.L.; Mróz, W.; Musial, O.; Schaubroeck, D.; Budner, B.; Syroka, R.; Dubruel, P.; Bačáková, Lucie

    2015-01-01

    Roč. 148, Jun 1 (2015), s. 178-183 ISSN 0167-577X R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:67985823 Keywords : mineralization * osteoblasts * bone tissue engineering Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.437, year: 2015

  19. Instructional Systems Development: Conceptual Analysis and Comprehensive Bibliography

    Science.gov (United States)

    1976-02-01

    in teaching. New York: Macmillan, 1965. Guba, E. G., Stufflebeam , D. L. Evaluation: The process of stimulating, aiding, and abetting insightful action...J. H. Performance testing in missile training. Training Directors Journal, 1964, 18(3), 57-60. Stufflebeam , D. L. Toward a science of Educational

  20. History of cable-stayed bridges

    DEFF Research Database (Denmark)

    Gimsing, Niels Jørgen

    1999-01-01

    The principle of supporting a bridge deck by inclined tension members leading to towers on either side of the span has been known for centuries. However, the real development of cable-stayed bridges did not begin before the 1950s. Since then the free span has been increased from 183 m...

  1. Detection of Interictal Epileptiform Discharges Using Signal Envelope Distribution Modelling: Application to Epileptic and Non-Epileptic Intracranial Recordings

    Czech Academy of Sciences Publication Activity Database

    Janča, R.; Ježdík, P.; Čmejla, R.; Tomášek, M.; Worrell, G. A.; Stead, M.; Wagenaar, J.; Jefferys, J. G. R.; Kršek, P.; Komárek, V.; Jiruška, Přemysl; Marusič, P.

    2015-01-01

    Roč. 28, č. 1 (2015), s. 172-183 ISSN 0896-0267 Grant - others:GA Mzd(CZ) NT11460 Institutional support: RVO:67985823 Keywords : spike detection * interictal epileptiform discharges * intracranial recording * automatic detection * Hilbert transform * principal component analysis Subject RIV: FH - Neurology Impact factor: 3.727, year: 2015

  2. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Soma Sen Roy. Articles written in Journal of Earth System Science. Volume 119 Issue 2 April 2010 pp 183-199. Doppler weather Radar based Nowcasting of cyclone Ogni · Soma Sen Roy V Lakshmanan S K Roy Bhowmik S B Thampi · More Details Abstract Fulltext PDF.

  3. Phenotypic and Genotypic Variation in Czech Forage, Ornamental and Wild Populations of Reed Canarygrass

    Czech Academy of Sciences Publication Activity Database

    Anderson, N. O.; Kávová, T.; Bastlová, D.; Curn, V.; Kubátová, B.; Edwards, K. R.; Januš, V.; Květ, Jan

    2016-01-01

    Roč. 56, č. 5 (2016), s. 2421-2435 ISSN 0011-183X Institutional support: RVO:86652079 Keywords : grass phalaris-arundinacea * invasive grass * constructed wetlands * genetic-variation * north-america * growth * plants * l. * competition * vegetation Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 1.629, year: 2016

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Arnab Ganguly. Articles written in Bulletin of Materials Science. Volume 30 Issue 2 April 2007 pp 183-185 Nanomaterials. Synthesis, characterization and gas sensitivity of MoO3 nanoparticles · Arnab Ganguly Raji George · More Details Abstract Fulltext PDF. Nanoparticles of ...

  5. Why has nature invented three stop codons of DNA and only one start codon?

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Křížek, P.

    2012-01-01

    Roč. 304, Jul 7 (2012), s. 183-187 ISSN 0022-5193 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional support: RVO:67985840 Keywords : DNA * RNA * stop codon * synchronization shift * drosophila genome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.351, year: 2012 http://www.sciencedirect.com/science/article/pii/S0022519312001580

  6. Specialized Plant Metabolism Characteristics and Impact on Target Molecule Biotechnological Production

    Czech Academy of Sciences Publication Activity Database

    Matsuura, H. N.; Malik, S.; de Costa, F.; Yousefzadi, M.; Mirjalili, M. H.; Arroo, R.R.J.; Bhambra, A.S.; Strnad, Miroslav; Bonfill, M.; Fett-Neto, A. G.

