Fabrication of lithium/C-103 alloy heat pipes for sharp leading edge cooling
Ai, Bangcheng; Chen, Siyuan; Yu, Jijun; Lu, Qin; Han, Hantao; Hu, Longfei
2018-05-01
In this study, lithium/C-103 alloys heat pipes are proposed for sharp leading edge cooling. Three models of lithium/C-103 alloy heat pipes were fabricated. And their startup properties were tested by radiant heat tests and aerothermal tests. It is found that the startup temperature of lithium heat pipe was about 860 °C. At 1000 °C radiant heat tests, the operating temperature of lithium/C-103 alloy heat pipe is lower than 860 °C. Thus, startup failure occurs. At 1100 °C radiant heat tests and aerothermal tests, the operating temperature of lithium/C-103 alloy heat pipe is higher than 860 °C, and the heat pipe starts up successfully. The startup of lithium/C-103 alloy heat pipe decreases the leading edge temperature effectively, which endows itself good ablation resistance. After radiant heat tests and aerothermal tests, all the heat pipe models are severely oxidized because of the C-103 poor oxidation resistance. Therefore, protective coatings are required for further applications of lithium/C-103 alloy heat pipes.
Preparation technology of 103Pd-110Agm composite alloy membranes
International Nuclear Information System (INIS)
Liu Zhuo; Chen Daming; Jin Xiaohai; Li Zhongyong; Guo Feihu; Qin Hongbin
2012-01-01
The preparation of 103 Pd- 110 Ag m alloy membranes was the basis for the production of 103 Pd- 125 I composite sources. Taking 103 Pd and 110 Ag m as trace elements, the method of non-electrolytical plating was chosen to prepare the alloy membrane. A γ-detector and electron microscope (SEM) were used for quantitative and qualitative analysis, respectively. The pre-treatment of the support before the preparation of Palladium-silver composite membranes was discussed in detail. It was found that when the concentration of PdCl 2 was between 0.5 and 2.0 mmol/L the result was good. The effects of various factors were investigated, including the proportion of Pd and Ag, the concentrations of the total metal, ammonium hydroxide hydrazine and ethylenediaminetetraacetic acid, temperature, the time, and the rotation speed. By improving the reaction conditions the alloy membrane with metallic luster was obtained. Besides, the presence of Pd and Ag was observed in the alloy membranes by qualitative analysis. (authors)
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT
Effects of Fe and Cr on corrosion behavior of ZrFeCr alloys in 500 oC steam
International Nuclear Information System (INIS)
Wang Jun; Fan Hongyuan; Xiong Ji; Liu Hong; Miao Zhi; Ying Shihao; Yang Gang
2011-01-01
Research highlights: Amount and size of SPP will effect the corrosion resistance of Zr alloy at 500 o C/10.3 MPa. - Abstract: A study of the corrosion behaviors of ZrFeCr alloy and the influence of microstructure on corrosion resistance are described by X-ray diffraction and scanning electron microscope in this paper. The results show that several ZrFeCr alloys exhibit protective behavior throughout the test and oxide growth is stable and protective. The best alloy has the composition Zr1.0Fe0.6Cr. Fitting of the weight gain curves for the protective oxide alloys in the region of protective behavior, it showed nearly cubic behavior for the most protective alloys. The Zr1.0Fe0.6Cr has the more laves Zr(Fe,Cr) 2 precipitate in matrix and it has the better corrosion resistance. The Zr0.2Fe0.1Cr has little precipitate, the biggest hydrogen absorption and the worst corrosion resistance. The number of precipitates and the amount of hydrogen absorption in Zr alloy plays an important role on corrosion resistance behaviors in 500 o C/10.3 MPa steam.
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
Tank 24-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-05-01
Information regarding flammable vapors, gases, and aerosols is presented and interpreted to help resolve the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. Concern that the headspace of tank 241-C-103 may contain a flammable mixture of organic vapors and an aerosol of combustible organic liquid droplets arises from the presence of a layer of organic liquid in the tank. This organic liquid is believed to have originated in the plutonium-uranium extraction (PUREX) process, having been stored initially in tank 241-C-102 and apparently transferred to tank 241-C-103 in 1975 (Carothers 1988). Analyses of samples of the organic liquid collected in 1991 and 1993 indicate that the primary constituents are tributyl phosphate (TBP) and several semivolatile hydrocarbons (Prentice 1991, Pool and Bean 1994). This is consistent with the premise that the organic waste came from the PUREX process, because the PUREX process used a solution of TBP in a diluent composed of the n-C 11 H 24 to n-C 15 H 32 normal paraffinic hydrocarbons (NPH)
Effect of mechanical alloying on FeCrC reinforced Ni alloys
Energy Technology Data Exchange (ETDEWEB)
Yilmaz, S. Osman [Univ. of Namik Kemal, Tekirdag (Turkey); Teker, Tanju [Adiyaman Univ. (Turkey). Dept. of Metallurgical and Materials Engineering; Demir, Fatih [Batman Univ. (Turkey)
2016-05-01
Mechanical alloying (MA) is a powder metallurgy processing technique involving cold welding, fracturing and rewelding of powder particles in a high-energy ball mill. In the present study, the intermetallic matrix composites (IMCs) of Ni-Al reinforced by M{sub 7}C{sub 3} were produced by powder metallurgical routes via solid state reaction of Ni, Al and M{sub 7}C{sub 3} particulates by mechanical alloying processes. Ni, Al and M{sub 7}C{sub 3} powders having 100 μm were mixed, mechanical alloyed and the compacts were combusted in a furnace. The mechanically alloyed (MAed) powders were investigated by X-ray diffraction (XRD), microhardness measurement, optic microscopy (OM), scanning electron microscopy (SEM) and energy dispersive spectrometry (EDS). The presence of the carbides depressed the formation of unwanted NiAl intermetallic phases. The mechanical alloyed M{sub 7}C{sub 3} particles were unstable and decomposed partially within the matrix during alloying and sintering, and the morphology of the composites changed with the dissolution ratio of M{sub 7}C{sub 3} and sintering temperature.
Synthesis Of NiCrAlC alloys by mechanical alloying
International Nuclear Information System (INIS)
Silva, A.K.; Pereira, J.I.; Vurobi Junior, S.; Cintho, O.M.
2010-01-01
The purpose of the present paper is the synthesis of nickel alloys (NiCrAlC), which has been proposed like a economic alternative to the Stellite family Co alloys using mechanical alloying, followed by sintering heat treatment of milled material. The NiCrAlC alloys consist of a chromium carbides dispersion in a Ni 3 Al intermetallic matrix, that is easily synthesized by mechanical alloying. The use of mechanical alloying enables higher carbides sizes and distribution control in the matrix during sintering. We are also investigated the compaction of the processed materials by compressibility curves. The milling products were characterized by X-ray diffraction, and the end product was featured by conventional metallography and scanning electronic microscopy (SEM), that enabled the identification of desired phases, beyond microhardness test, which has been shown comparable to alloys manufactured by fusion after heat treating. (author)
International Nuclear Information System (INIS)
Whelan, E.P.; Kalns, E.
1987-01-01
This patent describes, as an article of manufacture, a cast ingot of a molybdenum-hafnium-carbon alloy consisting essentially by weight of about 0.6% to about 1% Hf, about 0.045% to about 0.08% C, and the balance essentially molybdenum. The amount of Hf and C present are substantially stoichiometric with respect to HfC and within about +-15% of stoichiometry. The ingot is characterized in that it has a substantially less tendency to crack compared to alloys containing Hf in excess of about 1% by weight and carbon in excess of 0.08% by weight, without substantial diminution in strength properties of the alloy
Safety evaluation for the interim stabilization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.
Safety evaluation for the interim stabilization of Tank 241-C-103
International Nuclear Information System (INIS)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed
Grain refinement of an AZ63B magnesium alloy by an Al-1C master alloy
Energy Technology Data Exchange (ETDEWEB)
Yichuan Pan; Xiangfa Liu; Hua Yang [The Key Lab. of Liquid Structure and Heredity of Materials, Shandong Univ., Jinan (China)
2005-12-01
In order to develop a refiner of Mg-Al alloys, an Al-1C (in wt.%) master alloy was synthesized using a casting method. The microstructure and grain-refining performance of the Al-1C master alloy were investigated using X-ray diffraction (XRD), electron probe microanalysis (EPMA) and a grain-refining test. The microstructure of the Al-1C master alloy is composed of {alpha}-Al solid solution, Al{sub 4}C{sub 3} particles, and graphite phases. After grain refinement of AZ63B alloy by the Al-1C master alloy, the mean grain size reached a limit when 2 wt.% Al-C master alloy was added at 800 C and held for 20 min in the melt before casting. The minimum mean grain size is approximately 48 {mu}m at the one-half radius of the ingot and is about 17% of that of the unrefined alloy. The Al-1C master alloy results in better grain refinement than C{sub 2}Cl{sub 6} and MgCO{sub 3} carbon-containing refiners. (orig.)
Kinetics of bainite precipitation in the Cu{sub 69.3}Al{sub 18.8}Mn{sub 10.3}Ag{sub 1.6} alloy
Energy Technology Data Exchange (ETDEWEB)
Motta, M.B.J.L. [Departamento de Ciências Exatas e da Terra, UNIFESP, Diadema, SP (Brazil); Adorno, A.T.; Santos, C.M.A. [Departamento de Físico-Química, IQ-UNESP, Araraquara, SP (Brazil); Silva, R.A.G., E-mail: galdino.ricardo@gmail.com [Departamento de Ciências Exatas e da Terra, UNIFESP, Diadema, SP (Brazil)
2017-02-15
In this work the kinetics of bainite precipitation in the Cu{sub 69.3}Al{sub 18.8}Mn{sub 10.3}Ag{sub 1.6} alloy was studied using measurements of microhardness change with aging time, scanning electron microscopy (SEM), energy dispersive X-ray (EDX) analyses, measurements of magnetization change with applied field and high-resolution transmission electron microscopy (HRTEM). The results showed that the bainite precipitation is responsible for the hardness increase in the Cu{sub 69.3}Al{sub 18.8}Mn{sub 10.3}Ag{sub 1.6} alloy. The activation energy value obtained for the bainite precipitation is lower than that found in the literature. This was attributed to the presence of Ag dissolved in matrix and the occurrence of the Cu{sub 3}Al(DO{sub 3}) → Cu{sub 2}AlMn(L2{sub 1}) ordering reaction together with the bainite precipitation. - Highlights: • The activation energy for the bainite precipitation in the Cu{sub 69.3}Al{sub 18.8}Mn{sub 10.3}Ag{sub 1.6} alloy is around 33 kJ/mol. • During bainite precipitation the Cu{sub 2}AlMn phase formation occurs. • The Cu{sub 3}Al(DO{sub 3}) → Cu{sub 2}AlMn(L2{sub 1}) ordering reaction interferes in the activation energy value.
Crevice corrosion propagation on alloy 625 and alloy C276 in natural seawater
International Nuclear Information System (INIS)
McCafferty, E.; Bogar, F.D.; Thomas, E.D. II; Creegan, C.A.; Lucas, K.E.; Kaznoff, A.I.
1997-01-01
Chemical composition of the aqueous solution within crevices on two different Ni-Cr-Mo-Fe alloys immersed in natural seawater was determined using a semiquantitative thin-layer chromatographic method. Active crevices were found to contain concentrated amounts of dissolved Ni 2+ , Cr 3+ , Mo 3+ , and Fe 2+ ions. Propagation of crevice corrosion for the two alloys was determined from anodic polarization curves in model crevice solutions based upon stoichiometric dissolution or selective dissolution of alloy components. Both alloys 625 (UNS N06625) and C276 (UNS N10276) underwent crevice corrosion in the model crevice electrolytes. For the model crevice solution based upon selective dissolution of alloy constituents, the anodic dissolution rate for alloy 625 was higher than that for alloy C276. This trend was reversed for the model crevice solution based upon uniform dissolution of alloy constituents
Texture development in Al-Mg alloys during high temperature annealing
International Nuclear Information System (INIS)
Saitou, T.; Inagaki, H.
2001-01-01
To clarify the effect of Mg content on annealing textures developed in Al-Mg alloys during high temperature annealing, Al-Mg alloys containing up to 9 wt.% Mg in supersaturated solid solution were cold rolled 95% and isothermally annealed at 450 C. Their textures were investigated with the orientation distribution function analysis. It was found that, in the recrystallization textures observed at complete recrystallization, addition of more than 1 wt.% Mg was sufficient to suppress the development of {100} left angle 001 right angle. With increasing Mg content, {100} left angle 001 right angle decreased remarkably, whereas {100} left angle 013 right angle and {103} left angle 321 right angle increased. Thus, {100} left angle 013 right angle and {103} left angle 321 right angle were found to be the main orientations of the recrystallization textures of Al-Mg alloys annealed at high temperatures. {100} left angle 013 right angle developed most remarkably at 4 wt.% Mg, while {103} left angle 321 right angle showed the maximum development at 7 wt.% Mg. During subsequent grain growth at 450 C, remarkable texture changes were observed only in the alloys containing Mg in the range between 2 and 4 wt.%. In these alloys, {100} left angle 013 right angle developed at the expense of {100} left angle 001 right angle at earlier stages of grain growth, whereas {103} left angle 321 right angle increased independently of these two orientations at later stages of grain growth. Reflecting these texture changes, grain growth occurred in these alloys discontinuously. Such a discontinuous grain growth with large texture changes is expected, if strong textures are already present before grain growth, and if recrystallized grains having similar orientations are distributed by forming large clusters before grain growth. (orig.)
Mode of carbide TiC-ZrC alloy fracture at various temperatures
Energy Technology Data Exchange (ETDEWEB)
Paderno, V.N.; Lesnaya, M.I.; Martynenko, A.N.; Chugunova, S.I. (AN Ukrainskoj SSR, Kiev. Inst. Problem Materialovedeniya; Khersonskij Gosudarstvennyj Pedagogicheskij Inst. (Ukrainian SSR))
1983-05-01
Bending strength is studied for mutual TiC-ZrC alloys within a temperature range of 20-600 deg C. Structure of the material failure surface is studied from replicas by scanning and transmission electron microscopy. The data obtained are compared with concentration dependences of some physical properties of these alloys. Bending strength is shown to be minimum for the alloy with 40 mol % of zirconium carbide. It is stated that within the temperature range under study the carbide alloys undergo macroscopic brittle failure. The materials are characterized by a mixed type of failure with transcrystalline failure somewhat prevailing.
Mode of carbide TiC-ZrC alloy fracture at various temperatures
International Nuclear Information System (INIS)
Paderno, V.N.; Lesnaya, M.I.; Martynenko, A.N.; Chugunova, S.I.
1983-01-01
Bending strength is studied for mutual TiC-ZrC alloys within a temperature range of 20-600 deg C. Structure of the material failure surface is studied from replicas by scanning and transmission electron microscopy. The data obtained are compared with concentration dependences of some physical properties of these alloys. Bending strength is shown to be minimum for the alloy with 40 mol % of zirconium carbide. It is stated that within the temperature range under study the carbide alloys undergo macroscopic brittle failure. The materials are characterized by a mixed type of failure with transcrystalline failure somewhat prevailing
Grain refining efficiency of Al-Ti-C alloys
International Nuclear Information System (INIS)
Birol, Yuecel
2006-01-01
The problems associated with boride agglomeration and the poisoning effect of Zr in Zr-bearing alloys have created a big demand for boron-free grain refiners. The potential benefits of TiC as a direct nucleant for aluminium grains have thus generated a great deal of interest in TiC-bearing alloys in recent years. In Al-Ti-C grain refiners commercially available today, Al 3 Ti particles are introduced into the melt along with the TiC particles. Since the latter are claimed to nucleate α-Al directly, it is of great technological interest to see if reducing the Ti:C ratio further, i.e., increasing the C content of the grain refiner, will produce an increase in the grain refining efficiency of these alloys. A series of grain refiner samples with the Ti concentration fixed at 3% and a range of C contents between 0 and 0.75 were obtained by appropriately mixing an experimental Al-3Ti-0.75C alloy with Al-10Ti alloy and commercial purity aluminium. The grain refining efficiency of these grain refiners was assessed to investigate the role of the insoluble TiC and the soluble Al 3 Ti particles. The optimum chemistry for the Al-Ti-C grain refiners was also identified
Grain refining efficiency of Al-Ti-C alloys
Energy Technology Data Exchange (ETDEWEB)
Birol, Yuecel [Materials Institute, Marmara Research Center, TUBITAK, 41470 Gebze, Kocaeli (Turkey)]. E-mail: yucel.birol@mam.gov.tr
2006-09-28
The problems associated with boride agglomeration and the poisoning effect of Zr in Zr-bearing alloys have created a big demand for boron-free grain refiners. The potential benefits of TiC as a direct nucleant for aluminium grains have thus generated a great deal of interest in TiC-bearing alloys in recent years. In Al-Ti-C grain refiners commercially available today, Al{sub 3}Ti particles are introduced into the melt along with the TiC particles. Since the latter are claimed to nucleate {alpha}-Al directly, it is of great technological interest to see if reducing the Ti:C ratio further, i.e., increasing the C content of the grain refiner, will produce an increase in the grain refining efficiency of these alloys. A series of grain refiner samples with the Ti concentration fixed at 3% and a range of C contents between 0 and 0.75 were obtained by appropriately mixing an experimental Al-3Ti-0.75C alloy with Al-10Ti alloy and commercial purity aluminium. The grain refining efficiency of these grain refiners was assessed to investigate the role of the insoluble TiC and the soluble Al{sub 3}Ti particles. The optimum chemistry for the Al-Ti-C grain refiners was also identified.
Thermophysical properties of Alloy 617 from 25 °C to 1000 °C
International Nuclear Information System (INIS)
Rabin, B.H.; Swank, W.D.; Wright, R.N.
2013-01-01
Highlights: • Thermophysical properties of Alloy 617 have been measured to 1000 °C. • Thermal conductivity at 600–850 °C is nonlinear due to Ni–Cr short-range ordering. • Four different heats and long-term aged material all exhibited similar properties. -- Abstract: Key thermophysical properties needed for the successful design and use of Alloy 617 in steam generator and heat exchanger applications have been measured experimentally, and results are compared with literature values and results obtained from some other commercial Ni–Cr alloys and model materials. Specifically, the thermal diffusivity, thermal expansion coefficient, and specific heat capacity have been measured for Alloy 617 over a range of temperatures, allowing calculation of thermal conductivity up to 1000 °C. It has been found that the thermal conductivity of Alloy 617 exhibits significant deviation from monotonic behavior in the temperature range from 600 °C to 850 °C, the temperatures of interest for most heat transfer applications. The non-linear behavior appears to result primarily from short-range order/disorder phenomena known to occur in the Ni–Cr system. Similar deviation from monotonic behavior was observed in the solid solution Ni–Cr-W Alloy 230, and lesser deviations were observed in iron based Alloy 800H and an austenitic stainless steel. Measured thermophysical property data are provided for four different heats of Alloy 617, and it is shown that property variations between the four different heats are not significant. Measurements were also obtained from Alloy 617 that was aged for up to 2000 h at 750 °C, and it was found that this aging treatment does not significantly influence the thermophysical properties
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
International Nuclear Information System (INIS)
Wilson, T.R.; Hanson, C.
1994-01-01
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
Energy Technology Data Exchange (ETDEWEB)
Wilson, T.R.; Hanson, C.
1994-10-03
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103.
Amorphization of C-implanted Fe(Cr) alloys
International Nuclear Information System (INIS)
Knapp, J.A.; Follstaedt, D.M.; Sorensen, N.R.; Pope, L.E.
1991-01-01
The amorphous phase formed by implanting C into Fe alloyed with Cr, which is a prototype for the amorphous phase formed by implanting C into stainless steels, is compared to that formed by implanting C and Ti into Fe and steels. The composition range of the phase has been examined; higher Cr and C concentrations are required than needed with Ti and C. The friction and wear benefits obtained by implanting stainless steels with C only do not persist for the long durations and high wear loads found with Ti and C. However, the amorphous Fe-Cr-C alloys exhibit good aqueous corrosion resistance. (orig.)
Assessment of vadose zone radionuclide contamination around Single Shell Tank 241-C-103
International Nuclear Information System (INIS)
Kos, S.E.
1995-12-01
Five drywells surrounding single shell tank 241-C-103 were logged with the high-purity germanium logging system to investigate possible leakage of radioactive contamination from the tank. The investigation included integration of the drywell survey results with several other data sources. There is no conclusive evidence showing indications that the 241-C-103 tank has leaked
United modification of Al-24Si alloy by Al-P and Al-Ti-C master alloys
Institute of Scientific and Technical Information of China (English)
韩延峰; 刘相法; 王海梅; 王振卿; 边秀房; 张均艳
2003-01-01
The modification effect of a new type of Al-P master alloy on Al-24Si alloys was investigated. It is foundthat excellent modification effect can be obtained by the addition of this new type of A1-P master alloy into Al-24Simelt and the average primary Si grain size is decreased below 47 μm from original 225 μm. It is also found that theTiC particles in the melt coming from Al8Ti2C can improve the modification effect of the Al-P master alloy. Whenthe content of TiC particles in the Al-24Si melt is 0.03 %, the improvement reaches the maximum and keeps steadywith increasing content of TiC particles. Modification effect occurs at 50 min after the addition of the Al-P master al-loy and TiC particles, and keeps stable with prolonging holding time.
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
The performance of Al-Ti-C master alloy in refining Al-10Mg and A1-5Cu alloys was studied by using electron probe micro-analyzer (EPMA) and X-ray diffractometer (XRD) analysis.The results indicate that there are obvious fading phenomena in both Al-10Mg and Al-5Cu alloys with the addition of Al-5Ti-0.4C refiner which contains TiC and TiAl3 compounds.Mg element has no influence on the stability of TiC and TiAl3, while TiC particles in Al-10Mg alloy react with Al to form Al4C3 particles, resulting in the refinement fading.However, TiC particles are relatively stable in Al-5Cu alloy, while TiAl3 phase reacts with Al2Cu to produce a new phase Ti(Al, Cu)2, which is responsible for the refinement fading in Al-5Cu alloy.These indicate that the refinement fading will not occur only when both the TiC particles and TiAl3 compound of Al-Ti-C refiner are stable in Al alloys.
Energy Technology Data Exchange (ETDEWEB)
Silva, A.K.; Pereira, J.I.; Vurobi Junior, S.; Cintho, O.M., E-mail: alissonkws@gmail.co [Universidade Estadual de Ponta Grossa (UEPG), PR (Brazil)
2010-07-01
The purpose of the present paper is the synthesis of nickel alloys (NiCrAlC), which has been proposed like a economic alternative to the Stellite family Co alloys using mechanical alloying, followed by sintering heat treatment of milled material. The NiCrAlC alloys consist of a chromium carbides dispersion in a Ni{sub 3}Al intermetallic matrix, that is easily synthesized by mechanical alloying. The use of mechanical alloying enables higher carbides sizes and distribution control in the matrix during sintering. We are also investigated the compaction of the processed materials by compressibility curves. The milling products were characterized by X-ray diffraction, and the end product was featured by conventional metallography and scanning electronic microscopy (SEM), that enabled the identification of desired phases, beyond microhardness test, which has been shown comparable to alloys manufactured by fusion after heat treating. (author)
Age hardening in mechanically alloyed Al-Mg-Li-C-O
Energy Technology Data Exchange (ETDEWEB)
Papazian, J.M. (Corporate Research Center, Grumman Corporation, Bethpage, NY (USA)); Gilman, P. (Allied-Signal Inc., Morristown, NJ (USA))
1990-05-01
The age-hardening behavior of a series of mechanically alloyed Al-Mg-Li-C-O alloys containing 3.0-4.0 wt.% Mg and 1.3-1.75 wt.% Li was studied using hardness tests, differential scanning calorimetry (DSC) and transmission electron microscopy. The hardness tests showed an increased hardness after 100degC aging in all the alloys containing at least 1.5 at.% Li. Likewise, the calorimetry results showed the presence of pronounced precipitate dissolution peaks in these same alloys after 100degC aging. The volume fraction of precipitates formed (as measured by the dissolution enthalpies of the DSC peaks) increased systematically with increasing solute content. Transmission electron microscopy after 100 and 190degC aging showed images and diffraction spots similar to those of {delta}' (Al{sub 3}Li). Comparison of the DSC results with results from binary Al-Li and Al-Mg alloys indicated that the precipitates formed in the Al-Mg-Li-C-O alloys were similar to those formed in binary Al-Li alloys, and that the primary role of the magnesium was to lower the solid solubility of lithium. (orig.).
Passivity of alloy C-22 in NaCl solutions
International Nuclear Information System (INIS)
Rodriguez, Martin A.; Carranza, Ricardo M.
2004-01-01
Alloy C-22 has been proposed as the corrosion resistant barrier of high-level waste nuclear containers. This alloy must be resistant to corrosion in multi-ionic solutions for a period of time as long as 10,000 years. The aim of the present work was to study the corrosion behavior of alloy C-22 in NaCl solutions. General and crevice corrosion were studied by means of electrochemical techniques. Open circuit potential was measured over the time, electrochemical impedance spectroscopy (EIS) measurements were carried out at open circuit and passivity potentials, as well as cyclic potentiodynamic polarization curves. Corrosion rates obtained by EIS measurements were acceptable for a waste nuclear container ( P ) values increased with open circuit potential and polarization time at constant potential. This was attributed to an increase in oxide film thickness and its aging respectively. The passive oxide form on alloy C-22 at the studied conditions presented a n-type semiconductor behavior in the passive potential range. Repassivation potential values (E R1 ) were determined for alloy C-22 at the studied conditions using PCA probes. (author) [es
Mechanical properties of Al-Cu alloy-SiC composites
Anggara, B. S.; Handoko, E.; Soegijono, B.
2014-09-01
The synthesis of aluminum (Al) alloys, Al-Cu, from mixture 96.2 % Al and 3.8 % Cu has been prepared by melting process at a temperature of 1200°C. The adding 12.5 wt% up to 20 wt% of SiC on Al-Cu alloys samples has been investigated. The structure analyses were examined by X-Ray Diffractometer (XRD) and scanning electron microscope (SEM). Moreover, the morphology of Al-Cu alloys has been seen as structure in micrometer range. The hardness was measured by hardness Vickers method. According to the results, it can be assumed that the 15 wt% of SiC content is prefer content to get better quality of back to back hardness Vickers of Al-Cu alloys.
Mechanical properties of Al-Cu alloy-SiC composites
Energy Technology Data Exchange (ETDEWEB)
Anggara, B. S., E-mail: anggorobs1960@yahoo.com [Jurusan Fisika, FMIPA Universitas Negeri Jakarta, Indonesia 13220 and PPS Ilmu Material, Department Fisika, FMIPA, Universitas Indonesia (Indonesia); Handoko, E. [Jurusan Fisika, FMIPA Universitas Negeri Jakarta, 13220 (Indonesia); Soegijono, B. [PPS Ilmu Material, Department Fisika, FMIPA, Universitas Indonesia (Indonesia)
2014-09-25
The synthesis of aluminum (Al) alloys, Al-Cu, from mixture 96.2 % Al and 3.8 % Cu has been prepared by melting process at a temperature of 1200°C. The adding 12.5 wt% up to 20 wt% of SiC on Al-Cu alloys samples has been investigated. The structure analyses were examined by X-Ray Diffractometer (XRD) and scanning electron microscope (SEM). Moreover, the morphology of Al-Cu alloys has been seen as structure in micrometer range. The hardness was measured by hardness Vickers method. According to the results, it can be assumed that the 15 wt% of SiC content is prefer content to get better quality of back to back hardness Vickers of Al-Cu alloys.
Study crevice corrosion alloys C-22 and 625 by electrochemical noise
International Nuclear Information System (INIS)
Ungaro, María L.; Carranza, Ricardo M.; Rodríguez, Martín A.
2013-01-01
C-22 and 625 alloys are two of the Ni –Cr-Mo alloys considered as candidate materials to form the corrosion resistance engineered barriers for nuclear waste repositories. The corrosion resistance of these alloys is remarkable in a wide variety of environments. Despite of their resistance these alloys are susceptible to crevice corrosion in a certain aggressive environments. This work presents the use of electrochemical noise technique to study crevice corrosion susceptibility of alloys C-22 and 625 in 1M NaCl acidic solutions at 60ºC and 90ºC. Asymmetrical electrodes and a complementary platinum electrode were used to assess the influence of cathodic reaction in crevice process. The obtained records were analyzed directly and through statistical parameters. The potential drop and the simultaneous increment of the current records indicated the occurrence of crevice corrosion. The alternative use of a platinum electrode resulted in higher currents and higher potentials and reduced the induction time to crevice formation. The reason for this behavior is that platinum surface allows faster cathodic reactions than C-22 and 625 alloys. The standard deviation of the current records was responsive to the crevice corrosion intensity. C-22 alloy had better crevice corrosion performance than 625 alloy. (author)
Tank 241-C-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-103
<90 day storage training plan for the 103-B, 1701-BA, AND 1714-C buildings
International Nuclear Information System (INIS)
Snider, P.M.
1996-10-01
The 103-B, 1701-BA, and 1714C < 90 Day Storage Area stores characteristic wastes generated in the demolition of the 103-B, 1701-BA, and 1714-C Complex. Wastes (lead-based painted components) are packaged and stored in vendor shipment containers. This is the Environmental Restoration Contractor team training plan for the 103-B, 1701-BA, and 1714-C subgrade demolition < 90 Day Storage of Hazardous Waste. This document is intended to meet the requirements of Washington Administrative Code 173-303-330 and the Hanford Dangerous Waste Permit. Training unrelated to compliance with WAC 173-303-330 is not addressed in this training plan. WAC 173-303-330(1)(d)(2, 5, 6) requires that personnel be familiarized, where applicable, with waste feed cut-off systems, response to ground-water contamination incidents, and shutdown of operations. These are not applicable to 103-B, 1701-BA, and 1714-C Subgrade Demolition < 90 Day Storage, and therefore are not covered in this training plan
Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy
Energy Technology Data Exchange (ETDEWEB)
Li, Zhen [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Han, Jiesheng; Lu, Jinjun [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Chen, Jianmin, E-mail: chenjm@lzb.ac.cn [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)
2015-01-15
Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276.
Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy
International Nuclear Information System (INIS)
Li, Zhen; Han, Jiesheng; Lu, Jinjun; Chen, Jianmin
2015-01-01
Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276
Wetting behavior of liquid Fe-C-Ti alloys on sapphire
International Nuclear Information System (INIS)
Gelbstein, M.; Froumin, N.; Frage, N.
2008-01-01
Wetting behavior in the (Fe-C-Ti)/sapphire system was studied at 1823 K. The wetting angle between sapphire and Fe-C alloys is higher than 90 deg. (93 deg. and 105 deg. for the alloys with 1.4 and 3.6 at.% C, respectively). The presence of Ti improves the wetting of the iron-carbon alloys, especially for the alloys with carbon content of 3.6 at.%. The addition of 5 at.% Ti to Fe-3.6 at.% C provides a contact angle of about 30 deg., while the same addition to Fe-1.4 at.% C decreases the wetting angle to 70 deg. only. It was established that the wetting in the systems is controlled by the formation of a titanium oxicarbide layer at the interface, which composition and thickness depend on C and Ti contents in the melt. The experimental observations are well accounted for by a thermodynamic analysis of the Fe-Ti-Al-O-C system
Internal Friction of Austenitic Fe-Mn-C-Al Alloys
Lee, Young-Kook; Jeong, Sohee; Kang, Jee-Hyun; Lee, Sang-Min
2017-12-01
The internal friction (IF) spectra of Fe-Mn-C-Al alloys with a face-centered-cubic (fcc) austenitic phase were measured at a wide range of temperature and frequency ( f) to understand the mechanisms of anelastic relaxations occurring particularly in Fe-Mn-C twinning-induced plasticity steels. Four IF peaks were observed at 346 K (73 °C) (P1), 389 K (116 °C) (P2), 511 K (238 °C) (P3), and 634 K (361 °C) (P4) when f was 0.1 Hz. However, when f increased to 100 Hz, whereas P1, P2, and P4 disappeared, only P3 remained without the change in peak height, but with the increased peak temperature. P3 matches well with the IF peak of Fe-high Mn-C alloys reported in the literature. The effects of chemical composition and vacancy (v) on the four IF peaks were also investigated using various alloys with different concentrations of C, Mn, Al, and vacancy. As a result, the defect pair responsible for each IF peak was found as follows: a v-v pair for P1, a C-v pair for P2, a C-C pair for P3, and a C-C-v complex (major effect) + a Mn-C pair (minor effect) for P4. These results showed that the IF peaks of Fe-Mn-C-Al alloys reported previously were caused by the reorientation of C in C-C pairs, not by the reorientation of C in Mn-C pairs.
Directory of Open Access Journals (Sweden)
Kalezić-Glišović A.
2009-01-01
Full Text Available The structural changes effect on functional properties of ribbon shaped samples of the Fe81B13Si4C2 amorphous alloy during annealing process was investigated in this paper. Differential scanning calorimetry method has shown that this alloy crystallizes in one stage, in temperature range from room temperature up to 700°C. Structural relaxation process was investigated by sensitive dilatation method in nonisothermal and isothermal conditions. It has been shown that structural relaxation process occurs in two stages by measuring thermal expansion at constant temperatures of t1=420°C, t2 = 440°C and t3 = 460°C. The first stage is characterized by linear logarithmic dependence of thermal expansion upon time at constant temperature. The second stage of structural relaxation process is characterized by linear dependence of isothermal expansion upon the square root of process time. These results imply that the first stage of structural relaxation process is a rapid kinetic process, while the second stage of structural relaxation process is a slow diffusion process. The rate constants k11 = 2,27⋅10- 3 s-1, k12 = 2,79⋅10-3 s-1, k13 = 3,6⋅10-3 s-1, k21 = 0,67⋅10-4 s-1, k22 = 3,72⋅10-4 s-1, k23 = 21,53⋅10-4 s-1 and activation energies E1 = 48,64 kJ/mol and E2 = 366, 23 kJ/mol were determined for both stages of structural relaxation process. The distinct correlation between structural relaxation process and magnetic susceptibility relative change was determined by thermomagnetic measurements. It has been shown that magnetic susceptibility can be increased by up to 80%, by convenient annealings after structural relaxation process, at magnetic field intensity of 8 kA/m.
Degradable and porous Fe-Mn-C alloy for biomaterials candidate
Pratesa, Yudha; Harjanto, Sri; Larasati, Almira; Suharno, Bambang; Ariati, Myrna
2018-02-01
Nowadays, degradable implants attract attention to be developed because it can improve the quality of life of patients. The degradable implant is expected to degrade easily in the body until the bone healing process already achieved. However, there is limited material that could be used as a degradable implant, polymer, magnesium, and iron. In the previous study, Fe-Mn-C alloys had succesfully produced austenitic phase. However, the weakness of the alloy is degradation rate of materials was considered below the expectation. This study aimed to produce porous Fe-Mn-C materials to improve degradation rate and reduce the density of alloy without losing it non-magnetic properties. Potassium carbonate (K2CO3) were chosen as filler material to produce foam structure by sintering and dissolution process. Multisteps sintering process under argon gas environment was performed to generate austenite phase. The product showed an increment of the degradation rate of the foamed Fe-Mn-C alloy compared with the solid Fe-Mn-C alloy without losing the Austenitic Structure
HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy
Directory of Open Access Journals (Sweden)
Fahrmann Michael G.
2014-01-01
Full Text Available HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability as they pertain to the intended use in rings and seals of advanced gas turbines.
Energy Technology Data Exchange (ETDEWEB)
Schneider, W. [Vereinigte Aluminium-Werke AG, Bonn (Germany). Forschung und Entwicklung
2000-10-01
AlTiC master alloys are a new grain refiner type to produce an equiaxed grain structure of cast extrusion and rolling ingots. These master alloys contain Ti carbides which act as nucleants of the {alpha} solid solution during solidification. The TiC content is lower than the TiB{sub 2} content of the industrial proved AlTiB master alloys. Benefits of the AlTiC master alloys are the low agglomeration tendency of the Ti carbides in the melt and that no Zr poisoning takes place. Despite of the low Ti carbide content the grain refinement performance can be very efficient, if low melt temperatures during casting will be used and as result of this a sufficient constitutional supercooling at the solidification front is achieved. (orig.)
Interdiffusion between U-Mo alloys and Al or Al alloys at 340 deg. C. Irradiation plan
International Nuclear Information System (INIS)
Fortis, A.M.; Mirandou, M.; Ortiz, M.; Balart, S.; Denis, A.; Moglioni, A.; Cabot, P.
2005-01-01
Out of reactor interdiffusion experiments between U-Mo alloys and Al alloys made close to fuel operation temperature are needed to validate the results obtained above 500 deg. C. A study of interdiffusion between U-Mo and Al or Al alloys, out and in reactor, has been initiated. The objective is to characterize the interdiffusion layer around 250 deg. C and study the influence of neutron irradiation. Irradiation experiments will be performed in the Argentine RA3 reactor and chemical diffusion couples will be fabricated by Friction Stir Welding (FSW) technique. In this work out-of-pile diffusion experiments performed at 340 deg. C are presented. Friction Stir Welding (FSW) was used to fabricate some of the samples. One of the results is the presence of Si, in the interaction layer, coming from the Al alloy. This is promising in the sense that the absence of Al rich phases may also be expected at low temperature. (author)
Steam Oxidation Behavior of Alloy 617 at 900 °C to 1100 °C
Liang, Zhiyuan; Wang, Yungang; Zhao, Qinxin
2018-05-01
The steam oxidation behavior of solid solution strengthened alloy 617 at 900 °C-1100 °C was investigated. The oxidation products were characterized by scanning electron microscopy, X-ray diffraction, and energy-dispersive spectroscopy. The results show that the oxidation kinetics of alloy 617 in steam followed the parabolic oxidation law. The calculated activity energy of alloy 617 was 223.47 kJ/mol. The oxidation products were mainly composed of external and internal scales and prior oxides at grain boundaries. External oxide scales were MnCr2O4, TiO2, and Cr2O3. Internal oxidation scales and prior oxides were Al2O3 and some Cr2O3 dissolved into Al2O3. The growth mechanism of oxide scales on alloy 617 is proposed.
A FeNiMnC alloy with strain glass transition
Directory of Open Access Journals (Sweden)
Hui Ma
2018-02-01
Full Text Available Recent experimental and theoretical investigations suggested that doping sufficient point defects into a normal ferroelastic/martensitic alloy systems could lead to a frozen disordered state of local lattice strains (nanomartensite domains, thereby suppressing the long-range strain-ordering martensitic transition. In this study, we attempt to explore the possibility of developing novel ferrous Elinvar alloys by replacing nickel with carbon and manganese as dopant species. A nominal Fe89Ni5Mn4.6C1.4 alloy was prepared by argon arc melting, and XRD, DSC, DMA and TEM techniques were employed to characterize the strain glass transition signatures, such as invariance in average structure, frequency dispersion in dynamic mechanical properties (storage modulus and internal friction and the formation of nanosized strain domains. It is indicated that doping of Ni, Mn and C suppresses γ→α long-range strain-ordering martensitic transformation in Fe89Ni5Mn4.6C1.4 alloy, generating randomly distributed nanosized domains by strain glass transition. Keywords: Strain glass transition, Elinvar alloys, Point defects, Nanosized domains
Magnesium Alloy WE43 and WE43-T5 - Mechanical and Thermal Properties
Xiang, Chongchen
Magnesium alloys are promising in aerospace, automotive and electronic industries due to low density, high specific strength and excellent machinability. A rare earth element alloy (WE43) is studied in as cast and heat treated conditions. Multiscale characterization is conducted to understand the nanomechanical response using a nanoindentor and microscale behavior using tensile tests. Further, compressive characterization is conducted across six orders of strain rate magnitudes from 10-3 to 3x103 s -1 under the range of liquid nitrogen (-196°C) to room temperature (25°C). Based on the results, a constitutive model is developed to estimate the plastic behavior of as-cast WE43 and WE43-T5 at different strain rates and under different temperatures. In addition, dynamic properties are studied using a dynamic mechanical analyzer at 1-100 Hz loading frequencies and the temperature range from 35°C to 500°C. Only Yttrium-rich cuboidal phase and zirconium-rich phase were present in WE43-T5 alloy and the eutectic phase was absent. Also, the grain size was reduced due to the hot rolling process. The difference in microstructure reflects into the mechanical properties. WE43-T5 specimens have improved mechanical properties over the as-cast alloy. Two transition temperatures are found at 210 and 250°C based on the storage and loss moduli results. The Mg24Y5 peak is found in the high temperature x-ray diffraction results along with a new Mg12Nd peak at those two temperature points. The corrosion behavior, studied by 7-day immersion in 3.5% NaCl solution, shows that the heat treated alloy has significantly lower corrosion rate than the as-cast alloy due to the absence of the eutectic mixture in the microstructure. With rapidly growing applications of magnesium alloys, particularly with rare earth elements, this study is expected to provide critical data and structure-property correlations that will help the scientific community.
Grain refining of Al-4.5Cu alloy by adding an Al-30TiC master alloy
Energy Technology Data Exchange (ETDEWEB)
Sato, Kazuaki [Toyota Motor Corp., Shizuoka (Japan). Materials Engineering Div. III; Flemings, M.C. [Massachusetts Inst. of Tech., Cambridge, MA (United States). Dept. of Materials Science and Engineering
1998-06-01
A particulate Al-30 wt pct TiC composite was employed as a grain refiner for the Al-4.5 wt pct Cu alloy. The composite contains submicron TiC particles. The addition of the TiC grain refiner to the metal alloy in the amount of 0.1 Ti wt pct effected a remarkable reduction in the average grain size in Al-4.5 wt pct Cu alloy castings. With the content of over 0.2 Ti wt pct, the grain refiner maintained its refining effectiveness even after a 3,600-second holding time at 973 K. The TiC particles in the resulting castings were free of interfacial phases. It is concluded that the TiC are the nucleating agents and that they are resistant to the fading effect encountered with most grain refiners.
Zr/ZrC modified layer formed on AISI 440B stainless steel by plasma Zr-alloying
Shen, H. H.; Liu, L.; Liu, X. Z.; Guo, Q.; Meng, T. X.; Wang, Z. X.; Yang, H. J.; Liu, X. P.
2016-12-01
The surface Zr/ZrC gradient alloying layer was prepared by double glow plasma surface alloying technique to increase the surface hardness and wear resistance of AISI 440B stainless steel. The microstructure of the Zr/ZrC alloying layer formed at different alloying temperatures and times as well as its formation mechanism were discussed by using scanning electron microscopy, glow discharge optical emission spectrum, X-ray diffraction and X-ray photoelectron spectroscopy. The adhesive strength, hardness and tribological property of the Zr/ZrC alloying layer were also evaluated in the paper. The alloying surface consists of the Zr-top layer and ZrC-subsurface layer which adheres strongly to the AISI 440B steel substrate. The thickness of the Zr/ZrC alloying layer increases gradually from 16 μm to 23 μm with alloying temperature elevated from 900 °C to 1000 °C. With alloying time from 0.5 h to 4 h, the alloyed depth increases from 3 μm to 30 μm, and the ZrC-rich alloyed thickness vs time is basically parabola at temperature of 1000 °C. Both the hardness and wear resistance of the Zr/ZrC alloying layer obviously increase compared with untreated AISI 440B steel.
International Nuclear Information System (INIS)
Postlethwaite, J.
1991-12-01
Two molybdenum-bearing nickel alloys, Alloy C-276 and Alloy 625, were previously identified for consideration as candidate container materials for the Canadian Nuclear Fuel Waste Management Program. Because of the paucity of data for the localized corrosion behaviour of these passive alloys under conditions that may be experienced in a disposal vault, this project was undertaken to study the crevice and pitting corrosion of Alloys C-276 and 625 in chloride solutions at elevated temperatures. Electrochemical and immersion tests have been conducted in neutral sodium chloride solutions (0.1 wt% to saturated) at 25 to 200 degrees C, in an attempt to identify the conditions under which localized corrosion occurs and to relate the actual corrosion behaviour to that expected on the basis of electrochemical studies. Cyclic polarization studies showed that the passivation breakdown potentials move rapidly to more active values with increasing temperatures. Above 100 degrees C the resistance to localized corrosion is greatly reduced. The results of the immersion tests are presented in the form of T versus (C1-) diagrams. These susceptibility diagrams suggest that there is a limiting crevice-corrosion temperature for each alloy in aerated, neutral sodium chloride solutions. Below this temperature corrosion does not occur, regardless of the chloride concentration. The values of the limiting crevice-corrosion temperatures were in the range 100 to 125 degrees C for Alloy C-276 and 100 to 115 degrees C for Alloy 625. Such values suggest that saturation of the chloride solutions by surface boiling could occur without the initiation of localized corrosion. These electrochemical results indicate that a large safety margin for susceptibility to localized corrosion might be found below 100 degrees C
Tensile properties of vanadium alloys irradiated at <430{degrees}C
Energy Technology Data Exchange (ETDEWEB)
Chung, H.M.; Smith, D.L. [Argonne National Lab., IL (United States)
1997-08-01
Recent attention to vanadium alloys has focused on significant susceptibility to loss of work-hardening capability in irradiation experiments at <430{degrees}C. An evaluation of this phenomenon was conducted on V-Ti, V-Cr-Ti, and V-Ti-Si alloys irradiated in several conventional and helium-charging irradiation experiments in the FFTF-MOTA, HFIR, and EBR-II. Work hardening capability and uniform tensile elongation appear to vary strongly from alloy and heat to heat. A strong heat-to-heat variation has been observed in V-4Cr-4Ti alloys tested, i.e., a 500-kg heat (No. 832665), a 100-kg heat (VX-8), and a 30-kg heat (BL-47). The significant differences in susceptibility to loss of work-hardening capability from one heat to another are estimated to correspond to a difference of {approx}100{degrees}C or more in minimum allowable operating temperature (e.g., 450 versus 350{degrees}C).
Effect of diluted alloying elements on mechanical properties of iron
International Nuclear Information System (INIS)
Hassan, A.A.S.
1996-01-01
Iron and its alloys have extensive applications. The effect of solute additions on mechanical properties of iron was investigated to check the efficiency of solute atoms on strength and surface e life. Additions in the range of 0.1 wt.% and 0.3 wt.% of alloying elements of Cu,Ni and Si were used. Samples of grains size ranged from 6-40 m which have been prepared by annealing followed by furnace cooling. The recrystallization temperature increases with alloying addition (475 degree C for Fe-0.3 wt. % C alloy compared to 375 degree C for pure iron). Si and Cu additions inhibit grain growth of iron whereas Ni addition enhances it.Addition of Si or Ni to iron induced softening below room temperature whereas addition of Cu caused hardening. The work hardening parameters decreased due to alloying additions. The strength coefficient K was 290 M N/m2 for Fe-03 wt % Ni compared to 340 M N/m2 for pure iron. The work hardening exponent n is 0.12 for fe-0.3 wt. Cu alloy compared to 0.17 for pure iron. All the investigated alloys fulfilled the Hall-Petch relation at liquid Nitrogen and at room temperature. Alloying addition which caused softening addition which caused hardening increased the Half-Petch parameters. Ni addition favors ductility of iron whereas Cu addition reduces it. Alloying additions generally lead to brittle fracture and decrease the crack resistance of iron. 9 tabs., 55 figs., 103 refs
Vapor characterization of Tank 241-C-103
International Nuclear Information System (INIS)
Huckaby, J.L.; Story, M.S.
1994-06-01
The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program
Vapor characterization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L. [Westinghouse Hanford Co., Richland, WA (United States); Story, M.S. [Northwest Instrument Systems, Inc. Richland, WA (United States)
1994-06-01
The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program.
Anti-Invar properties and magnetic order in fcc Fe-Ni-C alloy
International Nuclear Information System (INIS)
Nadutov, V.M.; Kosintsev, S.G.; Svystunov, Ye.O.; Garamus, V.M.; Willumeit, R.; Eckerlebe, H.; Ericsson, T.; Annersten, H.
2011-01-01
Anti-Invar effect was revealed in the fcc Fe-25.3%Ni-0.73%C (wt%) alloy, which demonstrates high values of thermal expansion coefficient (TEC) (15-21)x10 -6 K -1 accompanied by almost temperature-insensitive behavior in temperature range of 122-525 K. Alloying with carbon considerably expanded the low temperature range of anti-Invar behavior in fcc Fe-Ni-based alloy. The Curie temperature of the alloy T C =195 K was determined on measurements of temperature dependences of magnetic susceptibility and saturation magnetization. The Moessbauer and small-angle neutron scattering (SANS) experiments on the fcc Fe-25.3%Ni-(0.73-0.78)%C alloys with the varying temperatures below and above the Curie point and in external magnetic field of 1.5-5 T were conducted. Low value of the Debye temperature Θ D =180 K was estimated using the temperature dependence of the integral intensity of Moessbauer spectra for specified temperature range. The inequality B eff =(0.7-0.9)B ext was obtained in external field Moessbauer measurement that points to antiferromagnetically coupled Fe atoms, which have a tendency to align their spins perpendicular to B ext . Nano length scale magnetic inhomogeneities nearby and far above T C were revealed, which assumed that it is caused by mixed antiferromagnetically and ferromagnetically coupled Fe atom spins. The anti-Invar behavior of Fe-Ni-C alloy is explained in terms of evolution of magnetic order with changing temperature resulting from thermally varied interspin interaction and decreasing stiffness of interatomic bond. - Highlights: → Anti-Invar effect was revealed in the fcc Fe-25.3%Ni-0.73%C (wt%) alloy. → Carbon expanded the temperature range of anti-Invar behavior in Fe-Ni-based alloy. → Moessbauer data point to mixed interspin interaction and low the Dedye temperature. → The SANS experiments reveal nano length scale magnetic inhomogeneities ≤6 nm. → Anti-Invar behavior of Fe-Ni-C alloy explained by thermally varied magnetic order.
High-temperature deformation of dispersion-strengthened Cu-Zr-Ti-C alloys
International Nuclear Information System (INIS)
Palma, Rodrigo H.; Sepulveda, Aquiles; Espinoza, Rodrigo; Dianez, M. Jesus; Criado, Jose M.; Sayagues, M. Jesus
2005-01-01
The hot mechanical behaviour and microstructure of Cu-5 vol.% TiC, Cu-5 vol.% ZrO 2 and Cu-2.5 vol.% TiC-2.5 vol.% ZrO 2 alloys prepared by reaction milling were studied. After a test of 1 h annealing at 1173 K, the Cu-5 vol.% ZrO 2 alloy presented the lower softening resistance to annealing, while the other two ones kept their initial room-temperature hardness (about 2 GPa). Hot-compression tests at 773 and 1123 K, at initial true strain rates of 0.85 x 10 -3 and 0.85 x 10 -4 s -1 were performed. The Cu-2.5 vol.% TiC-2.5 vol.% ZrO 2 and the Cu-5 vol.% ZrO 2 alloys were the strongest and softest materials, respectively. Moreover, by electron microscopy, nanometric TiC and micrometric particles were detected in the Cu-5 vol.% TiC and Cu-5 vol.% ZrO 2 alloys, respectively. A possible explanation for the observed behaviour of these materials is proposed. In the compression tests, it was also found that strain rate has a low effect on flow stress, as it has been previously observed by various authors in dispersion-strengthened alloys deformed at high temperatures
Zr/ZrC modified layer formed on AISI 440B stainless steel by plasma Zr-alloying
Energy Technology Data Exchange (ETDEWEB)
Shen, H.H.; Liu, L.; Liu, X.Z.; Guo, Q.; Meng, T.X.; Wang, Z.X.; Yang, H.J.; Liu, X.P., E-mail: liuxiaoping@tyut.edu.cn
2016-12-01
Highlights: • A Zr/ZrC modified layer was formed on AISI 440B stainless steel using plasma surface Zr-alloying. • The thickness of the modified layer increases with alloying temperature and time. • Formation mechanism of the modified layer is dependent on the mutual diffusion of Zr and substrate elements. • The modified surface shows an improved wear resistance. - Abstract: The surface Zr/ZrC gradient alloying layer was prepared by double glow plasma surface alloying technique to increase the surface hardness and wear resistance of AISI 440B stainless steel. The microstructure of the Zr/ZrC alloying layer formed at different alloying temperatures and times as well as its formation mechanism were discussed by using scanning electron microscopy, glow discharge optical emission spectrum, X-ray diffraction and X-ray photoelectron spectroscopy. The adhesive strength, hardness and tribological property of the Zr/ZrC alloying layer were also evaluated in the paper. The alloying surface consists of the Zr-top layer and ZrC-subsurface layer which adheres strongly to the AISI 440B steel substrate. The thickness of the Zr/ZrC alloying layer increases gradually from 16 μm to 23 μm with alloying temperature elevated from 900 °C to 1000 °C. With alloying time from 0.5 h to 4 h, the alloyed depth increases from 3 μm to 30 μm, and the ZrC-rich alloyed thickness vs time is basically parabola at temperature of 1000 °C. Both the hardness and wear resistance of the Zr/ZrC alloying layer obviously increase compared with untreated AISI 440B steel.
Evaluation of Sc-Bearing Aluminum Alloy C557 for Aerospace Applications
Domack, Marcia S.; Dicus, Dennis L.
2002-01-01
The performance of the Al-Mg-Sc alloy C557 was evaluated to assess its potential for a broad range of aerospace applications, including airframe and launch vehicle structures. Of specific interest were mechanical properties at anticipated service temperatures and thermal stability of the alloy. Performance was compared with conventional airframe aluminum alloys and with other emerging aluminum alloys developed for specific service environments. Mechanical properties and metallurgical structure were evaluated for commercially rolled sheet in the as-received H116 condition and after thermal exposures at 107 C. Metallurgical analyses were performed to de.ne grain morphology and texture, strengthening precipitates, and to assess the effect of thermal exposure.
Energy Technology Data Exchange (ETDEWEB)
Lindemann, J.; Hannesen, K.; Mast, R.; Viefhaus, H. [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany); Grabke, H.J.
1998-12-31
The paper reports examinations of Alloy 800 and specific commercially available variants known under the names of 800H, 800HT, and 800LC, differing in their concentrations of C, Al, and Ti. In addition, melts also containing phosphorus (0.09 wt-%) or sulfur (0.04 wt-%) as additional alloying materials have been prepared for the experiments. The volume diffusion and the grain boundary diffusion of {sup 59}Fe in those alloys was measured at temperatures between 800 and 1000 C by means of a radioactive tracer method combined with residual activity measurements. It was found that accompanying elements like phosphorus and sulfur increase the activation energy of the grain boundary diffusion of the iron and thus delay the grain boundary self-diffusion in Alloy 800. Creep curves were measured of the same materials after age-hardening treatment for 100 hours at 800 C, measurements performed at constant temperature but at three different, constant creep stress loads. The results showed that addition of phosphorus markedly increases the lifetime of Alloy 800, and reduces the creep rupture strain. The minimum strain rate in Alloy 800 containing 0.09 wt-% of phosphorus was found to be lower by a factor of 100, as compared to the other Alloy 800 materials used. (orig./CB) [Deutsch] Alloy 800 ist ein austenitischer Fe-Ni-Cr Stahl, der relativ geringe, aber wichtige Konzentrationen von Kohlenstoff, Aluminium und Titan enthaelt. Besondere Varianten von Alloy 800, bekannt als 800H, 800HT und 800LC, unterscheiden sich in den Konzentrationen dieser Elemente. Diese kommerziellen Legierungen wurden untersucht, und zusaetzlich wurden Schmelzen mit zulegiertem Phosphor (0,09 Gew-%) bzw. Schwefel (0,04 Gew-%) hergestellt. Mittels einer radioaktiven Tracermethode in Verbindung mit Restaktivitaetsmessungen wurde die Volumen- und Korngrenzendiffusion von {sup 59}Fe in diesen Legierungen im Temperaturbereich 800-1000 C gemessen. Es wurde gefunden, dass Begleitelemente wie Phosphor und
Pd-Au/C catalysts with different alloying degrees for ethanol oxidation in alkaline media
International Nuclear Information System (INIS)
Qin, Yuan-Hang; Li, Yunfeng; Lv, Ren-Liang; Wang, Tie-Lin; Wang, Wei-Guo; Wang, Cun-Wen
2014-01-01
High alloyed Pd-Au/C catalyst is prepared through a rate-limiting strategy in water/ethylene glycol solution. Pd/C and low alloyed Pd-Au/C catalysts are prepared with trisodium citrate and sodium borohydride as stabilizing and reducing agents, respectively. Transmission electron microscopy (TEM) shows that the synthesized Pd(Au) particles are well dispersed on the catalysts. X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) show that the high alloyed Pd-Au/C catalyst presents a relatively homogenous structure while the low alloyed Pd-Au/C catalyst presents a Pd-rich shell/Au-rich core structure. Electrochemical characterization shows that the low alloyed Pd-Au/C catalyst exhibits the best catalytic activity for ethanol oxidation reaction (EOR) in alkaline media, which could be attributed to its relatively large exposed Pd surface area as compared with the high alloyed Pd-Au/C catalyst due to its Pd-rich shell structure and its enhanced adsorption of OH ads as compared with Pd/C catalyst due to its core-shell structure
Systems engineering study: tank 241-C-103 organic skimming,storage, treatment and disposal options
Energy Technology Data Exchange (ETDEWEB)
Klem, M.J.
1996-10-23
This report evaluates alternatives for pumping, storing, treating and disposing of the separable phase organic layer in Hanford Site Tank 241-C-103. The report provides safety and technology based preferences and recommendations. Two major options and several varations of these options were identified. The major options were: 1) transfer both the organic and pumpable aqueous layers to a double-shell tank as part of interim stabilization using existing salt well pumping equipment or 2) skim the organic to an above ground before interim stabilization of Tank 241-C-103. Other options to remove the organic were considered but rejected following preliminary evaluation.
Removal of Separable Organic From Tank 241-C-103 Scoping Study
Energy Technology Data Exchange (ETDEWEB)
KOCH, M.R.
2000-05-16
This study is based on previous evaluations/proposals for removing the floating organic layer in C-103. A practical method is described with assumptions, cost and schedule estimates, and risks. Proposed operational steps include bulk organic removal, phase separation, organic washing and offsite disposal, followed by an in-situ polishing process.
Removal of Separable Organic From Tank 241-C-103 Scoping Study
International Nuclear Information System (INIS)
KOCH, M.R.
2000-01-01
This study is based on previous evaluations/proposals for removing the floating organic layer in C-103. A practical method is described with assumptions, cost and schedule estimates, and risks. Proposed operational steps include bulk organic removal, phase separation, organic washing and offsite disposal, followed by an in-situ polishing process
Grain refinement of AZ91D magnesium alloy by a new Mg–50%Al4C3 master alloy
International Nuclear Information System (INIS)
Liu, Shengfa; Chen, Yang; Han, Hui
2015-01-01
A novel and simple method for preparing Mg–50%Al 4 C 3 (hereafter in wt.%) master alloy has been developed by powder in-situ synthesis process under argon atmosphere. X-ray diffraction (XRD), scanning electron microscope (SEM) and energy dispersive X-ray spectroscopy (EDS) results show the existence of Al 4 C 3 particles in this master alloy. After adding 1.8% Mg–50%Al 4 C 3 master alloy, the average grain size of α-Mg decreased from 360 μm to 154 μm. Based on the DTA test results and calculation of the planar disregistry between Al 4 C 3 and α-Mg, Al 4 C 3 particles located in the central regions of magnesium grains can act as the heterogeneous nucleus of primary α-Mg phase
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
The microstructure and microhardness of a cast Al-10wt%Mg (henceforth Al-l0Mg) alloy with 0.2wt% addition of Al-5Ti-0.25C master alloy were compared with those of a refiner-free alloy of similar chemical composition.It was found that this level of the master alloy addition not only caused an effective grain refinement, but also caused a significant increase in the microhardness of the Al-10Mg alloy.Microchemical analysis revealed that TiC particles existed in the grain center.The relationship between the holding time and grain size was also studied.It shows that the grain refining efficiency is faded observably with the holding time.This is explained in terms of the instability of TiC particles.
Solute segregation and void formation in ion-irradiated vanadium-base alloys
International Nuclear Information System (INIS)
Loomis, B.A.; Smith, D.L.
1985-01-01
The radiation-induced segregation of solute atoms in the V-15Cr-5Ti alloys was determined after either single- dual-, or helium implantation followed by single-ion irradiation at 725 0 C to radiation damage levels ranging from 103 to 169 dpa. Also, the effect of irradiation temperature (600-750 0 C) on the microstructure in the V-15Cr-5Ti alloy was determined after single-ion irradiation to 200 and 300 dpa. The solute segregation results for the single- and dual-ion irradiated alloy showed that the simultaneous production of irradiation damage and deposition of helium resulted in enhanced depletion of Cr solute and enrichment of Ti, C and S solute in the near-surface layers of irradiated specimens. The observations of the irradiation-damaged microstructures in V-15Cr-5Ti specimens showed an absence of voids for irradiations of the alloy at 600-750 0 C to 200 dpa and at 725 0 C to 300 dpa. The principle effect on the microstructure of these irradiations was to induce the formation of a high density of disc-like precipitates in the vicinity of grain boundaries and intrinsic precipitates and on the dislocation structure. 8 references, 4 figures
Surface Nb-ALLOYING on 0.4C-13Cr Stainless Steel: Microstructure and Tribological Behavior
Yu, Shengwang; You, Kai; Liu, Xiaozhen; Zhang, Yihui; Wang, Zhenxia; Liu, Xiaoping
2016-02-01
0.4C-13Cr stainless steel was alloyed with niobium using double glow plasma surface alloying and tribological properties of Nb-alloyed steel such as hardness, friction and wear were measured. Effects of the alloying temperature on microstructure and the tribological behavior of the alloyed steel were investigated compared with untreated steel. Formation mechanisms of Nb-alloyed layers and increased wear resistance were also studied. The result shows that after surface Nb-alloying treatment, the 0.4C-13Cr steel exhibits a diffusion adhesion at the alloyed layer/substrate interface and improved tribological property. The friction coefficient of Nb-alloyed steel is decreased by about 0.3-0.45 and the wear rate after Nb-alloying is only 2-5% of untreated steel.
GP2 is selectively expressed by small intestinal CD103+CD11b+ cDC
DEFF Research Database (Denmark)
Müller-Luda, Katarzyna; Ahmadi, Fatemeh; Ohno, Hiroshi
DC in the small intestine. Moreover, GP2 expressing cDC in the small intestine were dramatically reduced in the setting of intestinal inflammation. We have previously shown that mice with an IRF4 deletion in CD11c+ cells (Cd11c-cre.Irf4 fl/fl mice) have reduced numbers of small intestinal CD103+CD11b+ c......DC. Interesting, we found that GP2+ CD103+CD11b+ cDC were dramatically reduced in these mice. Finally, to address the in vivo role of GP2 expression by cDC, we have generated mice with a selective deletion of GP2 in CD103+CD11b+ cDC (huLangerin-cre.gp2 fl/fl mice). Results from these ongoing studies...
Effect of alloying element on mechanical and oxidation properties of Ni-Cr-Mo-Co alloys at 950 °C
Energy Technology Data Exchange (ETDEWEB)
Kim, Dong-Jin, E-mail: djink@kaeri.re.kr; Jung, Su Jin; Mun, Byung Hak; Kim, Sung Woo; Lim, Yun Soo; Kim, Woo Gon; Hwang, Seong Sik; Kim, Hong Pyo
2016-12-01
Graphical abstract: Mo rich carbide was developed leading to significant increase of elongation to rupture and creep rupture time of Ni-Cr-Co-Mo alloy at 950 °C. Al addition improved corrosion resistance caused by enhancement of oxide/matrix interface stability. Abstract: The very-high-temperature reactor (VHTR) is a promising Generation-IV reactor design given its clear advantage regarding the production of massive amounts of hydrogen and in generating highly efficient electricity despite the fact that a material challenge remains at a high temperature of around 950 °C, where hydrogen production is possible under high pressure. In particular, among the many components composing a VHTR, the temperature of the intermediate heat exchanger (IHX) is expected to be the highest, with a coolant environment of up to 950 °C. Therefore, this work focuses on the mechanical and oxidation properties at 950 °C as a function of the alloying elements of Cr, Co, Mo, Al, and Ti constituting nickel-based alloys fabricated in a laboratory. The tensile, creep, and oxidation properties of the alloying elements were analyzed with SEM, TEM-EDS, and by assessing the weight change.
Svynarenko, Kateryna; Zhang, Yubo; Jie, Jinchuan; Kutsova, Valentyna; Li, Tingju
2017-09-01
Al-5Ti-0.2C, Al-0.8Ti-0.2C, Al-8Ti-2C, and Al-10Ti master alloys were prepared and used to investigate the influence of excess Ti on the growth of TiC particles and its ability to nucleate Al-grains. The results of a microstructure analysis of TiC-containing alloys and refined CPAl were interrelated to the results of a refinement test. It was found that the presence of excess Ti is essential at the stage of master alloy preparation, as it facilitates the growth and uniform distribution of TiC within the structure. In Al-5Ti-0.2C alloy containing excess Ti, carbide particles grow faster and to a higher extent (from 0.29 μm to 0.44 μm) compared to Al-0.8Ti-0.2C alloy produced without excess Ti (from 0.29 μm to 0.32 μm). The results support the "Ti-transition zone theory" as the mechanism of grain refinement by TiC-containing master alloys. The refinement performance of Al-5Ti-0.2C is superior compared to the one achieved by adding Al-8Ti-2C and Al-10Ti master alloys in corresponding concentrations. For the TiC particles to become favourable nucleating sites, they must undergo certain interaction with excess Ti at the stage of master alloy preparation.
Toxicologic evaluation of analytes from Tank 241-C-103
International Nuclear Information System (INIS)
Mahlum, D.D.; Young, J.Y.; Weller, R.E.
1994-11-01
Westinghouse Hanford Company requested PNL to assemble a toxicology review panel (TRP) to evaluate analytical data compiled by WHC, and provide advice concerning potential health effects associated with exposure to tank-vapor constituents. The team's objectives would be to (1) review procedures used for sampling vapors from tanks, (2) identify constituents in tank-vapor samples that could be related to symptoms reported by workers, (3) evaluate the toxicological implications of those constituents by comparison to establish toxicological databases, (4) provide advice for additional analytical efforts, and (5) support other activities as requested by WHC. The TRP represents a wide range of expertise, including toxicology, industrial hygiene, and occupational medicine. The TRP prepared a list of target analytes that chemists at the Oregon Graduate Institute/Sandia (OGI), Oak Ridge National Laboratory (ORNL), and PNL used to establish validated methods for quantitative analysis of head-space vapors from Tank 241-C-103. this list was used by the analytical laboratories to develop appropriate analytical methods for samples from Tank 241-C-103. Target compounds on the list included acetone, acetonitrile, ammonia, benzene, 1, 3-butadiene, butanal, n-butanol, hexane, 2-hexanone, methylene chloride, nitric oxide, nitrogen dioxide, nitrous oxide, dodecane, tridecane, propane nitrile, sulfur oxide, tributyl phosphate, and vinylidene chloride. The TRP considered constituent concentrations, current exposure limits, reliability of data relative to toxicity, consistency of the analytical data, and whether the material was carcinogenic or teratogenic. A final consideration in the analyte selection process was to include representative chemicals for each class of compounds found
Progress toward resolution of vapor problems associated with tank 241-C-103
International Nuclear Information System (INIS)
Huckaby, J.L.; Babad, H.; Story, M.S.
1994-02-01
Noxious and flammable gases and vapors associated with high-level radioactive waste storage tank 241-C-103 at the Hanford Site are discussed. Focus is on the Westinghouse Hanford Company strategy to characterize the tank headspace. The sampling and analysis methodology is described. Sampling limitations, devices, and equipment are discussed. Results to date are given
Influence of nitrogen on the synthesis and nucleation ability of TiC{sub x} in Al–Ti–C master alloy
Energy Technology Data Exchange (ETDEWEB)
Zhang, Ping; Nie, Jinfeng; Gao, Tong; Wang, Tao; Liu, Xiangfa, E-mail: xfliu@sdu.edu.cn
2014-07-15
Highlights: • A group of Al–Ti–C master alloy has been prepared in different concentration of N{sub 2}. • It is found that N atoms can dope into TiC{sub x} at a certain concentration of N{sub 2}. • The effect of N element on the nucleation ability of TiC{sub x} on α-Al is investigated. • The excellent refining performance of the doped TiC{sub x} does not fade within 60 min. - Abstract: In this study, a group of Al–Ti–C master alloy has been prepared in an atmosphere with different concentration of N{sub 2}. The master alloys are analyzed by field emission scanning electron microscope (FE-SEM) and transmission electron microscope (TEM). It is discovered that N atoms can be doped into TiC{sub x} at a certain concentration of N{sub 2} while it will form AlN if the concentration is higher. Adding Al–Ti–C master alloy with N doped TiC{sub x} particles in molten aluminum, the average grain size of α-Al can be reduced from 3320 μm to 189 μm and the efficiency does not fade within 60 min. It is supposed that the grain refinement efficiency and stability of TiC{sub x} is improved obviously after N doping. This master alloy exhibits potential to promote the application of grain refiner in industries.
Tensile properties of vanadium alloys irradiated at 200{degrees}C in the HFIR
Energy Technology Data Exchange (ETDEWEB)
Chung, H.M.; Nowicki, L.; Smith, D.L. [Argonne National Lab., IL (United States)
1997-08-01
Vanadium alloys were irradiated in a helium environment to {approx}10 dpa at {approx}200{degrees}C in the High Flux Isotope Reactor (HFIR). This report presents results of postirradiation tests of tensile properties of laboratory heats of V-(1-18)Ti, V-4Cr-4Ti, V-8Cr-6Ti, V-9Cr-5Ti, V-3Ti-1Si, and V-3Ti-0.1C alloys. Because of significant loss of work-hardening capability, all alloys except V-18Ti exhibited a very low uniform plastic strain <1%. For V-Ti. The mechanism of the loss of work-hardening capability in the other alloys is not understood.
Mechanism study of c.f.c Fe-Ni-Cr alloy corrosion in supercritical water
International Nuclear Information System (INIS)
Payet, M.
2011-01-01
Supercritical water can be use as a high pressure coolant in order to improve the thermodynamic efficiency of power plants. For nuclear concept, lifetime is an important safety parameter for materials. Thus materials selection criteria concern high temperature yield stress, creep resistance, resistance to irradiation embrittlement and also to both uniform corrosion and stress corrosion cracking.This study aims for supplying a new insight on uniform corrosion mechanism of Fe-Ni-Cr f.c.c. alloys in deaerated supercritical water at 600 C and 25 MPa. Corrosion tests were performed on 316L and 690 alloys as sample autoclaves taking into account the effect of surface finishes. Morphologies, compositions and crystallographic structure of the oxides were determined using FEG scanning electron microscopy, glow discharge spectroscopy and X-ray diffraction. If supercritical water is expected to have a gas-like behaviour in the test conditions, the results show a significant dissolution of the alloy species. Thus the corrosion in supercritical water can be considered similar to corrosion in under-critical water assuming the higher temperature and its effect on the solid state diffusion. For alloy 690, the protective oxide layer formed on polished surface consists of a chromia film topped with an iron and nickel mixed chromite or spinel. The double oxide layer formed on 316L steel seems less protective with an outer porous layer of magnetite and an inhomogeneous Cr-rich inner layer. For each alloy, the study of the inner protective scale growth mechanisms by marker or tracer experiments reveals that diffusion in the oxide scale is governed by an anionic process. However, surface finishes impact deeply the growth mechanisms. Comparisons between the results for the steel suggest that there is a competition between the oxidation of iron and chromium in supercritical water. Sufficient available chromium is required in order to form a thin oxide layer. Highly deformed or ultra fine
High heat load properties of TiC dispersed Mo alloys
International Nuclear Information System (INIS)
Tokunaga, Kazutoshi; Yoshida, Naoaki; Miura, Yasushi; Kurishita, Hiroaki; Kitsunai, Yuji; Kayano, Hideo.
1996-01-01
Electron beam high heat load experiment of new developed three kinds of TiC dispersed Mo alloys (Mo-0.1wt%TiC, Mo-0.5wt%TiC and Mo-1.0wt%TiC) was studied so as to evaluate it's high heat load at using as the surface materials of divertor. The obtained results indicated that cracks were not observed by embrittlement by recrystallization until about 2200degC of surface temperature and the gas emission properties were not different from sintered molibdenum. However, at near melting point, deep cracks on grain boundary and smaller gas emission than that of sintered Mo were observed. So that, we concluded that TiC dispersed Mo alloy was good surface materials used under the conditions of the stationary heat flux and less than the melting point, although not good one to be melted under nonstationary large heat flux. (S.Y.)
The influence of various cooling rates during laser alloying on nodular iron surface layer
Paczkowska, Marta; Makuch, Natalia; Kulka, Michał
2018-06-01
the alloyed zone formed at higher cooling rates. The hardness of nodular iron surface layer, alloyed with cobalt, was up to 4-times higher than the hardness of core material. The hardness of alloyed zones strongly depended on laser treatment conditions. In the case of lower cooling rate, lower hardness was observed due to more coarse-grained microstructure and a presence of pearlite. The hardness of the alloyed zone increased (from 850 to 950HV0.1) together with the increasing cooling rate (from 2 · 103 to nearly 9 · 103 °C/s). Laser treatment enabled a formation of surface layers on nodular iron, alloyed with cobalt. The microstructure of such a surface layer could be controlled by the laser processing parameters. High hardness and fine microstructure of the laser-alloyed nodular iron with cobalt should result in higher resistance to wear, corrosion and even (due to effect of cobalt addition) elevated temperatures during operation conditions of machine parts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 801.103 Section... VETERANS AFFAIRS ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 801.103 Authority. The Secretary issues the VAAR under the authority of 40 U.S.C. 121(c), Title 48 of the Code of Federal...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 301.103 Section... REGULATION SYSTEM Purpose, Authority, and Issuance 301.103 Authority. (b) The Assistant Secretary for Financial Resources (ASFR) prescribes the HHSAR under the authority of 5 U.S.C. 301 and section 205(c) of...
Structural heredity of TiC and its influences on refinement behaviors of AlTiC master alloy
Institute of Scientific and Technical Information of China (English)
王振卿; 刘相法; 柳延辉; 张均燕; 于丽娜; 边秀房
2003-01-01
Heredity of microstructure in AlTiC master alloy, grain refiners, was analyzed. It is found that, for morphologies and distributions of TiC particles, there are visible heredity which originates from raw materials or processing methods of Al melt, and will ultimately be transferred to the solid state structure through the melt stage, and this phenomenon can cause hereditary influences on refinement: formation of chain-like TiC morphology results in rapid refinement fading behavior; distribution of TiC along grain boundaries greatly reduces refinement efficiency. Controlling of structural heredity through proper selections of raw materials and processing parameters is of great importance in obtaining ideal microstructures and improving refinement behaviors of AlTiC master alloys.
Compressive Creep Behaviour of Extruded Mg Alloys at 150 °C
Fletcher, M.; Bichler, L.; Sediako, D.; Klassen, R.
Wrought magnesium alloy bars, sections and tubes have been extensively used in the aerospace, electronics and automotive industries, where component weight is of concern. The operating temperature of these components is typically limited to below 100°C, since appreciable creep relaxation of the wrought alloys takes place above this temperature.
Compressive performance and crack propagation in Al alloy/Ti{sub 2}AlC composites
Energy Technology Data Exchange (ETDEWEB)
Hanaor, D.A.H., E-mail: dorian.hanaor@sydney.edu.au [School of Civil Engineering, University of Sydney, Sydney, NSW 2006 (Australia); Hu, L. [Ames Laboratory, U.S. Department of Energy, Ames, Iowa 50011 (United States); Kan, W.H.; Proust, G. [School of Civil Engineering, University of Sydney, Sydney, NSW 2006 (Australia); Foley, M. [Australian Centre for Microscopy and Microanalysis, University of Sydney, Sydney, NSW 2006 (Australia); Karaman, I.; Radovic, M. [Department of Materials Science and Engineering, Texas A& M University, College Station, TX 77843 (United States)
2016-08-30
Composite materials comprising a porous Ti{sub 2}AlC matrix and Al 6061 alloy were fabricated by a current-activated pressure assisted melt infiltration process. Coarse, medium and fine meso-structures were prepared with Al alloy filled pores of differing sizes. Materials were subjected to uniaxial compressive loading up to stresses of 668 MPa, leading to the failure of specimens through crack propagation in both phases. As-fabricated and post-failure specimens were analysed by X-ray microscopy and electron microscopy. Quasi-static mechanical testing results revealed that compressive strength was the highest in the fine structured composite materials. While the coarse structured specimens exhibited a compressive strength of 80% relative to this. Reconstructed micro-scale X-ray tomography data revealed different crack propagation mechanisms. Large planar shear cracks propagated throughout the fine structured materials while the coarser specimens exhibited networks of branching cracks propagating preferentially along Al alloy-Ti{sub 2}AlC phase interfaces and through shrinkage pores in the Al alloy phase. Results suggest that control of porosity, compensation for Al alloy shrinkage and enhancement of the Al alloy-Ti{sub 2}AlC phase interfaces are key considerations in the design of high performance metal/Ti{sub 2}AlC phase composites.
The effect of the solidification mode on eutectic structure in Fe-C-V alloys
International Nuclear Information System (INIS)
Fras, E.; Guzik, E.
1980-01-01
The aim of the study was to determine such a chemical composition of Fe-C-V alloys which would ensure the formation of perfectly eutectic structures as well as to investigate the eutectic morphology of these alloys when undergoing bulk and directional solidification. Attempts have been done to get in situ composites from Fe-C-V alloys. The adopted testing methods as well as obtained results are described in detail. (H.M.)
Apparao, K. Ch; Birru, Anil Kumar
2018-01-01
A novel Al-3.5FeNb-1.5C master alloy with uniform microstructure was prepared using a melt reaction process for this study. In the master alloy, basic intermetallic particles such as NbAl3, NbC act as heterogeneous nucleation substrates during the solidification of aluminium. The grain refining performance of the novel master alloy on Al-Si9.8-Cu3.4 alloy has also been investigated. It is observed that the addition of 0.1 wt.% of Al-3.5FeNb-1.5C master alloy can induce very effective grain refinement of the Al-Si9.8-Cu3.4 alloy. The average grain size of α-Al is reduced to 22.90 μm from about 61.22 μm and most importantly, the inoculation of Al-Si9.8-Cu3.4 alloy with FeNb-C is not characterised by any visible poisoning effect, which is the drawback of using commercial Al-Ti-B master alloys on aluminium cast alloys. Therefore, the mechanical properties of the Al-Si9.8-Cu3.4 alloy have been improved obviously by the addition of the 0.1 wt.% of Al-3.5FeNb-1.5C master alloy, including the yield strength and elongation.
Microstructure of Fe-Cr-C hardfacing alloys with additions of Nb, Ti and, B
International Nuclear Information System (INIS)
Berns, H.; Fischer, A.
1987-01-01
The abrasive wear of machine parts and tools used in the mining, earth moving, and transporting of mineral materials can be lowered by filler wire welding of hardfacing alloys. In this paper, the microstructures of Fe-Cr-C and Fe-Cr-C-Nb/Ti hardfacing alloys and deposits and those of newly developed Fe-Cr-C-B and Fe-Ti-Cr-C-B ones are described. They show up to 85 vol.% of primarily solidified coarse hard phases; i.e., Carbides of MC-, M/sub 7/C/sub 3/-, M/sub 3/C-type and Borides of MB/sub 2/-, M/sub 3/B/sub 2/-, M/sub 2/B-, M/sub 3/B-, M/sub 23/B/sub 6/-type, which are embedded in a hard eutectic. This itself consists of eutectic hard phases and a martensitic or austenitic metal matrix. The newly developed Fe-Cr-C-B alloys reach hardness values of up to 1200 HV and are harder than all purchased ones. The primary solidification of the MB/sub 2/-type phase of titanium requires such high amounts of titanium and boron that these alloys are not practical for manufacture as commercial filler wires
International Nuclear Information System (INIS)
Teng Lidong; Aune, Ragnhild; Seetharaman, Seshadri
2005-01-01
In view of the important applications of carbides and nitrides of transition metals in the hard materials industries, the thermodynamic activities of manganese in Mn-Ni-C-N alloys have been studied by solid-state galvanic cell technique with CaF 2 as the solid electrolyte. The phase compositions and microstructure of various alloys have been analyzed by X-ray diffraction (XRD) and scanning electron microscopy (SEM). Nitrogen was introduced into the alloy by equilibrating with N 2 gas. It was established during the experiments that the solubility of nitrogen in the alloys was affected by the carbon content. A (Mn,Ni) 4 (N,C) nitride was formed during the nitriding procedure in the alloys. The electromotive force (EMF) measurements were carried out in the temperature range 940-1127 K in order to determine the activities of Mn in the alloys. The activities of manganese were calculated and compared with those of the corresponding Mn-Ni-C ternary alloys
Kesteven, Jazmin; Kannan, M Bobby; Walter, Rhys; Khakbaz, Hadis; Choe, Han-Choel
2015-01-01
In this study, the in vitro degradation behaviour of titanium-tantalum (Ti-Ta) alloys (10-30 wt.% Ta) was investigated and compared with conventional implant materials, i.e., commercially pure titanium (Cp-Ti) and titanium-aluminium-vanadium (Ti6Al4V) alloy. Among the three Ti-Ta alloys studied, the Ti20Ta (6.3×10(-4) mm/y) exhibited the lowest degradation rate, followed by Ti30Ta (1.2×10(-3) mm/y) and Ti10Ta (1.4×10(-3) mm/y). All the Ti-Ta alloys exhibited lower degradation rate than that of Cp-Ti (1.8×10(-3) mm/y), which suggests that Ta addition to Ti is beneficial. As compared to Ti6Al4V alloy (8.1×10(-4) mm/y), the degradation rate of Ti20Ta alloy was lower by ~22%. However, the Ti30Ta alloy, which has closer elastic modulus to that of natural bone, showed ~48% higher degradation rate than that of Ti6Al4V alloy. Hence, to improve the degradation performance of Ti30Ta alloy, an intermediate thin porous layer was formed electrochemically on the alloy followed by calcium phosphate (CaP) electrodeposition. The coated Ti30Ta alloy (3.8×10(-3) mm/y) showed ~53% lower degradation rate than that of Ti6Al4V alloy. Thus, the study suggests that CaP coated Ti30Ta alloy can be a viable material for load-bearing permanent implants. Copyright © 2014 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Wanwu Ding
2017-06-01
Full Text Available Al-5Ti-0.62C-0.2Ce master alloy was synthesized by a method of thermal explosion reaction in pure molten aluminum and used to modify commercial pure Al and hypoeutectic Al-8Si alloy. The microstructure and tensile properties of commercial pure Al and hypoeutectic Al-8Si alloy with different additions of Al-5Ti-0.62C-0.2Ce master alloy were investigated. The results show that the Al-5Ti-0.62C-0.2Ce alloy was composed of α-Al, granular TiC, lump-like TiAl3 and block-like Ti2Al20Ce. Al-5Ti-0.62C-0.2Ce master alloy (0.3 wt %, 5 min can significantly refine macro grains of commercial pure Al into tiny equiaxed grains. The Al-5Ti-0.62C-0.2Ce master alloy (0.3 wt %, 30 min still has a good refinement effect. The tensile strength and elongation of commercial pure Al modified by the Al-5Ti-0.62C-0.2Ce master alloy (0.3 wt %, 5 min increased by roughly 19.26% and 61.83%, respectively. Al-5Ti-0.62C-0.2Ce master alloy (1.5 wt %, 10 min can significantly refine both α-Al grains and eutectic Si of hypoeutectic Al-8Si alloy. The dendritic α-Al grains were significantly refined to tiny equiaxed grains. The morphology of the eutectic Si crystals was significantly refined from coarse needle-shape or lath-shape to short rod-like or grain-like eutectic Si. The tensile strength and elongation of hypoeutectic Al-8Si alloy modified by the Al-5Ti-0.62C-0.2Ce master alloy (1.5 wt %, 10 min increased by roughly 20.53% and 50%, respectively. The change in mechanical properties corresponds to evolution of the microstructure.
Osorio-Galicia, Ramon; Gomez-Garcia, Carlos; Alcantara, Miguel Angel; Herrera-Vazquez, Andres
2012-01-01
The hardness and wear behavior properties of two C 18000 copper alloys with variations in Ni, Si, and Cr concentrations, both within the range of C18000 chemical analysis standard, were studied after the alloy samples had been prepared by melting and casting in sand molds and then heat-treated in solution using two-stage aging for different heating time periods. The results obtained from sample sets of the aforementioned two alloys, C 0 and C 1 , show that the alloy C 1 , with slightly higher...
Engineering Task Plan for a vapor treatment system on Tank 241-C-103
International Nuclear Information System (INIS)
Conrad, R.B.
1995-01-01
This Engineering Task Plan describes tasks and responsibilities for the design, fabrication, test, and installation of a vapor treatment system (mixing system) on Tank 241-C-103. The mixing system is to be installed downstream of the breather filter and will use a mixing blower to reduce the chemical concentrations to below allowable levels
Preparation of 103Pd seed-molecular plating of 103Pd onto silver rod
International Nuclear Information System (INIS)
Zhang Chunfu; Wang Yongxian; Tian Haibin; Yin Duanzhi
2002-01-01
A method for 103 Pd 'molecular plating' onto the surface of a silver rod is reported. The optimal composition of the plating bath is as follows: palladium chloride 0.1 mol/l, formaldehyde 2 mol/l, nitric acid 1 mol/l, and formic acid 0.4 mol/l. The 103 Pd molecular plating procedure will last 25 min at 30 deg. C. This article provides a valuable experience for the preparation of 103 Pd brachytherapy seed
2010-01-01
... or Its Successor Agency Under Public Law 103-354 Financed Contract To: Area Director, Office of... 7 Agriculture 12 2010-01-01 2010-01-01 false FmHA or Its Successor Agency Under Public Law 103-354 Financed Contract C Exhibit C to Subpart E of Part 1901 Agriculture Regulations of the Department of...
International Nuclear Information System (INIS)
Rhein, R.K.; Novak, M.D.; Levi, C.G.; Pollock, T.M.
2011-01-01
Research highlights: → Low net thermal expansion bimetallic structural lattice constructed. → Temperatures on the order of 1000 deg. C reached. → Improved silicide coating for niobium alloy developed. - Abstract: The fabrication and high temperature performance of low thermal expansion bimetallic lattices composed of Co-base and Nb-base alloys have been investigated. A 2D sheet lattice with a coefficient of thermal expansion (CTE) lower than the constituent materials of construction was designed for thermal cycling to 1000 deg. C with the use of elastic-plastic finite element analyses. The low CTE lattice consisted of a continuous network of the Nb-base alloy C-103 with inserts of high CTE Co-base alloy Haynes 188. A new coating approach wherein submicron alumina particles were incorporated into (Nb, Cr, Fe) silicide coatings was employed for oxidation protection of the Nb-base alloy. Thermal gravimetric analysis results indicate that the addition of submicron alumina particles reduced the oxidative mass gain by a factor of four during thermal cycling, increasing lifetime. Bimetallic cells with net expansion of 6 x 10 -6 /deg. C and 1 x 10 -6 /deg. C at 1000 deg. C were demonstrated and their measured thermal expansion characteristics were consistent with analytical models and finite element analysis predictions.
8 CFR 103.41 - Genealogy request fees.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Genealogy request fees. 103.41 Section 103...; AVAILABILITY OF RECORDS § 103.41 Genealogy request fees. (a) Genealogy search fee. See 8 CFR 103.7(b)(1). (b) Genealogy records fees. See 8 CFR 103.7(b)(1). (c) Manner of submission. When a request is submitted online...
Laser alloying of Al with mixed Ni, Ti and SiC powders
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2010-11-01
Full Text Available Laser alloying of aluminium AA1200 was performed with a 4.4kW Rofin Sinar Nd:YAG laser to improve the surface hardness. Alloying was carried out by depositing Ni, Ti and SiC powders of different weight ratios on the aluminium substrate. The aim...
Chen, Shaohai; Zhou, Jing; Lin, Weinan; Yu, Jihang; Guo, Rui; Poh, Francis; Shum, Danny; Chen, Jingsheng
2018-02-01
The thermal tolerance and perpendicular magnetic anisotropy (PMA) of ferromagnetic alloy Co40Fe40C20 in the structure MgO/CoFeC/Pt (or Ta) were investigated and compared with the commonly used CoFeB alloy. It is found that the PMA of CoFeC with {{K}i,CoFeC}=2.21 erg c{{m}-2} , which is 59% higher than that of CoFeB, can be obtained after proper post-annealing treatment. Furthermore, CoFeC alloy provides better thermal tolerance to temperature of 400 °C than CoFeB. The studies on ferromagnetic resonance show that the intrinsic damping constant α in of Co40Fe40C20 alloy is 0.0047, which is similar to the reported value of 0.004 for Co40Fe40B20 alloy. The comprehensive comparisons indicate that CoFeC alloy is a promising candidate for the application of the integration of spin torque transfer magnetic random access memory with complementary metal-oxide semiconductor processes.
Aging Optimization of Aluminum-Lithium Alloy C458 for Application to Cryotank Structures
Sova, B. J.; Sankaran, K. K.; Babel, H.; Farahmand, B.; Rioja, R.
2003-01-01
Compared with aluminum alloys such as 2219, which is widely used in space vehicle for cryogenic tanks and unpressurized structures, aluminum-lithium alloys possess attractive combinations of lower density and higher modulus along with comparable mechanical properties. These characteristics have resulted in the successful use of the aluminum-lithium alloy 2195 (Al-1.0 Li-4.0 Cu-0.4 Mg-0.4 Ag-0.12 Zr) for the Space Shuttle External Tank, and the consideration of newer U.S. aluminum-lithium alloys such as L277 and C458 for future space vehicles. These newer alloys generally have lithium content less than 2 wt. % and their composition and processing have been carefully tailored to increase the toughness and reduce the mechanical property anisotropy of the earlier generation alloys such 2090 and 8090. Alloy processing, particularly the aging treatment, has a significant influence on the strength-toughness combinations and their dependence on service environments for aluminum-lithium alloys. Work at NASA Marshall Space Flight Center on alloy 2195 has shown that the cryogenic toughness can be improved by employing a two-step aging process. This is accomplished by aging at a lower temperature in the first step to suppress nucleation of the strengthening precipitate at sub-grain boundaries while promoting nucleation in the interior of the grains. Second step aging at the normal aging temperature results in precipitate growth to the optimum size. A design of experiments aging study was conducted for plate. To achieve the T8 temper, Alloy C458 (Al-1.8 Li-2.7 Cu-0.3 Mg- 0.08 Zr-0.3 Mn-0.6 Zn) is typically aged at 300 F for 24 hours. In this study, a two-step aging treatment was developed through a comprehensive 24 full factorial design of experiments study and the typical one-step aging used as a reference. Based on the higher lithium content of C458 compared with 2195, the first step aging temperature was varied between 175 F and 250 F. The second step aging temperatures was
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Definitions. 25.103 Section 25.103 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... communications satellites. (c) Communications satellite corporation. (1) The terms “communications satellite...
Energy Technology Data Exchange (ETDEWEB)
Csontos, A.A.; Gable, B.M.; Starke, E.A. Jr. [Virginia Univ., Charlottesville, VA (United States). Dept. of Mater. Sci. and Eng.; Gaber, A.
2000-07-01
The air force recently developed two isotropic Al-Li-Cu-X alloys with 1.8{sup w}/oLiLi and 2.1{sup w}/oLi designated AF/C-458 and AF/C-489, respectively. The objective of this investigation was to determine the effect of quench rate on the microstructure and mechanical properties of the AF/C-458 and AF/C-489 alloys. TEM, SEM, microhardness, and tensile testing were utilized to ascertain these microstructure/property relationships for both alloys in the T4, T6, and T86 tempers as a function of quench rate. Subsequent losses in ductility for both alloys in all tempers with decreasing quench rate were determined to be due to the precipitation of the equilibrium Al{sub 2}CuLi (T{sub 1}) phase along subgrain and grain boundaries which promoted intergranular fracture. Furthermore, yield and tensile strengths increased for both alloys in the T4 temper but decreased in the T6 and T86 tempers with decreasing quench rate. The increased strengths for the T4 condition resulted from the heterogeneous precipitation of coarse T{sub 1} and naturally aged {delta}' phases. The decrease in yield and tensile strengths for the T6 and T86 tempers were also due to the coarse heterogeneous precipitation of T{sub 1} which denuded regions of Cu thereby reducing the number density of fine matrix {theta}{sup ''} (T6) and T{sub 1} (T86). Finally, a comparison of the quench sensitivity for both the AF/C-458 and AF/C-489 alloys indicates that the mechanical properties for both alloys were less quench rate sensitive than other typical Al-Li-Cu-X alloys. (orig.)
Fracture testing and performance of beryllium copper alloy C 17510
International Nuclear Information System (INIS)
Murray, H.A.; Zatz, I.J.
1992-01-01
A series of test programs was undertaken on copper beryllium alloy C 17510 for several variations in material process and chemistry. These variations in C 17510 were primarily optimized for combinations of strength and conductivity. While originally intended for use as cyclically loaded high-field, high-strength conductors in fusion energy research, material testing of C 17510 has indicated that it is an attractive and economical alternative for a host of other structural, mechanical and electrical applications. ASTM tests performed on three variations of C 17510 alloys included both J-integral and plane strain fracture toughness testing (E813, E399) and fatigue crack growth rate tests (E647), as well as verifying tensile, hardness, Charpy, and other well defined mechanical properties. Fracture testing was performed at both room and liquid nitrogen temperatures, which bound the thermal environment anticipated for the fusion components being designed. Fatigue crack propagation stress ratios ranged from nominal zero to minus one at each temperature
Sulfide phase in the Fe-Ti-S and Fe-C-Ti-S alloys
International Nuclear Information System (INIS)
Malinochka, Ya.N.; Balakina, N.A.; Shmelev, Yu.S.
1976-01-01
The nature of the sulfide phases in Fe-Ti-S and Fe-C-Ti-S alloys was studied. The carbide and the sulfide phase were identified the aid of X-ray spectral microanalysis. It was established that for a small content of titanium and sulfur in ternary Fe-Ti-S alloys the solidification of the γ-solution on the boundaries of dendritic branches is accompanied, along with the precipitation of a sulfide rich in iron of the (Fe, Ti) S type where a small quantity of titanium is dissolved, by the formation of a titanium-bearing sulfide eutectic γ + TiS. The amount of the sulfide eutectic increases with the contents of titanium and sulfur until a purely eutectic alloy is formed. Both carbides and sulfides may be formed in the solidification of quaternary alloys Fe-C-Ti-S
International Nuclear Information System (INIS)
1993-01-01
The action proposed is to sample the vapor space and liquid waste and perform other supporting activities in Tank 241-C-103 located in the 241-C Tank Farm on the Hanford Site. Operations at Tank 241-C-103 are curtailed because of an unreviewed safety question (USQ) concerning flammability issues of the organic waste in the tank. This USQ must be resolved before normal operation and surveillance of the tank can resume. In addition to the USQ, Tank 241-C-103 is thought to be involved in several cases of exposure of individuals to noxious vapors. This safety issue requires the use of supplied air for workers in the vicinity of the tank. Because of the USQ, the US Department of Energy proposes to characterize the waste in the vapor space and the organic and aqueous layers, to determine the volume of the organic layer. This action is needed to: (1) assess potential risks to workers, the public, and the environment from continued routine tank operations and (2) provide information on the waste material in the tank to facilitate a comprehensive safety analysis of this USQ. The information would be used to determine if a flammable condition within the tank is credible. This information would be used to prevent or mitigate an accident during continued waste storage and future waste characterization. Alternatives to the proposed activities have been considered in this analysis
Arc melting and homogenization of ZrC and ZrC + B alloys
Darolia, R.; Archbold, T. F.
1973-01-01
A description is given of the methods used to arc-melt and to homogenize near-stoichiometric ZrC and ZrC-boron alloys, giving attention to the oxygen contamination problem. The starting material for the carbide preparation was ZrC powder with an average particle size of 4.6 micron. Pellets weighing approximately 3 g each were prepared at room temperature from the powder by the use of an isostatic press operated at 50,000 psi. These pellets were individually melted in an arc furnace containing a static atmosphere of purified argon. A graphite resistance furnace was used for the homogenization process.
Microstructure and properties of an Al-Ti-Cu-Si brazing alloy for SiC-metal joining
Dai, Chun-duo; Ma, Rui-na; Wang, Wei; Cao, Xiao-ming; Yu, Yan
2017-05-01
An Al-Ti-Cu-Si solid-liquid dual-phase alloy that exhibits good wettability and appropriate interfacial reaction with SiC at 500-600°C was designed for SiC-metal joining. The microstructure, phases, differential thermal curves, and high-temperature wetting behavior of the alloy were analyzed using scanning electron microscopy, X-ray diffraction analysis, differential scanning calorimetry, and the sessile drop method. The experimental results show that the 76.5Al-8.5Ti-5Cu-10Si alloy is mainly composed of Al-Al2Cu and Al-Si hypoeutectic low-melting-point microstructures (493-586°C) and the high-melting-point intermetallic compound AlTiSi (840°C). The contact angle, determined by high-temperature wetting experiments, is approximately 54°. Furthermore, the wetting interface is smooth and contains no obvious defects. Metallurgical bonding at the interface is attributable to the reaction between Al and Si in the alloy and ceramic, respectively. The formation of the brittle Al4C3 phase at the interface is suppressed by the addition of 10wt% Si to the alloy.
Interfacial morphologies and growth modes of F.C.C. metallic crystals from liquid alloys
International Nuclear Information System (INIS)
Camel, Denis
1980-01-01
Equilibrium and growth morphologies of f.c.c. metallic crystals in contact with liquid alloys have been observed in-situ using transmission electron microscopy. These morphologies have been discussed in terms of atomic interfacial structure and growth mechanisms with the help of a statistical thermodynamic model which takes into account the effects of chemical interactions and interfacial adsorption. (author) [fr
Early stages of the mechanical alloying of TiC-TiN powder mixtures
Energy Technology Data Exchange (ETDEWEB)
Mura, Giovanna [Dipartimento di Ingegneria Elettrica ed Elettronica, Universita degli Studi di Cagliari, via Marengo 2, 09123 Cagliari (Italy); Musu, Elodia [Industrial Telemicroscopy Laboratory, Sardegna Ricerche, Polaris, Technology Park of Sardinia, Edificio 3, Loc. Piscinamanna, 09010 Pula (Italy); Delogu, Francesco, E-mail: francesco.delogu@dimcm.unica.it [Dipartimento di Ingegneria Meccanica, Chimica, e dei Materiali, Universita degli Studi di Cagliari, via Marengo 2, I-09123 Cagliari (Italy)
2013-01-15
The present work focuses on the alloying behavior of TiC-TiN powder mixtures submitted to mechanical processing by ball milling. Accurate X-ray diffraction analyses indicate a progressive modification of the unit cell parameters of the TiC and TiN phases, suggesting the formation of TiC- and TiN-rich solid solutions with an increasingly larger content of solutes. Once the discrete character of the mechanical treatment is taken into due account, the smooth change of the unit cell parameters can be explained by a sequence of mutual dissolution stages related to individual collisions. At each collision, the average chemical composition of small amounts of TiC- and TiN-rich phases changes discontinuously. The discontinuous changes can be tentatively ascribed to local mass transport processes activated by the mechanical deformation of powders at collisions. -- Highlights: Black-Right-Pointing-Pointer Mechanically processed TiC-TiN powder mixtures form two solid solutions. Black-Right-Pointing-Pointer An analytical model was developed to describe the mechanical alloying kinetics. Black-Right-Pointing-Pointer The amount of powder alloyed at collision was indirectly estimated. Black-Right-Pointing-Pointer A few nanomoles of material participate in the alloying process at each collision. Black-Right-Pointing-Pointer The chemical composition of the solid solutions was shown to change discontinuously.