    2018-01-01

    Roč. 60, č. 2 (2018), s. 169-183 ISSN 1073-6085 Institutional support: RVO:61389030 Keywords : Genetically engineered cultures * In vitro culture * Natural products * Secondary metabolites * Synthetic biology Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 1.634, year: 2016

  7. IN Hedysarum coronarium L. (FABACEAE)

    African Journals Online (AJOL)

    Agronomie Africaine 12 (3) ; 91-103 (2000) the pod contains one or more aborted seeds. The seed abortion may be an ex- pression of inbreeding depression due to ...... Population characteristics, Heredity, 58: 183 — 192,. YAGOUBl (N) and (A) CHRIKI. 2000 (in press). Estimation of mating system parameters in Hedysarum ...

  8. Secondary School Students' Motivation and Achievement in Combined Science

    Science.gov (United States)

    Chow, Shean Jen; Yong, Bob Chui Seng

    2013-01-01

    This study investigated students' motivation and achievement in combined science. A sample of 324 Year 11 students from eight government secondary schools in Brunei Darussalam participated in the study. Of the sample, 141 were boys and 183 were girls and their average age was 16.4 years. The motivation instrument used was adapted from the science…

  9. Engineering of Paraoxonases for Pre- and Post-treatment of Intoxication by a Broad Spectrum of Nerve Agents and Pesticides

    Science.gov (United States)

    2014-08-01

    PDB code: 3SRG). Depicted are putative hydrogen bonds of D183 and H184 to H2 residues (orange) and to its C-terminal loop ( salmon ), as well to the...TB, Marsillach J, Furlong CE (2013) Paraoxonase 1 (PON1) as a genetic determinant of susceptibility to organophosphate toxicity. Toxicology 307: 115

  10. Effect of intimate partner violence on birth outcomes | Laelago ...

    African Journals Online (AJOL)

    Background: Violence by intimate partner during pregnancy has many adverse pregnancy outcomes. Thus, that's why we sought to determine association between intimate partner violence during pregnancy and adverse birth outcomes. Methods: A facility based cross-sectional study was conducted among 183 recently ...

  11. Isolation and cultivation of planktonic freshwater microbes is essential for a comprehensive understanding of their ecology.

    Czech Academy of Sciences Publication Activity Database

    Salcher, Michaela M.; Šimek, Karel

    2016-01-01

    Roč. 77, č. 3 (2016), s. 183-196 ISSN 0948-3055 R&D Projects: GA ČR(CZ) GA13-00243S Institutional support: RVO:60077344 Keywords : autecology * axenic cultures * dilution to extinction * ecophysiology * genomics * isolation of freshwater microbes * targeted enrichment Subject RIV: EE - Microbiology, Virology Impact factor: 1.633, year: 2016

  12. Isotachophoretic determination of hydrosulfite and metabisulfite in technical samples

    Czech Academy of Sciences Publication Activity Database

    Nováková, Michaela; Křivánková, Ludmila; Bartoš, M.; Urbanová, V.; Vytřas, K.

    2007-01-01

    Roč. 74, č. 2 (2007), s. 183-189 ISSN 0039-9140 R&D Projects: GA ČR GA203/05/2106; GA AV ČR IAA400310703 Institutional research plan: CEZ:AV0Z40310501 Keywords : isotachophoresis * metabisulfite * hydrosulfite Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.374, year: 2007

  13. TRANSIENT ELECTRONICS CATEGORIZATION

    Science.gov (United States)

    2017-08-24

    building transience into critical electronic systems is not new. Anyone who watched the 1970’s television series Mission Impossible is familiar with the...Madou, “MEMS fabrication”, in The MEMS Handbook , CRC Press, New York, NY, Ch. 16, pp1-183, (2002). 20 K. R. Williams, K. Gupta, and M. Wasilik

  14. Identification and characterization of small molecule modulators of the Epstein-Barr virus-induced gene 2 (EBI2) receptor

    DEFF Research Database (Denmark)

    Gessier, Francois; Preuss, Inga; Yin, Hong

    2014-01-01

    Oxysterols have recently been identified as natural ligands for a G protein-coupled receptor called EBI2 (aka GPR183) ( Nature 2011 , 475 , 524 ; 519 ). EBI2 is highly expressed in immune cells ( J. Biol. Chem. 2006 , 281 , 13199 ), and its activation has been shown to be critical for the adaptive...