Localized corrosion of Alloy C22 nuclear waste canister material under limiting conditions
International Nuclear Information System (INIS)
Lee, S.G.; Solomon, A.A.
2006-01-01
Localized corrosion behavior of Alloy C22 in simulated Yucca Mountain (YM) repository environments was studied at the highest achievable but realistic temperatures under boiling and dripping scenarios. Temperatures measured in concentrated boiling solutions of KCl and NaNO 3 were found to be stable at 140 deg. C, although transient boiling before dryout was observed at temperatures as high as 160 deg. C, as the electrolyte became progressively more concentrated. Experiments that simulated a dripping scenario with simulated J13 well water confirmed the existence of concentrated solutions stable at 142 ± 3 deg. C under controlled drip conditions leading to pit initiation in Alloy C22 after only a few hours. The polarization experiments conducted at 140 deg. C in a solution with 0.5 mol L -1 chloride concentration showed that the critical potential for localized corrosion was 250 mV (versus Ag/AgCl). Potentiostatic tests confirmed that active metal dissolution occurred only in the crevice region at this potential. The crevice corrosion of Alloy C22 required an incubation time to develop a critical crevice solution, and it was triggered by severe local chemistry (enrichment of Cl - and H + ) aided by the high temperature
Shape memory effect in Fe-Mn-Ni-Si-C alloys with low Mn contents
Energy Technology Data Exchange (ETDEWEB)
Min, X.H., E-mail: MIN.Xiaohua@nims.go.jp [National Institute for Materials Science, Tsukuba 305-0047 (Japan); Sawaguchi, T.; Ogawa, K. [National Institute for Materials Science, Tsukuba 305-0047 (Japan); Maruyama, T. [Awaji Materia Co., Ltd. 2-3-13, Kanda ogawamachi, Chiyoda, Tokyo 101-0052 (Japan); Yin, F.X. [National Institute for Materials Science, Tsukuba 305-0047 (Japan); Tsuzaki, K. [National Institute for Materials Science, Tsukuba 305-0047 (Japan); Graduate School of Pure and Applied Sciences, University of Tsukuba, Ibaraki 305-0047 (Japan)
2011-06-15
Highlights: {yields} A class of new Fe-Mn-Ni-Si-C shape memory alloys with low Mn contents has been designed. {yields} A Mn content for the onset of the {alpha}' martensite is less than 13 mass%, and the {epsilon} martensite still exists in the alloy with a 9 mass% Mn. {yields} The shape recovery strain decreases considerably when the Mn content is reduced from 13 to 11 mass%. {yields} The sudden decrease in the shape recovery strain is mainly caused by the formation of {alpha}' martensite. - Abstract: An attempt was made to develop a new Fe-Mn-Si-based shape memory alloy from a Fe-17Mn-6Si-0.3C (mass%) shape memory alloy, which was previously reported to show a superior shape memory effect without any costly training treatment, by lowering its Mn content. The shape memory effect and the phase transformation behavior were investigated for the as-solution treated Fe-(17-2x)Mn-6Si-0.3C-xNi (x = 0, 1, 2, 3, 4) polycrystalline alloys. The shape recovery strain exceeded 2% in the alloys with x = 0-2, which is sufficient for an industrially applicable shape memory effect; however, it suddenly decreased in the alloys between x = 2 and 3 although the significant shape recovery strain still exceeded 1%. In the alloys with x = 3 and 4, X-ray diffraction analysis and transmission electron microscope observation revealed the existence of {alpha}' martensite, which forms at the intersection of the {epsilon} martensite plates and suppresses the crystallographic reversibility of the {gamma} austenite to {epsilon} martensitic transformation.
Measurement and Analysis of Density of Molten Ni-W Alloys
Institute of Scientific and Technical Information of China (English)
FANG Liang; XIAO Feng; TAO Zainan; MuKai Kusuhiro
2005-01-01
The density of molten Ni-W alloys was measured with a modified pycnometric method. It is found that the density of the molten Ni- W alloys decreases with temperature rising, but increases with the increase of tungsten concentration in the alloys. The molar volume of molten Ni- W binary alloys increases with the increase of temperature and tungsten concentration. The partial molar volume of tungsten in liquid Ni- W binary alloy has been calculated approximately as ( - 1.59+ 5.64 × 10-3 T) × 10-6m3 ·mol-1.
International Nuclear Information System (INIS)
Doychak, J.; Barrett, C.A.; Smialek, J.L.
1989-01-01
This paper reports the isothermal and cyclic oxidation behavior of Zr-doped β-NiAl and β/γ' intermetallic alloys studied over the temperature range 1000 degrees C-1600 degrees C. Isothermal scale growth was governed by γ-Al 2 O 3 growth kinetics. The scale growth rates showed no monotonic trends with alloy aluminum content, although the stoichiometric β-NiAl alloy had the slowest kinetics. Cyclic oxidation at 1200 degrees C for 1000, 1-hr cycles of alloys having less than approximately 40 at %Al was poor due to the formation of martensite and less protective Ni-containing oxides. The cyclic oxidation behavior of Zr-doped stoichiometric β-NiAl was poor beyond 100, 1-hr cycles at 1425 degrees C. Computer modeling of the cyclic oxidation results was performed to arrive at limiting criteria for alloy service life. The limiting criteria were based on alloy aluminum depletion by oxidation that is necessary for less protective Ni-containing oxide formation. The modelling and lifetime criteria were applied to the cyclic oxidation of a Ni-50.2Al-0.04Zr (at%) alloy
Structural and magnetic properties of FeCoC system obtained by mechanical alloying
Energy Technology Data Exchange (ETDEWEB)
Rincón Soler, A. I. [Universidad Tecnológica de Pereira, Fac. de Ciencias, Depto. de Física (Colombia); Rodríguez Jacobo, R. R., E-mail: rrrodriguez@uao.edu.co [Universidad Autónoma de Occidente, Fac. de Ciencias Básicas, Depto. de Física (Colombia); Medina Barreto, M. H.; Cruz-Muñoz, B. [Universidad Tecnológica de Pereira, Fac. de Ciencias, Depto. de Física (Colombia)
2017-11-15
Fe{sub 96−X}Co{sub X}C{sub 4} (x = 0, 10, 20, 30, 40 at. %) alloys were obtained by mechanical alloying of Fe, C and Co powders using high-energy milling. The structural and magnetic properties of the alloy system were analyzed by X-ray diffraction, Scanning Electron Microscopy (SEM), Vibrating Sample Magnetometer (VSM) and Mössbauer Spectrometry at room temperature. The X-ray diffraction patterns showed a BCC-FeCoC structure phase for all samples, as well as a lattice parameter that slightly decreases with Co content. The saturation magnetization and coercive field were analyzed as a function of Co content. The Mössbauer spectra were fitted with a hyperfine magnetic field distribution showing the ferromagnetic behavior and the disordered character of the samples. The mean hyperfine magnetic field remained nearly constant (358 T) with Co content.
Structural and magnetic properties of FeCoC system obtained by mechanical alloying
International Nuclear Information System (INIS)
Rincón Soler, A. I.; Rodríguez Jacobo, R. R.; Medina Barreto, M. H.; Cruz-Muñoz, B.
2017-01-01
Fe 96−X Co X C 4 (x = 0, 10, 20, 30, 40 at. %) alloys were obtained by mechanical alloying of Fe, C and Co powders using high-energy milling. The structural and magnetic properties of the alloy system were analyzed by X-ray diffraction, Scanning Electron Microscopy (SEM), Vibrating Sample Magnetometer (VSM) and Mössbauer Spectrometry at room temperature. The X-ray diffraction patterns showed a BCC-FeCoC structure phase for all samples, as well as a lattice parameter that slightly decreases with Co content. The saturation magnetization and coercive field were analyzed as a function of Co content. The Mössbauer spectra were fitted with a hyperfine magnetic field distribution showing the ferromagnetic behavior and the disordered character of the samples. The mean hyperfine magnetic field remained nearly constant (358 T) with Co content.
Laser alloying of AI with mixed Ni, Ti and SiC powders
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2010-03-01
Full Text Available composite (MMC) is formed. The MMC layer has excellent hardness and wear resistance compared to the base alloy [9-13]. Man et al. [14] used a high power continuous wave Nd:YAG laser to alloy aluminium AA 6061 with preplaced NiTi (54 wt% Ni & 46 wt...Al, Ti3Al, SiC, Al and Si phases. The hardness increased from 75HV to 650HV due to the formation of the TiC particles and TiAl and Ti3Al intermetallics. Su and Lei [9] laser cladded Al-12wt%Si with a powder containing SiC and Al-12wt%Si in a 3...
Effect of addition of V and C on strain recovery characteristics in Fe-Mn-Si alloy
International Nuclear Information System (INIS)
Lin Chengxin; Wang Guixin; Wu Yandong; Liu Qingsuo; Zhang Jianjun
2006-01-01
Shape recoverable strain, recovery stress and low-temperature stress relaxation characteristics in an Fe-17Mn-5Si-10Cr-4Ni (0.08C) alloy and an Fe-17Mn-2Cr-5Si-2Ni-1V (0.23C) alloy have been studied by means of X-ray diffraction, transmission electron microscopy and measurement of recoverable strain and recovery stress. The amount of stress-induced ε martensite under tensile deformation at room temperature, recoverable strain and recovery stress are increased obviously with addition V and C in Fe-Mn-Si alloy, which is owing to the influence of addition V and C on strengthening austenitic matrix. Addition of V and C in Fe-Mn-Si alloy is evidently effective to reduce the degree of low-temperature stress relaxation, for the dispersed VC particles 50-180 nm in size precipitated during annealing restrain the stress induced martensitic transformation
International Nuclear Information System (INIS)
Uan, J.-Y.; Cho, C.-Y.; Chen, Z.-M.; Lin, J.-K.
2006-01-01
The evolution of metastable precipitates and the aging response in underaged Al-Mg-Si alloy during environmental temperature cycling was investigated using transmission electron microscopy (TEM) and hardness tests. After the alloy underwent thermal cycling between 25 deg. C and 65 deg. C, the hardness tests revealed that hardness decreased slightly, rather than following a concave downward curve, with the cycle times. Needle-shaped G.P. zones transformed during the environmental thermal cycling. The fraction of the zones declined sharply from almost 100% to only approximately 10% after 90 cycles, accompanied by an increase in the fraction of lath-shaped precipitates and the formation of β'' precipitates in the matrix. The precipitate developed with the 25-65 deg. C cycling time as follows: needle-shaped G.P. zones → lath-shaped ppt + β'' ppt + needle-shaped G.P. zones → lath-shaped ppt + β'' ppt + rod-shaped ppt + needle-shaped G.P. zones. Therefore, three or four precipitates coexisted in the underaged alloy following prolonged cycling. The formation of a limited number of β'' precipitates and the presence of a rod-shaped phase in the alloy during environmental temperature cycling reduced the hardness as the cycle time increases
A united refinement technology for commercial pure Al by Al-10Ti and Al-Ti-C master alloys
International Nuclear Information System (INIS)
Ma Xiaoguang; Liu Xiangfa; Ding Haimin
2009-01-01
Because flake-like TiAl 3 particles in Al-Ti-C master alloys prepared in a melt reaction method dissolve slowly when they are added into Al melt at 720 deg. C, Ti atoms cannot be released rapidly to play the assistant role of grain refinement, leading to a poor refinement efficiency of Al-Ti-C master alloys. A united refinement technology by Al-10Ti and Al-Ti-C master alloys was put forward in this paper. The rational combination of fine blocky TiAl 3 particles in Al-10Ti and TiC particles in Al-Ti-C can improve the nucleation rate of α-Al. It not only improves the grain refinement efficiency of Al-Ti-C master alloys, but also reduces the consumption
International Nuclear Information System (INIS)
Cragnolino, G.A.; Dunn, D.S.; Sridhar, N.
1998-01-01
Two corrosion resistant nickel-based alloys, 625 and C22, have been selected by the US Department of Energy as candidate materials for the inner container of high-level radioactive waste packages. The susceptibility of these materials to localized corrosion was evaluated by measuring the repassivation potential as a function of solution chloride concentration and temperature using cyclic potentiodynamic polarization and lead-in-pencil potential step test methods. At intermediate Cl- concentrations, e.g., 0.028--0.4 M, the repassivation potential of alloy 625 is greater than that for alloy 825 and is dependent on the Cl- concentration. However, at higher concentrations, the repassivation potential is slightly less than that for alloy 825 and is weakly dependent on Cl- concentration. The repassivation potentials for alloy C-22 under all test conditions are considerably higher than those of either alloy 625 or 825 and are in the range where oxygen evolution is expected to occur
Hard coatings on magnesium alloys by sputter deposition using a pulsed d.c. bias voltage
Energy Technology Data Exchange (ETDEWEB)
Reiners, G. [Bundesanstalt fuer Materialforschung und -pruefung, Berlin (Germany); Griepentrog, M. [Bundesanstalt fuer Materialforschung und -pruefung, Berlin (Germany)
1995-12-01
An increasing use of magnesium-based light-metal alloys for various industrial applications was predicted in different technological studies. Companies in different branches have developed machine parts made of magnesium alloys (e.g. cars, car engines, sewing and knitting machines). Hence, this work was started to evaluate the ability of hard coatings obtained by physical vapour deposition (PVD) in combination with coatings obtained by electrochemical deposition to protect magnesium alloys against wear and corrosion. TiN hard coatings were deposited onto magnesium alloys by unbalanced magnetron sputter deposition. A bipolar pulsed d.c. bias voltage was used to limit substrate temperatures to 180 C during deposition without considerable loss of microhardness and adhesion. Adhesion, hardness and load-carrying capacity of TiN coatings deposited directly onto magnesium alloys are compared with the corresponding values of TiN coatings deposited onto substrates which had been coated electroless with an Ni-P alloy interlayer prior to the PVD. (orig.)
Preparation of 103Pd seeds. Part 2. 'Molecular Plating' of 103Pd onto copper rod
International Nuclear Information System (INIS)
Chunfu Zhang; Yongxian Wang; Haibin Tian; Duanzhi Yin
2002-01-01
A method for 103 Pd 'molecular plating' onto the surface of the copper rod is reported. The optimal composition of the plating bath was: palladium chloride 2 g/l, ammonium hydroxide (28%) 150 ml/l, sodium hypophosphite 12 g/l, and ammonium chloride 37 g/l. The whole procedure of 103 Pd 'molecular plating' will last 50 minutes at 40 deg C. Valuable experience for the preparation of 103 Pd seeds is provided. (author)
A united refinement technology for commercial pure Al by Al-10Ti and Al-Ti-C master alloys
Energy Technology Data Exchange (ETDEWEB)
Ma Xiaoguang [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Liu Xiangfa [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China)], E-mail: xfliu@sdu.edu.cn; Ding Haimin [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China)
2009-03-05
Because flake-like TiAl{sub 3} particles in Al-Ti-C master alloys prepared in a melt reaction method dissolve slowly when they are added into Al melt at 720 deg. C, Ti atoms cannot be released rapidly to play the assistant role of grain refinement, leading to a poor refinement efficiency of Al-Ti-C master alloys. A united refinement technology by Al-10Ti and Al-Ti-C master alloys was put forward in this paper. The rational combination of fine blocky TiAl{sub 3} particles in Al-10Ti and TiC particles in Al-Ti-C can improve the nucleation rate of {alpha}-Al. It not only improves the grain refinement efficiency of Al-Ti-C master alloys, but also reduces the consumption.
The tensile properties of alloys 800H and 617 in the range 20 to 950deg C
International Nuclear Information System (INIS)
Abd El-Azim, M.E.; Ennis, P.J.; Schuster, H.; Nickel, H.
1990-01-01
The tensile properties of Alloy 800H and Alloy 617 in the solution treated condition and after ageing or carburization have been determined for the temperature range 20 to 950deg C. It was found that ageing at 900deg C prior to testing led to an increase in strength and a decrease in ductility at test temperatures up to 700deg C. Above 700deg C, there was no significant difference between the tensile properties of solution treated and aged material. Carburization caused a severe loss of ductility in both alloys at temperatures of 20 to around 800deg C, but the ductility increased sharply at test temperatures above 800deg C, accompanied by a change in the fracture mode from fracture of the carbide particles themselves to void formation and separation at the carbide/matrix interface. The correlation between tensile properties and creep data was investigated in tests carried out at different strain rates. Reasonable agreement was found at 800 to 950deg C for Alloy 617 and at 800 to 900deg C for Alloy 800H. Strain ageing effects were observed in both alloys at some temperatures and strain rates; these effects were serrated flow, negative strain rate sensitivity, peaks in the normalized UTS-temperature curves and plateaus in the elongation-temperature curves. The experimental results were interpreted in the light of two current models for strain ageing, the dislocation-dislocation interaction model and the dislocation-solute interaction model. (orig.) [de
Radiation-induced segregation and void formation in C+ ion-irradiated vanadium-carbon alloys
International Nuclear Information System (INIS)
Takeyama, T.; Ohnuki, S.; Takahashi, H.; Sato, Y.; Mochizuki, S.
1982-01-01
To clarify the effect of interstitial elements on radiation-induced segregation and void formation in V and V-C alloys irradiated by 200 keV C + ions to a dose of 48 dpa at 973 K, the microstructural observation and the measurement of C segregation to the surfaces were carried out by TEM and XPS. Voids, dislocations and precipitates were produced in all of the specimens during irradiation. The addition of C in V led to a reduction of void size and to increase in void number density, consequently the void swelling was suppressed strongly. Radiation-induced segregation of C was observed clearly on and near the irradiated surfaces of V-C alloys and as a result of the enrichment of C atoms, carbides precipitated on the surfaces. It is the first evidence of the radiation-induced segregation of interstitial elements on the surfaces. Also, quasi-carbides were observed on the (210) habit plaints near large voids and dislocations in V. The phenomena show that C atoms, which was insolved and/or implanted, interact strongly with vacancies rather than self-interstitial atoms and migrate with vacancies toward defect sinks, such as surfaces, voids, and dislocations. The segregated zones of C reduced the sink efficiency of the defects, and showed the effect of the suppression on void in V-C alloys. (author)
Reactive wetting of Ti-6Al-4V alloy by molten Al 4043 and 6061 alloys at 600-700 C
Energy Technology Data Exchange (ETDEWEB)
Lin, Qiaoli; Li, Fuxiang; Jin, Peng; Yu, Weiyuan [Lanzhou Univ. of Technology (China). State Key Lab. of Advanced Processing and Recycling of Non-ferrous Metal
2017-06-15
Wetting of Ti-6Al-4V alloy by two industrial grade Al alloys (i.e., Al 6061 and 4043 alloys) was studied using the sessile drop method at 600-700 C under high vacuum. Al/Ti-6Al-4V is a typical reactive wetting system with good final wettability accompanied by the formation of precursor film which is actually an extended reaction layer. The formation mechanism for the precursor film is ''subcutaneous infiltration''. The small amount of alloying element Si in the alloys can cause significant segregation at the liquid/solid interface which satisfies the thermodynamic condition. The wetting behavior can be described by the classic reaction product control models, and Ti{sub 7}Al{sub 5}Si{sub 12} decomposition and Al{sub 3}Ti formation correspond to the two spreading stages. The small difference in alloying elements in Al 6061 and 4043 resulted in distinctly different interface structures, formation of precursor film and spreading dynamics, especially for the Si segregation at the interface.
2010-07-01
... definitions apply: (a) Money laundering means an activity criminalized by 18 U.S.C. 1956 or 1957, or an... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 103.90 Section 103.90 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND...
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 1301.103... COMMERCE ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1301.103 Authority. The CAR is issued under the authority of section 22 of the Office of Federal Procurement Policy Act, as amended (41 U.S.C...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true The Act. 4.103 Section 4.103 Labor Office of the Secretary... Contract Act Introductory § 4.103 The Act. The McNamara-O'Hara Service Contract Act of 1965 (Pub. L. 89-286, 79 Stat. 1034, 41 U.S.C. 351 et seq.), hereinafter referred to as the Act, was approved by the...
Sardinha, Guilherme; Cordeiro, Soraia; Gomes, Erica; Romanelli, Cinthia; Andrade, Claudia; Reis, Joice; de Filippis, Ivano
2013-08-01
Outbreaks caused by serogroup C meningococci in the northeast region of Brazil from 2005 to 2011 were associated to the emergence of variant ET-15 of cc11, which has been replaced by cc103 from 2006 to date. The increase of cc103 should be closely monitored to prevent the spread of this clone to neighbouring regions. Copyright © 2013 Elsevier Inc. All rights reserved.
Laser and electron beam welding study on niobium based Nb-1Zr-0.1C alloy
International Nuclear Information System (INIS)
Badgujar, B.P.; Kushwaha, R.P.; Tewari, R.; Dey, G.K.
2016-01-01
The refractory metal based alloys are most suitable for the structural applications in high temperature reactors envisaged to operate at temperature higher than 1000°C. The Nb-1Zr-0.1C (wt. %) is being considered for structural applications in the proposed Compact High Temperature Reactors (CHTR). The welding of this alloy is a difficult task due to its reactive nature and higher thermal conductivity. Laser and Electron Beam (EB) welds were produced on sheet of Nb-1Zr-0.1C alloy at various processing parameters and their effects on weld quality was studied by characterizing their optical and SEM micrographs and microhardness profile. The joining efficiency of both welding processes were also studied. The laser welds done in air with argon shielding showed higher hardness values compared to EB welds indicating need for adequate shielding. This study will help to find the optimized welding parameters to produce defect free welds of Nb-1Zr-0.1C alloy. (author)
Yate, Luis; Coy, L Emerson; Aperador, Willian
2017-06-08
In this work we report the hot corrosion properties of binary and ternary films of the Ta-Hf-C system in V 2 O 5 -Na 2 SO 4 (50%wt.-50%wt.) molten salts at 700 °C deposited on AISI D3 steel substrates. Additionally, the mechanical and nanowear properties of the films were studied. The results show that the ternary alloys consist of solid solutions of the TaC and HfC binary carbides. The ternary alloy films have higher hardness and elastic recoveries, reaching 26.2 GPa and 87%, respectively, and lower nanowear when compared to the binary films. The corrosion rates of the ternary alloys have a superior behavior compared to the binary films, with corrosion rates as low as 0.058 μm/year. The combination and tunability of high hardness, elastic recovery, low nanowear and an excellent resistance to high temperature corrosion demonstrates the potential of the ternary Ta-Hf-C alloy films for applications in extreme conditions.
The effect of C concentration on radiation damage in Fe–Cr–C alloys
Energy Technology Data Exchange (ETDEWEB)
Meinander, A., E-mail: andrea.meinander@helsinki.fi [EURATOM-Tekes, Department of Physics, P.O. Box 43, FI-00014 University of Helsinki (Finland); Henriksson, K.O.E. [EURATOM-Tekes, Department of Physics, P.O. Box 43, FI-00014 University of Helsinki (Finland); Björkas, C. [EURATOM-Tekes, Department of Physics, P.O. Box 43, FI-00014 University of Helsinki (Finland); Institute of Energy and Climate Research – Plasma Physics, Forschungszentrum Jülich GmbH, Association EURATOM-FZJ, Partner in the Trilateral Euregio Cluster, Jülich (Germany); Vörtler, K.; Nordlund, K. [EURATOM-Tekes, Department of Physics, P.O. Box 43, FI-00014 University of Helsinki (Finland)
2013-11-15
Using a recently developed analytical bond-order potential for the complete ternary system, we performed molecular dynamics simulations of the primary radiation damage by displacement cascades in different Fe–Cr–C model alloys. We compared results obtained with this new potential to previous studies employing potentials for the binary Fe–Cr and Fe–C systems. We analysed the effect of C concentration on the number of Frenkel pairs produced by the cascades, as well as on clustering of vacancies and self-interstitial atoms (SIAs), and on the Cr and C content in the defects. The effect of C concentration on defect production was negligible, except at very high concentrations of over 1 at.% C. The main effect was in the Cr content of clustered SIAs, which increased with increasing C concentration.
Production of NbC reinforced aluminum matrix composites by mechanical alloying
International Nuclear Information System (INIS)
Silva, Marina Judice; Cardoso, Katia Regina; Travessa, Dilermando Nagle
2014-01-01
Aluminum and their alloys are key materials for the automotive and aerospace industries. The dispersion of hard ceramic particles in the Al soft matrix produces lightweight composites with interesting properties, as environmental resistance, high specific strength and stiffness, high thermal and electrical conductivity, and good wear resistance, encouraging their technological use. Powder metallurgy techniques like mechanical alloying (MA) are very attractive to design metal matrix composites, as they are able to achieve a homogeneous distribution of well dispersed particles inside the metal matrix. In this work, pure aluminum has been reinforced with particles of Niobium carbide (NbC), an extremely hard and stable refractory ceramic. NbC is frequently used as a grain growth inhibitor in micro-alloyed steel due to their low solubility in austenite. In the present work, NbC is expected to act as a reinforcing phase by its fine dispersion into the aluminum matrix, produced by MA. Composite powders produced after different milling times (up to 50h), with 10 and 20% (volume) of NbC were characterized by diffraction laser particle size analysis, scanning electron microscopy (SEM) and by X-ray diffraction (DRX), in order to establish a relationship between the milling time and the characteristics of the powder produced, as size and morphology, crystallite size and reinforcement distribution. This characterization is important in defining the MA process for production of composites for further consolidation by hot extrusion process. (author)
Production of NbC reinforced aluminum matrix composites by mechanical alloying
Energy Technology Data Exchange (ETDEWEB)
Silva, Marina Judice; Cardoso, Katia Regina; Travessa, Dilermando Nagle, E-mail: dilermando.travessa@unifesp.br [Universidade Federal de Sao Paulo (UNIFESP), Sao Jose dos Campos, SP (Brazil). Instituto de Ciencia e Tecnologia
2014-07-01
Aluminum and their alloys are key materials for the automotive and aerospace industries. The dispersion of hard ceramic particles in the Al soft matrix produces lightweight composites with interesting properties, as environmental resistance, high specific strength and stiffness, high thermal and electrical conductivity, and good wear resistance, encouraging their technological use. Powder metallurgy techniques like mechanical alloying (MA) are very attractive to design metal matrix composites, as they are able to achieve a homogeneous distribution of well dispersed particles inside the metal matrix. In this work, pure aluminum has been reinforced with particles of Niobium carbide (NbC), an extremely hard and stable refractory ceramic. NbC is frequently used as a grain growth inhibitor in micro-alloyed steel due to their low solubility in austenite. In the present work, NbC is expected to act as a reinforcing phase by its fine dispersion into the aluminum matrix, produced by MA. Composite powders produced after different milling times (up to 50h), with 10 and 20% (volume) of NbC were characterized by diffraction laser particle size analysis, scanning electron microscopy (SEM) and by X-ray diffraction (DRX), in order to establish a relationship between the milling time and the characteristics of the powder produced, as size and morphology, crystallite size and reinforcement distribution. This characterization is important in defining the MA process for production of composites for further consolidation by hot extrusion process. (author)
Irradiation performance of oxide dispersion strengthened copper alloys to 150 dpa at 415 degree C
International Nuclear Information System (INIS)
Edwards, D.J.; Kumar, A.S.; Anderson, K.R.; Stubbins, J.F.; Garner, F.A.; Hamilton, M.L.
1991-11-01
Results have been obtained on the post-irradiation properties of various oxide dispersion strengthened copper alloys irradiated from 34 to 150 dpa at 415 degrees C in the Fast Flux Test Facility. The GlidCop alloys strengthened by Al 2 O 3 continue to outperform other alloys with respect to swelling resistance, and retention of both electrical conductivity and yield strength. Several castable ODS alloys and a Cr 2 O 3 -strengthened alloy show increasingly poor resistance to radiation, especially in their swelling behavior. A HfO 2 -strengthened alloy retains most of its strength and its electrical conductivity reaches a constant level after 50 dpa, but it exhibits a higher residual radioactivity
Low cycle fatigue behaviors of low alloy steels in 310 .deg. C deoxygenated water
International Nuclear Information System (INIS)
Jang, Hun
2008-02-01
After low cycle fatigue tests of SA508 Gr.1a low alloy steel in 310 .deg. C deoxygenated water, the fatigue surface and the sectioned area of specimens were observed to understand the effect of the cyclic strain rate on the environmentally assisted cracking behaviors. From the fatigue crack morphologies of the specimen tested at a strain rate of 0.008 %/s, unclear ductile striations and blunt crack tip were observed. So, metal dissolution could be the main cracking mechanism of the material at the strain rate. On the other hand, on the fatigue surface of the specimen tested at strain rates of 0.04 and 0.4 %/s, the brittle cracks and the flat facets, which are the evidence of the hydrogen induced cracking, were observed. Also, the tendency of linkage between the main crack and micro-cracks was observed on the sectioned area. Therefore, the main cracking mechanism at the strain rates of 0.04 and 0.4 %/s could be the hydrogen induced cracking. Additionally, the evidence of the dissolved MnS inclusions was observed on the fatigue surface from energy dispersive x-ray spectrometer analyses. So, despite of the low sulfur content of the test material, the sulfides seem to contribute to environmentally assisted cracking of SA508 Gr.1a low alloy steel in 310 .deg. C deoxygenated water. Additionally, our experimental fatigue life data of SA508 Gr.1a low alloy steel (heat A) showed a consistent difference with statistical model produced in argon national laboratory. So, additional low cycle fatigue tests of other heat SA508 Gr.1a (heat B) and SA508 Gr.3 low alloy steels were performed to investigate the effect of material variability on fatigue behaviors of low alloy steels in 310 .deg. C deoxygenated water. In results, the fatigue lives of three low alloy steels were increased following order: SA508 Gr.1a low alloy steel - heat A, SA508 Gr.3 low alloy steel, and SA508 Gr.1a low alloy steel - heat B. From microstructure observation, the fatigue surface of SA508 Gr.1a low alloy
The effect of carbon distribution on deformation and cracking of Ni-16Cr-9Fe-C alloys
International Nuclear Information System (INIS)
Hertzberg, J.L.; Was, G.S.
1995-01-01
Constant extension rate tensile (CERT) tests and constant load tensile (CLT) tests were conducted on controlled purity Ni-16Cr-9Fe-C alloys. The amount and form of carbon were varied in order to investigate the roles of carbon in solution and as intergranular (IG) carbides in the deformation and IG cracking behavior in 360 C argon and primary water environments. Results show that the strength, ductility and creep resistance of these alloys are increased with carbon present in solid solution, while IG cracking on the fracture surface is suppressed. Alloys containing carbon in the form of IG carbides, however, exhibit reduced strength and ductility relative to carbon in solution, while maintaining high IG cracking resistance with respect to carbon-free alloys. CERT results of commercial alloy 600 and controlled purity, carbon containing alloys yield comparable failure strains and IG cracking amounts. CLT comparisons with creep tests of alloy 600 suggest that alloys containing IG carbides are more susceptible to creep than those containing all carbon in solid solution
Kumar, P.; Singh, A.
2018-04-01
The present study deals with evaluation of low cycle fatigue (LCF) behavior of aluminum alloy 5754 (AA 5754) at different strain rates. This alloy has magnesium (Mg) as main alloying element (Al-Mg alloy) which makes this alloy suitable for Marines and Cryogenics applications. The testing procedure and specimen preparation are guided by ASTM E606 standard. The tests are performed at 0.5% strain amplitude with three different strain rates i.e. 0.5×10-3 sec-1, 1×10-3 sec-1 and 2×10-3 sec-1 thus the frequency of tests vary accordingly. The experimental results show that there is significant decrease in the fatigue life with the increase in strain rate. LCF behavior of AA 5754 is also simulated at different strain rates by finite element method. Chaboche kinematic hardening cyclic plasticity model is used for simulating the hardening behavior of the material. Axisymmetric finite element model is created to reduce the computational cost of the simulation. The material coefficients used for “Chaboche Model” are determined by experimentally obtained stabilized hysteresis loop. The results obtained from finite element simulation are compared with those obtained through LCF experiments.
Heat treatment effect on the properties of welded joint of niobium alloys of the Nb-1Zr-C system
International Nuclear Information System (INIS)
Aref'ev, Yu.V; Chernyshova, T.A.; Pokosov, V.S.
1976-01-01
Thermal treatment of weld joints of the alloys Nb-1 Zr-(0.01-0.12)C at 800-900 deg C leads to decomposition of the solid solution of the weld metal which is accompanied with a decrease in plasticity and impact strength. The decomposition of the solid solution takes place even in a relatively pure alloy containing only 0.025% of intrusion impurities. Thermal treatment is reasonable only when carbon content in the alloys is no less than 0.1%. The decomposition of the solid solution in the weld metal of the alloy containing 0.12% of C takes place during thermal treatment at the expense of liberating niobium carbides Nb 3 C 2 and Nb 2 C. When rearrangement takes place, i it is Nb 2 C that liberates mainly
Self propagating high temperature synthesis (SHS) of the Fe(TiMo)C master alloy using ferroalloys
International Nuclear Information System (INIS)
Erauskin, J. I.; Sargyan, A.; Arana, J. L.
2009-01-01
Titanium monocarbide TiC is very hard, stable both at high and low temperatures and relatively easy to synthesize from its constituent elements by SHS. Nevertheless, it is difficult to use, as alloying element, in the reinforcement of steels manufactured by liquid metallurgy due to its low wettability by molten steel. To achieve this purpose and due to its better wettability, it is more appropriate to use a master alloy formed by the complex carbide (TiMo)C bonded in Fe. The simplest and most economic way to fabricate such a master alloy Fe(TiMo)C is, again, by SHS, with the added advantage that it can be manufactured using the commercial ferroalloys FeTi and FeMo instead of the individual elements Fe, Ti and Mo. In this work, we describe such a process as well as the characteristics of the master alloy obtained. (Author) 13 refs
International Nuclear Information System (INIS)
Edwards, D.J.; Newkirk, J.W.; Garner, F.A.; Hamilton, M.L.; Nadkarni, A.; Samal, P.
1993-01-01
Various oxide-dispersion-strengthened copper alloys have been irradiated to 150 dpa at 415 degrees C in the Fast Flux Test Facility (FFTF). The Al 2 O 3 -strengthened GlidCop TM alloys, followed closely by a HfO 2 -strengthened alloy, displayed the best swelling resistance, electrical conductivity, and tensile properties. The conductivity of the HfO 2 -strengthened alloy reached a plateau at the higher levels of irradiation, instead of exhibiting the steady decrease in conductivity observed in the other alloys. A high initial oxygen content results in significantly higher swelling for a series of castable oxide-dispersion-strengthened alloys, while a Cr 2 O 3 -strengthened alloy showed poor resistance to radiation
Harf, F. H.; Tewari, S. N.
1977-01-01
Cylindrical bars (1.2 cm diameter) of Fe-13.6Cr-3.7Al-9TaC (wt %) eutectic alloy were directionally solidified in a modified Bridgman type furnace at 1 cm/h. The alloy microstructure consisted of aligned TaC fibers imbedded in a bcc Fe-Cr-Al matrix. Specimens of the alloy were thermally cycled from 1100 to 425 C in a burner rig. The effects of 1800 thermal cycles on the microstructure was examined by scanning electron microscopy, revealing a zig-zag shape of TaC fibers aligned parallel to the growth direction. The mechanism of carbide solution and reprecipitation on the (111) easy growth planes, suggested previously to account for the development of irregular serrations in Co-Cr-Ni matrix alloys, is believed to be responsible for these zig-zag surfaces.
International Nuclear Information System (INIS)
Rojas Jara, David
2011-01-01
This work was carried out aiming to design and characterise 9-12% Cr steels with tailormade microstructures for applications in fossil fuel fired power plants. The investigations concentrated in the design and characterisation of heat resistant steels for applications in high oxidising atmospheres (12% Cr) and 9% Cr alloys for components such as rotors (P91). ThermoCalc calculations showed to be a reliable tool for alloy development. The modeling also provided valuable information for the adjustment of the processing parameters (austenisation and tempering temperatures). Two 12% Cr heat resistant steels with a fine dispersion of nano precipitates were designed and produced supported by thermodynamic modeling (ThermoCalc). A detailed characterisation of the microstructure evolution at different creep times (100 MPa / 650 C / 8000 h) was carried out by scanning transmission electron microscopy (STEM). The results of the microstructure analysis were correlated with the mechanical properties in order to investigate the influence of different precipitates (especially M 23 C 6 carbides) on the creep strength of the alloys. Precipitation of Laves phase and Z-phase was observed after several hundred hours creep time. Very few Z-phase of the type Cr(V,Ta)N nucleating from existing (V,Ta)(C,N) was observed. Both alloys show growth and coarsening of Laves phase, meanwhile the MX carbonitrides present a very slow growth and coarsening rate. Alloys containing Laves phase, MX and M 23 C 6 precipitates show best creep properties. The influence of hot-deformation and tempering temperature on the microstructure evolution on one of the designed 12% Cr alloys was studied during short-term creep at 80-250 MPa and 650 C. Quantitative determination of dislocation density and sub-grain size in the initial microstructure and after creep was investigated by STEM combined with the high-angle annular dark-field detector (HAADF). A correlation between microstructure evolution and creep
Energy Technology Data Exchange (ETDEWEB)
Rojas Jara, David
2011-03-21
This work was carried out aiming to design and characterise 9-12% Cr steels with tailormade microstructures for applications in fossil fuel fired power plants. The investigations concentrated in the design and characterisation of heat resistant steels for applications in high oxidising atmospheres (12% Cr) and 9% Cr alloys for components such as rotors (P91). ThermoCalc calculations showed to be a reliable tool for alloy development. The modeling also provided valuable information for the adjustment of the processing parameters (austenisation and tempering temperatures). Two 12% Cr heat resistant steels with a fine dispersion of nano precipitates were designed and produced supported by thermodynamic modeling (ThermoCalc). A detailed characterisation of the microstructure evolution at different creep times (100 MPa / 650 C / 8000 h) was carried out by scanning transmission electron microscopy (STEM). The results of the microstructure analysis were correlated with the mechanical properties in order to investigate the influence of different precipitates (especially M{sub 23}C{sub 6} carbides) on the creep strength of the alloys. Precipitation of Laves phase and Z-phase was observed after several hundred hours creep time. Very few Z-phase of the type Cr(V,Ta)N nucleating from existing (V,Ta)(C,N) was observed. Both alloys show growth and coarsening of Laves phase, meanwhile the MX carbonitrides present a very slow growth and coarsening rate. Alloys containing Laves phase, MX and M{sub 23}C{sub 6} precipitates show best creep properties. The influence of hot-deformation and tempering temperature on the microstructure evolution on one of the designed 12% Cr alloys was studied during short-term creep at 80-250 MPa and 650 C. Quantitative determination of dislocation density and sub-grain size in the initial microstructure and after creep was investigated by STEM combined with the high-angle annular dark-field detector (HAADF). A correlation between microstructure
Diffusion of titanium and niobium in b.c.c. Ti--Nb alloys
International Nuclear Information System (INIS)
Pontau, A.E.
1978-01-01
The diffusion coefficients for titanium and niobium radioactive tracers were simultaneously measured in Ti, Ti 94 6 Nb 5 4 , Ti 80 4 Nb 19 6 , and Ti 64 3 Nb 35 . 7 over the temperature range from 950 0 C to 1511 0 C using standard lathe sectioning techniques. The samples were initially heat treated by annealing above the α-β phase transition temperature and then either cooling slowly to room temperature or quenching. The room temperature crystal morphology was then examined using x-ray diffraction. Alloy concentrations were chosen both to suppress the β-α transition and to obtain the metastable ω-phase
Measurement of surface-induced microplasticity in Alloy 600 C-rings
International Nuclear Information System (INIS)
Lo, C.F.; Kamide, H.; Mayo, W.E.; Weissmann, S.
1990-03-01
The level of microplasticity in Alloy 600 specimens used for accelerated SCC tests was measured with the aid of a novel x-ray rocking curve technique developed at Rutgers University. With this tool, it was possible to measure quantitatively the strain level at any point along the circumference of a C-ring. Combined with selective etching, the method was used to obtain a depth profile of the strain. A detailed study of the deformation state in C-rings was performed with a particular emphasis on how material parameters influence localization of the strain. These studies included the role of grain boundary carbides, grain size and mill anneal temperatures. The studies led to the development of a numerical model for calculation of the strain distribution along a C-ring which is superior to that currently in use. An additional result of these studies was a simple indirect method that can be used to determine the amount of grain boundary carbides present in tubes of Alloy 600. The final phase of this project was to measure the strain relaxation kinetics in this alloy. From this work, the activation energy for relaxation and the atomistic process responsible were identified. Based on this work, calculations were performed to indicate the degree of relaxation that can be expected during normal steam generator operation and accelerated SCC testing. These calculations suggest that relaxation may be significant in the temperature range of 280--360 degree C which is typical for such tests and highlights the fact that during these tests significant changes in the microstructure that can be detected by x-rays are taking place. These results will provide a more accurate basis for extrapolating tests to actual steam generator corrosion experience. 6 figs., 2 tabs
Impact strength of the uranium-6 weight percent niobium alloy between -1980 and +2000C
International Nuclear Information System (INIS)
Anderson, R.C.
1981-09-01
A study was conducted to determine if a ductile-to-brittle transition wxisted for the uranium-6 wt % niobium (U-6Nb) alloy. Standard V-notched Charpy bars were made from both solution-quenched and solution-quenched and aged U-6Nb alloy and were tested between -198 0 and +200 0 C. It was found that a sharp ductile-brittle transition does not exist for the alloy. A linear relationship existed between test temperature and impact strength, and the alloy retained a significant amount of impact strength even at very low temperatures. 9 figures
Separation and determination of 103Ru in samples of fission 99Mo
International Nuclear Information System (INIS)
Aghazarian, V.P.; Duran, Adrian P.; Mondino, Angel V.
2003-01-01
In Argentina 99 Mo is produced in the RA-3 reactor at the Ezeiza Atomic Center (CAE), by irradiation of miniplates of Al/U (90% 235 U) alloy. The 99 Mo separation is carried out at the Fission Radioisotopes Production Plant. Quality control is important to assure the quality of molybdenum that is produced in CAE. A new method to purify and on line quantify 103 Ru as an impurity present in 99 Mo samples was developed. This procedure is based in the RuO 4 volatilization and its dissolution in NaOH 6M. This is necessary due to the fact that 103 Ru cannot be detected in presence of high activities of 99 Mo without previous separation. This method allows a quantitative, specific, efficient, fast and reproducible separation of 103 Ru from 99 Mo. (author)
Energy Technology Data Exchange (ETDEWEB)
Oro, Raquel, E-mail: raqueld@chalmers.se [Department of Materials and Manufacturing Technology, Chalmers University of Technology, Rännvägen 2A, SE-41296 Gothenburg (Sweden); Campos, Mónica, E-mail: campos@ing.uc3m.es [Department of Materials Science and Engineering, IAAB, Universidad Carlos III de Madrid, Av. Universidad 30, 28911 Leganés, Madrid (Spain); Hryha, Eduard, E-mail: hryha@chalmers.se [Department of Materials and Manufacturing Technology, Chalmers University of Technology, Rännvägen 2A, SE-41296 Gothenburg (Sweden); Torralba, José Manuel, E-mail: torralba@ing.uc3m.es [Department of Materials Science and Engineering, IAAB, Universidad Carlos III de Madrid, Av. Universidad 30, 28911 Leganés, Madrid (Spain); IMDEA Materials Institute, C/Eric Kandel, 2, 28906 Getafe, Madrid (Spain); Nyborg, Lars, E-mail: lars.nyborg@chalmers.se [Department of Materials and Manufacturing Technology, Chalmers University of Technology, Rännvägen 2A, SE-41296 Gothenburg (Sweden)
2013-12-15
The characteristics of the metallic powder surface play a critical role in the development of strong bonds between particles during sintering, especially when introducing elements with a high affinity for oxygen. In this study, Mn and Si have been combined in a Fe–Mn–Si–C master alloy powder in order to reduce their chemical activity and prevent oxidation during the heating stage of the sintering process. However, when this master alloy powder is mixed with an iron base powder, differences in chemical activity between both components can lead to an oxygen transfer from the iron base powder to the surface of the master alloy particles. The present research is focused on studying the evolution of the master alloy particle surface during the early stages of sintering. Surface characterization by X-ray Photoelectron Spectroscopy (XPS) shows that the master alloy powder surface is mostly covered by a thin easily reducible iron oxide layer (∼ 1 nm). Mn–Si particulate oxides are found as inclusions in specific areas of the surface. Evolution of oxides during sintering was studied on green compacts containing iron powder, graphite and Fe–Mn–Si–C master alloy powder that were heat treated in vacuum (10{sup −6} mbar) at different temperatures (from 400, 600, 800 to 1000 °C) and analyzed by means of XPS. Vacuum sintering provides the necessary conditions to remove manganese and silicon oxides from the powder surface in the range of temperatures between 600 °C and 1000 °C. When sintering in vacuum, since the gaseous products from reduction processes are continuously eliminated, oxidation of master alloy particles due to oxygen transfer through the atmosphere is minimized. - Highlights: • Mn and Si were introduced in sintered steels using a master alloy powder. • Surface of the master alloy is mainly covered by an easily reducible iron oxide. • Temperature ranges for oxidation/reduction are identified. • Vacuum conditions avoid oxygen transfer to
High performance Ti-6Al-4V + TiC alloy by blended elemental powder metallurgy
International Nuclear Information System (INIS)
Fujii, H.; Yamazaki, T.; Horiya, T.; Takahashi, K.
1993-01-01
The blended elemental powder metallurgy (BE) of titanium alloys is one of the most cost saving technologies, in which the blending of titanium powder and alloying element powders (or master alloy powders), precise compaction at room temperature, and consolidation are conducted in turn. In addition to some economical and material saving advantages, the BE has a noteworthy feature, that is, the synthesis of special alloy systems which are difficult to be produced by the ingot metallurgy. A particle or fiber reinforced metal matrix composite (MMC) is one of the examples, and the addition of TiC particles to the extensively used Ti-6Al 4V has succeeded in obtaining higher tensile strength, Young's modulus, and elevated temperature properties. However, the raising up of some properties sometimes deteriorates other ones in MMC, and it often prevents the practical use. In this research work, the improvement of tensile ductility and fatigue properties of Ti-6Al-4V+TiC alloys without lowering other mechanical properties is aimed through the microstructural control
Role of manganese on the grain refining efficiency of AZ91D magnesium alloy refined by Al4C3
International Nuclear Information System (INIS)
Liu Shengfa; Zhang Yuan; Han Hui
2010-01-01
A novel Mg-50% Al 4 C 3 (hereafter in wt.%) master alloy has been developed by powder in situ synthesis process, the role of manganese on the grain refining efficiency of AZ91D magnesium alloy refined by this master alloy has been investigated. X-ray diffraction (XRD) and energy dispersive X-ray spectroscopy (EDS) results show the existence of Al 4 C 3 particles in this master alloy. After addition of 0.6% Al 4 C 3 or combined addition of 0.6% Al 4 C 3 and 0.27% Mn, the average grain size of AZ91D decreased dramatically from 360 μm to 210 μm, and from 360 μm to130 μm, respectively. However, no further refinement of grain size was achieved with additional amount of Mn exceeding 0.27% for AZ91D alloy refined by 0.6% Al 4 C 3 in the present investigation. Al-C-O-Mn-Fe-rich intermetallic particles with an Al-C-O-rich coating film, often observed in the central region of magnesium grains of the AZ91D alloy treated by the combination of Al 4 C 3 and Mn, are proposed to be the potent nucleating substrates for primary α-Mg.
Preparation and mechanical properties of in situ TiC{sub x}–Ni (Si, Ti) alloy composites
Energy Technology Data Exchange (ETDEWEB)
Wang, Wenjuan [Institute of Materials Science and Engineering, School of Mechanical, Electronic and Control Engineering, Beijing Jiaotong University, Beijing 100044 (China); Zhai, Hongxiang, E-mail: hxzhai@sina.com [Institute of Materials Science and Engineering, School of Mechanical, Electronic and Control Engineering, Beijing Jiaotong University, Beijing 100044 (China); Chen, Lin; Huang, Zhenying [Institute of Materials Science and Engineering, School of Mechanical, Electronic and Control Engineering, Beijing Jiaotong University, Beijing 100044 (China); Bei, Guoping; Baumgärtner, Christoph; Greil, Peter [Department of Materials Science (Glass and Ceramics), University of Erlangen-Nuernberg, Martensstr. 5, 91058 Erlangen (Germany)
2014-10-20
Novel in situ TiC{sub x} reinforced Ni (Si, Ti) alloy composites with superior mechanical properties were prepared at 1250 °C for 30 min by pressureless sintering Ti{sub 3}SiC{sub 2} (10 and 20 vol%) and Ni as precursors. The Ti{sub 3}SiC{sub 2} particles decomposed into substoichiometric TiC{sub x} phase, while the additional Si and partial Ti atoms derived from Ti{sub 3}SiC{sub 2} diffused into Ni matrix to form Ni (Si, Ti) alloy. The in situ formed TiC{sub x} phases are mainly dispersed on the grain boundaries of the Ni (Si, Ti) alloying, forming a strong skeleton and refining the microstructures of the metal matrix. The hardness, the yield stress σ{sub 0.2%} and ultimate compressive strength of 20.6 vol%TiC{sub x}–Ni(Si, Ti) composite can reach 2.15±0.04 GPa, 466.8±55.8 MPa and 733.3±78.4 MPa, respectively. The enhanced mechanical properties of TiC{sub x}–Ni(Si, Ti) composites are due to the in situ formation of TiC{sub x} skeleton, the refined microstructures of Ni (Si, Ti) alloys and solid solution effects as well as good wettability between TiC{sub x} and Ni (Si, Ti) matrix.