  15. Language policy and speech practice in Cape Town: An exploratory ...

    African Journals Online (AJOL)

    ... this system, to the detriment of isiXhosa. Where medical interpreters are available, the state health services appear to be superior, particularly for unilingual isiXhosa speakers. Most facilities are however without officially trained interpreters. Southern African Linguistics and Applied Language Studies 2008, 26(1): 171–183 ...

  16. 75 FR 60231 - Acephate, Cacodylic Acid, Dicamba, Dicloran, et al.; Tolerance Actions

    Science.gov (United States)

    2010-09-29

    ..., cabbage, cauliflower, cotton, coffee green beans, and asparagus, and by 2 additional years for head and... of June 30, 2014, and the tolerance in 40 CFR 180.183(c) on asparagus with an expiration/ revocation...; and asparagus with expiration dates of December 31, 2013; disulfoton tolerances on lettuce, head and...

  17. Product ion distributions for the reactions of NO+ with some N-containing and O-containing heterocyclic compounds obtained using SRI-TOF-MS

    Czech Academy of Sciences Publication Activity Database

    Mochalski, P.; Unterkofler, K.; Španěl, Patrik; Smith, D.; Amann, A.

    2015-01-01

    Roč. 386, JUL 2015 (2015), s. 42-46 ISSN 1387-3806 Institutional support: RVO:61388955 Keywords : heterocyclic compounds * SRI-TOF-MS * NO+ reactions Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.183, year: 2015

  18. What Makes Proteges Take Mentors' Advice in Formal Mentoring Relationships?

    Science.gov (United States)

    Son, SuJin; Kim, Do-Yeong

    2013-01-01

    This study examines the factors affecting a protege's willingness to take a mentor's advice. The sample for this study consisted of 183 proteges from two different South Korean organizations who were part of formal mentoring programs. We found protege commitment to be the principal factor that predisposes a protege to take advice from mentors and…

  19. Performance of the multitarget Mikrogen Chlamydia trachomatis IgG ELISA in the prediction of tubal factor infertility (TFI) in subfertile women : Comparison with the Medac MOMP IgG ELISA plus

    NARCIS (Netherlands)

    van Ess, Eleanne F.; Ouburg, Sander; Spaargaren, Joke; Land, Jolande A.; Morre, Servaas A.

    2017-01-01

    There is a need for more accurate Chlamydia trachomatis (CT) IgG antibody tests for tubal factor infertility (TFI) diagnostics. We evaluated the predictive value for TFI of Medac ELISA plus (MOMP) and multitarget Mikrogen ELISA (MOMP-CPAF-TARP). Based on Medac ELISA plus results, 183 subfertile

  20. Pattern of pathogens from surgical wound infections in a Nigerian ...

    African Journals Online (AJOL)

    Results: Bacterial pathogens were isolated from all the specimens while the yeast Candida species (spp) was isolated from 12.4%. Staphylococcus aureus was the most frequent organism isolated accounting for 23 (18.3%) of a total of 126 isolates. Other organisms were Pseudomonas aeruginosa and Bacillus spp 11.1% ...

  1. Separation of trivalent actinides and lanthanides from simulated high-level waste using cobalt bis(dicarbollide) ion derivate substituted with diphenyl-N-tert.octyl-carbamoylmethylphosphine oxide

    Czech Academy of Sciences Publication Activity Database

    Selucký, P.; Lučaníková, M.; Grüner, Bohumír

    2012-01-01

    Roč. 100, č. 3 (2012), s. 179-183 ISSN 0033-8230 R&D Projects: GA MŠk LC523; GA ČR GA104/09/0668 Institutional research plan: CEZ:AV0Z40320502 Keywords : dicarbollide * CMPO * liquid-liquid extraction * actinides * lanthanides Subject RIV: CA - Inorganic Chemistry Impact factor: 1.373, year: 2012

  2. Simultaneous determination of the elastic modulus and density/thickness of ultrathin films utilizing micro-/nanoresonators under applied axial force

    Czech Academy of Sciences Publication Activity Database

    Stachiv, Ivo; Zapoměl, Jaroslav; Chen, Y.-L.

    2014-01-01

    Roč. 115, č. 12 (2014), "124304-1"-"124304-6" ISSN 0021-8979 Institutional support: RVO:68378271 ; RVO:61388998 Keywords : elastic moduli * thin films * polymer films * vibration resonance * thin film deposition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  3. Soil nematodes in cambisol agroecosystems of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    2003-01-01

    Roč. 58, č. 2 (2003), s. 205-216 ISSN 0006-3088 R&D Projects: GA AV ČR KSK6005114 Keywords : Nematoda * community structure * abundance Subject RIV: EH - Ecology, Behaviour Impact factor: 0.183, year: 2003

  4. Deepwater Ports Approach/Exit Hazard and Risk Assessment.

    Science.gov (United States)

    1979-02-01

    Foreign Vessels 183 • 4. Fault Tree Analysis 184 B. Hazard Ranking 194 1. Ranking By Vessel Casualty Data 194 2. Auxiliar y Casualty Information 201 3...hydraulic system — 2. a. Piping — 1. 5. Steering gear: pumps -- 2. a. Auxiliar y system turbines and gears: governing system -- 1. b. Hull - general -- 1

  5. Energy transfer processes in Ca.sub.3./sub.Tb.sub.2-x./sub.Eu.sub.x./sub.Si.sub.3./sub.O.sub.12./sub. (x = 0–2)

    Czech Academy of Sciences Publication Activity Database

    Carrasco, I.; Bartosiewicz, Karol; Nikl, Martin; Piccinelli, F.; Bettinelli, M.

    2015-01-01

    Roč. 48, Oct (2015), s. 252-257 ISSN 0925-3467 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : phosphors * silico-carnotite * luminescence * energy transfer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.183, year: 2015

  6. Genetic structure and variability within and among populations of the ...

    African Journals Online (AJOL)

    This study investigates the genetic diversity and the structure of the most dominant native fat-tailed Tunisian sheep breed (Barbarine, BAR) using microsatellite markers. Blood samples from 183 BAR animals, belonging to 4 subpopulations according to phenotypic traits, were collected across all regions in Tunisia.

  7. Polybrominated diphenyl ethers (PBDEs) in the indoor environment and associations with prenatal exposure

    DEFF Research Database (Denmark)

    Vorkamp, Katrin; Thomsen, Marianne; Frederiksen, Marie

    2011-01-01

    As part of a larger exposure study, samples of dust and indoor air were collected in the homes of 43 pregnant women living in the Copenhagen area (Denmark) and analysed for 12 polybrominated diphenyl ethers using GC-MS. A second dust sample collected after delivery was analysed for BDE-183 and BD...

  8. Long-term Periodicity Analysis of Polarization Variation for Radio ...

    Indian Academy of Sciences (India)

    Kochanev, P. Yu., Gabuzda, D. C. 1998, In: Radio Emission From Galactic and Extragalactic. Compact Sources (eds) Zensus, J. A., Taylor, G. B., Wrobel, J. M., San Francisco: ASP, p. 273. Lomb, N. R. 1976, ApS&S, 39, 447. Mead, A. R. G., Ballard, K. R., Brand, P. W. J. L. et al. 1990, Astron. Astrophys. Suppl. Ser.,. 83, 183.

  9. Optical Spectra Evolution of BL Lac Objects XW Bi1,∗ , BZ Wang2 ...

    Indian Academy of Sciences (India)

    Mead, A. R. G., Ballard, K. R., Brand, P. W. J. L. et al. 1990, Astron. Astrophys. Suppl.,. 83, 183. Qian, B. C., Tao, J. 2002, Astron. J., 123, 678. Qian, B. C., Tao, J. 2004, Publ. Astron. Soc. Pacific, 116, 161. Rieke G. H., Lebofsky M. J. 1985, Astrophys. J., 288, 618. Schlegel D. J., Finkbeiner D. P., Davis M. 1998, Astrophys.

  10. Sporting Equipment and Students\\' Academic Performance in the ...

    African Journals Online (AJOL)

    This study investigated the effect of sporting equipment on students academic performance in the concept of projectile in Nigerian senior secondary school Physics in Uyo Local Government Area of Akwa Ibom State, Nigeria. A total of 183 senior secondary two (SS2) Physics students were involved in the study. The design ...