International Nuclear Information System (INIS)
Lin, Chi-Ming; Lai, Hsuan-Han; Kuo, Jui-Chao; Wu, Weite
2011-01-01
A combination of transmission electron microscopy, electron backscatter diffraction and wavelength dispersive spectrum has been used to identify crystal structure, grain boundary characteristic and chemical composition of the constituent phases in Cr-Fe-C alloys with three different carbon concentrations. Depending on the three different carbon concentrations, the solidification structures are found to consist of primary α-phase and [α + (Cr,Fe) 23 C 6 ] eutectic in Cr-18.4Fe-2.3 C alloy; primary (Cr,Fe) 23 C 6 and [α + (Cr,Fe) 23 C 6 ] eutectic in Cr-24.5Fe-3.8 C alloy and primary (Cr,Fe) 7 C 3 and [α + (Cr,Fe) 7 C 3 ] eutectic in Cr-21.1Fe-5.9 C alloy, respectively. The grain boundary analysis is useful to understand growth mechanism of the primary phase. The morphologies of primary (Cr,Fe) 23 C 6 and (Cr,Fe) 7 C 3 carbides are faceted structures with polygonal shapes, different from primary α-phase with dendritic shape. The primary (Cr,Fe) 23 C 6 and (Cr,Fe) 7 C 3 carbides with strong texture exist a single crystal structure and contain a slight low angle boundary, resulting in the polygonal growth mechanism. Nevertheless, the primary α-phase with relative random orientation exhibits a polycrystalline structure and comprises a massive high-angle boundary, caused by the dendritic growth mechanism. - Highlights: ► Microstructures of the as-clad Cr-based alloys are characterized by TEM. ► EBSD technique has been use to characterize the grain boundary of primary phases. ► We examine transitions in morphology about the primary phases. ► Morphologies of primary carbides are polygonal different from primary α-phase. ► Solidification structures rely on C concentrations in Cr-Fe-C alloy.
International Nuclear Information System (INIS)
Bartos, B.; Kowalska, E.; Bilewicz, A.; Skarnemark, G.
2009-01-01
103m Rh is a very promising radionuclide for Auger electron therapy due to its very low photon/electron ratio. The goal of the present work was the elaboration a method for production of large quantities of 103m Rh for generator system. It was found that the combination of solvent extraction with evaporation of 103 RuO 4 followed by decomposition of H 5 IO 6 makes it possible to produce 103m Rh of high radionuclidic and chemical purity. (author)
International Nuclear Information System (INIS)
Kim, Dong Jin; Jung, Su Jin; Moon, Byung Hak; Kim, Sung Woo; Lim, Yun Soo; Kim, Hong Pyo
2013-01-01
Helium is used as a coolant in a VHTR owing to its high thermal conductivity, inertness, and low neutron absorption. However, helium inevitably includes impurities that create an imbalance in the surface reactivity at the interface of the coolant and the exposed materials. The carbon monoxide, methane, hydrogen, and water that are formed by the reaction with the graphite in the core induce various surface reactions that lead to material property changes over time. According to previous reports it was predicted that the outer oxide layer thickness, internal oxide depth, and carbidedepleted zone depth increase to 116 μm, 600 μm, and 1000 μm, respectively, when Alloy 617 is exposed to a plausible impure helium environment at 950 .deg. C for 20 years, based on the reaction rate constant determined from the short time experiment. These values are large enough to pay attention to the material degradation at high temperature, i. e., the life of the IHX. Therefore, finding the range of impurity concentration at which the material is stable, based on the thermodynamics and kinetics determined by a long-term experiment, is very important to the optimum chemistry control for a life extension. Another countermeasure is to improve the material performance through alloy development. Commercial nickel-based wrought alloy is strengthened by a solid solution and precipitation hardening mechanism in a wide temperature range of 500 to 900 .deg. C. The γ' significantly contributes to the strengthening by forming an anti-phase boundary and preventing a dislocation motion at an intermediate temperature range of 700 to 800 .deg. C, but is no longer stable above this temperature range. However, the material for an IHX needs to fulfill the mechanical property requirements in a narrow, very high temperature range of 850 to 950 .deg. C rather than in a wide temperature range. Therefore, it is worth making the effort to find an optimum combination of alloying elements and processing
Energy Technology Data Exchange (ETDEWEB)
Kim, Dong Jin; Jung, Su Jin; Moon, Byung Hak; Kim, Sung Woo; Lim, Yun Soo; Kim, Hong Pyo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2013-10-15
Helium is used as a coolant in a VHTR owing to its high thermal conductivity, inertness, and low neutron absorption. However, helium inevitably includes impurities that create an imbalance in the surface reactivity at the interface of the coolant and the exposed materials. The carbon monoxide, methane, hydrogen, and water that are formed by the reaction with the graphite in the core induce various surface reactions that lead to material property changes over time. According to previous reports it was predicted that the outer oxide layer thickness, internal oxide depth, and carbidedepleted zone depth increase to 116 μm, 600 μm, and 1000 μm, respectively, when Alloy 617 is exposed to a plausible impure helium environment at 950 .deg. C for 20 years, based on the reaction rate constant determined from the short time experiment. These values are large enough to pay attention to the material degradation at high temperature, i. e., the life of the IHX. Therefore, finding the range of impurity concentration at which the material is stable, based on the thermodynamics and kinetics determined by a long-term experiment, is very important to the optimum chemistry control for a life extension. Another countermeasure is to improve the material performance through alloy development. Commercial nickel-based wrought alloy is strengthened by a solid solution and precipitation hardening mechanism in a wide temperature range of 500 to 900 .deg. C. The γ' significantly contributes to the strengthening by forming an anti-phase boundary and preventing a dislocation motion at an intermediate temperature range of 700 to 800 .deg. C, but is no longer stable above this temperature range. However, the material for an IHX needs to fulfill the mechanical property requirements in a narrow, very high temperature range of 850 to 950 .deg. C rather than in a wide temperature range. Therefore, it is worth making the effort to find an optimum combination of alloying elements and processing
Corrosion of aluminum alloys as a function of alloy composition
International Nuclear Information System (INIS)
Johnson, A.B. Jr.
1969-10-01
A study was initiated which included nineteen aluminum alloys. Tests were conducted in high purity water at 360 0 C and flow tests (approx. 20 ft/sec) in reactor process water at 130 0 C (TF-18 loop tests). High-silicon alloys and AlSi failed completely in the 360 0 C tests. However, coupling of AlSi to 8001 aluminum suppressed the failure. The alloy compositions containing iron and nickel survived tht 360 0 C autoclave exposures. Corrosion rates varied widely as a function of alloy composition, but in directions which were predictable from previous high-temperature autoclave experience. In the TF-18 loop flow tests, corrosion penetrations were similar on all of the alloys and on high-purity aluminum after 105 days. However, certain alloys established relatively low linear corrosion rates: Al-0.9 Ni-0.5 Fe-0.1 Zr, Al-1.0 Ni-0.15 Fe-11.5 Si-0.8 Mg, Al-1.2 Ni-1.8 Fe, and Al-7.0 Ni-4.8 Fe. Electrical polarity measurements between AlSi and 8001 alloys in reactor process water at temperatures up to 150 0 C indicated that AlSi was anodic to 8001 in the static autoclave system above approx. 50 0 C
Tank 241-C-103 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
The data quality objective (DQO) process was chosen as a tool to be used to identify the sampling analytical needs for the resolution of safety issues. A Tank Characterization Plant (TCP) will be developed for each double shell tank (DST) and single-shell tank (SST) using the DQO process. There are four Watch list tank classifications (ferrocyanide, organic salts, hydrogen/flammable gas, and high heat load). These classifications cover the six safety issues related to public and worker health that have been associated with the Hanford Site underground storage tanks. These safety issues are as follows: ferrocyanide, flammable gas, organic, criticality, high heat, and vapor safety issues. Tank C-103 is one of the twenty tanks currently on the Organic Salts Watch List. This TCP will identify characterization objectives pertaining to sample collection, hot cell sample isolation, and laboratory analytical evaluation and reporting requirements in accordance with the appropriate DQO documents. In addition, the current contents and status of the tank are projected from historical information. The relevant safety issues that are of concern for tanks on the Organic Salts Watch List are: the potential for an exothermic reaction occurring from the flammable mixture of organic materials and nitrate/nitrite salts that could result in a release of radioactive material and the possibility that other safety issues may exist for the tank
Directory of Open Access Journals (Sweden)
Farida Benhalla-Haddad
2012-01-01
Full Text Available This work deals with the relation between microstructure and electrochemical behavior of four iron-based FeCoC ternary alloys. First, the arc-melted studied alloys were characterized using differential thermal analyses and scanning electron microscopy. The established solidification sequences of these alloys show the presence of two primary crystallization phases (δ(Fe and graphite as well as two univariante lines : peritectic L+(Fe↔(Fe and eutectic L↔(Fe+Cgraphite. The ternary alloys were thereafter studied in nondeaerated solution of 10−3 M NaHCO3 + 10−3 M Na2SO4, at 25°C, by means of the potentiodynamic technique. The results indicate that the corrosion resistance of the FeCoC alloys depends on the carbon amount and the morphology of the phases present in the studied alloys.
International Nuclear Information System (INIS)
Xiong, X.Y.; Tran, P.; Pereloma, E.; Ringer, S.P.
2004-01-01
Full text: Extensive studies on the effect of ageing treatment on the micro structure and mechanical properties of most commercial ferritic (a) Fe-C(-X) alloys reveal age-hardening characteristics that involve a monotonic increase towards a peak hardness after several hours of ageing. Peak hardness is always associated with the formation of precipitate particles (e.g: MnC 3 ). However, there is relatively little systematic work on the very early stages of ageing using direct nanostructural analysis and many questions remain on the potential for clustering of interstitial C atoms prior to the precipitation reaction. In this experimental work, we report a small but significant hardness peak within 300 sec during ageing at 550 deg C. High resolution transmission electron microscopy (HRTEM) observations did not show any microstructural change during this early stage of ageing. In order to understand the microstructural evolution in ultra-low carbon a-Fe-C(-Mn) alloys during these early stages of ageing, 3-dimensional atom probe (3DAP) has been used to examine the C atom distribution and possible segregation of C and Mn atoms in these alloys. In this report, the 3DAP analyses and HRTEM observations of Fe-C and Fe-C-Mn alloys are correlated with age hardening measurements and possible mechanisms of the initial hardening phenomenon will be discussed
Oxidation in air of two refractory alloys (Nicral D and Hastelloy X) at 900 and 1100 deg. C
International Nuclear Information System (INIS)
Sannier, J.; Dominget, R.; Darras, R.
1960-01-01
The oxidation in air of two refractory alloys (Nicral D and Hastelloy X) has been studied at 900 and 1100 deg. C, by means of recording thermo-balances and microscopic cross section examination. At 900 deg. C, the surface oxidation rates of the two alloys are quite similar, but at 1100 deg. C the alloy Nicral D oxidizes faster than the alloy Hastelloy X. On the other hand, after heating at 1100 deg. C for 150 hours, Nicral D shows both intergranular oxidation and a small amount of internal oxidation, whereas Hastelloy X is especially subject to internal oxidation. In addition, two descaling methods were compared: an electrolytic method, in a sodium hydroxide-sodium carbonate bath, and a chemical method using a sodium nitrate-sodium peroxide bath; the latter appears suitable only for Hastelloy X. Reprint of a paper published in Journal of nuclear materials, 3, p. 213-225, 1959 [fr
Mondol, S.; Makineni, S. K.; Kumar, S.; Chattopadhyay, K.
2018-05-01
This paper presents a detailed investigation on the effect of small amount of Nb and Zr additions to 2219 Al alloy coupled with a novel three-stage heat treatment process. The main aim of the work is to increase the high temperature strength of 2219 alloy by introducing thermally stable L12 type ordered precipitates in the matrix as well as by reducing the coarsening of metastable strengthening θ″ and θ' precipitates. To achieve this, small amounts of Nb and Zr are added to 2219 alloy melt and retained in solid solution by suction casting in a water-cooled copper mould having a cooling rate of 102 to 103 K/s. The suction cast alloy is directly aged at 673 K (400 °C) to form L12 type ordered coherent Al3Zr precipitates. Subsequently, the alloy is solution treated at 808 K (535 °C) for 30 minutes to get supersaturation of Cu in the matrix without significantly affecting the Al3Zr precipitates. Finally, the alloy is aged at 473 K (200 °C), which results in the precipitation of θ″ and θ'. Microstructural characterization reveals that θ″ and θ' are heterogeneously precipitated on pre-existing uniformly distributed Al3Zr precipitates, which leads to a higher number density of these precipitates. This results in a significant increase in strength at room temperature as well as at 473 K (200 °C) as compared to the 2219 alloy. Furthermore, the alloy remains thermally stable after prolonged exposure at 473 K (200 °C), which is attributed to the elastic strain energy minimization by the conjoint Al3Zr/θ' or Al3Zr/θ″ precipitates, and the high Zr and Nb solute-vacancy binding energy, retarding the growth and coarsening of θ″ and θ' precipitates.
STUDY OF COATINGS OBTAINED FROM ALLOY Fe-Mn-C-B-Si-Ni-Cr
Directory of Open Access Journals (Sweden)
Mychajło Paszeczko
2016-09-01
Full Text Available Tribological behaviour of coatings obtained from eutectic alloy Fe-Mn-C-B-Si-Ni-Cr was studied. The coatings were obtained by the method of gas metal arc welding (GMA with use of powder wire. GMA welding method is widely used for the regeneration of machine parts. Eutectic Fe-Mn-C-B-Si-Ni-Cr alloys can be used to obtain high quality coatings resistant to wear and corrosion. Pin-on-disk dry sliding wear tests at sliding speeds 0.4 m/s and under load 10 MPa were conducted for pin specimens. During friction a typical tribological behavior was observed. The mechanism of wear was mechanical-chemical.
International Nuclear Information System (INIS)
Postma, A.K.; Bechtold, D.B.; Borsheim, G.L.; Grisby, J.M.; Guthrie, R.L.; Kummerer, M.; Turner, D.A.; Plys, M.G.
1994-03-01
Safety hazards associated with the interim storage of a potentially flammable organic liquid in waste Tank C-103 are identified and evaluated. The technical basis for closing the unreviewed safety question (USQ) associated with the floating liquid organic layer in this tank is presented
Energy Technology Data Exchange (ETDEWEB)
Postma, A.K.; Bechtold, D.B.; Borsheim, G.L.; Grisby, J.M.; Guthrie, R.L.; Kummerer, M.; Turner, D.A. [Westinghouse Hanford Co., Richland, WA (United States); Plys, M.G. [Fauske and Associates, Inc., Burr Ridge, IL (United States)
1994-03-01
Safety hazards associated with the interim storage of a potentially flammable organic liquid in waste Tank C-103 are identified and evaluated. The technical basis for closing the unreviewed safety question (USQ) associated with the floating liquid organic layer in this tank is presented.
Generator separation of 103Ru//sup 103m/Rh
International Nuclear Information System (INIS)
Epperson, C.E.
1975-01-01
A generator for producing carrier-free Rh-103m was developed using a liquid extraction technique. Initially, Ru-103 chloride was converted to the sulfate by moderate fuming for 80 minutes in 1:1 sulfuric acid. The Ru-103 was then brought to its highest oxidation state with 0.2 N ceric sulfate. Ru-103 tetroxide was removed from an aqueous equilibrium solution of Ru-103/Rh-103m by three one-minute extractions into CCl 4 . The Rh-103m daughter was not extracted under these conditions. Yields of Rh-103m exceeded 90 percent theoretical. The Ru-103 removed by CCl 4 could be recovered by two hours of back-extraction into 2 M sulfuric acid containing 5 mg of sodium sulfite. A cyclic extraction system was made possible by employing sulfate media. Equilibrium Ru-103 could be repeatedly extracted and recovered, thereby producing a ''generator'' system for the production of Rh-103m. Ru-103 chloride can be converted to the sulfate and then stored for at least 38 days prior to extraction. By performing the fuming step whenever convenient, the time required to perform an extraction separation was reduced to 15 minutes. Prior treatment of glassware surfaces with dilute sulfuric acid prevented Ru-103 glass adsorption losses and made glassware much easier to decontaminate. Off-the-shelf reagent-grade CCl 4 could be used without further purification. Efforts to separate Rh-103m from Ru-103 by chromatography techniques were unsuccessful
International Nuclear Information System (INIS)
Shower, Patrick T.; Technology Division; University of Tennessee, Knoxville, TN; Roy, Shibayan; Technology Division; Indian Institute of Technology; Hawkins, Charles Shane; Technology Division)
2017-01-01
Here in this study, the high temperature compressive response of cast aluminum alloys 319 and RR350 is compared in light of their microstructures. The 319 alloy is widely used in thermally critical automotive applications and provides a baseline for comparison with the RR350 alloy, whose microstructural stability at high homologous temperatures was recently reported. Cylindrical compression samples from each alloy were tested at four temperatures up to 300 °C at a constant true strain rate that was varied over four orders of magnitude. Although both alloys are strengthened by metastable precipitates (nominally Al 2 Cu) in the as-aged condition, their mechanical response diverges at temperatures greater than 250 °C as the strengthening precipitates evolve in the 319 alloy and retain their as-aged morphology in the RR350 alloy. Deformation mechanisms of each alloy are examined using microstructural analysis and empirical activation energy calculations. The stability of the θ' phase in the RR350 alloy leads to effective precipitation hardening at homologous temperatures up to 0.6 and an extensive regime of grain boundary controlled deformation.
Energy Technology Data Exchange (ETDEWEB)
Dwivedi, Shashi Prakash [Noida Institute of Engineering and Technology, Greater Noida (Korea, Republic of)
2014-01-15
In the present investigation, A356/C355 aluminium alloys are welded by friction stir welding by controlling various welding parameters. A356 and C355 aluminium alloys materials have a set of mechanical and physical properties that are ideally suited for application in aerospace and automobile industries and not widely used because of its poor weldebility. To overcome this barrier, weldebility analysis of A356 and C355 aluminium alloys with high speed steel (Wc-Co) tool has been investigated. An attempt has been made to investigate the influence of the rotational speed of the tools, the axial force and welding speed on tensile strength of A356/C355 aluminium alloys joint. The experiments were conducted on a milling machine. The main focus of investigation is to determine good tensile strength. Response surface methodology (box Behnken design) is chosen to design the optimum welding parameters leading to maximum tensile strength. The result shows that axial force increases, tensile strength decreases. Whereas tool rotational speed and welding speed increase, tensile strength increases. Optimum values of axial force (3 /KN), tool rotational speed (900 RPM) and welding speed (75 mm/min.) during welding of A356/C355 aluminium alloys joint to maximize the tensile strength (Predicted 223.2 MPa) have been find out.
International Nuclear Information System (INIS)
Dwivedi, Shashi Prakash
2014-01-01
In the present investigation, A356/C355 aluminium alloys are welded by friction stir welding by controlling various welding parameters. A356 and C355 aluminium alloys materials have a set of mechanical and physical properties that are ideally suited for application in aerospace and automobile industries and not widely used because of its poor weldebility. To overcome this barrier, weldebility analysis of A356 and C355 aluminium alloys with high speed steel (Wc-Co) tool has been investigated. An attempt has been made to investigate the influence of the rotational speed of the tools, the axial force and welding speed on tensile strength of A356/C355 aluminium alloys joint. The experiments were conducted on a milling machine. The main focus of investigation is to determine good tensile strength. Response surface methodology (box Behnken design) is chosen to design the optimum welding parameters leading to maximum tensile strength. The result shows that axial force increases, tensile strength decreases. Whereas tool rotational speed and welding speed increase, tensile strength increases. Optimum values of axial force (3 /KN), tool rotational speed (900 RPM) and welding speed (75 mm/min.) during welding of A356/C355 aluminium alloys joint to maximize the tensile strength (Predicted 223.2 MPa) have been find out.
International Nuclear Information System (INIS)
Follstaedt, D.M.; Knapp, J.A.; Pope, L.E.; Yost, F.G.; Picraux, S.T.
1984-01-01
The microstructural and tribological effects of ion implanting C into Ti-implanted, Fe-based alloys are examined and compared to the influence of C introduced by vacuum carburization during Ti implantation alone. The amorphous surface alloy formed by Ti implantation of pure Fe increases in thickness when additional C is implanted at depths containing Ti but beyond the range of carburization. Pin-on-disc tests of 15-5 PH stainless steel show that implantation of both Ti and C reduces friction significantly under conditions where no reduction is obtained by Ti implantation alone; wear depths are also less when C is implanted. All available experimental results can be accounted for by consideration of the thickness and Ti concentration of the amorphous Fe-Ti-C alloy. The thicker amorphous layer on samples implanted with additional C extends tribological benefits to more severe wear regimes
DENSITY-FUNCTIONAL STUDY OF U-Mo AND U-Zr ALLOYS
Energy Technology Data Exchange (ETDEWEB)
Landa, A; Soderlind, P; Turchi, P A
2010-11-01
Density-functional theory previously used to describe phase equilibria in U-Zr alloys [A. Landa, P. Soederlind, P.E.A. Turchi, J. Alloys Comp. 478 (2009) 103-110] is extended to investigate the ground-state properties of U-Mo solid solutions. We discuss how the heat of formation in both alloys correlates with the charge transfer between the alloy components, and how the specific behavior of the density of states in the vicinity of the Fermi level promotes the stabilization of the U{sub 2}Mo compound. Our calculations prove that, due to the existence of a single {gamma}-phase over the typical fuel operation temperatures, {gamma}-U-Mo alloys should indeed have much lower constituent redistribution than {gamma}-U-Zr alloys for which binodal decomposition causes a high degree of constituent redistribution.
Characterization of B4C-composite-reinforced aluminum alloy composites
Singh, Ram; Rai, R. N.
2018-04-01
Dry sliding wear tests conducted on Pin-on-disk wear test machine. The rotational speed of disc is ranging from (400-600rpm) and under loads ranging from (30-70 N) the contact time between the disc and pin is constant for each pin specimen of composites is 15 minute. In all manufacturing industries the uses of composite materials has been increasing globally, In the present study, an aluminum 5083 alloy is used as the matrix and 5% of weight percentage of Boron Carbide (B4C) as the reinforcing material. The composite is produced using stir casting technique. This is cost effective method. The aluminum 5083 matrix can be strengthened by reinforcing with hard ceramic particles like silicon carbide and boron carbide. In this experiment, aluminum 5083 alloy is selected as one of main material for making parts of the ship it has good mechanical properties, good corrosion resistance and it is can welded very easily and does have good strength. The samples are tested for hardness and tensile strength. The mechanical properties like Hardness can be increased by reinforcing aluminum 5083alloy 5% boron carbide (B4C) particles and tensile strength. Finally the Scanning Electron Microscope (SEM) analysis and EDS is done, which helps to study topography of composites and it produces images of a sample by scanning it with a focused beam of electrons and the presence of composition found in the matrix.
Influence of dynamic strain aging on tensile deformation behavior of alloy 617
International Nuclear Information System (INIS)
Ekaputra, I. M. W.; Kim, Woo Gon; Park, Jae Young; Kim, Seon Jin; Kim, Eung Seon
2016-01-01
To investigate the dynamic strain aging (DSA) behavior of Alloy 617, high-temperature tensile tests were carried out with strain rates variations of 10"-3"/s, 10"-"4/s, and 10"-"5/s from 24°C to 950°C. Five flow relationships, Hollomon, Ludwik, Swift, Ludwigson, and Voce, were applied to describe the tensile true stress–strain curves, and the DSA region was defined. In describing the tensile curves, Ludwigson's equation was superior to the other equations, and the DSA region was adequately defined by this equation as plateaus at intermediate temperatures from 200°C to 700°C. It was identified that Alloy 617 is dominated by three types of serrations, known as Types D, A+B, and C. The activation energy values for each serration type were obtained by the Arrhenius equation. By using the obtained activation energy values, the serrated yielding map and the DSA mechanism were drawn and manifested. In addition, the relationship between the tensile strength and strain rate at higher temperatures above 700°C was found to be closely related to the amounts of slip lines. In the scanning electron microscope (SEM) fractographs, there was a significant difference at the low, intermediate, and high temperatures, but almost the same to the three strain rates
Tensile properties of Zr-2.5 Nb pressure tube alloy between 25 and 800 degC
International Nuclear Information System (INIS)
Singh, R.N.; Kishore, R.; Sinha, T.K.; Banerjee, S.
2000-10-01
Tensile properties of zirconium-2.5 wt. % niobium pressure tube material were evaluated by uniaxial tension tests at temperatures between 25 and 800 degC and under strain-rates varying from 3.3 x 10 -5 to 3.3 x 10 -3 /s. Tests were carried out on specimens fabricated from the sections of finished (autoclaved) tubes as well as on those machined from the sections of cold worked (2 nd pilgered) tubes. Moreover, specimens fabricated from finished tubes belonging to twenty different heats were tested at 300 degC to study the heat to heat variation in tensile properties of this alloy. In order to study the effect of the crystallographic texture on the tensile properties, specimens oriented in longitudinal as well as, in transverse directions of the tubes were also tested. Results showed that both yield and ultimate tensile strengths of this alloy decreased monotonically with increasing test temperatures, with a rapid fall in strengths above a temperature of 350 degC (623 K). The tensile ductility did not change appreciably up to 400 degC (673K) but increased rapidly above this temperature. The observed results on the temperature dependence of the strength and ductility indicated the possible occurrence of dynamic strain-ageing in this alloy in the temperature range of 200-300 degC (473 to 573 K). The transverse specimens showed higher strengths and lower ductility as compared to those of the longitudinal specimens up to a temperature of 350 degC (623 K). Above 350 degC, the difference in the strengths and the ductility of the two types of the specimens, became negligibly small indicating that the texture did not appreciably influence the tensile properties of this alloy at temperatures exceeding 350 degC. The alloy developed extensive superplasticity (ductility exceeding 100 %), when tested in the temperature range of 650-800 degC. Maximum ductility values of 650 % for longitudinal and 900 % for the transverse orientation with strain-rate sensitivity (m) exceeding 0
Wu, Xiaozhi
2013-10-25
The generalized stacking fault (GSF) energies and surface energies of magnesium and its alloys with alloying atoms X = C, B, N, O and vacancy have been investigated using the first-principles methods. It is found that the predominant reducing effects of the alloying atoms and vacancy on the stacking fault energy are resulted from the position of them in the 1st layer near the slip plane. The stacking fault energies are nearly the same as the pure magnesium while the alloying atoms and vacancy are placed in the 2nd, 3rd, 4th, 5th and 6th layers. It has been shown that O strongly reduces the GSF energy of Mg. The alloying atoms C, B and N increase the surface energy, but O and vacancy reduce the surface energy of Mg. The ductilities of Mg and Mg alloys have been discussed based on the Rice criterion by using the ratio between surface energy and unstable stacking fault energy. © 2013 Higher Education Press and Springer-Verlag Berlin Heidelberg.
International Nuclear Information System (INIS)
Brager, H.R.; Heinisch, H.L.; Garner, F.A.
1985-01-01
High-purity copper and eight copper alloys were irradiated to approx.16 dpa at approx.450 0 C in the MOTA experiment in FFTF. These alloys were also examined after aging at 400 0 C for 1000 hours. The radiation-induced changes in the electrical conductivity, tensile properties, and density were measured and compared to those of the aged materials. The changes in conductivity can be either positive or negative depending on the alloy. Changes in tensile properties of most, but not all, of the alloys seem to be primarily dependent on thermal effects rather than the effect of atomic displacements. Radiation at 450 0 C induced changes in density varying from 0.66% densification to 16.6% swelling. The latter occurred in Cu-O.1% Ag and implies a swelling rate of at least 1%/dpa. 6 references, 3 figures, 2 tables
International Nuclear Information System (INIS)
Xu, J.; Yang, Y.Z.; Li, W.; Chen, X.C.; Xie, Z.W.
2016-01-01
The dependency of phosphorous content on the glass forming ability, thermal stability and soft magnetic properties of Fe 83.4 Si 2 B 14−x P x Cu 0.5 C 0.1 (x=0,1,2,3,4) alloys was investigated. The experimental results showed that the substitution of B by P increased the glass forming ability in this alloy system. The Fe 83.4 Si 2 B 10 P 4 Cu 0.5 C 0.1 alloy shows a fully amorphous character. Thermal stability of melt-spun ribbons increases and temperature interval between the first and second crystallization peaks enlarges with the increase of P content. And the saturation magnetic flux density (Bs) shows a slight increase with the increase of P content. The Fe 83.4 Si 2 B 11 P 3 Cu 0.5 C 0.1 nanocrystalline alloy exhibits a high Bs about 200.6 emu/g. The Bs of fully amorphous alloy Fe 83.4 Si 2 B 10 P 4 Cu 0.5 C 0.1 drops dramatically to 172.1 emu/g, which is lower than that of other nanocrystallines. Low material cost and excellent soft magnetic properties make the FeSiBPCuC alloys promise soft magnetic materials for industrial applications. - Highlights: • Partial substituting B by P helps to improve the glass forming ability of the alloy. • The addition of P content reduces the thermal stability and improves heat treatment temperature region for these alloys. • The Fe 83.4 Si 2 B 11 P 3 Cu 0.5 C 0.1 nanocrystalline alloy exhibits a high saturation magnetic density of 200.6 emu/g.
Experimental Studies on SiC and Rice Husk Ash Reinforced Al Alloy Composite
Directory of Open Access Journals (Sweden)
Shivaprakash Y. M.
2018-01-01
Full Text Available In this research work Aluminium alloy with Cu (4.5% as the major alloying element is used as the matrix in which SiC and Rice Husk Ash (RHA are dispersed to develop a hybrid composite. The dispersion is done by the motorized stir casting arrangement. The composite is fabricated by varying the proportions of the reinforcements in the base alloy. The composite specimens were tested for density changes, hardness and the wear. The microstructure images showed a uniform dispersion of the reinforcements in the matrix and this resulted in higher strength to weight ratio. The increase in strength of the composite is probably attributed to the increase in the dislocation density. Also, the abrasive wear resistance of the produced composite is found to be superior as compared to the matrix alloy because of the hard-ceramic particles in the reinforcements.
Thermomechanical processing of aluminum micro-alloyed with Sc, Zr, Ti, B, and C
McNamara, Cameron T.
Critical exploration of the minimalistic high strength low alloy aluminum (HSLA-Al) paradigm is necessary for the continued development of advanced aluminum alloys. In this study, scandium (Sc) and zirconium (Zr) are examined as the main precipitation strengthening additions, while magnesium (Mg) is added to probe the synergistic effects of solution and precipitation hardening, as well as the grain refinement during solidification afforded by a moderate growth restriction factor. Further, pathways of recrystallization are explored in several potential HSLA-Al syste =ms sans Sc. Aluminum-titanium-boron (Al-Ti-B) and aluminum-titanium-carbon (Al-Ti-C) grain refining master alloys are added to a series of Al-Zr alloys to examine both the reported Zr poisoning effect on grain size reduction and the impact on recrystallization resistance through the use of electron backscattered diffraction (EBSD) imaging. Results include an analysis of active strengthening mechanisms and advisement for both constitution and thermomechanical processing of HSLA-Al alloys for wrought or near-net shape cast components. The mechanisms of recrystallization are discussed for alloys which contain a bimodal distribution of particles, some of which act as nucleation sites for grain formation during annealing and others which restrict the growth of the newly formed grains.
MICROSTRUCTURE AND TENSILE PROPERTIES OF Fe3Al-BASED ALLOYS WITH VC AND TiC ADDITIONS
Institute of Scientific and Technical Information of China (English)
W.L.Xu; Y.S.Sun; S.S.Ding
2001-01-01
Microstructure and tensile properties of Fe3Al-based alloys with additions of TiC andVC particles have been investigated.Results show that the formation of TiC particlesresults in the refinement of the macrostructure of as-cast ingots.Although the additionof VC particles does not cause significant change of the as-cast microstructure,themicrostructure of the alloy after hot-working and recrystallization has been found tobe refined.The formation of both VC and TiC particles results in the increase of yieldstrength,especially at high temperature of 600℃.
Laser surface alloying of aluminum (AA1200) with Ni and SiC Powders
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2010-12-01
Full Text Available . The dissociated C reacted with Al to form Al4C3. The addition of Ni resulted in the formation of the Al3Ni phase. A hardness increase of approximately four times that of aluminum AA1200 was achieved in the alloyed layer....
International Nuclear Information System (INIS)
Chakravartty, J.K.; Kapoor, R.; Suri, A.K.
2011-08-01
Nb-1Zr-0.1C is a potential material for use in high temperature nuclear reactors. Use of this alloy in components requires appropriate thermomechanical processing to break the cast microstructure and to obtain uniformly distributed fine stable precipitates so as to produce the desired mechanical properties at the high operating temperatures. This report reviews the thermomechanical processing of Nb-1Zr-0.1C alloy carried out over the years by other researchers and the high temperature creep behavior of the alloy. The hot deformation of Nb-1Zr-0.1C alloy carried out at Mechanical Metallurgy Division is also presented here. From this review it is evident that most primary hot working studies were carried out between 1500 to 1700 degC. The subsequent annealing treatments, which require holding at lower temperatures of about 1100 to 1300 degC for very long times help further transform the precipitates from coarse orthorhombic to very fine cubic. Our studies on Nb-1Zr-0.1C alloy also confirm that optimum hot working lies at temperatures beyond 1500 degC where dynamic recrystallization initiates, and optimally around 1700 degC where dynamic recrystallization transforms the microstructure. Working at temperatures lower than 1000 degC may lead to the undesirable effect of both micro as well as macro strain localization, and should be avoided. (author)
Energy Technology Data Exchange (ETDEWEB)
Hu, Guo-rong, E-mail: hgrhsj@263.net; Liu, Ji-jun; Du, Ke; Peng, Zhong-dong; Cao, Yan-bing; Wang, Wei-gang; Duan, Jian-guo
2014-08-01
To separate ferrum from chromium in the leaching sulfate solution of ferrochrome alloy, the oxalic acid was employed to precipitate the ferrum as the form of FeC{sub 2}O{sub 4} and Cr was left in the solution. In this route, small amount of nickel, cobalt and manganese exited in ferrochrome alloy were also precipitated simultaneously together with ferrous oxalate. Analysis from ICP shows that the molar percent of Fe in oxalic precipitate is 97.9% and the main doped elements are Ni (1.1%) and Mn (0.4%).The mixed metal oxalate Fe{sub (1−x)}M{sub x}C{sub 2}O{sub 4} was used as a raw material to prepare doped LiFePO{sub 4} cathode material of lithium ion batteries. The obtained LiFe{sub (1−x)}M{sub x}PO{sub 4}/C was a single olivine-type phase with higher crystallinity and presents the well-distributed fine particles. It shows an outstanding electrochemical performance with a discharge capacity of 162 mAh/g at the rate of 0.1 C, 136 mAh/g at 1 C and 103 mAh/g at 5 C. When cycled at 1 C for 50 times, the capacity retention is 98.2%.
Macrophage proinflammatory response to the titanium alloy equipment in dental implantation.
Chen, X; Li, H S; Yin, Y; Feng, Y; Tan, X W
2015-08-07
Titanium alloy and stainless steel (SS) had been widely used as dental implant materials because of their affinity with epithelial tissue and connective tissue, and good physical, chemical, biological, mechanical properties and processability. We compared the effects of titanium alloy and SS on macrophage cytokine expression as well as their biocompatibility. Mouse macrophage RAW264.7 cells were cultured on titanium alloy and SS surfaces. Cells were counted by scanning electron microscopy. A nitride oxide kit was used to detect released nitric oxide by macrophages on the different materials. An enzyme linked immunosorbent assay was used to detect monocyte chemoattractant protein-1 levels. Scanning electron microscopy revealed fewer macrophages on the surface of titanium alloy (48.2 ± 6.4 x 10(3) cells/cm(2)) than on SS (135 ± 7.3 x 10(3) cells/cm(2)). The nitric oxide content stimulated by titanium alloy was 22.5 mM, which was lower than that stimulated by SS (26.8 mM), but the difference was not statistically significant (P = 0.07). The level of monocyte chemoattractant protein-1 released was significantly higher in the SS group (OD value = 0.128) than in the titanium alloy group (OD value = 0.081) (P = 0.024). The transforming growth factor-b1 mRNA expression levels in macrophages after stimulation by titanium alloy for 12 and 36 h were significantly higher than that after stimulation by SS (P = 0.31 and 0.25, respectively). Macrophages participate in the inflammatory response by regulating cytokines such as nitric oxide, monocyte chemoattractant protein-1, and transforming growth factor-b1. There were fewer macrophages and lower inflammation on the titanium alloy surface than on the SS surface. Titanium alloy materials exhibited better biological compatibility than did SS.
Church, Jessica D.; Jones, Dana; Flys, Tamara; Hoover, Donald; Marlowe, Natalia; Chen, Shu; Shi, Chanjuan; Eshleman, James R.; Guay, Laura A.; Jackson, J. Brooks; Kumwenda, Newton; Taha, Taha E.; Eshleman, Susan H.
2006-01-01
The US Food and Drug Administration-cleared ViroSeq HIV-1 Genotyping System (ViroSeq) and other population sequencing-based human immunodeficiency virus type 1 (HIV-1) genotyping methods detect antiretroviral drug resistance mutations present in the major viral population of a test sample. These assays also detect some mutations in viral variants that are present as mixtures. We compared detection of the K103N nevirapine resistance mutation using ViroSeq and a sensitive, quantitative point mutation assay, LigAmp. The LigAmp assay measured the percentage of K103N-containing variants in the viral population (percentage of K103N). We analyzed 305 samples with HIV-1 subtypes A, C, and D collected from African women after nevirapine administration. ViroSeq detected K103N in 100% of samples with >20% K103N, 77.8% of samples with 10 to 20% K103N, 71.4% of samples with 5 to 10% K103N, and 16.9% of samples with 1 to 5% K103N. The sensitivity of ViroSeq for detection of K103N was similar for subtypes A, C, and D. These data indicate that the ViroSeq system reliably detects the K103N mutation at levels above 20% and frequently detects the mutation at lower levels. Further studies are needed to compare the sensitivity of different assays for detection of HIV-1 drug resistance mutations and to determine the clinical relevance of HIV-1 minority variants. PMID:16931582
As-cast microstructures of Ti-11 Al- xC alloys
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
Presents the investigation of as-cast microstructures of high temperature α + α2 titanium alloys matrix composites reinforced by particles and fabricated using a reaction synthesis method by XRD, OM and SEM which reveals that the matrix transformed into single phase α2 from two phases α + α2 and reinforcing phases become Ti3A1C and TiC from single phase TiC as C content increases to a critical value, and Ti3AlC precipitates during solidification processing and points out that the norphologies of TiC and Ti3AlC are of short-lath shape and near spherical shape, respectively, and lattice parameters of matrix α2 increase with the increasing of C content, but the lattice parameter of reinforcing phase TiC is lower than standard lattice parameter of TiC due to the C defection in TiC.
31 CFR Appendix C to Part 103 - Interpretive Rules
2010-07-01
...-money laundering programs. See 31 CFR 103.125. Specifically, this Interpretive Guidance clarifies that the anti-money laundering program regulation requires Money Services Businesses to establish adequate and appropriate policies, procedures, and controls commensurate with the risks of money laundering and...
International Nuclear Information System (INIS)
Schubert, L.E.; Hamilton, M.L.; Gelles, D.S.
1997-01-01
Miniature CVN specimens of four ferritic alloys, GA3X, F82H, GA4X and HT9, have been impact tested following irradiation at 430 degrees C to 67 dpa. Comparison of the results with those of the previously tested lower dose irradiation condition indicates that the GA3X and F82H alloys, two primary candidate low activation alloys, exhibit virtually identical behavior following irradiation at 430 degrees C to ∼67 dpa and at 370 degrees C to ∼15 dpa. Very little shift is observed in either DBTT or USE relative to the unirradiated condition. The shifts in DBTT and USE observed in both GA4X and HT9 were smaller after irradiation at 430 degrees C to ∼67 dpa than after irradiation at 370 degrees C to ∼15 dpa
Energy Technology Data Exchange (ETDEWEB)
Schubert, L.E.; Hamilton, M.L.; Gelles, D.S. [Pacific Northwest National Lab., Richland, WA (United States)
1997-04-01
Miniature CVN specimens of four ferritic alloys, GA3X, F82H, GA4X and HT9, have been impact tested following irradiation at 430{degrees}C to 67 dpa. Comparison of the results with those of the previously tested lower dose irradiation condition indicates that the GA3X and F82H alloys, two primary candidate low activation alloys, exhibit virtually identical behavior following irradiation at 430{degrees}C to {approximately}67 dpa and at 370{degrees}C to {approximately}15 dpa. Very little shift is observed in either DBTT or USE relative to the unirradiated condition. The shifts in DBTT and USE observed in both GA4X and HT9 were smaller after irradiation at 430{degrees}C to {approximately}67 dpa than after irradiation at 370{degrees}C to {approximately}15 dpa.
Energy Technology Data Exchange (ETDEWEB)
Toloczko, M.B.; Garner, F.A. [Pacific Northwest National Lab., Richland, WA (United States); Eiholzer, C.R. [Westinghouse Hanford Company, Richland, WA (United States)
1997-04-01
Three ferritic alloys were irradiated in two fast reactors to doses of 50 dpa or more at temperatures near 400{degrees}C. One martensitic alloy, HT9, was irradiated in both the FFTF and PFR reactors. PFR is the Prototype Fast Reactor in Dourneay, Scotland, and FFTF is the Fast Flux Test Facility in Richland, WA. D57 is a developmental alloy that was irradiated in PFR only, and MA957 is a Y{sub 2}O{sub 3} dispersion-hardened ferritic alloy that was irradiated only in FFTF. These alloys exhibited little or no void swelling at {approximately}400{degrees}C. Depending on the alloy starting condition, these steels develop a variety of non-creep strains early in the irradiation that are associated with phase changes. Each of these alloys creeps at a rate that is significantly lower than that of austenitic steels irradiated in the same experiments. The creep compliance for ferritic alloys in general appears to be {approximately}0.5 x 10{sup {minus}6} MPa{sup {minus}1} dpa{sup {minus}1}, independent of both composition and starting state. The addition of Y{sub 2}O{sub 3} as a dispersoid does not appear to change the creep behavior.
International Nuclear Information System (INIS)
Kim, Jiwoong; Kang, Shinhoo
2012-01-01
Highlights: ► Elastic properties of TiC, TiN and their alloys were calculated by ab initio calculations. ► Debye temperature and Gruneisen constant of TiC, TiN and their alloys were calculated as a function of nitrogen content. ► Thermo-physical properties were calculated as a function of nitrogen content. ► Thermal expansion of the alloys was fitted in different temperature range. - Abstract: The equilibrium lattice parameters, elastic properties, material brittleness, heat capacities, and thermal expansion coefficients of TiC, TiN, and their intermediate composition alloys (Ti(C 1−x N x ), x = 0.25, 0.5, and 0.75) were calculated using ab initio density functional theory (DFT) methods. We employed the Debye–Gruneisen model to calculate a finite temperature heat capacity and thermal expansion coefficient. The calculated elastic moduli and thermal expansion coefficients agreed well with the experimental data and with other DFT calculations. Accurate heat capacities of TiC, TiN, and their intermediate composition alloys were obtained by calculating not only the phonon contributions but also the electron contributions to the heat capacity. Our calculations indicated that the heat capacity differences between each composition originated mainly from the electronic contributions.
Gilman, P. S.
1984-01-01
Powder processing of Al-Li-Mg and Al-Li-Cu alloys by mechanical alloying (MA) is described, with a discussion of physical and mechanical properties of early experimental alloys of these compositions. The experimental samples were mechanically alloyed in a Szegvari attritor, extruded at 343 and 427 C, and some were solution-treated at 520 and 566 C and naturally, as well as artificially, aged at 170, 190, and 210 C for times of up to 1000 hours. All alloys exhibited maximum hardness after being aged at 170 C; lower hardness corresponds to the solution treatment at 566 C than to that at 520 C. A comparison with ingot metallurgy alloys of the same composition shows the MA material to be stronger and more ductile. It is also noted that properly aged MA alloys can develop a better combination of yield strength and notched toughness at lower alloying levels.
Interdiffusion among U-Mo-Zr and alloys of Al to 550oC
International Nuclear Information System (INIS)
Komar Varela, C.L; Arico, S.F; Gribaudo, L.M
2006-01-01
The international community, by means of the project 'Reduced Enrichment for Research and Test Reactors' is interested in the development of a new nuclear fuel of very high density of uranium and low enrichment (≤ 20% de U 235 ) for reactors of investigation and production of radioisotopes, that permit to reach greater neutron flows, with good capacity to be reprocessed One of these assemblies are the alloys of U with Mo contents between 7 and 10% in weight. In the fuels 'dispersed type plate' the particles of U-Mo are mixed with dust of aluminum and are co - laminated between two plates of an alloy of the same material. The existing contact among the particles permits the interdiffusion of the materials with the consequent apparition of new phases. Studies pursuit-irradiation have shown a badly behavior of these new phases. It is for this that is necessary to control the presence of these products of interaction. The aggregate of a third element to the alloys U - Mo has begun to be practiced with this purpose. In this work the modification of the start of the disorder of the phase γU in the alloy U-7%Mo-1%Zr was studied and the interdiffusion between pure aluminum and the same alloy to 550 o C. The results obtained are compared with other obtained for peers U-Mo/Al. The techniques of characterization utilized were: optical microscopy, analysis by diffraction of X-rays and microanalysis quantitative by microprobe electronic. It was observed that the aggregate of Zr refines the grain for a processing of homogenized in composition of Mo to 1000 o C and accelerates the start of the disorder of the phase γU to 550 o C. As for the zone of interaction, was found that the composed identifying do not they differ to them reported in the in peers U-Mo/Al. These are: (U,Mo)Al 4 y UAl 3 (AG)
Effect of thermal aging on corrosion resistance of C-22 alloy in chloride solutions
International Nuclear Information System (INIS)
Carranza, Ricardo M.; Rodriguez, Martin A.
2007-01-01
Alloy 22 (N06022) belongs to the Ni-Cr-Mo family and it is highly resistant to localized corrosion. The anodic behavior of mill annealed (MA) and thermally aged (10 hours at 760 C degrees) Alloy 22 was studied in chloride solutions with different pH values at 90 C degrees. Thermal aging leads to a microstructure of full grain boundary precipitation of topologically closed packed (TCP) phases. Electrochemical tests included monitoring of open circuit potential, potentiodynamic polarization and electrochemical impedance spectroscopy. Assessment of general and localized (crevice) corrosion was performed. Re passivation potentials were obtained from cyclic potentiodynamic polarization tests. Results indicate that MA and TCP material show similar general corrosion rates and crevice corrosion resistance in the tested environments. MA and TCP specimens suffered general corrosion in an active state when tested in low pH chloride solutions. The grain structure of the alloy was revealed for MA material, while TCP material suffered a preferential attack at grain boundaries. (author)
Fracture testing and performance of beryllium copper alloy C17510
International Nuclear Information System (INIS)
Murray, H.A.; Zatz, I.J.
1994-05-01
When a literature search and discussion with manufacturers revealed that there was virtually no existing data related to the fracture properties and behavior of copper beryllium alloy C17510, a series of test programs was undertaken to ascertain this information for several variations in material processing and chemistry. These variations in C17510 were primarily optimized for combinations of strength and conductivity. While originally intended for use as cyclically loaded high-field, high-strength conductors in fusion energy research, material testing of C17510 has indicated that it is an attractive and economical alternative for a host of other structural, mechanical and electrical applications. ASTM tests performed on three variations of C17510 alloys included both J-integral and plane strain fracture toughness testing and fatigue crack growth rate tests, as well as verifying tensile, hardness, Charpy, and other well defined mechanical properties. Fracture testing was performed at both room and liquid nitrogen temperatures, which bound the thermal environment anticipated for the fusion components being designed. Fatigue crack propagation stress ratios ranged from nominal zero to minus one at each temperature. In order to confirm the test results, duplicate and independent test programs were awarded to separate facilities with appropriate test experience, whenever possible. The primary goal of the test program, to determine and bound the fracture toughness and Paris constants for C17510,was accomplished. In addition, a wealth of information was accumulated pertaining to crack growth characteristics, effects of directionality and potential testing pitfalls. The paper discusses the test program and its findings in detail
Effect of Microstructure of Fe-C-V Alloys on Selected Functional Properties
Directory of Open Access Journals (Sweden)
Kawalec M.
2014-08-01
Full Text Available The cast alloys crystallizing in Fe-C-V system are classified as white cast iron, because all the carbon is bound in vanadium carbides. High vanadium cast iron has a very high abrasion resistance due to hard VC vanadium carbides. However, as opposed to ordinary white cast iron, this material can be treated using conventional machining tools. This article contains the results of the group of Fe-C-V alloys of various microstructure which are been tested metallographic, mechanical using an INSTRON machine and machinability with the method of drilling. The study shows that controlling the proper chemical composition can influence on the type and shape of the crystallized matrix and vanadium carbides. This makes it possible to obtain a high-vanadium cast iron with very high wear resistance while maintaining a good workability.