  11. Evaluation of Turf-type Interspecific Hybrids of Meadow Fescue with Perennial Ryegrass for Improved Stress Tolerance

    Czech Academy of Sciences Publication Activity Database

    Barnes, B.D.; Kopecký, David; Lukaszewski, A.J.; Baird, J. H.

    2014-01-01

    Roč. 54, č. 1 (2014), s. 355-365 ISSN 0011-183X R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : LOLIUM-FESTUCA COMPLEX * TALL FESCUE * INTERGENERIC HYBRIDS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.575, year: 2014

  12. Palindromic widths of nilpotent and wreath products

    Indian Academy of Sciences (India)

    2Siberian University of Consumer Cooperatives, Novosibirsk 630087, Russia. 3Department of Mathematical Sciences, Indian Institute of Science Education and Research ..... [2] Bardakov V, On the theory of braid groups, Russian Acad. Sci., Sb., Math. 76(1) (1993). 123–153, translation from Mat. Sb. 183(6) (1992) 3–42.

  13. Comparison of Outpatient Services between Elderly People with Intellectual Disabilities and the General Elderly Population in Taiwan

    Science.gov (United States)

    Hsu, Shang-Wei; Lin, Jin-Ding; Chiang, Po-Huang; Chang, Yu-Chia; Tung, Ho-Jui

    2012-01-01

    This study aims to analyze the ambulatory visit frequency and medical expenditures of the general elderly population versus the elderly with intellectual disabilities in Taiwan, while examining the effects of age, gender, urbanization and copayment status on ambulatory utilization. A cross-sectional study was conducted to analyze data from 103,183

  14. EBI2, GPR18 and GPR17--three structurally related, but biologically distinct 7TM receptors

    DEFF Research Database (Denmark)

    Nørregaard, Kristine; Benned-Jensen, Tau; Rosenkilde, Mette Marie

    2011-01-01

    have been deorphanized, many remain orphan, and these orphan receptors constitute a large pool of potential drug targets. This review focuses on one of these orphan targets, the Epstein-Barr Virus-induced receptor 2, EBI2 (or GPR183), together with two structurally related receptors, GPR17 and GPR18...

  15. The power of direct context as revealed by eye tracking: A model tracks relative attention to competing editorial and promotional content

    NARCIS (Netherlands)

    Smit, E.G.; Boerman, S.C.; van Meurs, L.

    2015-01-01

    Many previous studies on attention have ignored the eye-catching potential of 'direct context'—the entire promotional and editorial content an observer can view at the same time—in print media. In the current study, characteristics of 183 magazine advertisements and their direct context were coded

  16. Autoxidated linolenic acid inhibits aflatoxin biosynthesis in Aspergillus flavus via oxylipin species.

    Science.gov (United States)

    Yan, Shijuan; Liang, Yating; Zhang, Jindan; Chen, Zhuang; Liu, Chun-Ming

    2015-08-01

    Aflatoxins produced by Aspergillus species are among the most toxic and carcinogenic compounds in nature. Although it has been known for a long time that seeds with high oil content are more susceptible to aflatoxin contamination, the role of fatty acids in aflatoxin biosynthesis remains controversial. Here we demonstrate in A. flavus that both the saturated stearic acid (C18:0) and the polyunsaturated linolenic acid (C18:3) promoted aflatoxin production, while C18:3, but not C18:0, inhibited aflatoxin biosynthesis after exposure to air for several hours. Further experiments showed that autoxidated C18:3 promoted mycelial growth, sporulation, and kojic acid production, but inhibited the expression of genes in the AF biosynthetic gene cluster. Mass spectrometry analyses of autoxidated C18:3 fractions that were able to inhibit aflatoxin biosynthesis led to the identification of multiple oxylipin species. These results may help to clarify the role of fatty acids in aflatoxin biosynthesis, and may explain why controversial results have been obtained for fatty acids in the past. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. De exportrelatie tussen de regio Zwolle en Duitsland : rapportage over de huidige export en het export potentieel vanuit de regio Zwolle met Duitsland

    NARCIS (Netherlands)

    Huub Ruël

    2014-01-01

    Exportwaarde vanuit Nederland en Overijssel De totale waarde van de Nederlandse export bedroeg 453,4 miljard Euro (2012) . De export vanuit de provincie Overijssel bedroeg 18,3 miljard Euro (2012) . In totaal zijn in de regio Zwolle 20,1% van de bedrijven internationaal actief of in buitenlandse

  18. AcEST: DK953483 [AcEST

    Lifescience Database Archive (English)

    Full Text Available haracterized protein OS=Popul... 217 5e-55 tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annon...VPVRVHKNNGEANN 179 Query: 560 HVPN 571 PN Sbjct: 180 FFPN 183 >tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 183-189 Inorganic. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide · N Raman Y ... are reported. pp 191-196 Organic. A convenient procedure for the synthesis of allyl and benzyl ethers from alcohols and phenols.

  20. Experiment list: SRX122464 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available antibody=Relb || treatment=LPS || time=0 min || chip antibody manufacturer 1=Bethyl || chip antibody catalog... number 1=A302-183A || chip antibody manufacturer 2=Santa Cruz || chip antibody catalog number 2=sc-226 htt

  1. Experiment list: SRX122466 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available p antibody=Relb || treatment=LPS || time=30 min || chip antibody manufacturer 1=Bethyl || chip antibody catalog... number 1=A302-183A || chip antibody manufacturer 2=Santa Cruz || chip antibody catalog number 2=sc-226 h

  2. F-18-FLT PET for visualization of laryngeal cancer : Comparison with F-18-FDG PET

    NARCIS (Netherlands)

    Cobben, DCP; van der Laan, BFAM; Maas, B; Vaalburg, W; Suurmeijer, AJH; Hoekstra, HJ; Jager, PL; Elsinga, PH

    The feasibility of F-18-3'-fluoro-3'-deoxy-L-thymidine PET (FLT PET) for detecting laryngeal cancer was investigated and compared with F-18-FDG PET. Methods: Eleven patients diagnosed with or strongly suspected of having recurrent laryngeal cancer and 10 patients with histologically proven primary

  3. Po stopách sv. Cyrila a Metoda v slovenskej a českej bibliografii v rámci bilaterálnej spolupráce

    Czech Academy of Sciences Publication Activity Database

    Havlíková, Lubomíra; Hetényi, M.; Ivanič, P.; Taneski, Z.

    2011-01-01

    Roč. 4, - (2011), s. 183 ISSN 1337-8740 R&D Projects: GA MŠk(CZ) MEB0810026 Institutional research plan: CEZ:AV0Z90920516 Keywords : Cyrilo-Methodian bibliography * Czech-Slovak collaboration Subject RIV: AB - History http://www.ukm.ff.ukf.sk/wp-content/uploads/2011/09/konstantinove-listy-2011-prispevky.pdf

  4. Determination of the average lifetime of bottom hadrons

    International Nuclear Information System (INIS)

    Althoff, M.; Braunschweig, W.; Kirschfink, F.J.; Martyn, H.U.; Rosskamp, P.; Schmitz, D.; Siebke, H.; Wallraff, W.; Hilger, E.; Kracht, T.; Krasemann, H.L.; Leu, P.; Lohrmann, E.; Pandoulas, D.; Poelz, G.; Poesnecker, K.U.; Duchovni, E.; Eisenberg, Y.; Karshon, U.; Mikenberg, G.; Mir, R.; Revel, D.; Shapira, A.; Baranko, G.; Caldwell, A.; Cherney, M.; Izen, J.M.; Mermikides, M.; Ritz, S.; Rudolph, G.; Strom, D.; Takashima, M.; Venkataramania, H.; Wicklund, E.; Wu, S.L.; Zobernig, G.

    1984-01-01

    We have determined the average lifetime of hadrons containing b quarks produced in e + e - annihilation to be tausub(B)=1.83x10 -12 s. Our method uses charged decay products from both non-leptonic and semileptonic decay modes. (orig./HSI)

  5. Environmental Factors that Determine Visual Skill Development of ...

    African Journals Online (AJOL)

    AOR 1.83; 95% CI 1.05–3.30), those who lived in large households (AOR 2.34; 95% CI 1.32–3.14), children whose mothers had secondary level education and below (AOR 2.21; 95% CI 1.31–3.83), and those whose fathers earned ≤$100 per ...