Wu, Xiaozhi; Liu, Lili; Wang, Rui; Gan, Liyong; Liu, Qing
2013-01-01
The generalized stacking fault (GSF) energies and surface energies of magnesium and its alloys with alloying atoms X = C, B, N, O and vacancy have been investigated using the first-principles methods. It is found that the predominant reducing
AZ91C magnesium alloy modified by Cd
DEFF Research Database (Denmark)
Shabadi, R.; Ambat, Rajan; Dwarakadasa, E.S.
2014-01-01
In the present work, the effect of Cd on the microstructure, mechanical properties and general corrosion behaviour of AZ91C alloys was investigated. Addition of Cd was found not to be efficient in modifying/refining the microstructure or β-phase. A morphology change in β-phase from fine continuous...... precipitates to discontinuous β-phase upon the addition of Cd was observed. A marginal increment in mechanical properties was observed. General corrosion behaviour was followed with weight loss measurements, potentiostatic polarisation studies and surface studies in 3.5% sodium chloride solution and 3.......5% sodium chloride with 2% potassium dichromate solution. Cd addition deteriorated the corrosion behaviour of AZ91C. This behaviour was attributed to the formation of chunks of β-phase upon the addition of Cd. AZ91C with refined β-phase distribution, performed rather better in the NaCl solutions....
Energy Technology Data Exchange (ETDEWEB)
Luettschwager, Frank
2011-09-27
Coal is still the most important energy source in Germany. In 2009 it produced 42.9 % of the overall German electrical power. Coal is available world-wide in large quantities and can be delivered economically. One of the possible ways to reduce CO{sub 2} pollution is the increase of efficiency of coal fired power plants, which requires steam conditions of up to 700 C - 730 C and 350 bar. Because many German power units will reach the end of their technical lifespan in a few years or the following decade, one will have the possibility to build up modern types of power plants with increased efficiency of more than 50 %. Some international standards (European Pressure Equipment Directive or ASME Boiler and Pressure Vessel Code) require 100 000 hour creep rupture strength of 100 MPa at 750 C. Therefore, nickel base alloys are in the focus of material qualification processes. Nickel base alloys are well investigated due to their hot corrosion behaviour. It is known that sodium sulphate may generate hot corrosion on those alloys at temperatures above its melting point of 884 C. On nickel base alloys an eutectic mixture of nickel sulphate and sodium sulphate with a melting point of 671 C can be generated, which leads to accelerated corrosion. This work examines, whether the high amount of sulphur and alkali metals will induce hot corrosion at the estimated working temperature on devices manufactured from nickel base alloy. Two synthetic coal ash deposits, according to the chemical composition of hard coal and lignite, and typical flue gases with and without sulphur dioxide were blended of pure agents. The reactions of the deposits with heater tubes' materials and synthetic flue gases are examined in the temperature range from 650 C to 800 C and different time ranges up to 2000 hours. The corroded specimen are examined with SEM/EDX to identify relevant corrosion products and determine the corrosivity of deposited compounds. Deposits increase the corrosion rate of
Yang, Chao; Muránsky, Ondrej; Zhu, Hanliang; Thorogood, Gordon J.; Avdeev, Maxim; Huang, Hefei; Zhou, Xingtai
2017-01-01
A new generation of alloys, which rely on a combination of various strengthening mechanisms, has been developed for application in molten salt nuclear reactors. In the current study, a battery of dispersion and precipitation-strengthened (DPS) NiMo-based alloys containing varying amounts of SiC (0.5–2.5 wt %) were prepared from Ni-Mo-SiC powder mixture via a mechanical alloying (MA) route followed by spark plasma sintering (SPS) and rapid cooling. Neutron Powder Diffraction (NPD), Electron Back Scattering Diffraction (EBSD), and Transmission Electron Microscopy (TEM) were employed in the characterization of the microstructural properties of these in-house prepared NiMo-SiC DPS alloys. The study showed that uniformly-dispersed SiC particles provide dispersion strengthening, the precipitation of nano-scale Ni3Si particles provides precipitation strengthening, and the solid-solution of Mo in the Ni matrix provides solid-solution strengthening. It was further shown that the milling time has significant effects on the microstructural characteristics of these alloys. Increased milling time seems to limit the grain growth of the NiMo matrix by producing well-dispersed Mo2C particles during sintering. The amount of grain boundaries greatly increases the Hall–Petch strengthening, resulting in significantly higher strength in the case of 48-h-milled NiMo-SiC DPS alloys compared with the 8-h-milled alloys. However, it was also shown that the total elongation is considerably reduced in the 48-h-milled NiMo-SiC DPS alloy due to high porosity. The porosity is a result of cold welding of the powder mixture during the extended milling process. PMID:28772747
Directory of Open Access Journals (Sweden)
Chao Yang
2017-04-01
Full Text Available A new generation of alloys, which rely on a combination of various strengthening mechanisms, has been developed for application in molten salt nuclear reactors. In the current study, a battery of dispersion and precipitation-strengthened (DPS NiMo-based alloys containing varying amounts of SiC (0.5–2.5 wt % were prepared from Ni-Mo-SiC powder mixture via a mechanical alloying (MA route followed by spark plasma sintering (SPS and rapid cooling. Neutron Powder Diffraction (NPD, Electron Back Scattering Diffraction (EBSD, and Transmission Electron Microscopy (TEM were employed in the characterization of the microstructural properties of these in-house prepared NiMo-SiC DPS alloys. The study showed that uniformly-dispersed SiC particles provide dispersion strengthening, the precipitation of nano-scale Ni3Si particles provides precipitation strengthening, and the solid-solution of Mo in the Ni matrix provides solid-solution strengthening. It was further shown that the milling time has significant effects on the microstructural characteristics of these alloys. Increased milling time seems to limit the grain growth of the NiMo matrix by producing well-dispersed Mo2C particles during sintering. The amount of grain boundaries greatly increases the Hall–Petch strengthening, resulting in significantly higher strength in the case of 48-h-milled NiMo-SiC DPS alloys compared with the 8-h-milled alloys. However, it was also shown that the total elongation is considerably reduced in the 48-h-milled NiMo-SiC DPS alloy due to high porosity. The porosity is a result of cold welding of the powder mixture during the extended milling process.
Yang, Chao; Muránsky, Ondrej; Zhu, Hanliang; Thorogood, Gordon J; Avdeev, Maxim; Huang, Hefei; Zhou, Xingtai
2017-04-06
A new generation of alloys, which rely on a combination of various strengthening mechanisms, has been developed for application in molten salt nuclear reactors. In the current study, a battery of dispersion and precipitation-strengthened (DPS) NiMo-based alloys containing varying amounts of SiC (0.5-2.5 wt %) were prepared from Ni-Mo-SiC powder mixture via a mechanical alloying (MA) route followed by spark plasma sintering (SPS) and rapid cooling. Neutron Powder Diffraction (NPD), Electron Back Scattering Diffraction (EBSD), and Transmission Electron Microscopy (TEM) were employed in the characterization of the microstructural properties of these in-house prepared NiMo-SiC DPS alloys. The study showed that uniformly-dispersed SiC particles provide dispersion strengthening, the precipitation of nano-scale Ni₃Si particles provides precipitation strengthening, and the solid-solution of Mo in the Ni matrix provides solid-solution strengthening. It was further shown that the milling time has significant effects on the microstructural characteristics of these alloys. Increased milling time seems to limit the grain growth of the NiMo matrix by producing well-dispersed Mo₂C particles during sintering. The amount of grain boundaries greatly increases the Hall-Petch strengthening, resulting in significantly higher strength in the case of 48-h-milled NiMo-SiC DPS alloys compared with the 8-h-milled alloys. However, it was also shown that the total elongation is considerably reduced in the 48-h-milled NiMo-SiC DPS alloy due to high porosity. The porosity is a result of cold welding of the powder mixture during the extended milling process.
Influence of the C content on the permeation of hydrogen in Fe alloys with low contents of C
Directory of Open Access Journals (Sweden)
I. Peñalva
2016-12-01
The experimental permeation results were analyzed using a non-linear least square fitting. The final resulting values of the permeability were paired off in order to determine the effect of the C content: pure Fe versus FeC, FeP versus FePC and Fe10%Cr versus Fe10%CrC. According to the results, the influence of the metallurgical composition of C in Fe alloys on the permeability of hydrogen is discussed together with the synergistic effects caused by the presence of P and Cr.
International Nuclear Information System (INIS)
Anantatmula, R.P.; Brehm, W.F.
1979-03-01
Sodium compatibility screening tests were performed on several commercial austenitic alloys at 700 0 C for 2000 hours for applications as breeder reactor fuel cladding. The sodium-exposed surfaces were characterized by Optical Metallography, Scanning Electron Microscopy (SEM) and Electron Probe Micro Analysis (EPMA). Sodium exposure generally resulted in the depletion of Ni, Cr, Ti, Si, Mn and Nb, and enrichment of Fe and Mo at the surface. The average thickness of the depleted zone was 5 μm. The alloys can be divided into three groups based on corrosion rate, and each group has its own characteristic surface structure. Grain-orientation dependent striations were seen in alloys with low corrosion rates, while alloys with intermediate corrosion rates displayed micron-size nodes enriched with Fe and Mo. The high corrosion rate alloys exhibited scale-like formations on the surface with irregularly shaped holes. In addition, the data importantly point out that a ferrite layer will form at the sodium-exposed surface of these austenitic alloys after prolonged exposure
Alloying effects on structural and thermal behavior of Ti1-xZrxC: A first principles study
International Nuclear Information System (INIS)
Chauhan, Mamta; Gupta, Dinesh C.
2016-01-01
The formation energy, equilibrium lattice parameter, bulk modulus, Debye temperature and heat capacity at constant volume have been calculated for TiC, ZrC, and their intermediate alloys (Ti 1-x Zr x C, x = 0,0.25.0.5,0.75,1) using first principles approach. The calculated values of lattice parameter and bulk modulus agree well with the available experimental and earlier theoretical reports. The variation of lattice parameter and bulk modulus with the change in concentration of Zr atom in Ti 1-x Zr x C has also been reported. The heat capacities of TiC, ZrC, and their intermediate alloys have been calculated by considering both vibrational and electronic contributions.
International Nuclear Information System (INIS)
Yang, S Y; Wang, C P; Liu, X J
2013-01-01
The effects of Dy addition on microstructure, martensitic transformation, mechanical and shape memory properties of the two-phase Ni 53 Mn 22 Co 6 Ga 19 high-temperature shape memory alloy were investigated. It is found that a small Dy addition results in the refinement of grain size, which can effectively improve the tensile ductility and strength of the two-phase Ni 53 Mn 22 Co 6 Ga 19 alloy. However, a Dy(Ni,Mn) 4 Ga precipitate forms in the alloys with the Dy addition, and its amount increases with an increase in the Dy addition. This change causes the ductility of the alloys to decrease when the Dy addition is further increased to 0.3 at.%. The results further show that the changes in the martensitic transformation temperature of the studied alloys can be attributed to the combined effects of the tetragonality (c/a) and electron concentration (e/a) of martensite. Additionally, the shape memory effects of the alloys are closely related to the refinement of grain size and the alloy strength. In this study, the (Ni 53 Mn 22 Co 6 Ga 19 ) 99.8 Dy 0.2 alloy exhibits a variety of good properties, including a high martensitic transformation starting temperature of 385.7 °C, a tensile ductility of 10.3% and a shape memory effect of 2.8%. (paper)
International Nuclear Information System (INIS)
Singh, B.N.; Eldrup, M.; Toft, P.; Edwards, D.J.
1998-05-01
The final irradiation experiment in a series of screening experiments aimed at investigating the effects of bonding and bakeout thermal cycles on irradiated copper alloys is described herein. Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing and bonding thermal treatment. Additional specimens were reaged and given a reactor bakeout treatment at 350 deg. C for 100 h. GlidCop TM CuAl-15 (previously referred to as CuAl-25) was given a heat treatment corresponding to a bonding thermal cycle only. Specimens were neutron irradiated at 100 deg. C to a dose level of ∼0.3 dpa. Post-irradiation tensile tests at (100 deg. C), electrical resistivity measurements (at 23 deg. C), and microstructural examinations were performed. The post-irradiation tests at 100 deg. C revealed that the greatest loss of ductility occurred in the CuCrZr alloys irradiated at 100 deg. C, irrespective of the pre-irradiation heat treatment, with the uniform elongation dropping to levels of less than 1.5%. The yield and ultimate strengths for all of the individual heat treated samples increased substantially after irradiation. The same trend was observed for the CuNiBe alloys, which exhibited much higher uniform elongation and strength after irradiation than that observed in the case of CuCrZr alloys. In both alloys irradiation-induced precipitation lead to a large increase in the strength of the solution annealed specimens with a noticeable decrease in uniform elongation. The CuAl-25 alloy also experienced an increase in the overall strength of the alloy after irradiation, accompanied by approximately a 50% decrease in the uniform and total elongation. The additional bakeout treatments given to the CuCrZr and CuNiBe before irradiation served to increase the strength, but in terms of the ductility no improvement or degradation resulted from the additional thermal exposure
International Nuclear Information System (INIS)
Petel'guzov, I.A.
2002-01-01
In the report brought results of corrosion process studies in water medium of pipe samples for fuel element shells from Zr1Nb alloy (earlier KTZ-110),made from the calcium-thermal zirconium alloys developed in the Ukraine of technology and,for the comparison,samples of pipes from the staff alloy E110, applicable in fuel elements acting reactors of type WWER. Tests were conducted under the working temperature of fuel shells in the reactor (350 degree C) in during of 14000 hours and under increased temperatures (400 degree C) within a time acordinly 4000 hours. Samples from the alloy Zr1Nb had more high contents of oxygen (before 0,12%...0,16%), than staff alloy Eh110 (0,08%O). Studies have shown sufficiently high corrosion stability of experimental alloy Zr1Nb, close to stability of alloy E110.Discovered signs of corrosion 'breakway' or 'transition' on kinetic corrosion curves of Zr1Nb alloys and E110 alloy, characterisating zircaloy type of alloy. Considered mechanism of influence of oxygen on the corrosion process of zirconium alloys with the additive a niobium
Lithium based alloy-thionyl chloride cells for applications at temperatures to 200 C
Kane, P.; Marincic, N.; Epstein, J.; Lindsey, A.
A long-life lithium battery for industrial applications at temperatures up to 200 C was developed by combining Li-based alloy anodes with oxyhalide electrolytes. Cathodes were fabricated by rolling the blend of polycarbonomonofluoride, a conductive carbon additive, and a binder, while anodes were fabricated as those used in oxyhalide cells, incorporating a modified anode current collector designed to prevent the formation of 'lithium islands' at the end of discharge; nonwoven glass fiber separators were pretreated to remove excessive binders and lubricants. Various active electrode surface areas were combined with a corresponding thickness of electrodes and separators, matched in capacity. Tests of the high-rate electrode structure, using Li-Mg alloy anode in conjunction with thionyl chloride electrolyte, have demonstrated that the battery with this anode can be used under abusive conditions such as short circuit and external heating (at 175 C). Raising the operating temperature to 200 C did require some modifications of regular cell hardware.
Santoro, G. J.
1979-01-01
The corrosion of sodium sulfate coated cobalt alloys was measured and the results compared to the cyclic oxidation of alloys with the same composition, and to the hot corrosion of compositionally equivalent nickel-base alloys. Cobalt alloys with sufficient aluminum content to form aluminum containing scales corrode less than their nickel-base counterparts. The cobalt alloys with lower aluminum levels form CoO scales and corrode more than their nickel-base counterparts which form NiO scales.
International Nuclear Information System (INIS)
Graff, St.
2006-10-01
The anomalous strain rate sensitivity of zirconium alloys over the temperatures range 20-600 C has been widely reported in the literature. This unconventional behavior is related to the existence of strain ageing phenomenon which results from the combined action of thermally activated diffusion of foreign atoms to and along dislocation cores and the long range of dislocations interactions. The important role of interstitial and substitutional atoms in zirconium alloys, responsible for strain ageing and the lack of information about the domain where strain ageing is active have not been yet adequately characterized because of the multiplicity of alloying elements and chemical impurities. The aim of this work is to characterize experimentally the range of temperatures and strain rates where strain ageing is active on the macroscopic and mesoscopic scales. We propose also a predictive approach of the strain ageing effects, using the macroscopic strain ageing model suggested by McCormick (McCormick, 1988; Zhang et al., 2000). Specific zirconium alloys were elaborated starting from a crystal bar of zirconium with 2.2 wt% hafnium and very low oxygen content (80 wt ppm), called ZrHf. Another substitutional atom was added to the solid solution under the form of 1 wt% niobium. Some zirconium alloys were doped with oxygen, others were not. All of them were characterized by various mechanical tests (standard tensile tests, tensile tests with strain rate changes, relaxation tests with unloading). The experimental results were compared with those for the standard oxygen doped zirconium alloy (1300 wt ppm) studied by Pujol (Pujol, 1994) and called Zr702. The following experimental evidences of the age-hardening phenomena were collected and then modeled: 1) low and/or negative strain rate sensitivity around 200-300 C, 2) creep arrest at 200 C, 3) relaxation arrest at 200 C and 300 C, 4) plastic strain heterogeneities observed in laser extensometry on the millimeter scale
Energy Technology Data Exchange (ETDEWEB)
Graff, St
2006-10-15
The anomalous strain rate sensitivity of zirconium alloys over the temperatures range 20-600 C has been widely reported in the literature. This unconventional behavior is related to the existence of strain ageing phenomenon which results from the combined action of thermally activated diffusion of foreign atoms to and along dislocation cores and the long range of dislocations interactions. The important role of interstitial and substitutional atoms in zirconium alloys, responsible for strain ageing and the lack of information about the domain where strain ageing is active have not been yet adequately characterized because of the multiplicity of alloying elements and chemical impurities. The aim of this work is to characterize experimentally the range of temperatures and strain rates where strain ageing is active on the macroscopic and mesoscopic scales. We propose also a predictive approach of the strain ageing effects, using the macroscopic strain ageing model suggested by McCormick (McCormick, 1988; Zhang et al., 2000). Specific zirconium alloys were elaborated starting from a crystal bar of zirconium with 2.2 wt% hafnium and very low oxygen content (80 wt ppm), called ZrHf. Another substitutional atom was added to the solid solution under the form of 1 wt% niobium. Some zirconium alloys were doped with oxygen, others were not. All of them were characterized by various mechanical tests (standard tensile tests, tensile tests with strain rate changes, relaxation tests with unloading). The experimental results were compared with those for the standard oxygen doped zirconium alloy (1300 wt ppm) studied by Pujol (Pujol, 1994) and called Zr702. The following experimental evidences of the age-hardening phenomena were collected and then modeled: 1) low and/or negative strain rate sensitivity around 200-300 C, 2) creep arrest at 200 C, 3) relaxation arrest at 200 C and 300 C, 4) plastic strain heterogeneities observed in laser extensometry on the millimeter scale
Effects of aluminum substitution in C14-rich multi-component alloys for NiMH battery application
International Nuclear Information System (INIS)
Young, K.; Regmi, R.; Lawes, G.; Ouchi, T.; Reichman, B.; Fetcenko, M.A.; Wu, A.
2010-01-01
The effects of aluminum substitution to the structural, electrochemical, and gas phase hydrogen storage properties of C14-rich alloys are reported. Minor phases, including C15 and TiNi, were identified by X-ray diffraction analysis. Entropy and enthalpy were estimated from equilibrium pressure at a fixed hydrogen concentration due to the large slope factor in pressure-concentration-temperature isotherms. The stability of hydrides from these materials, determined from the pressure-concentration isotherm equilibrium pressure and maximum storage capacities has a better correlation with the change in entropy than that in enthalpy. Alloys having smaller unit cell volume, relatively low hydride heat of formation, and relatively higher degree of disorder exhibit lower plateau pressure, higher storage capacity, and smaller hydrogen diffusion coefficient. Comparing to the Co substitution in the same base alloy, Al substitution makes better contribution to both bulk hydrogen transport and surface reaction. Substituting 0.4% Al and 1.5% Co to AB2 alloy is found to be the best combination in terms of general nickel metal hydride battery performance.
Fluxing purification and its effect on magnetic properties of high-B{sub s} FeBPSiC amorphous alloy
Energy Technology Data Exchange (ETDEWEB)
Pang, Jing [School of Materials Science and Engineering, Shenyang University of Technology, Shenyang, Liaoning 110870 (China); Wang, Anding, E-mail: anding@nimte.ac.cn [Key Laboratory of Magnetic Materials and Devices, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang 315201 (China); Center for Advanced Structural Materials, Department of Mechanical and Biomedical Engineering, College of Science and Engineering, City University of Hong Kong, Kowloon, Hong Kong (China); Yue, Shiqiang [Key Laboratory of Magnetic Materials and Devices, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang 315201 (China); Zhejiang Province Key Laboratory of Magnetic Materials and Application Technology, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo 315201 (China); Kong, Fengyu [School of Materials and Chemical Engineering, Ningbo University of Technology, Ningbo 315016 (China); Qiu, Keqiang, E-mail: kqqiu@163.com [School of Materials Science and Engineering, Shenyang University of Technology, Shenyang, Liaoning 110870 (China); Chang, Chuntao; Wang, Xinmin [Key Laboratory of Magnetic Materials and Devices, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang 315201 (China); Zhejiang Province Key Laboratory of Magnetic Materials and Application Technology, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo 315201 (China); Liu, Chain-Tsuan, E-mail: chainliu@cityu.edu.hk [Center for Advanced Structural Materials, Department of Mechanical and Biomedical Engineering, College of Science and Engineering, City University of Hong Kong, Kowloon, Hong Kong (China)
2017-07-01
Highlights: • Surface crystallization in Fe{sub 83}B{sub 11}P{sub 3}Si{sub 2}C{sub 1} ribbon was inhibited by flux purification. • Amorphous Fe{sub 83}B{sub 11}P{sub 3}Si{sub 2}C{sub 1} ribbon was made with industrial process and materials. • The ribbons exhibit high B{sub s} of 1.65 T, low H{sub c} of 2 A/m, and high μ{sub e} of 9.7 × 10{sup 3}. • High melting point inclusions trigger the surface crystallization as nuclei. - Abstract: A high-B{sub s} amorphous alloy with the base composition Fe{sub 83}B{sub 11}P{sub 3}Si{sub 2}C{sub 1} was used to study the effects of fluxing purification on amorphous forming ability and magnetic properties of the alloy prepared with raw materials in industrialization. By using fluxing purification, the surface crystallization was suppressed and fully amorphous Fe{sub 83}B{sub 11}P{sub 3}Si{sub 2}C{sub 1} ribbons with a maximum thickness of 48 μm were successfully achieved by using an industrial process and materials. The amorphous ribbons made with industrial-purified alloys exhibit excellent magnetic properties, containing high-B{sub s} of 1.65 T, low H{sub c} of 2.0 A/m, and high μ{sub e} of 9.7 × 10{sup 3} at 1 kHz. Impurities in the melting alloys exist in three forms and have different effluences on magnetic properties. The surface crystallization was triggered by the impurities which exist as high melting point inclusions serving as nuclei. Thus, fluxing purification is a feasible way for industrialization of high-B{sub s} FeBPSiC amorphous alloys.
On the causes of compositional order in the NicPt(1-c) alloys
International Nuclear Information System (INIS)
Gyorffy, B.L.; Staunton, J.B.
1991-01-01
We review, briefly, the arguments which gave rise to the current controversy concerning the origin of compositional order in Ni c Pt 1-c alloys. We note that strain fluctuations play an important role in determining the state of compositional order in this system and outline a theoretical framework that takes account of them. 29 refs., 4 figs
2010-04-01
... AVAILABILITY OF INFORMATION Production of Documents/Disclosure of Information Under the FOIA § 103.12 Exemptions. Pursuant to 5 U.S.C. 552(b), the disclosure requirements of 5 U.S.C. 552(a) are not applicable to... if such disclosure could reasonably be expected to risk circumvention of the law; or (6) Could...
International Nuclear Information System (INIS)
Fukumoto, Ken-ichi; Matsui, Hideki; Ohkubo, Hideaki; Tang, Zheng; Nagai, Yasuyoshi; Hasegawa, Masayuki
2008-01-01
Irradiation-induced Ti-rich precipitates in V-Ti and V-4Cr-4Ti alloys are studied by TEM and positron annihilation methods (positron lifetime, and coincidence Doppler broadening (CDB)). The characteristics of small defect clusters formed in V alloys containing Ti at irradiation temperatures below 300 deg. C have not been identified by TEM techniques. Strong interaction between vacancy and Ti solute atoms for irradiated V alloys containing Ti at irradiation temperatures from 220 to 350 deg. C are observed by positron lifetime measurement. The vacancy-multi Ti solute complexes in V-alloys containing Ti are definitely identified by using CDB measurement. It is suggested that ultra-fine Ti-rich precipitates or Ti segregation at periphery of dislocation loops are formed in V alloys containing Ti at irradiation temperatures below 300 deg. C
Thermal ageing and short-range ordering of Alloy 690 between 350 and 550 °C
Energy Technology Data Exchange (ETDEWEB)
Mouginot, Roman, E-mail: roman.mouginot@aalto.fi [Aalto University School of Engineering, Department of Mechanical Engineering, Otakaari 4, 02150 Espoo (Finland); Sarikka, Teemu [Aalto University School of Engineering, Department of Mechanical Engineering, Otakaari 4, 02150 Espoo (Finland); Heikkilä, Mikko [University of Helsinki, Laboratory of Inorganic Chemistry, A.I.Virtasen Aukio 1, 00560 Helsinki (Finland); Ivanchenko, Mykola; Ehrnstén, Ulla [VTT Technical Research Centre of Finland LTD, Kemistintie 3, 02150 Espoo (Finland); Kim, Young Suk; Kim, Sung Soo [Korea Atomic Energy Research Institute, Daedeok-Daero, 989-111, Yuseong, Daejeon, 34057 (Korea, Republic of); Hänninen, Hannu [Aalto University School of Engineering, Department of Mechanical Engineering, Otakaari 4, 02150 Espoo (Finland)
2017-03-15
Thermal ageing of Alloy 690 triggers an intergranular (IG) carbide precipitation and is known to promote an ordering reaction causing lattice contraction. It may affect the long-term primary water stress corrosion cracking (PWSCC) resistance of pressurized water reactor (PWR) components. Four conditions of Alloy 690 (solution annealed, cold-rolled and/or heat-treated) were aged between 350 and 550 °C for 10 000 h and characterized. Although no direct observation of ordering was made, variations in hardness and lattice parameter were attributed to the formation of short-range ordering (SRO) in all conditions with a peak level at 420 °C, consistent with the literature. Prior heat treatment induced ordering before thermal ageing. At higher temperatures, stress relaxation, recrystallization and α-Cr precipitation were observed in the cold-worked samples, while a disordering reaction was inferred in all samples based on a decrease in hardness. IG precipitation of M{sub 23}C{sub 6} carbides increased with increasing ageing temperature in all conditions, as well as diffusion-induced grain boundary migration (DIGM). - Highlights: • SRO was suggested in Alloy 690 with 9.18 wt% Fe after thermal ageing at 350, 420 and 475 °C. • Prior thermal treatment promoted SRO before ageing. • Cold work led to recrystallization and precipitation of α-Cr upon ageing at 550 °C. • Thermal ageing promoted IG precipitation of Cr-rich M{sub 23}C{sub 6} carbides and DIGM.
Kadam, Nikhil Rajendra; Karthikeyan, Ganesarethinam
2016-10-01
The purpose of the experiments in this paper is to use the Taguchi methods to investigate the wear of WC/C coated nitrided AISI 4140 alloy steel. A study of lamellar WC/C coating which were deposited by a physical vapor deposition on nitrided AISI 4140 alloy steel. The investigation includes wear evaluation using Pin-on-disk configuration. When WC/C coated AISI 4140 alloy steel slides against EN 8 steel, it was found that carbon-rich coatings show much lower wear of the countersurface than nitrogen-rich coatings. The results were correlated with the properties determined from tribological and mechanical characterization, therefore by probably selecting the proper processing parameters the deposition of WC/C coating results in decreasing the wear rate of the substrate which shows a potential for tribological application.
Energy Technology Data Exchange (ETDEWEB)
Schubert, L.E.; Hamilton, M.L.; Gelles, D.S. [Pacific Northwest National Lab., Richland, WA (United States)
1996-10-01
Miniature CVN specimens of four low activation ferritic alloys have been impact tested following irradiation at 370{degrees}C to 15 dpa. Comparison of the results with those of control specimens indicates that degradation in the impact behavior occurs in each of these four alloys. The 9Cr-2W alloy referred to as GA3X and the similar alloy F82H with 7.8Cr-2W appear most promising for further consideration as candidate structural materials in fusion energy system applications. These two alloys exhibit a small DBTT shift to higher temperatures but show increased absorbed energy on the upper shelf.
COMS eye plaque brachytherapy dosimetry simulations for 103Pd, 125I, and 131Cs
International Nuclear Information System (INIS)
Melhus, Christopher S.; Rivard, Mark J.
2008-01-01
Monte Carlo (MC) simulations were performed to estimate brachytherapy dose distributions for Collaborative Ocular Melanoma Study (COMS) eye plaques. Brachytherapy seed models 200, 6711, and CS-1 Rev2 carrying 103 Pd, 125 I, and 131 Cs radionuclides, respectively, were modeled and benchmarked against previously published values. Calculated dose rate constants MC Λ were 0.684, 0.924, and 1.052 cGy h -1 U -1 (±2.6%, k=1 uncertainty) for models 200, 6711, and CS-1 Rev2, respectively. The seeds were distributed into 10, 12, 14, 16, 18, 20, and 22 mm-diameter COMS eye plaques. Simulations were performed in both heterogeneous and homogeneous environments, where the latter were in-water and the former included the silastic seed carrier insert and gold-alloy plaque. MC-based homogenous central axis dose distributions agreed within 2%±1% (±1 s.d.) to hand-calculated values. For heterogeneous simulations, notable photon attenuation was observed, with dose reduction at 5 mm of 19%, 11%, and 9% for 103 Pd, 125 I, and 131 Cs, respectively. A depth-dependent correction factor was derived to correct homogenous central-axis dose distributions for plaque component heterogeneities, which were found to be significant at short radial distances
Suitability of Tophet C-Alloy 52/Kovar components to hydrogen environments
International Nuclear Information System (INIS)
Gebhart, J.M.; Kelly, M.D.
1976-01-01
The suitability of Tophet C-Alloy 52/Kovar weldments to hydrogen embrittlement were investigated because of their potential as candidate materials in fabrication of minaturized initiators for pyrotechnics. Cathodic charged samples were statically loaded for extended periods of time resulting in no load failures and in ductile fracture surfaces indicating resistance to hydrogen embrittlement. 20 figures
Temperature-dependent thermal and thermoelectric properties of n -type and p -type S c1 -xM gxN
Saha, Bivas; Perez-Taborda, Jaime Andres; Bahk, Je-Hyeong; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Sands, Timothy D.
2018-02-01
Scandium Nitride (ScN) is an emerging rocksalt semiconductor with octahedral coordination and an indirect bandgap. ScN has attracted significant attention in recent years for its potential thermoelectric applications, as a component material in epitaxial metal/semiconductor superlattices, and as a substrate for defect-free GaN growth. Sputter-deposited ScN thin films are highly degenerate n -type semiconductors and exhibit a large thermoelectric power factor of ˜3.5 ×10-3W /m -K2 at 600-800 K. Since practical thermoelectric devices require both n- and p-type materials with high thermoelectric figures-of-merit, development and demonstration of highly efficient p-type ScN is extremely important. Recently, the authors have demonstrated p-type S c1 -xM gxN thin film alloys with low M gxNy mole-fractions within the ScN matrix. In this article, we demonstrate temperature dependent thermal and thermoelectric transport properties, including large thermoelectric power factors in both n- and p-type S c1 -xM gxN thin film alloys at high temperatures (up to 850 K). Employing a combination of temperature-dependent Seebeck coefficient, electrical conductivity, and thermal conductivity measurements, as well as detailed Boltzmann transport-based modeling analyses of the transport properties, we demonstrate that p-type S c1 -xM gxN thin film alloys exhibit a maximum thermoelectric power factor of ˜0.8 ×10-3W /m -K2 at 850 K. The thermoelectric properties are tunable by adjusting the M gxNy mole-fraction inside the ScN matrix, thereby shifting the Fermi energy in the alloy films from inside the conduction band in case of undoped n -type ScN to inside the valence band in highly hole-doped p -type S c1 -xM gxN thin film alloys. The thermal conductivities of both the n- and p-type films were found to be undesirably large for thermoelectric applications. Thus, future work should address strategies to reduce the thermal conductivity of S c1 -xM gxN thin-film alloys, without affecting
International Nuclear Information System (INIS)
Yang Zhiqing; Chisholm, Matthew F.; Duscher, Gerd; Ma Xiuliang; Pennycook, Stephen J.
2013-01-01
Crystal defects in a plastically deformed Mg–Zn–Y alloy have been studied on the atomic scale using aberration-corrected scanning transmission electron microscopy, providing important structural data for understanding the material’s deformation behavior and strengthening mechanisms. Atomic scale structures of deformation stacking faults resulting from dissociation of different types of dislocations have been characterized experimentally, and modeled. Suzuki segregation of Zn and Y along stacking faults formed through dislocation dissociation during plastic deformation at 300 °C is confirmed experimentally on the atomic level. The stacking fault energy of the Mg–Zn–Y alloy is evaluated to be in the range of 4.0–10.3 mJ m −2 . The newly formed nanometer-wide stacking faults with their Zn/Y segregation in Mg grains play an important role in the superior strength of this alloy at elevated temperatures.
International Nuclear Information System (INIS)
Kolev, B.V.
2003-01-01
The paper presents framework a part of by now obtained results of the authors studies in the period 1967(68) - 2002 about possibilities for obtaining new high-strength and wear resistant cast alloys on, Fe-C base (complex alloyed steels and cast irons of different systems with different structure, reflected in over 125 articles, 15 inventions (patents) and other scientific studies. The paper includes summarized results and discussion. Key words: new austenite steels and cast irons, mechanical characteristics, wear resistance. (Original)
A TEM quantitative evaluation of strengthening in an Mg-RE alloy reinforced with SiC
International Nuclear Information System (INIS)
Cabibbo, Marcello; Spigarelli, Stefano
2011-01-01
Magnesium alloys containing rare earth elements are known to have high specific strength, good creep and corrosion resistance up to 523 K. The addition of SiC ceramic particles strengthens the metal matrix composite resulting in better wear and creep resistance while maintaining good machinability. The role of the reinforcement particles in enhancing strength can be quantitatively evaluated using transmission electron microscopy (TEM). This paper presents a quantitative evaluation of the different strengthening contributions, determined through TEM inspections, in an SiC Mg-RE composite alloy containing yttrium, neodymium, gadolinium and dysprosium. Compression tests at temperatures ranging between 290 and 573 K were carried out. The microstructure strengthening mechanism was studied for all the compression conditions. Strengthening was compared to the mechanical results and the way the different contributions were combined is also discussed and justified. - Research Highlights: → TEM yield strengthening terms evaluation on a Mg-RE SiC alloy. → The evaluation has been extended to different compression temperature conditions. → Linear and Quadratic sum has been proposed and validated. → Hall-Petch was found to be the most prominent strengthening contributions.
Thermal stability of the microstructure of an aged Nb-Zr-C alloy
Uz, Mehmet; Titran, Robert H.
1991-01-01
The effects of thermal aging with and without an applied stress on the microstructure of a Nb-Zr-C alloy containing 0.9 wt percent Zr and 0.06 percent C were studied. Chemical analysis, metallographic examination, energy dispersive X-ray spectra of the bulk material, and chemical and X-ray analyses of the phase-extracted residue were used to characterize the microstructure. The samples examined were from a creep strength study involving hot and cold working, and various combinations of exposure to temperatures ranging from 1350 to 1755 K with and without applied load times as long as 34,000 plus hours. The results showed that the initial microstructure consisted primarily of orthorombic precipitates of Nb sub C which were partially or completely transformed to face-centered cubic carbides of Nb and Zr, (Zr, Nb)C, upon prolonged exposure to elevated temperatures. Furthermore, it was found that the microstructure of the alloy is extremely stable owing to the very finely distributed precipitates throughout its matrix and along the grain boundaries. The lattice parameters of the cubic carbides were determined to vary from 0.458 to 0.465 nm as the Zr/Nb ratio varied from 38/62 to 75/25.
Thermal stability of the microstructure of an aged Nb-Zr-C alloy
International Nuclear Information System (INIS)
Uz, M.; Titran, R.H.
1991-01-01
The effects of thermally aging with and without an applied stress on the microstructure of a Nb-Zr-C alloy containing 0.9 wt % Zr and 0.06 wt % C were studied. Chemical analysis, metallographic examination, energy dispersive x-ray spectra of the bulk material, and chemical and x-ray analyses of the phase-extracted residue were used to characterize the microstructure. The samples examined were from a creep strength study involving hot and cold working, and various combinations of exposure to temperatures ranging from 1350 to 1755 K with and without applied load for times as long as 34,000 plus hours. The results showed that the initial microstructure consisted primarily of orthorhombic precipitates of Nb 2 C which were partially or completely transformed to face-centered cubic carbides of Nb and Zr, (Zr,Nb)C, upon prolonged exposure to elevated temperatures. Furthermore, it was found that the microstructure of the alloy is extremely stable owing to the very finely distributed precipitates throughout its matrix and along the grain boundaries. The lattice parameters of the cubic carbides were determined to vary from 0.458 to 0.465 nm as the Zr/Nb ratio varied from 38/62 to 75/25. 25 refs., 5 figs., 4 tabs
Corrosion of alloy C-22 in organic acid solutions
International Nuclear Information System (INIS)
Carranza, Ricardo M.; Rodriguez, Martin A.; Giordano, Celia M.
2007-01-01
Electrochemical studies such as cyclic potentiodynamic polarization (CPP) and electrochemical impedance spectroscopy (EIS) were performed to determine the corrosion behavior of Alloy 22 (N06022) in 1M NaCl solutions at various pH values from acidic to neutral at 90 C degrees. All the tested material was wrought Mill Annealed (MA). Tests were also performed in NaCl solutions containing weak organic acids such as oxalic, acetic, citric and picric acids. Results show that the corrosion rate of Alloy 22 was significantly higher in solutions containing oxalic acid than in solutions of pure NaCl at the same pH. Citric and Picric acids showed a slightly higher corrosion rate, and Acetic acid maintained the corrosion rate of pure chloride solutions at the same pH. Organic acids revealed to be weak inhibitors for crevice corrosion. Higher concentration ratios, compared to nitrate ions, were needed to completely inhibit crevice corrosion in chloride solutions. Results are discussed considering acid dissociation constants, buffer capacity and complex formation constants of the different weak acids. (author) [es
NEUTRON-INDUCED SWELLING OF Fe-Cr BINARY ALLOYS IN FFTF AT ∼400 DEGREES C
International Nuclear Information System (INIS)
Garner, Francis A.; Greenwood, Lawrence R.; Okita, Taira; Sekimura, Naoto; Wolfer, W. G.
2002-01-01
The purpose of this effort is to determine the influence of dpa rate, He/dpa ratio and composition on the void swelling of simple binary Fe-Cr alloys. Contrary to the behavior of swelling of model fcc Fe-Cr-Ni alloys irradiated in the same FFTF-MOTA experiment, model bcc Fe-Cr alloys do not exhibit a dependence of swelling on dpa rate at approximately 400 degrees C. This is surprising in that an apparent flux-sensitivity was observed in an earlier comparative irradiation of Fe-Cr binaries conducted in EBR-II and FFTF. The difference in behavior is ascribed to the higher helium generation rates of Fe-Cr alloys in EBR-II compared to that of FFTF, and also the fact that lower dpa rates in FFTF are accompanied by progressively lower helium generation rates.
Thermal stability of Ni-Pt-Ta alloy silicides on epi-Si{sub 1-x}C{sub x}
Energy Technology Data Exchange (ETDEWEB)
Yoo, Jung-Ho; Chang, Hyun-Jin [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Min, Byoung-Gi [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Jusung Engineering Co., Ltd., 49, Neungpyeong-ri, Opo-eup, Gwangju-Si, Kyunggi-do 464-892 (Korea, Republic of); Ko, Dae-Hong [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of)], E-mail: dhko@yonsei.ac.kr; Cho, Mann-Ho [Institute of Physics and Applied Physics, Yonsei University, Seoul 120-749 (Korea, Republic of); Sohn, Hyunchul [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Tae-Wan [Jusung Engineering Co., Ltd., 49, Neungpyeong-ri, Opo-eup, Gwangju-Si, Kyunggi-do 464-892 (Korea, Republic of)
2008-12-05
We investigated the silicide formation in Ni/epi-Si{sub 1-x}C{sub x} systems. Ni-Pt and Ni-Pt-Ta films were deposited on epi-Si{sub 1-x}C{sub x}/Si substrates by DC magnetron sputtering and processed at various temperatures. The sheet resistance of the silicide from the Ni alloy/epi-Si{sub 1-x}C{sub x} systems was maintained at low values compared to that from Ni/Si systems. By TEM and EDS analyses, we confirmed the presence of a Pt alloy layer at the top of the Ni-silicide layer. The stability of the silicide layer in the Ni alloy/epi-Si{sub 1-x}C{sub x} system is explained by not only the Pt rich layer on the top of the Ni-silicide layer, but also by the presence of a small amount of Pt in the Ni-silicide layer or at the grain boundaries. And both the thermal stability and the morphology of silicide were greatly improved by the addition of Ta in Ni-Pt films.
Tafwidli, Fahmi; Choi, Moo-Eob; Yi, Sang-Ho; Kang, Youn-Bae
2018-06-01
Evaporation of Cu or Sn from liquid iron alloys containing C and S was experimentally investigated. The initial C concentration, [pct C]0, in the liquid alloy was varied from zero to C saturation, and the evaporation temperature was varied from 1513 K to 1773 K (1240 °C to 1500 °C). Along with the report by one of the present authors, the evaporation mechanism of Cu and Sn from liquid Fe-C-S alloy is proposed, after a modification from the previous mechanism. It was proposed that Cu and Sn evaporate as Cu(g) and Sn(g) and also evaporate as CuS(g) and SnS(g), which are more volatile species. Therefore, availability of S in the alloy affects the overall evaporation rate of Cu and Sn. At the same time, C in the alloy also forms volatile carbosulfides CS(g) and CS2(g), thereby competing with Cu and Sn. Moreover, C increases the activity coefficients of Cu, Sn, and S. This increases the thermodynamic driving force for the formation of CuS(g) and SnS(g). Therefore, increasing [pct C] partly accelerates the evaporation rate of Cu and Sn by increasing the activity coefficient but partly decelerates the evaporation rate by lowering the available S content. S partly accelerates the evaporation rate by increasing the available S for the sulfide gas species but partly decelerates the evaporation rate due to the surface poisoning effect. Increasing the reaction temperature increases the overall evaporation rate. All these facts were taken into account in order to develop an evaporation rate model. This model was extended from the present authors' previous one by taking into account (1) CS(g), S(g), and CS2(g) (therefore, the following species were considered as dominant evaporating species: Cu(g), CuS(g), Sn(g), SnS(g), S(g), CS(g), and CS2(g)); (2) the effect of C and temperature on the activity coefficients of Cu, Sn, and S; (3) the effect of C and temperature on the density of the liquid alloy; and (4) the effect of temperature on the S adsorption coefficient. This revised
Tafwidli, Fahmi; Choi, Moo-Eob; Yi, Sang-Ho; Kang, Youn-Bae
2018-02-01
Evaporation of Cu or Sn from liquid iron alloys containing C and S was experimentally investigated. The initial C concentration, [pct C]0, in the liquid alloy was varied from zero to C saturation, and the evaporation temperature was varied from 1513 K to 1773 K (1240 °C to 1500 °C). Along with the report by one of the present authors, the evaporation mechanism of Cu and Sn from liquid Fe-C-S alloy is proposed, after a modification from the previous mechanism. It was proposed that Cu and Sn evaporate as Cu(g) and Sn(g) and also evaporate as CuS(g) and SnS(g), which are more volatile species. Therefore, availability of S in the alloy affects the overall evaporation rate of Cu and Sn. At the same time, C in the alloy also forms volatile carbosulfides CS(g) and CS2(g), thereby competing with Cu and Sn. Moreover, C increases the activity coefficients of Cu, Sn, and S. This increases the thermodynamic driving force for the formation of CuS(g) and SnS(g). Therefore, increasing [pct C] partly accelerates the evaporation rate of Cu and Sn by increasing the activity coefficient but partly decelerates the evaporation rate by lowering the available S content. S partly accelerates the evaporation rate by increasing the available S for the sulfide gas species but partly decelerates the evaporation rate due to the surface poisoning effect. Increasing the reaction temperature increases the overall evaporation rate. All these facts were taken into account in order to develop an evaporation rate model. This model was extended from the present authors' previous one by taking into account (1) CS(g), S(g), and CS2(g) (therefore, the following species were considered as dominant evaporating species: Cu(g), CuS(g), Sn(g), SnS(g), S(g), CS(g), and CS2(g)); (2) the effect of C and temperature on the activity coefficients of Cu, Sn, and S; (3) the effect of C and temperature on the density of the liquid alloy; and (4) the effect of temperature on the S adsorption coefficient. This revised
Electronic states density and solution volume of hydrogen solution in SiC alloys
International Nuclear Information System (INIS)
Gervasoni, J.L.; Furnari, J.C.
2012-01-01
The new reactor concepts are characterized by higher efficiency, better utilization of nuclear fuel and nuclear waste minimization. This approach means that this will be to enter a new and deep structural analysis of materials with a tensile strength significantly higher than those currently used radiation. To achieve high performance parameters, continuous research and testing of new materials will be needed. In this paper we concentrate on the analysis of SiC alloys, because due to their unique properties, this alloy can be used in high temperature conditions, where the silicon, semiconductor material of choice does not work (author)
Chen, Jie; Ma, Bing; Liu, Guang; Song, Hui; Wu, Jinming; Cui, Lang; Zheng, Ziyun
2017-08-01
In order to improve the wear and corrosion resistance of commonly used magnesium alloys, 316L stainless steel coating and 316L-SiC composite coating have been deposited directly on commercial AZ80 magnesium alloy using cold spraying technology (CS). The microstructure, hardness and bonding strength of as-sprayed coatings were studied. Their tribological properties sliding against Si3N4 and GCr15 steel under unlubricated conditions were evaluated by a ball-on-disk tribometer. Corrosion behaviors of coated samples were also evaluated and compared to that of uncoated magnesium alloy substrate in 3.5 wt.% NaCl solution by electrochemical measurements. Scanning electron microscopy was used to characterize the corresponding wear tracks and corroded surfaces to determine wear and corrosion mechanisms. The results showed that the as-sprayed coatings possessed higher microhardness and more excellent wear resistance than magnesium alloy substrate. Meanwhile, 316L and 316L-SiC coating also reduced the corrosion current density of magnesium alloy and the galvanic corrosion of the substrates was not observed after 200-h neutral salt spray exposure, which demonstrated that corrosion resistance of a magnesium alloy substrate could be greatly improved by cold-sprayed stainless steel-based coatings.
Microstructure and corrosion resistance of TC2 Ti alloy by laser cladding with Ti/TiC/TiB_2 powders
International Nuclear Information System (INIS)
Diao, Yunhua; Zhang, Kemin
2015-01-01
Highlights: • A TiC/TiB_2 composite coating was produced onto a TC2 Ti alloy by laser cladding with Ti/TiC/TiB_2 powders. • A maximum hardness of 1100 HV was achieved in the laser clad TiC/TiB_2 composite layer. • Corrosion resistance of the TC2 alloy in NaCl (3.5 wt%) aqueous solution can be improved after laser cladding. - Abstract: In the present work, a TiC/TiB_2 composite coating was produced onto a TC2 Ti alloy by laser cladding with Ti/TiC/TiB_2 powders. The surface microstructure, phase components and compositions were characterized with methods of optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffractometry (XRD), and energy dispersive spectrometry (EDS). The cladding layer is consisted of Ti, TiC and TiB_2. And the surface microhardness was measured. After laser cladding, a maximum hardness of 1100 HV is achieved in the laser cladding surface layer, which is more three times higher than that of the TC2 substrate (∼300 HV). Due to the formation of TiC and TiB_2 intermetallic compounds in the alloyed region and grain refinement, the microhardness of coating is higher than TC2 Ti alloy. In this paper, the corrosion property of matrix material and treated samples were both measured in NaCl (3.5 wt%) aqueous solution. From the result we can see that the laser cladding specimens’ corrosion property is clearly becoming better than that of the substrate.
International Nuclear Information System (INIS)
Tanaka, Nobuyuki; Onuki, Kaoru; Shimizu, Saburo; Yamaguchi, Akihisa
2006-01-01
Exposure tests of candidate materials were carried out up to 1000 hr in the sulfuric acid environments of thermochemical hydrogen production IS process, focusing on the corrosion of welded portion and of crevice area. In the gas phase sulfuric acid decomposition condition at 850degC, welded samples of Alloy 800 and of Alloy 600 showed the same good corrosion resistance as the base materials. In the boiling condition of 95 wt% sulfuric acid solution, test sample of SiC showed the same good corrosion resistance. Also negligible corrosion was observed in crevice corrosion. (author)
Berthod, Patrice
2018-06-01
Nickel-based cast alloys rich in chromium and reinforced by TaC carbides are potentially very interesting alloys for applications at elevated temperatures. Unfortunately, unlike cobalt-chromium and iron-chromium alloys, it is difficult to obtain exclusively TaC as primary carbides in Ni-Cr alloys. In alloys containing 30 wt pct Cr tantalum, carbides coexist with chromium carbides. The latter tend to weaken the alloy at elevated temperatures because they become rapidly spherical and then quickly lose their reinforcing effect. In this work, we attempted to stabilize TaC as a single carbide phase by testing different chromium contents in the [0, 50 wt pct] range. Six alloys containing 0.4C and 6Ta, weight contents corresponding to equivalent molar contents, were elaborated by foundry, and their as-cast microstructures were characterized. Samples of all alloys were exposed to 1127 °C and 1237 °C for 24 hours to characterize their stabilized microstructures. The surface fractions of chromium carbides and tantalum carbides were measured by image analysis, and their evolutions vs the chromium content were studied. For the chosen C and Ta contents, it appears that obtaining TaC only is possible by decreasing the chromium content to 10 wt pct. At the same time, TaC fractions are unfortunately too low because a large portion of tantalum integrates into the solid solution in the matrix. A second consequence is a critical decrease in oxidation resistance. Other possible methods to stabilize TaC as a single carbide are evocated, such as the simultaneous increase in Ta and decrease in chromium from 30 wt pct Cr.
Ni.sub.3 Al-based intermetallic alloys having improved strength above 850.degree. C.
Liu, Chain T.
2000-01-01
Intermetallic alloys composed essentially of: 15.5% to 17.0% Al, 3.5% to 5.5% Mo, 4% to 8% Cr, 0.04% to 0.2% Zr, 0.04% to 1.5% B, balance Ni, are characterized by melting points above 1200.degree. C. and superior strengths at temperatures above 1000.degree. C.
Effect Of SiC Particles On Sinterability Of Al-Zn-Mg-Cu P/M Alloy
Directory of Open Access Journals (Sweden)
Rudianto H.
2015-06-01
Full Text Available Premix Al-5.5Zn-2.5Mg-0.5Cu alloy powder was analyzed as matrix in this research. Gas atomized powder Al-9Si with 20% volume fraction of SiC particles was used as reinforcement and added into the alloy with varied concentration. Mix powders were compacted by dual action press with compaction pressure of 700 MPa. High volume fraction of SiC particles gave lower green density due to resistance of SiC particles to plastic deformation during compaction process and resulted voids between particles and this might reduce sinterability of this mix powder. Sintering was carried out under ultra high purity nitrogen gas from 565°-580°C for 1 hour. High content of premix Al-5.5Zn-2.5Mg-0.5Cu alloy powder gave better sintering density and reached up to 98% relative. Void between particles, oxide layer on aluminum powder and lower wettability between matrix and reinforcement particles lead to uncompleted liquid phase sintering, and resulted on lower sintering density and mechanical properties on powder with high content of SiC particles. Mix powder with wt90% of Alumix 431D and wt10% of Al-9Si-vf20SiC powder gave higher tensile strength compare to another mix powder for 270 MPa. From chemical compositions, sintering precipitates might form after sintering such as MgZn2, CuAl2 and Mg2Si. X-ray diffraction, DSC-TGA, and SEM were used to characterize these materials.
Gulsoy, Gokce; Was, Gary S.
2015-04-01
Alloy 617 was exposed to He-CO-CO2 environments with of either 9 or 1320 at temperatures from 1023 K to 1123 K (750 °C to 850 °C) to determine the oxygen diffusion coefficients within the internal oxidation zone of the alloy. The oxygen diffusion coefficients determined based on both intergranular and transgranular oxidation rates were several orders of magnitude greater than those reported in pure nickel and in nickel-based binary alloys, indicating that the rapid internal aluminum oxidation of Alloy 617 was primarily due to enhanced oxygen diffusion along the incoherent Al2O3-alloy interfaces. The range of activation energy values determined for oxygen diffusion associated with the intergranular aluminum oxidation was from 149.6 to 154.7 kJ/mol, and that associated with the transgranular aluminum oxidation was from 244.7 to 283.5 kJ/mol.
Low cycle fatigue behaviour of zirconium alloys at 3000C
International Nuclear Information System (INIS)
Hosbons, R.R.
1975-01-01
The low cycle fatigue lives of two zirconium alloys, zirconium--2.5 wt percent niobium and zirconium--1.1 wt percent chromium--0.1 wt percent iron, have been determined at 300 0 C. Both annealed material and cold-worked and stress-relieved material have similar fatigue lives to annealed Zircaloy-2 but β-quenched zirconium--niobium and zirconium--chromium--iron have lower fatigue lives than annealed Zircaloy-2. An atmosphere containing a concentration of iodine lower than that required for stress corrosion cracking still significantly lowers the fatigue life. A mathematical relationship between fatigue life and short-term tensile properties was used to estimate the fatigue life of zirconium alloy fuel sheaths and it was estimated that for a strain cycle of 0.1 percent a cyclic frequency exceeding 0.116 Hz (10,000 cycles/ day) would be required to cause fatigue failure of the sheath before its design life is realized
Low cycle fatigue behaviour of zirconium alloys at 3000C
International Nuclear Information System (INIS)
Hosbons, R.R.
1975-01-01
The low cycle fatigue lives of two zirconium alloys, zirconium-2.5 wt% niobium and zirconium-1.1 wt% chronium-0.1 wt% iron, have been determined at 300 0 C. Both annealed material and cold-worked and stress-relieved material have similar fatigue lives to annealed Zircaloy-2 but β-quenched zirconium-niobium and zirconium-chromium-iron have lower fatigue lives than annealed Zircaloy-2. An atmosphere containing a concentration of iodine lower than that required for stress corrosion cracking still significantly lowers the fatigue life. A mathematical relationship between fatigue life and short-term tensile properties was used to estimate the fatigue life of zirconium alloy fuel sheaths and it was estimated that for a strain cycle of 0.1 per cent a cyclic frequency exceeding 0.116 Hz (10 000 cycles/day) would be required to cause fatigue failure of the sheath before its design life is realized. (author)
Al-Li alloy 1441 for fuselage applications
Energy Technology Data Exchange (ETDEWEB)
Bird, R.K.; Dicus, D.L. [National Aeronautics and Space Administration, Hampton, VA (United States). Langley Research Center; Fridlyander, J.N.; Sandler, V.S.
2000-07-01
A cooperative investigation was conducted to evaluate Al-Cu-Mg-Li alloy 1441 for long service life fuselage applications. Alloy 1441 is currently being used for fuselage applications on the Russian Be- 103 amphibious aircraft, and is expected to be used for fuselage skin on a new Tupolev business class aircraft. Alloy 1441 is cold-rollable and has several attributes that make it attractive for fuselage skin applications. These attributes include lower density and higher specific modulus with similar strength as compared to conventional Al-Cu-Mg alloys. Cold-rolled 1441 Al-Li sheet specimens were tested at NASA Langley research center (LaRC) and at the All-Russia Institute of Aviation Materials (VIAM) in Russia to evaluate tensile properties, fracture toughness, impact resistance, fatigue life and fatigue crack growth rate. In addition, fuselage panels were fabricated by Tupolev Design Bureau (TDB) using 1441 skins and Al-Zn-Mg-Cu alloy stiffeners. The panels were subjected to cyclic pressurization fatigue tests at TDB and at LaRC to simulate fuselage pressurization/depressurization during aircraft service. This paper discusses the results from this investigation. (orig.)
Magnetism and local environment model in (Ni/sub 1-c/Co/sub c/)078P014B008 amorphous alloys
International Nuclear Information System (INIS)
Amamou, A.
1976-06-01
The magnetic properties of amorphous alloys (Ni/sub 1-c/Co/sub c/) 0 . 78 P 0 . 14 B 0 . 08 were investigated. The samples were prepared by the splat-cooling method. The Curie temperatures were determined and the magnetization measurements, performed for 1.7 0 K less than or equal to T less than or equal to 270 0 K and fields up to kOe. Ni 0 . 78 P 0 . 14 B 0 . 08 is paramagnetic, whereas Co 0 . 78 P 0 . 14 B 0 . 08 is ferromagnetic until the crystallization temperature (678 0 K). The average moment per cobalt atom is 1.15 μ/sub B/. In (Ni/sub 1-c/Co/sub c/) 0 . 78 P 0 . 14 B 0 . 08 the critical concentration for the paramagnetic-ferromagnetic transition is c approximately equal to 0.15; this transition occurs in an inhomogeneous way. The saturation magnetization in the whole concentration range can be interpreted (as for some crystallized alloys and compounds) by a local environment model, when a reasonable short-range order is assumed. In such a model the magnetic moment per cobalt atom is related merely to the number of its Co first neighbors n/sub Co/. For n/sub Co/ = 0 and 1 the cobalt atom is not magnetic, for n/sub Co/ = 2 and 3 it carries a small moment μ 1 = 0.50μ/sub B/ and for n/sub Co/ greater than 3 it is magnetic with μ 2 = 1.15μ/sub B/ as in Co 0 . 78 P 0 . 14 B 0 . 08 ; the nickel atoms do not carry a substantial moment in the entire concentration range. These features are comparable to those obtained in some crystalline alloys. 3 figures
Influence of oxygen on the interaction of Nb-Zr-C alloy with lithium
International Nuclear Information System (INIS)
Lyutyi, E.M.; Ignativ, M.I.
1980-01-01
This work is devoted to an investigation of the interaction of Nb-1% Zr-0.1% C alloy of different oxygen contents with molten technical-grade lithium. To obtain different oxygen contents in the steel, one lot of samples was annealed at 1400/degree/C for 2 h with a residual gas pressure of 0.1 mPa and the other under the same conditions in a vacuum of 10 mPa, which provided oxygen contents in the samples of 0.015 and 0.019 wt.%, respectively. The small difference between the oxygen contents in the samples of the two lots caused substantial differences in the interaction of the alloy with lithium. The sample with 0.015 wt.% oxygen had practically no corrosion even in holding in lithium for 1000 h. Impregnation of the samples with oxygen during the preliminary anneal leads to intensification of the corrosive action of lithium
Yield and strength properties of the Ti-6-22-22S alloy over a wide strain rate and temperature range
International Nuclear Information System (INIS)
Krueger, L.; Kanel, G.I.; Razorenov, S.V.; Bezrouchko, G.S.; Meyer, L.
2002-01-01
A mechanical behavior of the Ti-6-22-22S alloy was studied under uniaxial strain conditions at shock-wave loading and under uniaxial compressive stress conditions over a strain rate range of 10-4 s-1 to 103 s-1. The test temperature was varied from -175 deg. C to 620 deg. C. The strain-rate and the temperature dependencies of the yield stress obtained from the uniaxial stress tests and from the shock-wave experiments are in a good agreement and demonstrate a significant decrease in the yield strength as the temperature increases. This indicates the thermal activation mechanism of plastic deformation of the alloy is maintained at strain rates up to 106 s-1. Variation of sample thickness from 2.24 to 10 mm results in relatively small variations in the dynamic yield strength and the spall strength over the whole temperature range
Microstructure and tensile properties of Fe-40 at. pct Al alloys with C, Zr, Hf, and B additions
Gaydosh, D. J.; Draper, S. L.; Nathal, M. V.
1989-01-01
The influence of small additions of C, Zr, and Hf, alone or in combination with B, on the microstructure and tensile behavior of substoichiometric FeAl was investigated. Tensile properties were determined from 300 to 1100 K on powder which was consolidated by hot extrusion. All materials possessed some ductility at room temperature, although ternary additions generally reduced ductility compared to the binary alloy. Adding B to the C- and Zr-containing alloys changed the fracture mode from intergranular to transgranular and restored the ductility to approximately 5 percent elongation. Additions of Zr and Hf increased strength up to about 900 K. Fe6Al6Zr and Fe6Al6Hf precipitates, both with identical body-centered tetragonal structures, were identified as the principal second phase in these alloys. Strength decreased steadily as temperature increased above 700 K, as diffusion-assisted mechanisms became operative. Although all alloys had similar strengths at 1100 K, Hf additions significantly improved high-temperature ductility by suppressing cavitation.
A possible in vivo generator 103Pd/103mRh-Recoil considerations
International Nuclear Information System (INIS)
Rooyen, Johann van; Szucs, Zoltan; Rijn Zeevaart, Jan
2008-01-01
The use of Auger emitters as potential radiopharmaceuticals is increasingly investigated. One such radionuclide of interest is 103m Rh. This can be produced from 103 Ru or from 103 Pd in an in vivo generator. A potential problem with this concept is the recoil of the 103m Rh out of the carrier molecule and even out of the target cell. In order to determine whether this would happen in the 103 Pd/ 103m Rh case calculations were done to prove that this does not happen. From theoretical considerations it seems that the 103 Pd/ 103m Rh in vivo generator system would be possible
The Synthesis and Characterization of W- 1wt.% TiC Alloy Using a Chemical Method
Energy Technology Data Exchange (ETDEWEB)
Kim, Taehee; Ryu, Ho Jin [KAIST, Daejeon (Korea, Republic of)
2016-10-15
The tungsten and its alloys have been used in many applications due to their excellent mechanical and thermal properties such as high melting point, high thermal conductivity, high strength at elevated temperatures, low sputtering yield in radiation environment and low tritium inventory. Moreover, many researchers consider tungsten alloys as the most promising candidate for plasma facing components for future nuclear fusion reactors. Three samples of W – 1.0 wt.% TiC composites with the different fabrication methods were successfully developed. The combined method of the wet chemical method and 3D mixing showed small amount of agglomeration of TiC particles, however, the TiC particle sizes were smaller than 3DM1 sample. Since the WCM1 showed the better mechanical property, microhardness, the main future plan is to achieve the same or improved mechanical property of W3D1.
Energy Technology Data Exchange (ETDEWEB)
Liu, Xiang, E-mail: xliu@swip.ac.cn [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041, Sichuan (China); Chen, Jiming; Lian, Youyun; Wu, Jihong; Xu, Zengyu; Zhang, Nianman; Wang, Quanming; Duan, Xuro [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041, Sichuan (China); Wang, Zhanhong; Zhong, Jinming [Northwest Rare Metal Material Research Institute, CNMC, Ningxia Orient Group Co. Ltd.,No.119 Yejin Road, Shizuishan City, Ningxia,753000 (China)
2013-11-15
Beryllium and tungsten have been selected as the plasma facing materials of the ITER first wall (FW) and divertor chamber, respectively. China, as a participant in ITER, will share the manufacturing tasks of ITER first-wall mockups with the European Union and Russia. Therefore ITER-grade beryllium has been developed in China and a kind of vacuum hot-pressed (VHP) beryllium, CN-G01, was characterized for both physical, and thermo-mechanical properties and high heat flux performance, which indicated an equivalent performance to U.S. grade S-65C beryllium, a reference grade beryllium of ITER. Consequently CN-G01 beryllium has been accepted as the armor material of ITER-FW blankets. In addition, a modification of tungsten by TiC dispersion strengthening was investigated and a W–TiC alloy with TiC content of 0.1 wt.% has been developed. Both surface hardness and recrystallization measurements indicate its re-crystallization temperature approximately at 1773 K. Deuterium retention and thermal desorption behaviors of pure tungsten and the TiC alloy were also measured by deuterium ion irradiation of 1.7 keV energy to the fluence of 0.5–5 × 10{sup 18} D/cm{sup 2}; a main desorption peak at around 573 K was found and no significant difference was observed between pure tungsten and the tungsten alloy. Further characterization of the tungsten alloy is in progress.
Density of Liquid Ni-Mo Alloys Measured by a Modified Sessile Drop Method
Institute of Scientific and Technical Information of China (English)
Liang FANG; Zushu LI; ZaiNan TAO; Feng XIAO
2004-01-01
The density of liquid binary Ni-Mo alloys with molybdenum concentration from 0 to 20% (mass fraction) was measured by a modified sessile drop method. It has been found that the density of the liquid Ni-Mo alloys decreases with increasing temperature, but increases with the increase of molybdenum concentration in the alloys. The molar volume of liquid Ni-Mo binary alloys increases with the increase of temperature and molybdenum concentration. The partial molar volume of molybdenum in Ni-Mo binary alloy has been approximately calculated as [13.18 - 2.65 × 10-3T + (-47.94 + 3.10 × 10-2T) × 10-2XMo] × 10-6m3·mol-1. The molar volume of Ni-Mo alloy determined in the present work shows a negative deviation from the ideal linear mixing molar volume.
Energy Technology Data Exchange (ETDEWEB)
Wong, D.F. [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Department of Chemical Engineering, Wayne State University, Detroit, MI 48202 (United States); Young, K., E-mail: kwo.young@basf.com [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Department of Chemical Engineering, Wayne State University, Detroit, MI 48202 (United States); Nei, J.; Wang, L. [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Ng, K.Y.S. [Department of Chemical Engineering, Wayne State University, Detroit, MI 48202 (United States)
2015-10-25
Nd-addition to the AB{sub 2}-based alloy Ti{sub 12}Zr{sub 22.8−x}V{sub 10}Cr{sub 7.5}Mn{sub 8.1}Co{sub 7.0}Ni{sub 32.2}Al{sub 0.4}Nd{sub x} is studied for its effects on the structure, gaseous-phase hydrogen storage, and electrochemical properties. This study follows a series of Cu, Mo, Fe, Y, Si, and La doping studies in similar AB{sub 2}-based alloys. Limited solubility of Nd in the main Laves phase promotes the formation of secondary phases (AB and Zr{sub 7}Ni{sub 10}) to provide catalytic effects and synergies for improved capacity and high-rate dischargeability (HRD) performance. The main C14 storage phase has smaller lattice constants and cell volumes, and these effects reduce the storage capacity at higher Nd levels. Different hydrogen absorption mechanisms can occur in these multi-component, multi-phase alloys depending on the interfaces of the phases, and they have effects on the alloy properties. Higher Nd-levels improve the HRD performance despite having lower bulk diffusion and surface exchange current. Magnetic susceptibility measurements indicate large percentage of larger metallic nickel clusters are present in the surface oxide of alloys with higher Nd-content, and AC impedance studies show very low charge-transfer resistance with high catalytic capability in the alloys. The −40 °C charge-transfer resistance of 8.9 Ω g in this Nd-series of alloys is the lowest measured out of the studies investigating doped AB{sub 2}-based MH alloys for improved low-temperature characteristics. The improvement in HRD and low-temperature performance appears to be related to the proportion of the highly catalytic NdNi-phase at the surface, which must offset the increased bulk diffusion resistance in the alloy. - Graphical abstract: Schematics of hydrogen flow and corresponding PCT isotherms in funneling mode. - Highlights: • Structural and hydrogen storage properties of Nd-substituted AB{sub 2} metal hydride are reported. • Nd contributes to the lowest
Anodic behavior of alloy 22 in bicarbonate containing media: Effect of alloying
International Nuclear Information System (INIS)
Zadorozne, N S; Giordano, C M; Rebak, R B; Ares, A E; Carranza, R M
2012-01-01
Alloy 22 is one of the candidates for the manufacture of high level nuclear waste containers. These containers provide services in natural environments characterized by multi-ionic solutions.It is estimated they could suffer three types of deterioration: general corrosion, localized corrosion (specifically crevice corrosion) and stress corrosion cracking (SCC). It has been confirmed that the presence of bicarbonate and chloride ions is necessary to produce cracking, . It has also been determined that the susceptibility to SCC could be related to the occurrence of an anodic peak in the polarization curves in these media at potentials below transpassivity. The aim of this work is to study the effect of alloying elements on the anodic behavior of Alloy 22 in media containing bicarbonate and chloride ions at different concentrations and temperatures. Polarization curves were made on alloy 22 (Ni-22% Cr-13% Mo), Ni-Mo (Ni-28, 5% Mo) and Ni-Cr (Ni-20% Cr) in the following solutions: 1 mol/L NaCl at 90 o C, and 1.148 mol/L NaHCO 3 ; 1.148 mol/L NaHCO 3 + 1 mol/L NaCl; 1.148 mol/L NaHCO 3 + 0.1 mol/L NaCl, at 90 o C, 75 o C, 60 o C and 25 o C. It was found that alloy 22 has a anodic current density peak at potentials below transpassivity, only in the presence of bicarbonate ions. Curves performed in 1 mol/L NaCl did not show any anodic peak, in any of the tested alloys. The curves made on alloys Ni-Mo and Ni-Cr in the presence of bicarbonate ions, allowed to determine that Cr, is responsible for the appearance of the anodic peak in alloy 22. The curves of alloy Ni-Mo showed no anodic peak in the studied conditions. The potential at which the anodic peak appears in alloy 22 and Ni-Cr alloy, increases with decreasing temperature. The anodic peak was also affected by solution composition. When chloride ion is added to bicarbonate solutions, the anodic peak is shifted to higher potential and current densities, depending on the concentration of added chloride ions (author)
Processing and properties of Nb-Ti-based alloys
International Nuclear Information System (INIS)
Sikka, V.K.; Viswanathan, S.
1992-01-01
The processing characteristics, tensile properties, and oxidation response of two Nb-Ti-Al-Cr alloys were investigated. One creep test at 650 C and 172 MPa was conducted on the base alloy which contained 40Nb-40Ti-10Al-10Cr. A second alloy was modified with 0.11 at. % carbon and 0.07 at. % yttrium. Alloys were arc melted in a chamber backfilled with argon, drop cast into a water-cooled copper mold, and cold rolled to obtain a 0.8-mm sheet. The sheet was annealed at 1,100 C for 0.5 h. Longitudinal tensile specimens and oxidation specimens were obtained for both the base alloy and the modified alloy. Tensile properties were obtained for the base alloy at room temperature, 400, 600, 700, 800, 900, and 1,000 C, and for the modified alloy at room temperature, 400, 600, 700, and 800 C. Oxidation tests on the base alloy and modified alloy, as measured by weight change, were carried out at 600, 700, 800, and 900 C. Both the base alloy and the modified alloy were extremely ductile and were cold rolled to the final sheet thickness of 0.8 mm without an intermediate anneal. The modified alloy exhibited some edge cracking during cold during cold rolling. Both alloys recrystallized at the end of a 0.5-h annealing treatment. The alloys exhibited moderate strength and oxidation resistance below 600 C, similar to the results of alloys reported in the literature
Local atomic structure and chemical order in amorphous SiGe:H and SiC:H alloys
International Nuclear Information System (INIS)
Pisarkiewicz, T.; Stapinski, T.
1994-01-01
The local structure and chemical ordering in amorphous hydrogenated silicon-germanium and silicon-carbon alloys were analyzed mainly with the help of extended x-ray absorption fine structure (EXAFS) spectroscopy, Raman scattering and electron diffraction. Ge-Ge and Ge-Si distances were found to be independent of concentration and the composition of the first coordination shell around Ge is consistent with a random mixing of the two species in a-Si 1-x Ge:H alloy. The first-coordination-shell average bond lengths for Si-Si and SiC in a-Si 1-x C x :H are also constant with concentration x and the comparison of the first coordination shell composition around Si with average concentration indicates that the alloys tends to be chemically ordered. The degree of crystallinity in microcrystalline Si films determined by EXAFS is in agreement with that obtained in Raman scattering analysis. (author). 16 refs, 5 figs
Investigation of palladium-103 production and IR07-103Pd brachytherapy seed preparation
International Nuclear Information System (INIS)
Saidi, Pooneh; Sadeghi, Mahdi; Enferadi, Milad; Aslani, Gholamreza
2011-01-01
Highlights: → We report the cyclotron production of 103-palladium via 103 Rh(p,n) 103 Pd reaction. → 103 Pd was absorbed on resin beads for brachytherapy seed preparation. → The optimum absorption of 103 Pd in resin was achieved at 0.5 M HCl. → Version 5 of MCNP code was employed to model a new 103 Pd brachytherapy seed. - Abstract: In this study, design and fabrication of 103 Pd brachytherapy seed was investigated. The excitation functions of 103 Rh(p,n) 103 Pd and 103 Rh(d,2n) 103 Pd reactions were calculated using EMPIRE (version 3.1 Rivoli), ALICE/ASH and TALYS-1.2 codes, the TENDL-2010 database and compared with the published data. Production of 103 Pd was done via 103 Rh(p,n) 103 Pd nuclear reaction. The target was bombarded with 18 MeV protons at 200 μA beam current for 15 h. After irradiation and radiochemical separation of the electroplated rhodium target, the optimum condition for absorption of 103 Pd into Amberlite (registered) IR-93 resin was achieved at 0.5 M HCl. Version 5 of the (MCNP) Monte Carlo radiation transport code was employed to calculate the dosimetric parameters around the 103 Pd brachytherapy seed. Finally the calculated results were compared with published results for other commercial sources.
International Nuclear Information System (INIS)
Seagle, S.R.; Wood, J.R.
1993-01-01
As described above, new developments in the aerospace market are focusing on higher temperature alloys for jet engine components and higher strength/toughness alloys for airframe applications. Conventional alloys for engines have reached their maximum useful temperature of about 1000 F (540 C) because of oxidation resistance requirements. IMI 834 and Ti-1100 advanced alloys show some improvement, however, the major improvement appears to be in gamma titanium aluminides which could extend the maximum usage temperature to about 1500 F (815 C). This puts titanium alloys in a competitive position to replace nickel-base superalloys. Advanced airframe alloys such as Ti-6-22-22S, Beta C TM , Ti-15-333 and Ti-10-2-3 with higher strength than conventional Ti-6-4 are being utilized in significantly greater quantities, both in military and commercial applications. These alloys offer improved strength with little or no sacrifice in toughness and improved formability, in some cases. Advanced industrial alloys are being developed for improved corrosion resistance in more reducing and higher temperature environments such as those encountered in sour gas wells. Efforts are focused on small precious metal additions to optimize corrosion performance for specific applications at a modest increase in cost. As these applications develop, the usage of titanium alloys for industrial markets should steadily increase to approach that for aerospace applications. (orig.)
Microstructure characterization of nanocrystalline TiC synthesized by mechanical alloying
International Nuclear Information System (INIS)
Ghosh, B.; Pradhan, S.K.
2010-01-01
Nanocrystalline TiC is produced by mechanical milling the stoichiometric mixture of α-Ti and graphite powders at room temperature under argon atmosphere within 35 min of milling through a self-propagating combustion reaction. Microstructure characterization of the unmilled and ball-milled samples was done by both X-ray diffraction and electron microscopy. It reveals the fact that initially graphite layers were oriented along and in the course of milling, thin graphite layers were distributed evenly among the grain boundaries of α-Ti particles. Both α-Ti and TiC lattices contain stacking faults of different kinds. The grain size distribution obtained from the Rietveld's method and electron microscopy studies ensure that nanocrystalline TiC particles with almost uniform size (∼13 nm) can be prepared by mechanical alloying technique. The result obtained from X-ray analysis corroborates well with the microstructure characterization of nanocrystalline TiC by electron microscopy.
Engineering task plan for the vapor monitor installation into 241-C-103 tank
International Nuclear Information System (INIS)
Hertelendy, N.A.
1994-12-01
A vapor flow monitor is to be installed into the 241-C-103 tank's exhaust, just downstream of the HEPA filter. The flow monitor system includes the flow sensor, the baffle assembly, the signal conditioning and control electronics, and a chart recorder. The electronics package and the chart recorder are installed into a small, heated instrument cabinet that is mounted on the same steel pallet on which the flowmeter and the diffuser assembly is mounted. The flowmeter is connected to the HEPA filter with an unheated, un-insulated flex hose. An automatic drain, upstream of the flowmeter, is designed to automatically drain the condensate into an evaporating pan. The flowmeter is heated with a temperature controlled heater to avoid condensation
Energy Technology Data Exchange (ETDEWEB)
Taghvaei, A.H. [Department of Materials Science and Engineering, Shiraz University of Technology, Shiraz (Iran, Islamic Republic of); Ghajari, F., E-mail: fati.ghajari@gmail.com [Department of Materials Science and Engineering, Shiraz University, Shiraz (Iran, Islamic Republic of); Markó, D. [IFW Dresden, Institute for Complex Materials, Helmholtzstr. 20, 01069 Dresden (Germany); Prashanth, K.G. [IFW Dresden, Institute for Complex Materials, Helmholtzstr. 20, 01069 Dresden (Germany); Additive manufacturing Center, Sandvik AB, 81181 Sandviken (Sweden)
2015-12-01
Fe{sub 80}P{sub 11}C{sub 9} alloy with amorphous/nanocrytalline microstructure has been synthesized by mechanical alloying of the elemental powders. The microstructure, thermal behavior and morphology of the produced powders have been studied by X-ray diffraction (XRD), differential scanning calorimetry (DSC) and scanning electron microscopy (SEM), respectively. The crystallite size, lattice strain and fraction of the amorphous phase have been calculated by Rietveld refinement method. The results indicate that the powders microstructure consists of α-Fe(P,C) nanocrystals with an average diameter of 9 nm±1 nm dispersed in the amorphous matrix after 90 h of milling. Moreover, the fraction of amorphous phase initially increases up to 90 h of milling and then decreases after 120 h of milling, as a result of mechanical crystallization and formation of Fe{sub 2}P phase. The magnetic measurements show that while the saturation magnetization decreases continuously with the milling time, the coercivity exhibits a complicated trend. The correlation between microstructural changes and magnetic properties has been discussed in detail. - Highlights: • Glass formation was investigated in Fe{sub 80}P{sub 11}C{sub 9} by mechanical alloying. • Structural parameters were calculated by Rietveld refinement method. • Milling first increased and then decreased the fraction of amorphous phase. • Magnetic properties were significantly changed upon milling.
Wang, Hui-Long; Liu, Ling-Yun; Dou, Yong; Zhang, Wen-Zhu; Jiang, Wen-Feng
2013-12-01
In this paper, the protective electroless Ni-P/SiC gradient coatings on AZ91D magnesium alloy substrate were successfully prepared. The prepared Ni-P/SiC gradient coatings were characterized for its microstructure, morphology, microhardness and adhesion to the substrate. The deposition reaction kinetics was investigated and an empirical rate equation for electroless Ni-P/SiC plating on AZ91D magnesium alloy was developed. The anticorrosion properties of the Ni-P/SiC gradient coatings in 3.5 wt.% NaCl solution were evaluated by potentiodynamic polarization and electrochemical impedance spectroscopy (EIS) studies. The potentiodynamic polarization measurements revealed that the SiC concentration in the bath and heat treatment can influence the corrosion protection performance of electroless deposited Ni-P/SiC gradient coatings. EIS studies indicated that higher charge transfer resistance and slightly lower capacitance values were obtained for Ni-P/SiC gradient coatings compared to Ni-P coatings. The corrosion resistance of the Ni-P/SiC gradient coatings increases initially and decreases afterwards with the sustained increasing of immersion time in the aggressive medium. The electroless Ni-P/SiC gradient coatings can afford better corrosion protection for magnesium alloy substrate compared with Ni-P coatings.
International Nuclear Information System (INIS)
Kobayashi, Satoru; Schneider, Andre; Zaefferer, Stefan; Frommeyer, Georg; Raabe, Dierk
2005-01-01
In the context of the development of high-strength Fe 3 Al-based alloys, phase equilibria among α-Fe(Al, Cr, Ti), liquid and TiC phases in the Fe-Al-Cr-Ti-C quinary system and the formation of TiC were determined. A pseudo-eutectic trough (L α + L + TiC) exists at 1470 deg C at around Fe-26Al-5Cr-2Ti-1.7C on the vertical section between Fe-26Al-5Cr (α) and Ti-46C (TiC) in at.%. Large faceted TiC precipitates form from the melt after the formation of primary α phase even in hypoeutectic alloys. The TiC formation is thought to be due to the composition change of the liquid towards the hypereutectic compositions by solidification of the primary α. In order to remove the faceted TiC, which are unfavourable for strengthening the material, two different processing routes have been successfully tested: (i) solidification with an increased rate to reduce the composition variation of the liquid during solidification, and (ii) unidirectional solidification to separate the light TiC precipitates from the melt
International Nuclear Information System (INIS)
Bernshtejn, L.M.; Zakharov, A.M.; Veller, M.V.
1978-01-01
Presented are results of testing low-temperature thermomechanical treatment of low-alloying molybdenum alloys, including quenching from 2100 deg C, 40% deformation by hydroextrusion and aging at the temperature of 1200-1400 deg C. Tensile tests at room temperature with the following processing of results have shown that low-temperature thermomechanical treatment of low-alloying molybdenum alloys of Mo-Zr-C and Mo-Zr-Nb-C systems leads to a significant increase in low-temperature mechanical properties (strength properties - by 30-35%, ductility - by 30-40%) as compared with conventional heat treatment (aging after quenching). The treatment proposed increases resistance to small, as well as large plastic deformations, and leads to a simultaneous rise of strength and plastic properties at all stages of tensile test. Alloying of the Mo-Zr-C system with niobium increases both strength and plastic characteristics as compared with alloys without niobium when testing samples, subjected to low temperature thermomechanical treatment and conventional heat treatment at room temperature
Tensile behavior of RAFM alloys after neutron irradiation of up to 16.3 dpa between 250 and 450 °C
International Nuclear Information System (INIS)
Materna-Morris, E.; Schneider, H.-C.; Möslang, A.
2014-01-01
Tensile specimen of steel EUROFER97 and other alloys on the basis of RAFM steels such, as OPTIFER and F82H alloys, and Ga3X were irradiated and post-examined during a neutron irradiation program of up to 16.3 dpa between 250 and 450 °C in the HFR (High Flux Reactor) in the Netherlands. These tensile results were compared with former irradiation programs, with lower neutron doses of up to 0.8 and 2.4 dpa to quantify the difference in tensile strengthening. The average increase of tensile strength was in a range of 300 MPa between 0.8 and 16.3 dpa at temperatures of 250–300 °C. This behavior can be correlated with irradiation-induced changes in the microstructure. Most of the hardening can be attributed to dislocation loops, point defects or small precipitates as observed in boron-free alloys as F82H mod. and EUROFER97. Whereas the hardening in boron-containing alloys OPTIFER alloys and Ga3X can be correlated in addition with the combination of helium bubbles. At the highest irradiation and test temperature at 450 °C, all tensile data of all investigated materials were in the range of those of non-irradiated and irradiated material due to thermal aging effects
Tensile behavior of RAFM alloys after neutron irradiation of up to 16.3 dpa between 250 and 450 °C
Energy Technology Data Exchange (ETDEWEB)
Materna-Morris, E., E-mail: edeltraud.materna-morris@kit.edu; Schneider, H.-C., E-mail: hans-christian.schneider@kit.edu; Möslang, A., E-mail: anton.moeslang@kit.edu
2014-12-15
Tensile specimen of steel EUROFER97 and other alloys on the basis of RAFM steels such, as OPTIFER and F82H alloys, and Ga3X were irradiated and post-examined during a neutron irradiation program of up to 16.3 dpa between 250 and 450 °C in the HFR (High Flux Reactor) in the Netherlands. These tensile results were compared with former irradiation programs, with lower neutron doses of up to 0.8 and 2.4 dpa to quantify the difference in tensile strengthening. The average increase of tensile strength was in a range of 300 MPa between 0.8 and 16.3 dpa at temperatures of 250–300 °C. This behavior can be correlated with irradiation-induced changes in the microstructure. Most of the hardening can be attributed to dislocation loops, point defects or small precipitates as observed in boron-free alloys as F82H mod. and EUROFER97. Whereas the hardening in boron-containing alloys OPTIFER alloys and Ga3X can be correlated in addition with the combination of helium bubbles. At the highest irradiation and test temperature at 450 °C, all tensile data of all investigated materials were in the range of those of non-irradiated and irradiated material due to thermal aging effects.
Oxidation behavior of Al/Cr coating on Ti2AlNb alloy at 900 °C
Yang, Zhengang; Liang, Wenping; Miao, Qiang; Chen, Bowen; Ding, Zheng; Roy, Nipon
2018-04-01
In this paper, the Al/Cr coating was fabricated on the surface of Ti2AlNb alloy via rf magnetron sputtering and double glow treatment to enhance oxidation resistance. The protective coating with an outer layer of Al and inner layer of Cr has great bonding strength due to the in-diffusion of Cr and the inter-diffusion between Al and Cr to form Al-Cr alloyed layer which has great hardness. Acoustic emission curve which was detected via WS-2005 scratch tester indicates the bonding strength between Al/Cr coating and substrate is great. Morphology of Ti2AlNb alloy with Al/Cr coating after scratch test shows that the scratch is smooth without disbanding, and the depth and breadth of scratch are changed uniformly. The mass change was reduced after oxidation test due to the Al/Cr protective coating. Isothermal oxidation test at 900 °C was researched. Results indicate that Al/Cr coating provided oxidation resistance of Ti2AlNb alloy with prolonged air exposure at 900 °C. Al2O3 was detected by XRD patterns and SEM images, and was formed on the surface of Ti2AlNb alloy to protect substrate during oxidation test. A certain content of Cr is beneficial for the formation of Al2O3. Besides, Cr2O3 was produced under Al2O3 by outward diffusion of Cr to protect substrate sequentially, no cracks were discovered on Al/Cr protective coating. The process of Ti outward diffusion into surface was suppressive due to integration of Cr-Ti and Al-Ti intermetallics. A steady, adherent and continuous coated layer of Al/Cr on Ti2AlNb alloy increases oxidation resistance.
International Nuclear Information System (INIS)
Manenti, Simone; Alí Santoro, María del Carmen; Cotogno, Giulio; Duchemin, Charlotte; Haddad, Ferid; Holzwarth, Uwe; Groppi, Flavia
2017-01-01
Deuteron-induced nuclear reactions for the generation of 103 Pd were investigated using the stacked-foil activation technique on rhodium targets at deuteron energies up to E d = 33 MeV. The excitation functions of the reactions 103 Rh(d,xn) 101,103 Pd, 103 Rh(d,x) 100g,cum,101m,g,102m,g Rh and 103 Rh(d,2p) 103 Ru have been measured, and the Thick-Target Yield for 103 Pd has been calculated.
Swelling in neutron-irradiated titanium alloys
International Nuclear Information System (INIS)
Peterson, D.T.
1982-04-01
Immersion density measurements have been performed on a series of titanium alloys irradiated in EBR-II to a fluence of 5 x 10 22 n/cm 2 (E > 0.1 MeV) at 450 and 550 0 C. The materials irradiated were the near-alpha alloys Ti-6242S and Ti-5621S, the alpha-beta alloy Ti-64, and the beta alloy Ti-38644. Swelling was observed in all alloys with the greater swelling being observed at 550 0 C. Microstructural examination revealed the presence of voids in all alloys. Ti-38644 was found to be the most radiation resistant. Ti-6242S and Ti-5621S also displayed good radiation resistance, whereas considerable swelling and precipitation were observed in Ti-64 at 550 0 C
International Nuclear Information System (INIS)
Mirji, K.V.; Sheela; Saibaba, N.
2016-01-01
Nb master alloy, Zr2.5%Nb, Nb47%Ti, C-103, Nb1%Zr0.1%C, Nb5%Mo1%Zr0.1%C Nb10%W, Nb10%W2.5% Zr, Ta10%W etc. These alloys are produced by electron beam melting. Towards enhancement of melting capacity of the refractory and reactive metals and alloys, a collaborative programme has been taken up with BARC for indigenization of electron beam melting furnace of capacity 300 kW. The paper gives developments, details of parameters standardized and adopted at SMP/NFC along with the experience in production of refractory metals and their alloys. (author)
Magnetic studies of melt spun NdFeAl-C alloys
International Nuclear Information System (INIS)
Rodriguez Torres, C.E.; Cabrera, A.F.; Sanchez, F.H.; Billoni, O.V.; Urreta, S.E.; Fabietti, L.M.
2004-01-01
Alloys with compositions Nd 60-x C x Fe 30 Al 10 (x=0, 1, 5 and 10) were processed by melt spinning at a tangential speed of 5 m/s. The as-cast ribbons were characterized by X-ray diffraction, Moessbauer Effect spectroscopy and their room temperature hysteresis loops. The substitution of Nd by C is found to affect the phase selection, from mainly DHCP-Nd for x=0 to DHCP-Nd /FCC-Nd for the other ones. Moessbauer spectra of all the as-cast samples indicate that Fe is present in crystalline magnetic phases as well as in a paramagnetic one. The major crystalline phase was identified as a μ-type (or A1) metastable phase, which is reported to have a large anisotropy field and a relatively high saturation polarization. Interstitial C stabilizes the μ-type phase and improves its average hyperfine field. The magnetic measurements display an increase of coercivity and remanence with the C concentration
Energy Technology Data Exchange (ETDEWEB)
Diao, Yunhua, E-mail: 990722012@qq.com; Zhang, Kemin, E-mail: zhangkm@sues.edu.cn
2015-10-15
Highlights: • A TiC/TiB{sub 2} composite coating was produced onto a TC2 Ti alloy by laser cladding with Ti/TiC/TiB{sub 2} powders. • A maximum hardness of 1100 HV was achieved in the laser clad TiC/TiB{sub 2} composite layer. • Corrosion resistance of the TC2 alloy in NaCl (3.5 wt%) aqueous solution can be improved after laser cladding. - Abstract: In the present work, a TiC/TiB{sub 2} composite coating was produced onto a TC2 Ti alloy by laser cladding with Ti/TiC/TiB{sub 2} powders. The surface microstructure, phase components and compositions were characterized with methods of optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffractometry (XRD), and energy dispersive spectrometry (EDS). The cladding layer is consisted of Ti, TiC and TiB{sub 2}. And the surface microhardness was measured. After laser cladding, a maximum hardness of 1100 HV is achieved in the laser cladding surface layer, which is more three times higher than that of the TC2 substrate (∼300 HV). Due to the formation of TiC and TiB{sub 2} intermetallic compounds in the alloyed region and grain refinement, the microhardness of coating is higher than TC2 Ti alloy. In this paper, the corrosion property of matrix material and treated samples were both measured in NaCl (3.5 wt%) aqueous solution. From the result we can see that the laser cladding specimens’ corrosion property is clearly becoming better than that of the substrate.
Serbenta, V. A.; Skripnyak, N. V.; Skripnyak, V. A.; Skripnyak, E. G.
2017-12-01
This paper presents the results on the development of theoretical methods of evaluation and prediction of mechanical properties of Zr-Nb alloys over a range of strain rates from 10-3 to 103 s-1. The mechanical behavior of coarse- and ultrafine-grained Zr-1Nb (E110) was investigated numerically. The ranges of strain rates and temperatures in which the mechanical behavior of Zr-1Nb alloy can be described using modified models of Johnson-Cook and Zerilli-Armstrong were defined. The results can be used in engineering analysis of designed technical systems for nuclear reactors.
Pressure-induced structural change in liquid GaIn eutectic alloy
DEFF Research Database (Denmark)
Yu, Q.; Ahmad, A. S.; Ståhl, Kenny
2017-01-01
Synchrotron x-ray diffraction reveals a pressure induced crystallization at about 3.4 GPa and a polymorphic transition near 10.3 GPa when compressed a liquid GaIn eutectic alloy up to ~13 GPa at room temperature in a diamond anvil cell. Upon decompression, the high pressure crystalline phase...
Directory of Open Access Journals (Sweden)
Jakraphan Ninlachart
2017-06-01
Full Text Available Mg–Y–Nd alloy (WE43C or Elektron 43 is a heat treatable magnesium wrought alloy that can be used up to 250 °C for aerospace application. This alloy has excellent mechanical properties (UTS: up to 345 MPa at room temperature and improved corrosion resistance. Electrochemical passivation studies were conducted on this alloy under different heat treatment conditions in 0.1 M NaOH solution with the addition of chloride from 0 to 1000 ppm. The passive potential range typically extended to more than 1.5 VAg/AgCl. The transpassive potential was not dependent on the heat treatment condition of the alloy when the chloride concentration increased up to 500 ppm. However, pitting protection potential varied with the heat treatment condition when the chloride addition was 500 ppm or more. The specimen surface was analyzed using scanning electron microscopy (SEM, X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, and Raman spectroscopy to understand the passivation behavior of this alloy. The passivated surface of the WE43C specimens indicated that the surface layer consisted of MgO, Mg(OH2, and rare earth oxide phases, and the heat treatment conditions did not significantly affect the composition of the surface film.
Fe–Al–Mn–C lightweight structural alloys: a review on the microstructures and mechanical properties
Directory of Open Access Journals (Sweden)
Hansoo Kim, Dong-Woo Suh and Nack J Kim
2013-01-01
Full Text Available Adding a large amount of light elements such as aluminum to steels is not a new concept recalling that several Fe–Al–Mn–C alloys were patented in 1950s for replacement of nickel or chromium in corrosion resistance steels. However, the so-called lightweight steels or low-density steels were revisited recently, which is driven by demands from the industry where steel has served as a major structural material. Strengthening without loss of ductility has been a triumph in steel research, but lowering the density of steel by mixing with light elements will be another prospect that may support the competitiveness against emerging alternatives such as magnesium alloys. In this paper, we review recent studies on lightweight steels, emphasizing the concept of alloy design for microstructures and mechanical properties. The influence of alloying elements on the phase constituents, mechanical properties and the change of density is critically reviewed. Deformation mechanisms of various lightweight steels are discussed as well. This paper provides a reason why the success of lightweight steels is strongly dependent on scientific achievements even though alloy development is closely related to industrial applications. Finally, we summarize some of the main directions for future investigations necessary for vitalizing this field of interest.
Fe–Al–Mn–C lightweight structural alloys: a review on the microstructures and mechanical properties
Kim, Hansoo; Suh, Dong-Woo; Kim, Nack J
2013-01-01
Adding a large amount of light elements such as aluminum to steels is not a new concept recalling that several Fe–Al–Mn–C alloys were patented in 1950s for replacement of nickel or chromium in corrosion resistance steels. However, the so-called lightweight steels or low-density steels were revisited recently, which is driven by demands from the industry where steel has served as a major structural material. Strengthening without loss of ductility has been a triumph in steel research, but lowering the density of steel by mixing with light elements will be another prospect that may support the competitiveness against emerging alternatives such as magnesium alloys. In this paper, we review recent studies on lightweight steels, emphasizing the concept of alloy design for microstructures and mechanical properties. The influence of alloying elements on the phase constituents, mechanical properties and the change of density is critically reviewed. Deformation mechanisms of various lightweight steels are discussed as well. This paper provides a reason why the success of lightweight steels is strongly dependent on scientific achievements even though alloy development is closely related to industrial applications. Finally, we summarize some of the main directions for future investigations necessary for vitalizing this field of interest. PMID:27877553
Fe-Al-Mn-C lightweight structural alloys: a review on the microstructures and mechanical properties.
Kim, Hansoo; Suh, Dong-Woo; Kim, Nack J
2013-02-01
Adding a large amount of light elements such as aluminum to steels is not a new concept recalling that several Fe-Al-Mn-C alloys were patented in 1950s for replacement of nickel or chromium in corrosion resistance steels. However, the so-called lightweight steels or low-density steels were revisited recently, which is driven by demands from the industry where steel has served as a major structural material. Strengthening without loss of ductility has been a triumph in steel research, but lowering the density of steel by mixing with light elements will be another prospect that may support the competitiveness against emerging alternatives such as magnesium alloys. In this paper, we review recent studies on lightweight steels, emphasizing the concept of alloy design for microstructures and mechanical properties. The influence of alloying elements on the phase constituents, mechanical properties and the change of density is critically reviewed. Deformation mechanisms of various lightweight steels are discussed as well. This paper provides a reason why the success of lightweight steels is strongly dependent on scientific achievements even though alloy development is closely related to industrial applications. Finally, we summarize some of the main directions for future investigations necessary for vitalizing this field of interest.
OKMC study of the effect of grain boundaries in martensitic Fe-Cr-C alloys
International Nuclear Information System (INIS)
Chiapetto, M.; Becquart, C.S.; Malerba, L.