  6. Role of bacterial biofertilizers in agriculture and forestry

    Czech Academy of Sciences Publication Activity Database

    García-Fraile, Paula; Menendéz, E.; Rivas, R.

    2015-01-01

    Roč. 2, č. 3 (2015), s. 183-205 ISSN 2306-5354 R&D Projects: GA MŠk(CZ) EE2.3.30.0003 Institutional support: RVO:61388971 Keywords : plant growth-promoting Rhizobacteria * sustainable agriculture * biofertilizers Subject RIV: EE - Microbiology, Virology

  7. Cuparane sesquiterpenes from Laurencia natalensis Kylin as inhibitors of alpha-glucosidase, dipeptidyl peptidase IV and xanthine oxidase

    Czech Academy of Sciences Publication Activity Database

    Rengasamy, K.R.R.; Poštová Slavětínská, Lenka; Kulkarni, M. G.; Stirk, W. A.; Van Staden, J.

    2017-01-01

    Roč. 25, Jul (2017), s. 178-183 ISSN 2211-9264 Institutional support: RVO:61388963 Keywords : 1-deoxyalgoane * dipeptidyl peptidase IV * diabetes * gout * Laurencia natalensis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 3.994, year: 2016

  8. Wastewater disposal at safari lodges in the Okavango Delta, Botswana

    African Journals Online (AJOL)

    driniev

    2004-01-01

    Jan 1, 2004 ... their wastewater via soak-aways, creating a potential risk of contamination of their water supply. Most islands in the Delta ... in the Okavango Delta. Key words: Okavango Delta; wastewater disposal; field bacteriological screening ... groundwater 183 m from a wastewater point source. Viruses in particular ...

  9. Terbium induced glassy magnetism in La,Ca-based cobaltites

    Czech Academy of Sciences Publication Activity Database

    Maryško, Miroslav; Hejtmánek, Jiří; Jirák, Zdeněk; Kaman, Ondřej; Knížek, Karel

    2014-01-01

    Roč. 115, č. 17 (2014), "17E103 -1"-"17E103 -3" ISSN 0021-8979 R&D Projects: GA ČR(CZ) GAP204/11/0713 Institutional support: RVO:68378271 Keywords : terbium * cobalt * magnetic susceptibilities Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  10. From the Variscan to the Alpine Orogeny: crustal structure of the Bohemian Massif and the Western Carpathians in the light of the SUDETES 2003 seismic data

    Czech Academy of Sciences Publication Activity Database

    Hrubcová, Pavla; Środa, P.; Grad, M.; Geissler, W.H.; Guterch, A.; Vozár, J.; Hegedüs, E.

    2010-01-01

    Roč. 183, č. 2 (2010), s. 611-633 ISSN 0956-540X R&D Projects: GA ČR GAP210/10/2063 Institutional research plan: CEZ:AV0Z30120515 Keywords : controlled source seismology * body waves * continental margins: convergent * crustal structure * Europe Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.411, year: 2010

  11. Reduction of ploidy level by androgenesis in intergeneric Lolium-Festuca hybrids for turf grass breeding

    Czech Academy of Sciences Publication Activity Database

    Kopecký, David; Lukaszewski, A.J.; Gibeault, V.

    2005-01-01

    Roč. 45, č. 1 (2005), s. 274-281 ISSN 0011-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : anther culture * pentaploid hybrids * perenne L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.925, year: 2005

  12. Improving cost- effectiveness of hypertension management at a ...

    African Journals Online (AJOL)

    antihypertensive drugs on prescribing patterns, costs of drug treatment and blood pressure (BP) control. Design. ... reviews, therapeutic guidelines and clinical audit.' Hypertension is a major public health problem in South. Africa ..... Evaluation and Treatment of High Slood Pressure. Arch Intern Med 1993; 153: 154-183. 7.

  13. Causes and Risk Factors for Maternal Mortality in Rural Tanzania ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    Salud. Publica de Mexico 2006;48(3):183-92. 28. Mbonye A. Risk factors associated with maternal deaths in health units in Uganda. African Journal of. Reproductive Health 2001;5(3). 29. Evjen-Olsen B, Hinderaker SG, Lie RT, Bergsjo P,. Gasheka P, Kvale G. Risk factors for maternal death in the highlands of rural northern ...

  14. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... pp 183-193. Pterospermumocarpon, a new malvalean fruit from the Sindhudurg Formation (Miocene) of Maharashtra, India, and its phytogeographical significance ... Lagerstroemia L. from the middle Miocene Siwalik deposits, northern India: Implication for Cenozoic range shifts of the genus and the family Lythraceae.

  15. Shape Oscillations of an Oil Drop Rising in Water : Effect of Surface Contamination

    Czech Academy of Sciences Publication Activity Database

    Abi Chebel, N.; Vejražka, Jiří; Masbernat, O.; Risso, F.

    Roč. 702, JUL 10 ( 2012 ), s. 533-542 ISSN 0022-1120 R&D Projects: GA ČR GAP101/11/0806 Institutional support: RVO:67985858 Keywords : bubble dynamics * drops * drops and bubbles Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.183, year: 2012

  16. Self-induced vomiting – risk for oesophageal cancer? | Matsha ...

    African Journals Online (AJOL)

    Furthermore, self-induced vomiting was found to be significantly and independently associated with oesophageal chronic inflammation (odds ratio 1.83, 95% confidence interval: 1.13 - 2.96, p = 0.013). Conclusion: While the association between the cultural practice of self-induced vomiting and oesophageal cancer has ...

  17. Packing of Renal Fossa: Useful Technique for Intractable Bleeding ...

    African Journals Online (AJOL)

    The main wound was closed in layers for better tamponade effect. One 30F tube drain was also kept which ... She developed urinary fistula which closed spontaneously after. 2 weeks. The renal functions were normal even ... Innovation in surgery: the rules of evidence. Am J. Surg 2002;183:399-405. How to cite this article: ...

  18. Optimization-Based Selection of Influential Agents in a Rural Afghan Social Network

    Science.gov (United States)

    2010-06-01

    Awakens: The Tipping Point," Military Review, pp. 41-52, March-April 2008. [54] Fotini Christia , "Flipping the Taliban," Foreign Affairs, vol. 88, no. 4...183 [92] Andrew Beath, Fotini Christia , and Ruben Enikolopov, "Baseline Survey Report," Randomized Impact Evaluation of Afghanistan’s National

  19. Carbonic anhydrase IX is not an independent predictor of outcome for patients with clear cell renal cell carcinoma

    Czech Academy of Sciences Publication Activity Database

    Leibovich, B. C.; Sheinin, Y.; Lohse, Ch. M.; Thompson, R. H.; Cheville, J. C.; Závada, Jan; Kwon, E. D.

    2007-01-01

    Roč. 25, č. 30 (2007), s. 4757-4764 ISSN 0732-183X Institutional research plan: CEZ:AV0Z40550506 Keywords : renal carcinoma * CAIX antigen * prognostics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 15.484, year: 2007

  20. Oxidative degradation of dyes in water using Co2+/H2O2 and Co2+/peroxymonosulfate.

    Science.gov (United States)

    Ling, Sie King; Wang, Shaobin; Peng, Yuelian

    2010-06-15

    Dye degradation using advanced oxidation processes with Co(2+)/H(2)O(2) and Co(2+)/peroxymonosulfate (PMS) systems has been investigated. Two types of dyes, basic blue 9 and acid red 183, were employed. Several parameters affecting dye degradation such as Co(2+), PMS, H(2)O(2), and dye concentrations were investigated. The optimal ratio of oxidant (PMS, H(2)O(2))/Co(2+) for the degradation of two dyes was determined. It is found that dye decomposition is much faster in Co(2+)/PMS system than in Co(2+)/H(2)O(2). For Co(2+)/H(2)O(2), an optimal ratio of H(2)O(2) to Co(2+) at 6 is required for the maximum decomposition of the dyes. For Co(2+)/PMS, higher concentrations of Co(2+) and PMS will increase dye degradation rate with an optimal ratio of 3, achieving 95% decolourisation. For basic blue 9, a complete decolourisation can be achieved in 5 min at 0.13 mM Co(2+), 0.40 mM PMS and 7 mg/l basic blue 9 while the complete degradation of acid red 183 will be achieved at 30 min at 0.13 mM Co(2+), 0.40 mM PMS and 160 mg/l of acid red 183. The degradation of acid red 183 follows the second-order kinetics. Copyright 2010 Elsevier B.V. All rights reserved.