2015-01-01
Fe-Cr-C alloys with chromium concentrations in the range from about 2 wt % to 12 wt % form ferritic-martensitic structures by rapid cooling from the austenite state already in the presence of relatively low carbon concentrations. In this process it is possible to obtain different ratios of ferrite and martensite, as well as formation of carbides, by varying the thermal treatment. The presence of ferrite or martensite might have an influence on the nano-structural evolution under irradiation of these alloys. Here, considering a tempered martensite reference alloy with 9% Cr, we make use of an already validated object kinetic Monte Carlo (OKMC) model in order to study the possible effect of the formation of martensite laths on the material nano-structural evolution under neutron irradiation, assuming that the relevant boundaries act as sinks for radiation defects. The results show that the reduction of the grain size (including in this definition the average size of prior austenite grains, blocks and laths) does not play any relevant role until sizes of the order of about 0.5 μm are reached: for smaller grains the number of defects being absorbed by the boundaries becomes dominant. However, this threshold is lower than the experimentally observed martensite lath dimensions, thereby suggesting that what makes the difference in martensitic Fe-Cr-C alloys with respect to ferrite concerning events and mechanisms taking place during irradiation are not the lath boundaries as sinks. Differences between the nano-structural evolution in ferrite and martensite should therefore be ascribed to other factors. This document is composed of an article and the presentation slides. (authors)
Liu, B; Zheng, Y F
2011-03-01
Pure iron was determined to be a valid candidate material for biodegradable metallic stents in recent animal tests; however, a much faster degradation rate in physiological environments was desired. C, Mn, Si, P, S, B, Cr, Ni, Pb, Mo, Al, Ti, Cu, Co, V and W are common alloying elements in industrial steels, with Cr, Ni, Mo, Cu, Ti, V and Si being acknowledged as beneficial in enhancing the corrosion resistance of iron. The purpose of the present work (using Fe-X binary alloy models) is to explore the effect of the remaining alloying elements (Mn, Co, Al, W, B, C and S) and one detrimental impurity element Sn on the biodegradability and biocompatibility of pure iron by scanning electron microscopy, X-ray diffraction, metallographic observation, tensile testing, microhardness testing, electrochemical testing, static (for 6 months) and dynamic (for 1 month with various dissolved oxygen concentrations) immersion testing, cytotoxicity testing, hemolysis and platelet adhesion testing. The results showed that the addition of all alloying elements except for Sn improved the mechanical properties of iron after rolling. Localized corrosion of Fe-X binary alloys was observed in both static and dynamic immersion tests. Except for the Fe-Mn alloy, which showed a significant decrease in corrosion rate, the other Fe-X binary alloy corrosion rates were close to that of pure iron. It was found that compared with pure iron all Fe-X binary alloys decreased the viability of the L929 cell line, none of experimental alloying elements significantly reduced the viability of vascular smooth muscle cells and all the elements except for Mn increased the viability of the ECV304 cell line. The hemolysis percentage of all Fe-X binary alloy models were less than 5%, and no sign of thrombogenicity was observed. In vitro corrosion and the biological behavior of these Fe-X binary alloys are discussed and a corresponding mechanism of corrosion of Fe-X binary alloys in Hank's solution proposed. As a
Energy Technology Data Exchange (ETDEWEB)
Chauhan, Mamta, E-mail: mamta-physics@yahoo.co.in; Gupta, Dinesh C., E-mail: sosfizix@gmail.com [Condensed Matter Theory Group, School of Studies in Physics, Jiwaji University, Gwalior – 474 011(India)
2016-05-06
The formation energy, equilibrium lattice parameter, bulk modulus, Debye temperature and heat capacity at constant volume have been calculated for TiC, ZrC, and their intermediate alloys (Ti{sub 1-x}Zr{sub x}C, x = 0,0.25.0.5,0.75,1) using first principles approach. The calculated values of lattice parameter and bulk modulus agree well with the available experimental and earlier theoretical reports. The variation of lattice parameter and bulk modulus with the change in concentration of Zr atom in Ti{sub 1-x}Zr{sub x}C has also been reported. The heat capacities of TiC, ZrC, and their intermediate alloys have been calculated by considering both vibrational and electronic contributions.
2010-01-01
... not disabled for the position in question to the Merit Systems Protection Board under 5 U.S.C. 7701... EMPLOYEES' RETIREMENT SYSTEM-DISABILITY RETIREMENT General Provisions § 844.103 Eligibility. (a) Except as..., resulting in a deficiency in performance, conduct, or attendance, or if there is no such deficiency, the...
Energy Technology Data Exchange (ETDEWEB)
Perez, E., E-mail: Emmanuel.Perez@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Keiser, D.D., E-mail: dennis.keiser@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Sohn, Y.H., E-mail: yongho.sohn@ucf.edu [Department of Materials Science and Engineering, University of Central Florida, 4000 Central Florida Blvd., Orlando, FL 32816 (United States)
2016-08-15
The U.S. Material Management and Minimization Reactor Conversion Program is developing low enrichment fuel systems encased in Al-alloy for use in research and test reactors. Monolithic fuel plates have local regions where the U−Mo fuel plate may come into contact with the Al-alloy 6061 (AA6061) cladding. This results in the development of interdiffusion zones with complex microstructures with multiple phases. In this study, the microstructural development of diffusion couples, U−7 wt%Mo, U−10 wt%Mo, and U−12 wt%Mo vs. AA6061, annealed at 600 °C for 24 h and at 550 °C for 1, 5, and 20 h, were analyzed by scanning electron microscopy with x-ray energy dispersive spectroscopy. The microstructural development and kinetics were compared to diffusion couples U−Mo vs. high purity Al and binary Al−Si alloys. The diffusion couples developed complex interaction regions where phase development was influenced by the alloying additions of the AA6061. - Highlights: • Diffusion couples of U−7Mo, U−10Mo, and U−12Mo vs. AA6061 were analyzed by SEM with XEDS. • The couples were annealed at 600 °C for 24 h and at 550 °C for 1, 5 and 20 h. • The interaction regions were more complex than those in diffusion couples of U−Mo vs. high purity Al and Al−Si alloys. • Analysis showed that the alloying additions of the AA6061 were present in the interaction regions. • Phase development was significantly influenced by the alloying additions of the AA6061.
International Nuclear Information System (INIS)
Bernshtejn, L.M.; Zakharov, A.M.; Arbuzov, V.K.
1977-01-01
Change in mechanical properties of hardened low-alloyed molybdenum alloys (Mo-Zr-C and Mo-Zr-Nb-C) at two-stage strengthening during ageing at 1400 deg C is studied. The initial strengthening maximum following ageing for 5 hr is caused by separation of dispersed ZrC particles and is accompanied by worsened plasticity, a development characteristic of precipitation hardening processes. The second increase in strength after a 10-hr ageing is not accompanied by reduced plasticity, this being characteristic of strengthening as a result of reconstruction of the dislocation structure. Niobium (0.16 wt.%) added to Mo-Zr-C alloys simultaneously increases their plastic and strength properties. The said effect is caused by prevention of premature decomposition of alloys on account of increased low-temperature plasticity, which permits to obtain high resistance to plastic deformation
International Nuclear Information System (INIS)
Zakharova, M.I.; Khundzhua, A.K.; Kertesz, L.; Szasz, A.
1981-01-01
Changes in the crystal structure of the titanium alloy, containing 6.7 at% Mo, 3 at% Zr, and 1.8 at% Sn, during thermal decomposition are followed by means of X-ray and electron diffraction methods. Parallel to these tests the alteration in the electron structure and chemical bonds of the alloy are investigated with the help of the soft-x-ray emission (SXES) method. Attention is focussed on the at room temperature not equilibrated b.c.c. β-solid solution, on the metastable transition phase ω, and on the equilibrium phase α. (author)
Effect of Various SPD Techniques on Structure and Superplastic Deformation of Two Phase MgLiAl Alloy
Dutkiewicz, Jan; Bobrowski, Piotr; Rusz, Stanislav; Hilser, Ondrej; Tański, Tomasz A.; Borek, Wojciech; Łagoda, Marek; Ostachowski, Paweł; Pałka, Paweł; Boczkal, Grzegorz; Kuc, Dariusz; Mikuszewski, Tomasz
2018-03-01
MgLiAl alloy containing 9 wt% Li and 1.5% Al composed of hexagonal α and bcc β phases was cast under protecting atmosphere and hot extruded. Various methods of severe plastic deformation were applied to study their effect on structure and grain refinement. Rods were subjected to 1-3 passes of Twist Channel Angular Pressing TCAP (with helical component), cyclic compression to total strain ɛ = 5 using MAXStrain Gleeble equipment, both performed at temperature interval 160-200 °C and, as third SPD method, KOBO type extrusion at RT. The TCAP pass resulted in grain refinement of α phase from 30 μm down to about 2 μm and that of β phase from 12 to 5 μm. Maxstrain cycling 10 × up to ɛ = 5 led to much finer grain size of 300 nm. KOBO method performed at RT caused average grain size refinement of α and β phases down to about 1 μm. Hardness of alloy decreased slightly with increasing number of TCAP passes due to increase of small void density. It was higher after MAXStrain cycling and after KOBO extrusion. TEM studies after TCAP passes showed higher dislocation density in the β region than in the α phase. Crystallographic relationship (001) α|| (110) β indicated parallel positioning of slip planes of both phases. Electron diffraction technique confirmed increase of grain misorientation with number of TCAP passes. Stress/strain curves recorded at temperature 200 °C showed superplastic forming after 1st and 3rd TCAP passes with better superplastic properties due to higher elongation with increasing number of passes. Values of strain rate sensitivity coefficient m were calculated at 0.29 after 3rd TCAP pass for strain rate range 10-5 to 5 × 10-3 s-1. Deformation by MAXStrain cycling caused much more effective grain refinement with fine microtwins in α phase. Superplastic deformation was also observed in alloy deformed by KOBO method, however the value of m = 0.21 was obtained at lower temperature of deformation equal to 160 °C and deformation rate in the
Alyaldin, Loay
In recent years, aluminum and aluminum alloys have been widely used in automotive and aerospace industries. Among the most commonly used cast aluminum alloys are those belonging to the Al-Si system. Due to their mechanical properties, light weight, excellent castability and corrosion resistance, these alloys are primarily used in engineering and in automotive applications. The more aluminum is used in the production of a vehicle, the less the weight of the vehicle, and the less fuel it consumes, thereby reducing the amount of harmful emissions into the atmosphere. The principal alloying elements in Al-Si alloys, in addition to silicon, are magnesium and copper which, through the formation of Al2Cu and Mg2Si precipitates, improve the alloy strength via precipitation hardening following heat treatment. However, most Al-Si alloys are not suitable for high temperature applications because their tensile and fatigue strengths are not as high as desired in the temperature range 230-350°C, which are the temperatures that are often attained in automotive engine components under actual service conditions. The main challenge lies in the fact that the strength of heat-treatable cast aluminum alloys decreases at temperatures above 200°C. The strength of alloys under high temperature conditions is improved by obtaining a microstructure containing thermally stable and coarsening-resistant intermetallics, which may be achieved with the addition of Ni. Zr and Sc. Nickel leads to the formation of nickel aluminide Al3Ni and Al 9FeNi in the presence of iron, while zirconium forms Al3Zr. These intermetallics improve the high temperature strength of Al-Si alloys. Some interesting improvements have been achieved by modifying the composition of the base alloy with additions of Mn, resulting in an increase in strength and ductility at both room and high temperatures. Al-Si-Cu-Mg alloys such as the 354 (Al-9wt%Si-1.8wt%Cu-0.5wt%Mg) alloys show a greater response to heat treatment as a
Energy Technology Data Exchange (ETDEWEB)
Roy, Marion, E-mail: marion.roy@cea.fr [CEA, DEN, DPC, SCCME, Laboratoire d’Etude de la Corrosion Non Aqueuse, F-91191 Gif-sur-Yvette (France); Martinelli, Laure, E-mail: laure.martinelli@cea.fr [CEA, DEN, DPC, SCCME, Laboratoire d’Etude de la Corrosion Non Aqueuse, F-91191 Gif-sur-Yvette (France); Ginestar, Kevin, E-mail: kevin.ginestar@cea.fr [CEA, DEN, DPC, SCCME, Laboratoire d’Etude de la Corrosion Non Aqueuse, F-91191 Gif-sur-Yvette (France); Favergeon, Jérôme, E-mail: jerome.favergeon@utc.fr [Laboratoire Roberval, UMR 7337, Université de Technologie de Compiègne, Centre de Recherche de Royallieu, CS 60319, 60203 Compiègne Cedex (France); Moulin, Gérard [Laboratoire Roberval, UMR 7337, Université de Technologie de Compiègne, Centre de Recherche de Royallieu, CS 60319, 60203 Compiègne Cedex (France)
2016-01-15
Ten austenitic steels and Ni rich alloys were tested in static lead-bismuth eutectic (LBE) at 520 °C in order to obtain a selection of austenitic steels having promising corrosion behaviour in LBE. A test of 1850 h was carried out with a dissolved oxygen concentration between 10{sup −9} and 5 10{sup −4} g kg{sup −1}. The combination of thermodynamic of the studied system and literature results leads to the determination of an expression of the dissolved oxygen content in LBE as a function of temperature: RT(K)ln[O](wt%) = −57584/T(K) −55.876T(K) + 254546 (R is the gas constant in J mol{sup −1} K{sup −1}). This relation can be considered as a threshold of oxygen content above which only oxidation is observed on the AISI 316L and AISI 304L austenitic alloys in static LBE between 400 °C and 600 °C. The oxygen content during the test leads to both dissolution and oxidation of the samples during the first 190 h and leads to pure oxidation for the rest of the test. Results of mixed oxidation and dissolution test showed that only four types of corrosion behaviour were observed: usual austenitic steels and Ni rich alloys behaviour including the reference alloy 17Cr-12Ni-2.5Mo (AISI 316LN), the 20Cr-31Ni alloy one, the Si containing alloy one and the Al containing alloy one. According to the proposed criteria of oxidation and dissolution kinetics, silicon rich alloys and aluminum rich alloy presented a promising corrosion behaviour. - Highlights: • 10 austenitic steels and Ni rich alloys were tested in LBE at 520 °C with dissolved oxygen content between 10{sup -9} and 5 10{sup -4} wt%. • It is shown that only thermodynamics cannot explain the Ni rich alloys corrosion behaviour in LBE. • The role of oxygen on corrosion behaviour in LBE was highlighted. • An equilibrium line was defined above which only oxidation has occurred on 316L: RTln[O](wt%) = -57584/T(K)-55.876T(K)+254546. • 18Cr-15Ni-3.7Si, 21Cr-11Ni-1.6Si and 14Cr-25Ni-3.5Al
International Nuclear Information System (INIS)
Clauss, T.W.; Ligotke, M.W.; McVeety, B.D.; Lucke, R.B.; Young, J.S.; McCulloch, M.; Fruchter, J.S.; Goheen, S.C.
1995-06-01
This report describes organic analyses results from ambient samples collected both upwind and through the vapor sampling system (VSS) near Hanford waste storage Tank 241-C-103 (referred to as Tank C-103). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed. Quantitative results were obtained for organic compounds. Five organic tentatively identified compounds (TICS) were observed above the detection limit of (ca.) 10 ppbv, but standards for most of these were not available at the time of analysis, and the reported concentrations are semiquantitative estimates. In addition, we looked for the 40 standard TO-14 analytes. We observed 39. Of these, only one was observed above the 2-ppbv calibrated instrument detection limit. Dichloromethane was above the detection limits using both methods, but the result from the TO-14 method is traceable to a standard gas mixture and is considered more accurate. Organic analytes were found only in the sample collected through the VSS, suggesting that these compounds were residual contamination from a previous sampling job. Detailed descriptions of the results appear in the text
Shape memory alloy-based small crawling robots inspired by C. elegans
Energy Technology Data Exchange (ETDEWEB)
Yuk, Hyunwoo; Kim, Daeyeon; Shin, Jennifer H [Department of Mechanical Engineering, Korea Advanced Institute of Science and Technology, 291 Daehak-ro, Yuseong-gu, Daejeon (Korea, Republic of); Lee, Honggu; Jo, Sungho, E-mail: shjo@kaist.ac.kr, E-mail: j_shin@kaist.ac.kr [Department of Computer Science, Korea Advanced Institute of Science and Technology, 291 Daehak-ro, Yuseong-gu, Daejeon (Korea, Republic of)
2011-12-15
Inspired by its simple musculature, actuation and motion mechanisms, we have developed a small crawling robot that closely mimics the model organism of our choice: Caenorhabditis elegans. A thermal shape memory alloy (SMA) was selected as an actuator due to the similarities of its properties to C. elegans muscles. Based on the anatomy of C. elegans, a 12-unit robot was designed to generate a sinusoidal undulating motion. Each body unit consisting of a pair of SMA actuators is serially connected by rigid links with an embedded motion control circuit. A simple binary operation-based motion control mechanism was implemented using a microcontroller. The assembled robot can execute C. elegans-like motion with a 0.17 Hz undulation frequency. Its motion is comparable to that of a real worm.
Lang, Shaoting; Yan, Qingzhi; Sun, Ningbo; Zhang, Xiaoxin; Ge, Changchun
2017-10-01
Two kinds of W-0.5 wt.%TiC alloys were prepared, one by ball milling and the other by the wet chemical method. For comparison, pure tungsten powders were chemically prepared and sintered by the same process. The microstructures, mechanical properties and thermal conductivities of the prepared samples were characterized. It has been found that the wet chemical method resulted in finer sizes and more uniform distribution of TiC particles in the sintered tungsten matrix than the ball milling method. The W-TiC alloy prepared by the wet chemical method achieved the highest bending strength (1065.72 MPa) among the samples. Further, it also exhibited obviously higher thermal conductivities in the temperature range of room temperature to 600°C than did the W-TiC alloy prepared by ball milling, but the differences in their thermal conductivities could be ignored in the range of 600-800°C.
The synthesis and characterization of W- 1wt. % TiC alloy using a chemical method
Energy Technology Data Exchange (ETDEWEB)
Kim, Tae Hee; Ryu, Ho Jin [KAIST, Daejeon (Korea, Republic of)
2016-05-15
Many studies have demonstrated the dispersed second phase nanoparticles in the tungsten matrix inhibit the grain growth and recrystallization, besides they improve the ductility and the irradiation resistance by hindering grain boundary sliding and stabilizing the microstructure.7 La{sub 2}O{sub 3}, Y{sub 2}O{sub 3}, TiC or ZrC particles are usually added to tungsten. However, some crucial issues should be solved such as the uniform distribution of these second phase particles and the industrial mass production. By using typical mechanical alloying and powder metallurgy, nanoparticles tend to be agglomerated and concentrated at the grain boundaries due to the high surface energies introduced. Moreover, the milling process often produces detrimental phase by the wear of the milling equipment and media. Xia et al. have firstly reported core-shell structured W/TiC using ammonium metatungstate ((NH{sub 4}){sub 6}W{sub 7}O{sub 24}·XH{sub 2}O, AMT) and hydrochloric acid. Nano-sized TiC particles are coated uniformly by AMT precipitation formed by the addition of hydrochloric acid to the AMT solution. The core-shell structure particles were examined by TEM. To achieve uniform distribution of TiC nanoparticles, a wet chemical method is essential rather than typical mechanical alloying. Also, the use of the chemical method of alloying can be easily applied to the industry with cost-effective and environmental benefits. The purpose of this study is to achieve uniform distribution of TiC nano-particles within the tungsten matrix, as the literature has studied. Moreover, the chemical methods could be applied to other refectory metals such as molybdenum. The obtained powder was reduced and sintered using SPS technique. The relative density of sintered sample achieved was 97%. Furthermore, the microstructure of the sintered sample was analyzed using FE-SEM and the presence of TiC particles at the grain boundary and grain interior was confirmed by EDS.
Directory of Open Access Journals (Sweden)
Felipe García-Vázquez
Full Text Available Abstract: Aluminum alloys are very promising for structural applications in aerospace, military and transportation industries due to their light weight, high strength-to-weight ratio and excellent resistance to corrosion. In comparison to unreinforced aluminum alloys, aluminum/aluminum alloy matrix composites reinforced with ceramic phases exhibit higher strength and hardness, improved tribological characteristics. A novel surface modifying technique, friction stir processing (FSP, has been developed for fabrication of surface composite with an improved performance. The effect of FSP parameters such as number of passes, direction of each pass, sealed or unsealed groove on microstructure was investigated. In this work, nano-particles of TiC (2% in weight were added to aluminum alloy AA7075-T651 to produce a functional surface. Fixed parameters for this AA7075 alloy were used; rotation speed of 1000 rpm, travel speed of 300 mm/min and pin penetration of 2.8 mm. Optical microscopy (OM, scanning electron microscopy (SEM and atomic force microscopy (AFM were employed to study the microstructure of the fabricated surface composites. The results indicated that the selected FSP parameters influenced the area of surface composite, distribution of TiC particles and micro-hardness of the surface composites. Finally, in order to evaluate rate wear the pin on disk test was carried out.
Impact toughness of laser alloyed aluminium AA1200 alloys
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2013-08-01
Full Text Available ),. 559-563. [2] T. Tomida, K. Nakata, S. Saji, T. Kubo, T, Formation of metal matrix composite layer on aluminium alloy with TiC-Cu powder by laser surface alloying process; Surface and Coatings Technology; vol. 142-144, 2001, 585-589. [3] L. A. B...
Influence of trace boron on the morphology of titanium carbide in an Al-Ti-C-B master alloy
International Nuclear Information System (INIS)
Nie Jinfeng; Liu Xiangfa; Ma Xiaoguang
2010-01-01
The influence of trace B (boron) element on the morphology of TiC crystals in an Al-Ti-C-B master alloy prepared by a melt reaction method has been investigated in this paper. The morphology and chemical composition of TiC crystals are characterized from X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM), energy dispersion spectroscopy (EDS), transmission electron microscopy (TEM) and selected area electron diffraction (SAED) analyses. It is found that both TiC hexagonal platelet and TiC polyhedron have formed in the Al-Ti-C-B master alloy. Furthermore, a trace amount of B element is found in TiC hexagonal platelets evidenced by the EDS spectrum. However, the SAED pattern confirms that the crystal structure of TiC has not changed. The formation and growth mechanism of the TiC hexagonal platelet have been discussed. It is considered that the trace B element in the aluminum melt promotes the transformation of TiC from polyhedron to hexagonal platelet at the initial growth stage.
Phase relationship in AL-Cu-Sc alloys at 450-500 deg C
International Nuclear Information System (INIS)
Kharakterova, M.L.
1991-01-01
Al-Cu-Sc alloys containing up to 40% Cu and up to 6% Sc at 450 deg C and 500 deg C are studied using light microscopy, X-ray-spectral microanalysis, X-ray diffraction analysis, scanning electron microscopy, measurement of microhardness and electric resistance. It is determined, that in equilibrium with aluminium solid solution under the given temperature ther are Al 3 Sc, CuAl 2 phases of the respective binary systems and W (ScCu 6.6-4 Al 5.4-8 ) ternary phase. Isothermal cross sections of Al-Cu-Sc system at 450 and 500 deg C are plotted. Microhardness of equilibrium phases is measured. Combined solubility of copper and scandium in aluminium is determined
8 CFR 103.24 - Requests for accounting of record disclosure.
2010-01-01
... REGULATIONS POWERS AND DUTIES; AVAILABILITY OF RECORDS § 103.24 Requests for accounting of record disclosure... an accounting of disclosures made of his record outside the Department of Justice. Requests for... relates to: (a) A disclosure with respect to which no accounting need be kept (see § 103.30(c) of this...
High strain rate deformation and fracture of the magnesium alloy Ma2-1 under shock wave loading
Garkushin, G. V.; Kanel', G. I.; Razorenov, S. V.
2012-05-01
This paper presents the results of measurements of the dynamic elastic limit and spall strength under shock wave loading of specimens of the magnesium alloy Ma2-1 with a thickness ranging from 0.25 to 10 mm at normal and elevated (to 550°C) temperatures. From the results of measurements of the decay of the elastic precursor of a shock compression wave, it has been found that the plastic strain rate behind the front of the elastic precursor decreases from 2 × 105 s-1 at a distance of 0.25 mm to 103 s-1 at a distance of 10 mm. The plastic strain rate in a shock wave is one order of magnitude higher than that in the elastic precursor at the same value of the shear stress. The spall strength of the alloy decreases as the solidus temperature is approached.
Kunwar, Sundar; Pandey, Puran; Sui, Mao; Bastola, Sushil; Lee, Jihoon
2018-06-01
In this work, a systematic study on the fabrication of ternary AgPdAu alloy nanoparticles (NPs) on c-plane sapphire (0001) is presented and the corresponding structural and optical characteristics are demonstrated. The metallic trilayers of various thicknesses and deposition orders are annealed in a controlled manner (400 °C to 900 °C) to induce the solid-state dewetting that yields the various structural configurations of AgPdAu alloy NPs. The dewetting of relatively thicker trilayers (15 nm) is gradually progressed with void nucleation, growth, and coalescence, isolated NP formation, and shape transformation, along with the temperature control. For 6 nm thickness, owing to the sufficient dewetting of trilayers along with enhanced diffusion, dense and small spherical alloy NPs are fabricated. Depending on the specific growth condition, the surface diffusion and interdiffusion of metal atoms, surface and interface energy minimization, Rayleigh instability, and equilibrium configuration are correlated to describe the fabrication of ternary alloy NPs. Ternary alloy NPs exhibit morphology-dependent ultraviolet-visible-near infrared (UV-VIS-NIR) reflectance properties such as the inverse relationship of average reflectance with the surface coverage, absorption enhancement in specific regions, and reflectance maxima in UV and NIR regions. In addition, Raman spectra depict the six active phonon modes of sapphires and their intensity and position modulation by the alloy NPs.
Clean Grain Boundary Found in C14/Body-Center-Cubic Multi-Phase Metal Hydride Alloys
Directory of Open Access Journals (Sweden)
Hao-Ting Shen
2016-06-01
Full Text Available The grain boundaries of three Laves phase-related body-center-cubic (bcc solid-solution, metal hydride (MH alloys with different phase abundances were closely examined by scanning electron microscopy (SEM, transmission electron microscopy (TEM, and more importantly, electron backscatter diffraction (EBSD techniques. By using EBSD, we were able to identify the alignment of the crystallographic orientations of the three major phases in the alloys (C14, bcc, and B2 structures. This finding confirms the presence of crystallographically sharp interfaces between neighboring phases, which is a basic assumption for synergetic effects in a multi-phase MH system.
High-temperature deformation of a mechanically alloyed niobium-yttria alloy
International Nuclear Information System (INIS)
Chou, I.; Koss, D.A.; Howell, P.R.; Ramani, A.S.
1997-01-01
Mechanical alloying (MA) and hot isostatic pressing have been used to process two Nb alloys containing yttria particles, Nb-2 vol.%Y 2 O 3 and Nb-10 vol.%Y 2 O 3 . Similar to some thermomechanically processed nickel-based alloys, both alloys exhibit partially recrystallized microstructures, consisting of a 'necklace' of small recrystallized grains surrounding much larger but isolated, unrecrystallized, cold-worked grains. Hot compression tests from 1049 to 1347 C (0.5-0.6T MP ) of the 10% Y 2 O 3 alloy show that MA material possesses a much higher yield and creep strength than its powder-blended, fully recrystallized counterpart. In fact, the density-compensated specific yield strength of the MA Nb-10Y 2 O 3 exceeds that of currently available commercial Nb alloys. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Behera, A.N. [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Homi Bhabha National Institute, Anushakti Nagar, Mumbai 400094 (India); Kapoor, R., E-mail: rkapoor@barc.gov.in [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Homi Bhabha National Institute, Anushakti Nagar, Mumbai 400094 (India); Paul, B. [Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Chakravartty, J.K. [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)
2017-04-15
Uniaxial compression tests were carried out on Nb-1 wt%Zr-0.1 wt%C alloy at temperature of 1500 and 1600 °C and strain rate of 0.1 s{sup −1} to study the evolution of dynamic recrystallization with strain. Electron back scatter diffraction was used to quantify the microstructural evolution. Nb-1Zr-0.1C alloy showed a necklace structure at a strain of 0.9 when deformed at 1500 °C and at strain of 0.6 when deformed at 1600 °C, both at strain rate of 0.1 s{sup −1}. This suggested the occurrence of dynamic recrystallization. At 1500 °C and strain of 0.9 the local average misorientation and the grain orientation spread was low confirming the presence of dynamic recrystallization at this deformation condition. At both 1500 and 1600 °C and all measured strains the recrystallized grains had a strong fiber component of <001>. - Highlights: • Necklace formation of dynamically recrystallized grains occurred at strain of 0.6 and 0.9 for 1500 and 1600 °C, respectively. • Equiaxed microstructures were seen with increase in strain for both 1500 and 1600 °C. • At large strains the predominant recrystallized texture evolved to <001> pole.
International Nuclear Information System (INIS)
Tomlinson, W.J.; Gardner, M.J.; Kowalski, R.J.
1977-01-01
The spalling behaviour of scales on Ni-Fe alloys containing 0, 2, 10, 20, 30, 40, 50 and 60% Fe oxidized in air at 900, 1000, 1100 and 1200 0 C for periods up to 165 h have been investigated. The phases present and their relative amounts in the scales formed at 1200 0 C have been determined. Spalling was most severe in the Ni-30% Fe alloy, which had a scale consisting of 30% Nisub(x)Fesub(3-x)O 4 and 70% Nisub(1-x)Fesub(x)O. (author)
Development of [103Pd]-2-acetylpyridine 4N-methyl thiosemicarbazone complex for targeted therapy
International Nuclear Information System (INIS)
Jalilian, A.R.; Sadeghi, M.; Yari-Kamrani, Y.; Ensaf, M.R.
2006-01-01
Due to interesting biological properties of palladium-thiosemicarbazono complexes, production of a 103 Pd-labeled anti-cancer complex, i.e., [ 103 Pd]-2-acetylpyridine 4 N-methylthiosemicarbazone ([ 103 Pd]-APMTS) was developed. Palladium-103 (T 1/2 = 16.96 d) produced via the 103 Rh(p,n) 103 Pd nuclear reaction using natural rhodium target, was separated from the irradiated target material. Proton energy was 18 MeV with 200 μA irradiation for 15 hours (final activity 700 mCi of 103 Pd 2+ , RCY>95%, radionuclidic purity>99%). The final activity was eluted in form of Pd(NH 3 ) 2 Cl 2 in order to react with 2-acetylpyridine- 4 N-methylthiosemicarbazone to yield [ 103 Pd]-APMTS. Chemical purity of the final product was confirmed to be within the accepted limits by polarography. [ 103 Pd]-APMTS was prepared with a radiochemical yield of more than 80% at room temperature after 3 hours. The labeling reaction was optimized for time, temperature and radioactivity and ligand ratio. A mixture of APMTS and Pd activity in ethanol was heated at 90 deg C for 3 hours followed by reverse phase SPE purification using C 18 plus Sep-Pak. Radiochemical purity of more than 99% using RTLC and specific activity of about 12500 Ci/mol was obtained. The stability of the tracer was checked in the final product and the presence of human serum at 37 deg C up to 3 hours. The partition coefficient of the final complex was determined by octanol:saline buffer distribution. (author)
Phase formation in alloy-type anode materials in the quaternary system Li-Sn-Si-C
Energy Technology Data Exchange (ETDEWEB)
Druee, Martin; Seyring, Martin [Jena Univ. (Germany). Otto Schott Inst. of Materials Research; Liang, Song-Mao; Kozlov, Artem; Schmid-Fetzer, Rainer [Clausthal Univ. of Technology, Clausthal-Zellerfeld (Germany). Inst. of Metallurgy; Song, Xiaoyan [Beijing Univ. of Technology (China). Key Lab. of Advanced Functional Materials; Rettenmayr, Markus [Jena Univ. (Germany). Otto Schott Inst. of Materials Research; Jena Univ. (Germany). Center for Energy and Environmental
2017-11-15
Investigations on the thermodynamics of alloy-type anode materials have been carried out for the quaternary Li-C-Si-Sn system. Phase equilibria and phase stabilities were characterized in the binary subsystems Li-C, Li-Si, Li-Sn. The Calphad method was first used to optimize or completely re-establish all binary subsystems containing Li. For reasons of consistency, the binary subsystem Si-C had to be revisited and its Calphad description was modified. The ternary phase diagrams were then tentatively calculated by extrapolation from the binary subsystems and confirmed by key experiments. No ternary compounds were found. In order to verify the applicability of the anode materials in real batteries, some of the materials were nanostructured by ball milling and spark plasma sintering, the corresponding nanostructures were characterized. Theoretical predictions that nanograined Li{sub 2}C{sub 2} can also be used as cathode material were verified experimentally. The methodologies worked out in the present project (e.g. nanoscale structure transmission electron microscopy analysis, glow discharge optical emission spectroscopy) were also employed in other projects and led to publications concerning other materials such as Mg alloys, carbon nanofibers and an Mn-based antiperovskite.
Fretting wear behavior of zirconium alloy in B-Li water at 300 °C
Zhang, Lefu; Lai, Ping; Liu, Qingdong; Zeng, Qifeng; Lu, Junqiang; Guo, Xianglong
2018-02-01
The tangential fretting wear of three kinds of zirconium alloys tube mated with 304 stainless steel (SS) plate was investigated. The tests were conducted in an autoclave containing 300 °C pressurized B-Li water for tube-on-plate contact configuration. The worn surfaces were examined with scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS) and 3D microscopy. The cross-section of wear scar was examined with transmission electron microscope (TEM). The results indicated that the dominant wear mechanism of zirconium alloys in this test condition was delamination and oxidation. The oxide layer on the fretted area consists of outer oxide layer composed of iron oxide and zirconium oxide and inner oxide layer composed of zirconium oxide.
Formation of nanocrystalline TiC from titanium and different carbon sources by mechanical alloying
Energy Technology Data Exchange (ETDEWEB)
Jia Haoling [Key Lab of Liquid Structure and Heredity of Materials, Jingshi Road 73, Jinan 250061, Shandong (China); Zhang Zhonghua [Key Lab of Liquid Structure and Heredity of Materials, Jingshi Road 73, Jinan 250061, Shandong (China)], E-mail: zh_zhang@sdu.edu.cn; Qi Zhen [Key Lab of Liquid Structure and Heredity of Materials, Jingshi Road 73, Jinan 250061, Shandong (China); Liu Guodong [School of Materials Science and Engineering, Shandong University, Jingshi Road 73, Jinan 250061 (China); Bian Xiufang [Key Lab of Liquid Structure and Heredity of Materials, Jingshi Road 73, Jinan 250061, Shandong (China)
2009-03-20
In this paper, the formation of nanocrystalline TiC from titanium powders and different carbon resources by mechanical alloying (MA) has been investigated using X-ray diffraction (XRD), scanning electron microscopy (SEM), and transmission electron microscopy (TEM). The experimental results show that nanocrystalline TiC can be synthesized from Ti powders and different carbon resources (activated carbon, carbon fibres or carbon nanotubes) by MA at room temperature. Titanium and different carbon resources have a significant effect on the Ti-C reaction and the formation of TiC during MA. Moreover, the formation of nanocrystalline TiC is governed by a gradual diffusion reaction mechanism during MA, regardless of different carbon resources.
Energy Technology Data Exchange (ETDEWEB)
Torbati-Sarraf, S.A. [School of Metallurgical and Materials Engineering, University of Tehran, Tehran (Iran, Islamic Republic of); Mahmudi, R., E-mail: mahmudi@ut.ac.ir [School of Metallurgical and Materials Engineering, University of Tehran, Tehran (Iran, Islamic Republic of)
2010-06-15
Different amounts of Al-3Ti-0.15C master alloy (TiCAl), as grain refiner, were added to the AZ31 magnesium alloy (Mg-3Al-1Zn-0.3Mn) and the resulting microstructure, grain size distributions, texture, and mechanical properties were studied after extrusion and equal channel angular pressing (ECAP). Results showed that the addition of 1.0 wt.% TiCAl had the strongest grain refinement effect, reducing the grain sizes by 51.2 and 38.4% in the extruded and ECAPed conditions, respectively. The observed grain refinement was in part due to the presence of the thermally stable micron- and submicron-sized particles in the melt which act as nucleation sites during solidification. During the high-temperature extrusion and ECAP processes, dynamic recrystallization (DRX) and grain growth are likely to occur. However, second phase particles will help in reducing the grain size by the particle stimulated nucleation (PSN) mechanism. Furthermore, the pinning effect of these particles can oppose grain growth by reducing the grain boundary migration. These two phenomena together with the partitioning of the grains imposed by the severe plastic deformation in the ECAP process have all contributed to the achieved fine-grained structure in the AZ31 alloy with enhanced mechanical properties. The enhancement in the shear yield stress (SYS) and ultimate shear strengths (USS) were, respectively, 11.2 and 6.1% in the extruded state, and 7.6 and 3.9% in the ECAPed conditions. The weaker strengthening effect of grain refinement in the ECAPed alloys can be attributed to the textural modifications which partly offset the achieved grain boundary strengthening.
Coupling between bulk ordering and surface segregation: from alloy surfaces to surface alloys
International Nuclear Information System (INIS)
Gallis, Coralie
1997-01-01
-The knowledge of the alloy surfaces is of prime interest to understand their catalytic properties. On the one hand, the determination of the stability of the surface alloys depends very strongly on the behaviours of the A c B 1-c alloy surfaces. On the other hand, the knowledge of the kinetics of the formation-dissolution of surface alloys can allow to understand the equilibrium segregation isotherm. We have then studied the relation between the equilibrium surface segregation in an alloy A c B 1-c and the kinetics of dissolution of a few metallic layers of A/B and the inverse deposit. We have used an energetic model derived from the electronic structure (T.I.B.M.) allowing us to study the surface segregation both in the disordered state and in the ordered one. The kinetics of dissolution were studied using the kinetic version of this model (K.T.I.B.M.) consistent with the equilibrium model. To illustrate our study, we have chosen the Cu-Pd system, a model for the formation of surface alloys and for which a great number of studies, both experimental and theoretical, are in progress. We then have shown for the (111) surface of this system that the surface alloys obtained during the dissolution are related to the alloy surfaces observed for the equilibrium segregation. The Cu-Pd system is characteristic of systems which have a weak segregation energy. Then, we have performed an equivalent study for a system with a strong segregation energy. Our choice was directly put on the Pt-Sn system. The surface behaviour, both in equilibrium and during the kinetics of dissolution, is very different from the Cu-Pd case. In particular, we have found pure 2-D surface alloys. Finally, a quenched molecular dynamics study has allowed us to determine the relative stability of various possible surface superstructures. (author) [fr
Surface Modification of C17200 Copper-Beryllium Alloy by Plasma Nitriding of Cu-Ti Gradient Film
Zhu, Y. D.; Yan, M. F.; Zhang, Y. X.; Zhang, C. S.
2018-03-01
In the present work, a copper-titanium film of gradient composition was firstly fabricated by the dual magnetron sputtering through power control and plasma nitriding of the film was then conducted to modify C17200 Cu alloy. The results showed that the prepared gradient Cu-Ti film by magnetron sputtering was amorphous. After plasma nitriding at 650 °C, crystalline Cu-Ti intermetallics appeared in the multi-phase coating, including CuTi2, Cu3Ti, Cu3Ti2 and CuTi. Moreover, even though the plasma nitriding duration of the gradient Cu-Ti film was only 0.5 h, the mechanical properties of the modified Cu surface were obviously improved, with the surface hardness enhanced to be 417 HV0.01, the wear rate to be 0.32 × 10-14 m3/Nm and the friction coefficient to be 0.075 at the load of 10 N, which are all more excellent than the C17200 Cu alloy. In addition, the wear mechanism also changed from adhesion wear for C17200 Cu substrate to abrasive wear for the modified surface.
International Nuclear Information System (INIS)
Heubner, Ulrich; Kloewer, Jutta; Alves, Helena; Behrens, Rainer; Schindler, Claudius; Wahl, Volker; Wolf, Martin
2012-01-01
This book contains the following eight topics: 1. Nickel alloys and high-alloy special stainless steels - Material overview and metallurgical principles (U. Heubner); 2. Corrosion resistance of nickel alloys and high-alloy special stainless steels (U. Heubner); 3. Welding of nickel alloys and high-alloy special stainless steels (T. Hoffmann, M. Wolf); 4. High-temperature materials for industrial plant construction (J. Kloewer); 5. Nickel alloys and high-alloy special stainless steels as hot roll clad composites-a cost-effective alternative (C. Schindler); 6. Selected examples of the use of nickel alloys and high-alloy special stainless steels in chemical plants (H. Alves); 7. The use of nickel alloys and stainless steels in environmental engineering (V. Wahl); 8: Nickel alloys and high-alloy special stainless steels for the oil and gas industry (R. Behrens).
Li, Nan; Parker, Stephen S.; Wood, Elizabeth S.; Nelson, Andrew T.
2018-05-01
Iron-chromium-aluminum (FeCrAl) alloys are of interest to the nuclear materials community due to their resistance to high-temperature steam oxidation under accident conditions. The present work investigates oxide formation at temperatures relevant to light water reactor cladding operation following extended aging to assess growth kinetics, chemical composition, and microstructure of oxide formation on a commercial FeCrAl alloy, Fe-21 wt pct Cr-5 wt pct Al-3 wt pct Mo (Kanthal APMT). Aging treatments were performed for 100 to 1000 hours in stagnant air at 300 °C, 400 °C, 500 °C, and 600 °C, respectively. Oxide growth behavior under the investigated conditions follows a logarithmic time dependence. When the oxidization temperature is 400 °C or below, the oxide is amorphous. At 500 °C, isolated crystalline regions start to appear during short period aging time and expand with extended exposures. Crystalline α-Al2O3 oxide film develops at 600 °C and the correlated logarithmic rate constant decreases significantly, indicating enhanced oxidation resistance of the formed oxide film. In addition, Mo segregation at grain boundaries has been observed when the aging temperature exceeds 500 °C. The results of this study can be viewed as an upper bounding result for potential oxide coarsening during reactor operation.
High thermal shock resistance of the hot rolled and swaged bulk W–ZrC alloys
Energy Technology Data Exchange (ETDEWEB)
Xie, Z.M.; Liu, R.; Miao, S.; Yang, X.D. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Zhang, T., E-mail: zhangtao@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Fang, Q.F.; Wang, X.P. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, C.S., E-mail: csliu@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Lian, Y.Y. [Southwestern Institute of Physics, Chengdu (China); Liu, X., E-mail: xliu@swip.ac.cn [Southwestern Institute of Physics, Chengdu (China); Luo, G.N. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)
2016-02-15
The thermal shock (single shot) resistance and mechanical properties of the W–0.5wt% ZrC (WZC) alloys manufactured by ordinary sintering followed by swaging or rolling process were investigated. No cracks or surface melting were detected on the surface of the rolled WZC alloy plates after thermal shock at a power density of 0.66 GW/m{sup 2} for 5 ms, while primary intergranular cracks appear on the surface of the swaged WZC samples after thermal shock at a power density of 0.44 GW/m{sup 2} for 5 ms. Three point bending tests indicate that the rolled WZC alloy has a flexural strength of ∼2.4 GPa and a total strain of 1.8% at room temperature, which are 100% and 260% higher than those of the swaged WZC, respectively. The fracture energy density of the rolled WZC alloy is 3.23 × 10{sup 7} J/m{sup 3}, about 10 times higher than that of the swaged WZC (2.9 × 10{sup 6} J/m{sup 3}). The high thermal shock resistance of the rolled WZC alloys can be ascribed to their extraordinary ductility and plasticity. - Graphical abstract: (Left panel) surface morphology observed by optical microscope after a single pulse for 5 ms with various absorbed power densities at RT on the rolled WZC. (Right panel) curves of flexural stress versus strain at RT (a) and the calculated fracture energy (b) for the swaged WZC and rolled WZC alloys. - Highlights: • No cracks or surface melting were detected on the rolled WZC alloy samples after thermal shock at 0.66 GW/m{sup 2} for 5 ms. • Hot rolled WZC alloy plates exhibit a flexural strength of 2.4 GPa and a strain of 1.8% at RT. • The fracture energy of the rolled WZC alloy is 3.23 × 10{sup 7} J/m{sup 3} at RT, about 10 times higher than that of the swaged WZC. • A detailed analysis of the relationships between the mechanical properties and the thermal shock resistance is given.
Joining of pressureless-sintered SiC to stainless steel using Ag-Cu alloy and insert-metals
International Nuclear Information System (INIS)
Yano, Toyohiko; Takada, Naohiro; Iseki, Takayoshi
1987-01-01
Brazing of pressureless-sintered SiC to stainless steel using Ag-28 wt% Cu alloy was studied. In SiC plate joined to stainless steel rod (6 mm in diameter) using an Ag-Cu alloy powder containing 1.5 wt% Ti, the bond strength increased with decreasing brazing temperature and holding time. When the increased size of stainless steel plate (10 x 10 x 4 mm), joining was unsuccessful by the method mentioned above and even with Ti insert-metal. However, simultaneous use of Ti and Mo as insert-metal gave a good bonding in the order SiC/Ti/Mo/stainless steel, because of relaxation of residual stress due to thermal expansion mismatch. The shear strength was 30 - 50 MPa. A thin layer, probably Ti 3 SiC 2 , was observed at the interface between SiC and brazing filler immediately after melting. But with increasing both temperature and time, Ti 5 Si 3 (C) and TiC x were formed if Ti was continuously provided from the brazing filler. Since the interface of Ti 3 SiC 2 and either Ti 5 Si 3 (C) or TiC x seemed to be brittle, the formation of Ti 5 Si 3 (C) and TiC x decreased the bond strength. At lower temperature and short time, a high bond strength is expected when Ti was inserted in contact with SiC. (author)
Zhang, Qingquan; Zhang, Wei; Tian, Weisi; Zhao, Qinglong
2017-12-01
In this paper, the effects of TiC nano-particles on the mechanical properties of Al-5Cu alloy were investigated. Adding TiC nano-particles can effectively refine grain size and secondary dendritic arm. The ultimate tensile strength, yield strength and elongation of the Al-5Cu alloy in each of the three states (i.e. as-cast, solid-solution state and T6 state) were also improved by adding TiC nano-particles. Moreover, the elastic-plastic plane-strain fracture toughness (K J) and work of fracture ( wof) of Al-5Cu containing TiC were significantly higher than those of Al-5Cu without TiC after aging for 10 h. The addition of TiC nano-particles also led to finer and denser ‧ precipitates.
International Nuclear Information System (INIS)
Cook, J.W. Jr.; Davis, W.T.; Chandler, J.H.; Skove, M.J.
1977-01-01
The dependence of the superconducting transition temperature (T/sub c/) on stress (sigma) for pure In and Sn samples was found to be in qualitative agreement with earlier work. For convenience T/sub c/ is expressed as a function of the experimentally measured strain (epsilon), which is proportional to sigma. The effect of alloying on the initial dependence of the T/sub c/-vs-epsilon curves, (per. delta T/sub c//per. delta epsilon)/sub epsilon = 0/ = eta, was quite different for the In and Sn alloys. The In samples were alloyed with a maximum of 4.8 at.% Tl, 7.9 at.% Sn, and 6.7 at.% Pd; the Sn samples were alloyed with a maximum of 0.3 at.% Cd, 6.0 at.% In, 0.3 at.% Sb, and 2.2 at.% Bi. The addition of impurities had a large effect on eta for the In alloys, with eta reversing sign for some Sn and Pb alloy contents (chi). The T/sub c/-vs-epsilon curves also became nonlinear for some chi. The possible relationship of the In alloy results to changes in the Fermi surface due to the addition of impurities is discussed. For the Sn alloy samples, there was no change in eta with any impurity. The change in room-temperature resistivity with strain was also measured. There was only a slight decrease in the dependence of resistivity on strain for the In--Sn and In--Pb data and no effect on the In--Tl or Sn alloy data
Argon-arc welding of heat resisting aluminium alloys
International Nuclear Information System (INIS)
Ryazantsev, V.I.; Fedoseev, V.A.
1997-01-01
Welding of aluminium heat resisting alloys of the Al-Cu-Mg system is studied. The hot-shortness of heat-resistant alloys M40, 1150 and 1151 are at the level of aluminium alloys 1201 and by 2-3 times lower as compared to the aluminium alloy AMg6. The M40, 1150 and 1151 alloys have unquestionable advantages against other know aluminium alloys only at temperatures of welded structures operation, beginning with 150-2000 deg C and especially at 250 deg C
Effect of Ni Addition on the Wear and Corrosion Resistance of Fe-20Cr-1.7C-1Si Hardfacing Alloy
International Nuclear Information System (INIS)
Lee, Sung Hoon; Kim, Ki Nam; Kim, Seon Jin
2011-01-01
In order to improve the corrosion resistance of Fe-20Cr-1.7C-1Si hardfacing alloy without a loss of wear resistance, the effect of Ni addition was investigated. As expected, the corrosion resistance of the alloy increased with increasing Ni concentration. The wear resistance of the alloy did not decrease, even though the hardness decreased, up to Ni concentration of 5 wt.%. This was attributed to the fact that the decrease in hardness was counterbalanced by the strain-induced martensitic transformation. The wear resistance of the alloy, however, decreased abruptly with increases of the Ni concentration over 5 wt.%.
Electrodeposition of Al-Mn alloy on AZ31B magnesium alloy in molten salts
International Nuclear Information System (INIS)
Zhang Jifu; Yan Chuanwei; Wang Fuhui
2009-01-01
The Al-Mn alloy coatings were electrodeposited on AZ31B Mg alloy in AlCl 3 -NaCl-KCl-MnCl 2 molten salts at 170 deg. C aiming to improve the corrosion resistance. However, in order to prevent AZ31B Mg alloy from corrosion during electrodeposition in molten salts and to ensure excellent adhesion of coatings to the substrate, AZ31B Mg alloy should be pre-plated with a thin zinc layer as intermediate layer. Then the microstructure, composition and phase constituents of the coatings were investigated by scanning electron microscopy (SEM), energy-dispersive X-ray spectrometry (EDX), and X-ray diffraction (XRD). It was indicated that, by adjusting the MnCl 2 content in the molten salts from 0.5 wt% to 2 wt%, the Mn content in the alloy coating was increased and the phase constituents were changed from f.c.c Al-Mn solid solution to amorphous phase. The corrosion resistance of the coatings was evaluated by potentiodynamic polarization measurements in 3.5% NaCl solution. It was confirmed that the Al-Mn alloy coatings exhibited good corrosion resistance with a chear passive region and significantly reduced corrosion current density at anodic potentiodynamic polarization. The corrosion resistance of the alloy coatings was also related with the microstructure and Mn content of the coatings.
Role of alloying additions on the properties of Cu–Al–Mn shape memory alloys
Energy Technology Data Exchange (ETDEWEB)
Dasgupta, Rupa, E-mail: rupadasgupta@ampri.res.in; Jain, Ashish Kumar; Kumar, Pravir; Hussain, Shahadat; Pandey, Abhishek
2015-01-25
Highlights: • Cu based SMAs with high transition temperature could be made using LM route. • The properties depend on alloying composition. • Property characterisation establishes feasibility of making SMAs. - Abstract: The effect of alloying seven different elements [Zn, Si, Fe, Ni, Mg, Cr and Ti] on the microstructure, hardness, phase precipitation and transformation temperature in a Cu–12.5Al–5Mn alloy with a view to possible improvements as a result of these additions is the focus of the reported study. The base alloy has been chosen keeping in mind its ability to exhibit shape memory properties and improved ductility over other Cu-based SMAs. The objective was to ascertain changes or improvements attained due to the individual tertiary additions. The samples were prepared through liquid metallurgy route using pure copper, aluminum, manganese and the respective quaternary alloying elements in right quantities to weigh 1000 g of the alloy in total and were melted together. Samples from the cast alloys were subject to homogenisation treatment at 200 °C for 2 h in a muffle furnace and furnace cooled. Samples from the homogenised alloys were heated and held for 2 h at 920 °C followed by ice quenching to obtain the desired martensitic structure for shape memory behaviour. The alloys in the cast, homogenised and quenched conditions were metallographically polished to observe the martensitic phase formation mainly in quenched samples which is a pre requisite for exhibiting shape memory properties in these alloys. X-ray Diffraction studies were carried out on the cast and quenched samples using Cu Kα target; and the phases identified indicate martensitic phase precipitation; however in some cases the precipitation is incomplete. Differential Scanning Calorimetric [DSC] studies were carried out on quenched samples from room temperature to 600 °C maintaining a constant rate of 10 °C/min. Results indicate clear transformation peaks in all the samples which
Role of alloying additions on the properties of Cu–Al–Mn shape memory alloys
International Nuclear Information System (INIS)
Dasgupta, Rupa; Jain, Ashish Kumar; Kumar, Pravir; Hussain, Shahadat; Pandey, Abhishek
2015-01-01
Highlights: • Cu based SMAs with high transition temperature could be made using LM route. • The properties depend on alloying composition. • Property characterisation establishes feasibility of making SMAs. - Abstract: The effect of alloying seven different elements [Zn, Si, Fe, Ni, Mg, Cr and Ti] on the microstructure, hardness, phase precipitation and transformation temperature in a Cu–12.5Al–5Mn alloy with a view to possible improvements as a result of these additions is the focus of the reported study. The base alloy has been chosen keeping in mind its ability to exhibit shape memory properties and improved ductility over other Cu-based SMAs. The objective was to ascertain changes or improvements attained due to the individual tertiary additions. The samples were prepared through liquid metallurgy route using pure copper, aluminum, manganese and the respective quaternary alloying elements in right quantities to weigh 1000 g of the alloy in total and were melted together. Samples from the cast alloys were subject to homogenisation treatment at 200 °C for 2 h in a muffle furnace and furnace cooled. Samples from the homogenised alloys were heated and held for 2 h at 920 °C followed by ice quenching to obtain the desired martensitic structure for shape memory behaviour. The alloys in the cast, homogenised and quenched conditions were metallographically polished to observe the martensitic phase formation mainly in quenched samples which is a pre requisite for exhibiting shape memory properties in these alloys. X-ray Diffraction studies were carried out on the cast and quenched samples using Cu Kα target; and the phases identified indicate martensitic phase precipitation; however in some cases the precipitation is incomplete. Differential Scanning Calorimetric [DSC] studies were carried out on quenched samples from room temperature to 600 °C maintaining a constant rate of 10 °C/min. Results indicate clear transformation peaks in all the samples which
International Nuclear Information System (INIS)
Fernandes, Stela Maria de Carvalho
1993-01-01
The characterization of microstructural and mechanical properties of cold rolled and heat treated alloys 600 made in Brazil were investigated. The recovery and recrystallization behavior as well as solubilization and aging have been studied using optical, scanning electron and transmission electron microscopy. Microhardness and tensile testing have been carried out. The recovery process of the cold rolled alloy 600 occurred until 600 deg C and the recrystallization stage was situated between 600 and 850 deg C. The primary recrystallization temperature was obtained at 850 deg C after 1 hour (isochronal heat treatments). The aged alloy 600 shows carbide precipitation on grains bu with ductility maintenance. (author)
Sintered Fe-Ni-Cu-Sn-C Alloys Made of Ball-Milled Powders
Directory of Open Access Journals (Sweden)
Romański A.
2014-10-01
Full Text Available The main objective of this paper was to perform sinterability studies of ball-milled Fe-12%Ni-6.4%Cu-1.6%Sn-0.6%C powders. A mixture of precisely weighed amounts of elemental iron, nickel and graphite, and pre-alloyed 80/20 bronze powders was ball-milled for 8, 30 and 120 hours. After cold-pressing at 400 MPa the specimens were sintered at 900oC for 30 minutes in a reducing atmosphere and subsequently tested for density and hardness as well as subjected to structural studies using scanning electron microscopy (SEM and X-ray diffraction (XRD analysis.
The effects of microstructure on the hydriding for 500 °C/2 h aged U-13at.%Nb alloy
Energy Technology Data Exchange (ETDEWEB)
Ji, Hefei; Chen, Xianglin; Shi, Peng; Hu, Guichao; Li, Ruiwen [China Academy of Engineering Physics, Mianyang 621900 (China); Yang, Jiangrong, E-mail: yangjiangrong168@hotmail.com [Science and Technology on Surface Physics and Chemistry Laboratory, P.O.Box No.9-35, Huafengxincun, Jiangyou City, Sichuan Province, 621908 (China); Wang, Xiaolin, E-mail: xlwang@caep.cn [China Academy of Engineering Physics, Mianyang 621900 (China)
2017-05-15
The microstructure and hydriding properties of as-quenched and 500 °C/2 h aged U-13at.%Nb alloys were investigated. After suffering 500 °C/2 h process, the as-quenched alloy with single metastable α″ phase partially decomposed into lamellar pearlite along prior-γ grain boundaries and around impurities accompanied by the redistribution of niobium. The as-quenched U-13at.%Nb alloy performed perfect corrosion resistance to hydrogen while the aged poor owing to their different microstructure. The hydriding reaction order for the aged alloy in this work was determined to be 0.62. The decomposed areas had relatively lower Volta potential than the non-decomposed areas, which decreased the hydrogen corrosion resistance. In addition, the conclusion that Nb-poor α-like-U reacted with hydrogen preferentially than Nb-rich phase was confirmed by KFM results that Nb-poor phase had relatively lower Volta potential.
Aluminium EN AW-2124 alloy matrix composites reinforced with Ti(C,N), BN and Al2O3 particles
International Nuclear Information System (INIS)
Dobrzanski, L.A.; Wlodarczyk, A.; Adamiak, M.
2003-01-01
Investigation results of the aluminium alloy EN AW-2124 matrix composite materials with particles of the powders Ti(C,N), BN and Al 2 O 3 (15 wt.%) are presented in the paper. In order to obtain uniform distribution of reinforcement particles in aluminium alloy matrix powders of composite components have been milled in the rotary ball-bearing pulverizer. The composites have been pressed in laboratory vertical press at room temperature under the pressure of 500 kN. Obtained die samplings have been heated to the temperature 520-550 o C and extruded. Bars of diameter 8 mm have been received as a final product. Metallographic examination of the composites materials' structure shows non-uniform distribution of reinforced powders in the aluminium alloy matrix banding of reinforcements particles corresponds to the extrusion direction. Particles of reinforcement distribution in aluminium alloy matrix is irregular, some agglomerations of powder of aluminium oxide and porosity of different size have been noticed. Investigations of hardness and ultimate compressive strength show that the particles of reinforcement improve mechanical properties of composite materials. Investigations of compressive strength, carried out at room temperature, enable to compare mechanical properties of matrix and composite. (author)
International Nuclear Information System (INIS)
Ramos, J; Perez, G.A
2008-01-01
The big worldwide demand for chrome-nickel alloy steels ('conventional steel') leads to the need for advanced materials for applications in different engineering systems that operate at high temperatures and in aggressive environmental conditions, favoring research and development in alternate alloys. In this technological race in search of these new materials, the FeMnAlC alloys ('new steels') have attracted attention for their excellent mechanical and tribological properties as well as for their good performance in corrosive-oxide environments, which make them similar to conventional steel. There are two important similarities between these two steels. First, an agent that causes the passive film to become stainless appears in both steels: chrome in the conventional steel, and aluminum in the FeMnAl alloy. The second similarity is that a stabilizing agent of the austenitic phase (FCC) appears in both, so that excellent mechanical properties can be obtained: nickel in the conventional steel, and manganese in the FeMnAl alloy. In certain sectors, such as aeronautics, conventional steel is rarely used because it is a very heavy material. This conventional steel is almost three times heavier that aluminum (7.85/2.7). Two advantages that the new FeMnAIC steels have compared to the conventional steels are that they are about 13% lighter in weight and they are less expensive. The FeMnAl also have excellent mechanical properties and good corrosion-oxidation resistance, which generates big expectations for their application in a broad scientific spectrum. This work reports the state of the information currently available about FeMnAlC alloys, comparing the mechanical and tribological behaviors of conventional alloy steels with chrome and nickel alloys, specifying the scopes of their application. A condition that favors the steels' fragility is the high speed of deformation and impact, where the FCC crystalline structure materials do not have a fragile ductile transition
International Nuclear Information System (INIS)
Mizia, Ronald E.; Michael, Joseph Richard; Williams, David Brian; Dupont, John Neuman; Robino, Charles Victor
2004-01-01
The physical and welding a metallurgy of gadolinium- (Gd-) enriched Ni-based alloys has been examined using a combination of differential thermal analysis, hot ductility testing. Varestraint testing, and various microstructural characterization techniques. Three different matrix compositions were chosen that were similar to commercial Ni-Cr-Mo base alloys (UNS N06455, N06022, and N06059). A ternary Ni-Cr-Gd alloy was also examined. The Gd level of each alloy was ∼2 wt-%. All the alloys initiated solidification by formation of primary austenite and terminated solidification by a Liquid γ + Ni 5 Gd eutectic-type reaction at ∼1270 C. The solidification temperature ranges of the alloys varied from ∼100 to 130 C (depending on alloy composition). This is a substantial reduction compared to the solidification temperature range to Gd-enriched stainless steels (360 to 400 C) that terminate solidification by a peritectic reaction at ∼1060 C. The higher-temperature eutectic reaction that occurs in the Ni-based alloys is accompanied by significant improvements in hot ductility and solidification cracking resistance. The results of this research demonstrate that Gd-enriched Ni-based alloys are excellent candidate materials for nuclear criticality control in spent nuclear fuel storage applications that require production and fabrication of large amounts of material through conventional ingot metallurgy and fusion welding techniques
Influence of Microstructure on Microhardness of Fe81Si4B13C2 Amorphous Alloy after Thermal Treatment
Czech Academy of Sciences Publication Activity Database
Minić, Dragica, M.; Blagojević, V.; Minić, Dušan M.; Gavrilović, A.; Rafailović, L.; Žák, Tomáš
42A, č. 13 (2011), s. 4106-4112 ISSN 1073-5623 R&D Projects: GA MŠk(CZ) 1M0512 Institutional research plan: CEZ:AV0Z2041904 Keywords : bulk metallic-glass * mechanical properties * Fe81B13SI4C2 alloy * B alloys * alpha-Fe * crystallization * phase * nanocrystallization * behavior Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.545, year: 2011
International Nuclear Information System (INIS)
Mamadaliev, N.; Levin, V.I.; Malinin, A.B.
1978-01-01
103 Pd separated from metal rhodium irradiated with deuterons has been used without a carrier for sup( 03m)Rh generator The generator of sup(103m)Rh is a column 6mm in diameter filled with an anionite in Cl - form (Dowex-2,8,200-400 mesh) with an adsorbed parent isotope of 103 Pd. As a result of its decay, a 103 Rh daughter isotope is accumulated, which can be washed out from the generator from time to time with a corresponding solution. To prepare the generator, 0.5g of the resin with an adsorbed 103 Pd is charged into the column containing 1g of the same resin. Washing out with 2N HCl yields more than 90% of sup(103m)Rh with a radionuclide purity of more than 99.99%
The corrosion behaviour of Zr3Al-based alloys
International Nuclear Information System (INIS)
Murphy, E.V.; Wieler, R.
1977-07-01
The corrosion resistance of several zirconium-aluminum alloys with aluminum contents ranging from 7.6 to 9.6 wt% was examined in 300 deg C and 325 deg C water, 350 deg C and 400 deg C steam and in air and wet CO 2 at 325 deg C and 400 deg C. In the transformed alloys there are three phases present, αZr, Zr 2 Al and Zr 3 Al of which the αZr phase is the least corrosion resistant. The most important factor controlling the corrosion behaviour of these alloys was found to be the size, distribution and amount of the αZr phase in the transformed alloys, which in turn was dependent upon the microstructural scale of the untransformed alloys
Mariani, Robert Dominick
2014-09-09
Zirconium-based metal alloy compositions comprise zirconium, a first additive in which the permeability of hydrogen decreases with increasing temperatures at least over a temperature range extending from 350.degree. C. to 750.degree. C., and a second additive having a solubility in zirconium over the temperature range extending from 350.degree. C. to 750.degree. C. At least one of a solubility of the first additive in the second additive over the temperature range extending from 350.degree. C. to 750.degree. C. and a solubility of the second additive in the first additive over the temperature range extending from 350.degree. C. to 750.degree. C. is higher than the solubility of the second additive in zirconium over the temperature range extending from 350.degree. C. to 750.degree. C. Nuclear fuel rods include a cladding material comprising such metal alloy compositions, and nuclear reactors include such fuel rods. Methods are used to fabricate such zirconium-based metal alloy compositions.
Improvement of magnetocaloric properties of Gd-Ge-Si alloys by alloying with iron
Directory of Open Access Journals (Sweden)
Erenc-Sędziak T.
2013-01-01
Full Text Available The influence of annealing of Gd5Ge2Si2Fex alloys at 1200°C and of alloying with various amount of iron on structure as well as thermal and magnetocaloric properties is investigated. It was found that annealing for 1 to 10 hours improves the entropy change, but reduces the temperature of maximum magnetocaloric effect by up to 50 K. Prolonged annealing of the Gd5Ge2Si2 alloy results in the decrease of entropy change due to the reduction of Gd5Ge2Si2 phase content. Addition of iron to the ternary alloy enhances the magnetocaloric effect, if x = 0.4 – 0.6, especially if alloying is combined with annealing at 1200°C: the peak value of the isothermal entropy change from 0 to 2 T increases from 3.5 to 11 J/kgK. Simultaneously, the temperature of maximum magnetocaloric effect drops to 250 K. The changes in magnetocaloric properties are related to the change in phase transformation from the second order for arc molten ternary alloy to first order in the case of annealed and/or alloyed with iron. The results of this study indicate that the minor addition of iron and heat treatment to Gd-Ge-Si alloys may be useful in improving the materials’ magnetocaloric properties..
Ferromagnetic bulk glassy alloys
International Nuclear Information System (INIS)
Inoue, Akihisa; Makino, Akihiro; Mizushima, Takao
2000-01-01
This paper deals with the review on the formation, thermal stability and magnetic properties of the Fe-based bulk glassy alloys in as-cast bulk and melt-spun ribbon forms. A large supercooled liquid region over 50 K before crystallization was obtained in Fe-(Al, Ga)-(P, C, B, Si), Fe-(Cr, Mo, Nb)-(Al, Ga)-(P, C, B) and (Fe, Co, Ni)-Zr-M-B (M=Ti, Hf, V, Nb, Ta, Cr, Mo and W) systems and bulk glassy alloys were produced in a thickness range below 2 mm for the Fe-(Al, Ga)-(P, C, B, Si) system and 6 mm for the Fe-Co-(Zr, Nb, Ta)-(Mo, W)-B system by copper-mold casting. The ring-shaped glassy Fe-(Al, Ga)-(P, C, B, Si) alloys exhibit much better soft magnetic properties as compared with the ring-shaped alloy made from the melt-spun ribbon because of the formation of the unique domain structure. The good combination of high glass-forming ability and good soft magnetic properties indicates the possibility of future development as a new bulk glassy magnetic material
Wear behaviour of A356 aluminium alloy reinforced with micron and nano size SiC particles
CSIR Research Space (South Africa)
Camagu, ST
2013-07-01
Full Text Available A method for producing metal matrix composites MMC was successfully implemented for mixing nano and low micron (“Hybrid”) sized SiC reinforcing particles in an aluminium alloy matrix. Due to the improved specific modulus and strength, MMC...
Effects of segregation of primary alloying elements on the creep response in magnesium alloys
DEFF Research Database (Denmark)
Huang, Y.D.; Dieringa, H.; Hort, N.
2008-01-01
The segregation of primary alloying elements deteriorates the high temperature creep resistance of magnesium alloys. Annealing at high temperatures alleviating their segregations can improve the creep resistance. Present investigation on the effect of segregation of primary alloying elements...... on the creep response may provide some useful information about how to improve the creep resistance of magnesium alloys in the future. (c) 2008 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved....
Creep laws for refractory tungsten alloys between 900 and 1100 oC under low stress
International Nuclear Information System (INIS)
Gallet, D.; Dhers, J.; Levoy, R.; Polcik, P.
2001-01-01
Refractory metals and alloys with melting point above 2500 o C, are commonly used at temperature well above 1000 o C. Very few creep data exist at low temperature and low stress. In the present work, we studied the micro-creep deformation and the structure stability of different W and W alloys, W-B, W-La 2 O 3 , W-K, W-Re, in the temperature range 900-1100 o C and stress range 10-50 MPa, up to 500 hours. A Norton type law has been established for those materials. Stress exponents around 1.0 have been obtained. Activation energies have been determined, and are much lower than self diffusion energies for all materials tested. The main mechanism involved has been identified as Harper-Dorn creep, implying some dislocation rearrangement. The dopants are classified according to their efficiency in creep reduction and boron at 100 ppm has been found to be the most efficient, whereas at 10 ppm, it degrades the behavior of stress relieved tungsten. Furthermore, we have found that the addition of some elements may have an efficient effect as recrystallization inhibitor. (author)
International Nuclear Information System (INIS)
Shui, C.K.; Reynolds, W.T. Jr.; Shiflet, G.J.; Aaronson, H.I.
1988-01-01
Quantitative metallography is the most reliable method available for evaluating isothermal transformation kinetics in steel. However, the accuracy of this method depends on the metallographer's ability to reveal the microstructural constituents of a specimen with sufficient contrast to allow rapid identification either by manual techniques or through the use of an automatic image analyzer. Many of the reagents commonly employed to etch steels do not consistently expose all orientations of ferrite and are thus unsatisfactory for quantitative metallographic studies. Recent research on the kinetics of the bainite reaction in Fe-C-Mo alloys has led to the development of reliable methods for etching microstructures consisting of bainite andor ferrite and various proportions of martensite. This article compares a number of reagents used in studying Fe-C-Mo alloys, having carbon contents ranging from 0.08 to 0.27 wt% and molybdenum contents from 0.25 to 4.28 wt%. These alloys are isothermally reacted at temperatures ranging from slightly above that of the bay in the TTT curve for initiation of transformation down nearly to the M/sub s/. The authors evaluate their suitability for quantitative metallography
Leinenbach, Christian; Transchel, Robert; Gorgievski, Klea; Kuster, Friedrich; Elsener, Hans Rudolf; Wegener, Konrad
2015-05-01
A Cu-Sn-Ti-based active brazing filler alloy was in situ reinforced with nanosized TiC particles by adding different amounts of a cellulose nitride-based binder. The TiC particles emanate from a reaction of the Ti within the filler alloy with the carbon from the binder that does not decompose completely during heating. The correlation between the microstructure and mechanical performance was studied. In addition, the effect of different binder amounts on the shear strength and cutting performance of brazed diamond grains was studied in shear tests and single grain cutting tests. The results clearly show that the mechanical performance of the brazed diamond grains can be improved by the formation of TiC particles. This is attributed to particle strengthening of the filler alloy matrix as well as to the decreasing grain size and more homogeneous distribution of the (Cu,Sn)3Ti5 phase with increasing amount of binder.
A sulfidation-resistant nickel-base alloy
International Nuclear Information System (INIS)
Lai, G.Y.
1989-01-01
For applications in mildly to moderately sulfidizing environments, stainless steels, Fe-Ni-Cr alloys (e.g., alloys 800 and 330), and more recently Fe-Ni-Cr-Co alloys (e.g., alloy 556) are frequently used for construction of process equipment. However, for many highly sulfidizing environments, few existing commercial alloys have adequate performance. Thus, a new nickel-based alloy containing 27 wt.% Co, 28 wt.% Cr, 4 wt.% Fe, 2.75 wt.% Si, 0.5 wt.% Mn and 0.05 wt.% C (Haynes alloy HR-160) was developed
Waseem, Owais Ahmed; Ryu, Ho Jin
2017-05-16
The W x TaTiVCr high-entropy alloy with 32at.% of tungsten (W) and its derivative alloys with 42 to 90at.% of W with in-situ TiC were prepared via the mixing of elemental W, Ta, Ti, V and Cr powders followed by spark plasma sintering for the development of reduced-activation alloys for fusion plasma-facing materials. Characterization of the sintered samples revealed a BCC lattice and a multi-phase structure. The selected-area diffraction patterns confirmed the formation of TiC in the high-entropy alloy and its derivative alloys. It revealed the development of C15 (cubic) Laves phases as well in alloys with 71 to 90at.% W. A mechanical examination of the samples revealed a more than twofold improvement in the hardness and strength due to solid-solution strengthening and dispersion strengthening. This study explored the potential of powder metallurgy processing for the fabrication of a high-entropy alloy and other derived compositions with enhanced hardness and strength.
Grain refining mechanism of Al-containing Mg alloys with the addition of Mn-Al alloys
International Nuclear Information System (INIS)
Qin, Gaowu W.; Ren Yuping; Huang Wei; Li Song; Pei Wenli
2010-01-01
Graphical abstract: Display Omitted Research highlights: The ε-AlMn phase acts as the heterogeneous nucleus of α-Mg phase during the solidification of the AZ31 Mg alloy, not the γ-Al 8 Mn 5 phase. The grain refinement effect is very clear with the addition of only 0.5 wt% Mn-28Al alloy (pure ε-AlMn). The grain refinement does not deteriorate up to the holding time of 60 min at 740 o C. - Abstract: The effect of manganese on grain refinement of Al-containing AZ31 Mg alloy has been investigated by designing a series of Mn-Al alloys composed of either pure ε-AlMn, γ 2 -Al 8 Mn 5 or both of them using optical microscopy and X-ray diffraction. It is experimentally clarified that the grain refinement of the AZ31 Mg alloy is due to the existence of the ε-AlMn phase in the Mn-Al alloys, not the γ 2 -Al 8 Mn 5 phase. The grain size of AZ31 Mg alloy is about 91 μm without any addition of Mn-Al alloys, but remarkably decreases to ∼55 μm with the addition of either Mn-34 wt% Al or Mn-28 wt% Al. With a minor addition of 0.5 wt% Mn-28Al alloy, the grain size of AZ31 alloy decreases to ∼53 μm, and the Mn-28Al alloy can be active as grain refiner for holding time up to 60 min for the melt AZ31 alloy at 750 o C.
International Nuclear Information System (INIS)
Belyavenko, V.S.; Borozenets, G.P.; Vishnevskij, I.N.; Zheltonozhskij, V.A.
1986-01-01
103 Pd decay in different chemical states has been investigated. The change of the partial half-life period equal to 0.67±0.15% has been detected. The γ-spectrum has been measured to a high precision. The new data have been obtained on population probabilities of 103 Rh excited states and the total energy of decay for 103 Pd has been determined to a high precision (543.0±0.8). The values of log ft have been determined
DEFF Research Database (Denmark)
Lindgård, Per-Anker
1977-01-01
A mean-field random alloy theory combined with a simple calculation of the exchange interaction J(c,Q) is shown to quantitatively account for the phase diagrams for alloys of rare-earth metals with Y, Lu, Sc, and other rare-earth metals. A concentration-dependent J(c,Q) explains the empirical 2...
Corrosion resistance of tantalum base alloys
International Nuclear Information System (INIS)
Gypen, L.A.; Brabers, M.; Deruyttre, A.
1984-01-01
The corrosion behaviour of substitutional Ta-Mo, Ta-W, Ta-Nb, Ta-Hf, Ta-Zr, Ta-Re, Ta-Ni, Ta-V, Ta-W-Mo, Ta-W-Nb, Ta-W-Hf and Ta-W-Re alloys has been investigated in various corrosive media, i.e. (1) concentrated sulfuric acid at 250 0 C and 200 0 C, (2) boiling hydrochloric acid of azeotropic composition, (3) concentrated hydrochloric acid at 150 0 C under pressure, (4) HF-Containing solutions and (5) 0.5% H 2 SO 4 at room temperature (anodisation). In highly corrosive media such as concentrated H 2 SO 4 at 250 0 C and concentrated HCl at 150 0 C tantalum is hydrogen embrittled, probably by stress induced precipitation of β-hydride. Both corrosion rate and hydrogen embrittlement in concentrated H 2 SO 4 at 250 0 C are strongly influenced by alloying elements. Small alloying additions of either Mo or Re decrease the corrosion rate and the hydrogen embrittlement, while Hf has the opposite effect. Hydrogen embrittlement in concentrated H 2 SO 4 at 250 0 C is completely eliminated by alloying Ta with 1 to 3 at % Mo (0.5 to 1.5 wt % Mo). These results can be explained in terms of oxygen deficiency of the Ta 2 O 5 film and the electronic structure of these alloys. (orig.) [de
Ultrahigh temperature intermetallic alloys
Energy Technology Data Exchange (ETDEWEB)
Brady, M.P.; Zhu, J.H.; Liu, C.T.; Tortorelli, P.F.; Wright, J.L.; Carmichael, C.A.; Walker, L.R. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.
1997-12-01
A new family of Cr-Cr{sub 2}X based alloys with fabricability, mechanical properties, and oxidation resistance superior to previously developed Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys has been identified. The new alloys can be arc-melted/cast without cracking, and exhibit excellent room temperature and high-temperature tensile strengths. Preliminary evaluation of oxidation behavior at 1100 C in air indicates that the new Cr-Cr{sub 2}X based alloys form an adherent chromia-based scale. Under similar conditions, Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys suffer from extensive scale spallation.
International Nuclear Information System (INIS)
Gallego, S; Munoz, M C; Huttel, Y; Avila, J; Asensio, M C
2003-01-01
The c(2 x 2)MnCu surface alloy on Cu(100) can be considered as a purely two-dimensional magnetic system where the Mn atoms exhibit a large corrugation closely related to their high spin moment. In this paper we investigate the influence of the atomic environment on the electronic and magnetic properties of the two-dimensional alloyed layer, extending our study to the less known multilayered system made of MnCu two-dimensional alloy layers embedded in a Cu crystal. The analysis is based on angle-resolved photoelectron spectroscopy measurements and calculations using the Green function matching method, which allows us to treat exactly the projection of the three-dimensional lattice on the c(2 x 2) plane. A complete study of the valence band is performed along the two-dimensional Brillouin zone in a wide energy range. We show that the presence of Mn results in an important redistribution of the spin-polarized electronic states of the neighbouring Cu atoms. This redistribution is not accompanied by a net charge transfer between different atoms, and also the spin moment of Cu remains small. Most of the new features induced by Mn in the surface alloy are also present in the multilayered system, evidencing that they are specific to the two-dimensional alloyed layer and not surface effects
2010-10-01
... grant authorized by section 303 of the Act. Community Mental Health Centers Act means the Community Mental Health Centers Act (42 U.S.C. 2689 et seq.) other than Part D thereof. Experimental nature refers... OBLIGATED SERVICE FOR MENTAL HEALTH TRAINEESHIPS § 64a.103 Definitions. As used in this part: Act means the...
International Nuclear Information System (INIS)
Jalilian, A.R.; Sadeghi, M.; Kamrani, Y.Y.
2006-01-01
Due to interesting tumor seeking properties of bis-thiosemicarbazones, two radio palladium-bis-thiosemicarbazone complexes, i.e., [ 103 Pd]-pyruvaldehyde-bis(N 4 -methylthiosemicarbazone) ([ 103 Pd] PTSM) and [ 103 Pd]-diacetyl-bis(N 4 -methylthiosemicarbazone) ([ 103 Pd]ATSM) were prepared according to the analogy of radio copper homologs. Palladium-103 (t 1/2 = 16.96 d) was produced via the 103 Rh(p, n) 103 Pd nuclear reaction with proton energy 18 MeV. The final activity was eluted in form of Pd(NH 3 ) 2 Cl 2 in order to react with bis-thiosemicarbazones to yield [ 103 Pd]-labeled compounds. Chemical purity of the product was confirmed to be below the accepted limits by polarography. [ 103 Pd]-labeled bis-thiosemicarbazones were prepared with a radiochemical yield of more than 80% at room temperature after 60-90 min by vortexing a mixture of thiosemicarbazones and Pd activity in ethanol. The purification of the labeled compounds performed by reverse phase column chromatography using C 18 plus Sep-Pak. Radiochemical purity of more than 99% specific activity of about 12500-13 000 Ci/mol was obtained. The stability of the complexes was checked in final product and presence of human serum at 37 C up to 48 h. The partition co-efficients of the final complexes were determined. The initial physico-chemical properties of the labeled compounds were compared to those of their copper homologues. (orig.)
Absolute calibration of the Rh-103(n,n')Rh-103m reaction rate
International Nuclear Information System (INIS)
Taylor, W.H.; Murphy, M.F.; March, M.R.
1979-05-01
The uncertainties in determining the absolute values of the Rh-103(n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to approximately +-5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the IAEA. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)
DEFF Research Database (Denmark)
Singh, B.N.; Edwards, D.J.; Eldrup, Morten Mostgaard
2001-01-01
Screening experiments were carried out to determine the effect of bonding and bakeout thermal cycles on microstructure, mechanical properties and electrical resistivity of the oxide dispersion strengthened (GlidCop, CuAl-25) and the precipitation hardened (CuCrZr, CuNiBe) copper alloys. Tensile...... results are described and their salient features discussed. The most significant effect of neutron irradiation is a severe loss of ductility in the case of CuNiBe alloys. (C) 2001 Elsevier Science B.V. All rights reserved....
Hydriding and structural characteristics of thermally cycled and cold-worked V-0.5 at.%C alloy
International Nuclear Information System (INIS)
Chandra, Dhanesh; Sharma, Archana; Chellappa, Raja; Cathey, William N.; Lynch, Franklin E.; Bowman, Robert C.; Wermer, Joseph R.; Paglieri, Stephen N.
2008-01-01
High pressure hydrides of V 0.995 C 0.005 were thermally cycled between β 2 - and γ-phases hydrides for potential use in cryocoolers/heat pumps for space applications. The effect of addition of carbon to vanadium, on the plateau enthalpies of the high pressure β 2 + γ region is minimal. This is in contrast to the calculated plateau enthalpies for low pressure (α + β 1 ) mixed phases which showed a noticeable lowering of the values. Thermal cycling between β 2 -and γ-phase hydrides increased the absorption pressures but desorption pressure did not change significantly and the free energy loss due to hysteresis also increased. Hydriding of the alloy with prior cold-work increased the pressure hysteresis significantly and lowered the hydrogen capacity. In contrast to the alloy without any prior straining (as-cast), desorption pressure of the alloy with prior cold-work also decreased significantly. Microstrains, 2 > 1/2 , in the β 2 -phase lattice of the thermally cycled hydrides decreased after 778 cycles and the domain sizes increased. However, in the γ-phase, both the microstrains and the domain sizes decreased after thermal cycling indicating no particle size effect. The dehydrogenated α-phase after 778 thermal cycles also showed residual microstrains in the lattice, similar to those observed in intermetallic hydrides. The effect of thermal cycling (up to 4000 cycles between β 2 - and γ-phases) and cold working on absorption/desorption pressures, hydrogen storage capacity, microstrains, long-range strains, and domain sizes of β 2 - and γ-phase hydrides of V 0.995 C 0.005 alloys are presented
Structure and electrochemical hydrogen storage properties of Ti2Ni alloy synthesized by ball milling
International Nuclear Information System (INIS)
Hosni, B.; Li, X.; Khaldi, C.; ElKedim, O.; Lamloumi, J.
2014-01-01
Highlights: • The Ti 2 Ni alloy activation requires only one cycle of charge and discharge, regardless of the temperature. • By increasing the temperature the capacity loss, undergoes an increase and it is more pronounced for the 60 °C. • A good correlation is found between the evolutions of the different electrochemical parameters according to the temperature. - Abstract: The structure and the electrochemical hydrogen storage properties of amorphous Ti 2 Ni alloy synthesized by ball milling and used as an anode in nickel–metal hydride batteries were studied. Nominal Ti 2 Ni was synthesized under argon atmosphere at room temperature using a planetary high-energy ball mill. The structural and morphological characterization of the amorphous Ti 2 Ni alloy is carried out by X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The electrochemical characterization of the Ti 2 Ni electrodes is carried out by the galvanostatic charging and discharging, the constant potential discharge, the open circuit potential and the potentiodynamic polarization techniques. The Ti 2 Ni alloy activation requires only one cycle of charge and discharge, regardless of the temperature. The electrochemical discharge capacity of the Ti 2 Ni alloy, during the first eight cycles, and at a temperature of 30 °C, remained practically unchanged and a good held cycling is observed. By increasing the temperature, the electrochemical discharge capacity loss after eight cycles undergoes an increase and it is more pronounced for the temperature 60 °C. At 30 °C, the anodic corrosion current density is 1 mA cm −2 and then it undergoes a rapid drop, remaining substantially constant (0.06 mA cm −2 ) in the range 40–60 °C, before undergoing a slight increase to 70 °C (0.3 mA cm −2 ). This variation is in good agreement with the maximum electrochemical discharge capacity values found for the different temperatures. By increasing the
International Nuclear Information System (INIS)
Olmedo, A.M.; Bordon, R.
2007-01-01
In this work, the oxide films grown on Alloy 800 and Alloy 600 in lithiated (pH 25 C d egrees = 10.2-10.4) water at high temperature, with and without hydrogen overpressure (HO) and an initial oxygen dissolved in the water have been studied. The oxide films were grown at different temperatures (220-350 C degrees) and exposure times with HO, and at 315 C degrees without HO in static autoclaves. Some results are also reported for oxide layers grown on Alloy 800 coupons exposed in a high temperature loop during extended exposure times. The average oxide thickness was determined using descaling procedures. The morphology and composition of the oxide films were analyzed with scanning electron microscopy (SEM), EDS and X-ray diffraction (XRD). For both Alloys, at 350 C degrees with HO, the oxide layers were clearly composed of a double layer: an inner one of very small crystallites and an outer layer formed by bigger crystals scattered over the inner one. The analysis by X-ray diffraction indicated the presence of spinel structures like magnetite (Fe 3 O 4 ) and ferrites and/or nickel chromites. In this case the average oxide thickness was around 0.12 to 0.15 μm for both Alloys. Similar values were found at lower temperatures. The morphology of the oxide layer was similar at lower temperatures for Alloy 800, but a different morphology consisting of platelets or needles was found for Alloy 600. The oxide morphology found at 315 C degrees, without HO and with initial dissolved oxygen in the water, was also very different between both Alloys. The oxide film grown on Alloy 600 with an initial dissolved oxygen in the water, showed clusters of platelets forming structures like flowers that were dispersed on an rather homogeneous layer consisting of smaller platelets or needles. The average oxide film grown in this case was around 0.25 μm for Alloy 600 and 0.18 μm for Alloy 800. (author) [es
ZIRCONIUM-TITANIUM-BERYLLIUM BRAZING ALLOY
Gilliland, R.G.; Patriarca, P.; Slaughter, G.M.; Williams, L.C.
1962-06-12
A new and improved ternary alloy is described which is of particular utility in braze-bonding parts made of a refractory metal selected from Group IV, V, and VI of the periodic table and alloys containing said metal as a predominating alloying ingredient. The brazing alloy contains, by weight, 40 to 50 per cent zirconium, 40 to 50 per cent titanium, and the balance beryllium in amounts ranging from 1 to 20 per cent, said alloy having a melting point in the range 950 to 1400 deg C. (AEC)
Absolute calibration of the Rh-103 (n, n') Rh-103m reaction rate
International Nuclear Information System (INIS)
Taylor, W.H.; Murphy, M.F.; March, M.R.
1979-05-01
The uncertainties in determining the absolute values of the Rh-103 (n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to ∼±5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the I.A.E.A. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)
Ti-Pt Alloys form mechanical milling
CSIR Research Space (South Africa)
Nxumalo, S
2009-12-01
Full Text Available C maximum in these alloys. A few researchers have studied the martensitic transformation in TiPt alloys using arc melted cast samples. In this work high temperature shape memory alloys are targeted using powder metallurgy as a processing route....
Lifescience Database Archive (English)
Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis
33 CFR 127.103 - Piers and wharves.
2010-07-01
...) WATERFRONT FACILITIES WATERFRONT FACILITIES HANDLING LIQUEFIED NATURAL GAS AND LIQUEFIED HAZARDOUS GAS Waterfront Facilities Handling Liquefied Natural Gas § 127.103 Piers and wharves. (a) If the waterfront... not less than two hours. (c) LNG or LPG storage tanks must have the minimum volume necessary for— (1...
Electrochemical Impedance Spectroscopy Of Metal Alloys
Macdowell, L. G.; Calle, L. M.
1993-01-01
Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.
Klimova, Margarita; Stepanov, Nikita; Shaysultanov, Dmitry; Chernichenko, Ruslan; Yurchenko, Nikita; Sanin, Vladimir; Zherebtsov, Sergey
2017-12-29
The effect of cold rolling on the microstructure and mechanical properties of an Al- and C-containing CoCrFeNiMn-type high-entropy alloy was reported. The alloy with a chemical composition (at %) of (20-23) Co, Cr, Fe, and Ni; 8.82 Mn; 3.37 Al; and 0.69 C was produced by self-propagating high-temperature synthesis with subsequent induction. In the initial as-cast condition the alloy had an face centered cubic single-phase coarse-grained structure. Microstructure evolution was mostly associated with either planar dislocation glide at relatively low deformation during rolling (up to 20%) or deformation twinning and shear banding at higher strain. After 80% reduction, a heavily deformed twinned/subgrained structure was observed. A comparison with the equiatomic CoCrFeNiMn alloy revealed higher dislocation density at all stages of cold rolling and later onset of deformation twinning that was attributed to a stacking fault energy increase in the program alloy; this assumption was confirmed by calculations. In the initial as-cast condition the alloy had low yield strength of 210 MPa with yet very high uniform elongation of 74%. After 80% rolling, yield strength approached 1310 MPa while uniform elongation decreased to 1.3%. Substructure strengthening was found to be dominated at low rolling reductions (<40%), while grain (twin) boundary strengthening prevailed at higher strains.
Mechanistic Study of Delamination Fracture in Al-Li Alloy C458 (2099)
Tayon, W. A.; Crooks, R. E.; Domack, M. S.; Wagner, J. A.; Beaudoin, A. J.; McDonald, R. J.
2009-01-01
Delamination fracture has limited the use of lightweight Al-Li alloys. In the present study, electron backscattered diffraction (EBSD) methods were used to characterize crack paths in Al-Li alloy C458 (2099). Secondary delamination cracks in fracture toughness samples showed a pronounced tendency for fracture between grain variants of the same deformation texture component. These results were analyzed by EBSD mapping methods and simulated with finite element analyses. Simulation procedures include a description of material anisotropy, local grain orientations, and fracture utilizing crystal plasticity and cohesive zone elements. Taylor factors computed for each grain orientation subjected to normal and shear stresses indicated that grain pairs with the largest Taylor factor differences were adjacent to boundaries that failed by delamination. Examination of matching delamination fracture surface pairs revealed pronounced slip bands in only one of the grains bordering the delamination. These results, along with EBSD studies, plasticity simulations, and Auger electron spectroscopy observations support a hypothesis that delamination fracture occurs due to poor slip accommodation along boundaries between grains with greatly differing plastic response.
National Aeronautics and Space Administration — Silicided niobium alloy (C103) combustion chambers have been used extensively in both NASA and DoD liquid rocket propulsion systems. Niobium alloys offer a good...
Grain refining mechanism of Al-containing Mg alloys with the addition of Mn-Al alloys
Energy Technology Data Exchange (ETDEWEB)
Qin, Gaowu W., E-mail: qingw@smm.neu.edu.c [Key Laboratory for Anisotropy and Texture of Materials (Ministry of Education), Northeastern University, Wenhu Road 3-11, Heping District, Shenyang 110004, Liaoning Province (China); Ren Yuping; Huang Wei; Li Song; Pei Wenli [Key Laboratory for Anisotropy and Texture of Materials (Ministry of Education), Northeastern University, Wenhu Road 3-11, Heping District, Shenyang 110004, Liaoning Province (China)
2010-10-08
Graphical abstract: Display Omitted Research highlights: The {epsilon}-AlMn phase acts as the heterogeneous nucleus of {alpha}-Mg phase during the solidification of the AZ31 Mg alloy, not the {gamma}-Al{sub 8}Mn{sub 5} phase. The grain refinement effect is very clear with the addition of only 0.5 wt% Mn-28Al alloy (pure {epsilon}-AlMn). The grain refinement does not deteriorate up to the holding time of 60 min at 740 {sup o}C. - Abstract: The effect of manganese on grain refinement of Al-containing AZ31 Mg alloy has been investigated by designing a series of Mn-Al alloys composed of either pure {epsilon}-AlMn, {gamma}{sub 2}-Al{sub 8}Mn{sub 5} or both of them using optical microscopy and X-ray diffraction. It is experimentally clarified that the grain refinement of the AZ31 Mg alloy is due to the existence of the {epsilon}-AlMn phase in the Mn-Al alloys, not the {gamma}{sub 2}-Al{sub 8}Mn{sub 5} phase. The grain size of AZ31 Mg alloy is about 91 {mu}m without any addition of Mn-Al alloys, but remarkably decreases to {approx}55 {mu}m with the addition of either Mn-34 wt% Al or Mn-28 wt% Al. With a minor addition of 0.5 wt% Mn-28Al alloy, the grain size of AZ31 alloy decreases to {approx}53 {mu}m, and the Mn-28Al alloy can be active as grain refiner for holding time up to 60 min for the melt AZ31 alloy at 750 {sup o}C.
Comprehension and modelling of chromia-forming alloys corrosion mechanisms in nuclear glasses
International Nuclear Information System (INIS)
Schmucker, Eric
2016-01-01
Nuclear wastes management consists in the confinement of the radioactive wastes in a glass matrix. This is made by inductive melting in a hot crucible at an operating temperature around 1150 C. These crucibles are constituted of nickel based superalloys with high chromium content. They are submitted to a harsh corrosion by the molten glass, eventually leading to their replacement. The protection of the crucible against corrosion is best provided by the establishment of a protective chromium oxide layer at the surface of the alloy. A binary chromia-forming alloy (Ni-30Cr) is studied in this work. Three different binary and ternary glass compositions are chosen in order to understand the influence of the glass basicity and glass viscosity on the corrosion kinetics. Besides, the de-correlation of the formation and dissolution kinetics of the oxide layer allows the modelling of the overall oxide growth in the molten glass. For that purpose, the oxide formation kinetics in molten glass media is assimilated to the oxidation kinetics of the alloy in gaseous media with oxygen partial pressure that are representative of the redox properties of the glasses. Studies of the oxidation kinetics and of the diffusion mechanisms have shown that the oxidation kinetics is independent on the oxygen pressure in the range of 10"-"1"3 up to 10"-"3 atm O_2 at 1150 C. The present work has shown that the dissolution kinetics of the oxide layer is governed by the diffusion of Cr(III) in the glass melt. This dissolution kinetics has been evaluated from the diffusion coefficient and the solubility limit of Cr(III) in the glass. Finally, the overall growth kinetics of the Cr_2O_3 layer in the glass has been successfully modelled for each glass, thanks to the knowledge of (i) the solubility limit of Cr(III), (ii) its diffusion coefficient in the glasses and (iii) the oxidation kinetics of the alloy. The presented model also allows quantifying the influence of each of these parameters on the
Zr-Sn-Nb alloys. Preliminary studies
International Nuclear Information System (INIS)
Danon, C.A.; Arias, D.E.
1993-01-01
Studies of the Zr-Sn-Nb diagram have been started, focussing on the Zr-rich corner, near the composition of Zirlo commercial alloy, Zr-1Sn-1Nb, and with Fe and O contents usual in nuclear grade materials. Three alloys were melted, namely Zr-4Sn-2.4Nb (A), Zr-1Sn-3Nb (B) and Zr-2.1Sn-1Nb (C). α/β transformation temperatures were measured through the variation of electrical resistivity(p) vs temperature (T). Values of 560 deg C, 670 deg C and 750 deg C were measured for the α→α+β reaction and 980 deg C, 910 deg C and 1000 deg C for the α+β→β reaction, for the A, B and C alloys, respectively in that order. Some samples were submitted to heat treatments (62 and 216 hours at 825 deg C, 120 hours at 875 deg C). Optical and scanning electronic microscopy of those samples confirmed our resistivity results. (Author)
Phase transitions and thermal expansion in Ni51- x Mn36 + x Sn13 alloys
Kaletina, Yu. V.; Gerasimov, E. G.; Kazantsev, V. A.; Kaletin, A. Yu.
2017-10-01
Thermal expansion and structural and magnetic phase transitions in alloys of the Ni-Mn-Sn system have been investigated. The spontaneous martensitic transformation in Ni51-xMn36 + xSn13 (0 ≤ x ≤ 3) alloys is found to be accompanied by high jumps in the temperature dependences of the linear thermal expansion. The relative change in the linear sizes of these alloys at the martensitic transformation is 1.5 × 10-3. There are no anomalies in the magnetic-ordering temperature range in the temperature dependences of the coefficient of linear thermal expansion. The differences in the behavior of linear thermal expansion at the martensitic transformation in Ni51-xMn36 + xSn13 (0 ≤ x ≤ 3) and Ni47Mn40Sn13( x = 4) alloys have been established.
Oxidation resistance of nickel alloys at high temperature
International Nuclear Information System (INIS)
Tyuvin, Yu.D.; Rogel'berg, I.L.; Ryabkina, M.M.; Plakushchaya, A.F.
1977-01-01
The heat resistance properties of nickel alloys Ni-Cr-Si, Ni-Si-Al, Ni-Si-Mn and Ni-Al-Mn have been studied by the weight method during oxidation in air at 1000 deg and 1200 deg C. It is demonstrated that manganese reduces the heat resistance properties of Ni-Si and Ni-Al alloys, whilst the addition of over 3% aluminium enhances the heat resistance properties of Ni-Si (over 1.5%) alloys. The maximum heat resistance properties are shown by Ni-Si-Al and Ni-Cr-Si alloys with over 2% Si. These alloys offer 3 to 4 times better oxidation resistance as compared with pure nickel at 1000 deg C and 10 times at 1200 deg C
Measurement of 103mRh produced by the 103Rh(γ,γ')103mRh reaction with liquid scintillation counting
International Nuclear Information System (INIS)
Sekine, T.; Yoshihara, Kenji; Pavlicsek, I.; Lakosi, L.; Veres, A.
1989-01-01
A liquid scintillation counting technique was applied to measure the isotope 103m Rh (half life = 56.12 min) which is difficult to detect because its γ-ray is of low energy and low emission probability. Tris-(2,4-pentanedionato)rhodium(III) (Rh(acac) 3 ) was irradiated with bremsstrahlung of accelerated 3.2 MeV electrons by LINAC. The method has given a reliable calibration curve for the determination of 103m Rh radioactivity below Rh(acac) 3 concentrations of 2 mM. The integrated cross section of 103 Rh(γ,γ') 103m Rh determined by this method was found to be 6.8±3.4 μb MeV at 3.2 MeV. (author) 8 refs.; 5 figs
Recoil effect on β-decaying in vivo generators, interpreted for 103Pd/103mRh
International Nuclear Information System (INIS)
Szucs, Zoltan; Rooyen, Johann van; Zeevaart, Jan Rijn
2009-01-01
The use of Auger emitters as potential radiopharmaceuticals is being increasingly investigated. One of the radionuclides of interest is 103m Rh, which can be produced from 103 Ru or 103 Pd in an in vivo generator. A potential problem, however, is the recoil of the 103m Rh out of the carrier molecule and even out of the target cell. In order to determine the likelihood of this happening in the 103 Pd/ 103m Rh, case calculations were made to prove that this does not happen. The equations were generalised for all radionuclides with an atomic mass of 10-240 as a tool for determining the recoil threshold of any β-emitting radionuclide.
New determination of the half-lives of 57Co, 103Ru, sup(103m)Rh, 103Pd, and 109Cd
International Nuclear Information System (INIS)
Vaninbroukx, R.; Grosse, G.; Zehner, W.
1981-01-01
The half-lives of five radionuclides were redetermined by photon-counting techniques using NaI(Tl)- and Si(Li) detectors. The results are: 57 Co: (271.90 +- 0.09)d, 103 Ru: (39.260 +- 0.020)d, sup(103m)Rh: (56.114 +- 0.020)m, 103 Pd: (16.991 +- 0.019)d, and 109 Cd: (461.90 +- 0.30)d. The quoted uncertainties, corresponding to a lσ level, take into account random and systematic uncertainties. (author)
Advanced Class of FML on the Base Al-Li Alloy 1441 with Lower Density
Antipov, V. V.; Senatorova, O. G.; Lukina, N. F.
Structure, composition, properties combination of specimens and components, a number of technological parameters for production of advanced FML based on high-modulus Al-Li 1441 alloy (E 79 GPa) with reduced density (d 2.6 g/m3) and optimized adhesive prepreg reinforced with high-strength high-modulus VMP glass fibres are described. Service life 1441 alloy provides the possibility of manufacture of thin sheets (up to 0.3 mm), clad and unclad. Moreover, some experience on the usage of 1441 T1, T11 sheets and shapes in Be 200 and Be 103 aircraft was accumulated. The class of FML materials based on Al-Li alloy provide an 5% improvement in weight efficiency and stiffness of skin structures as compared with those made from FML with conventional Al-Cu-Mg (2024T3 a.o.) and Al-Zn-Mg-Cu (7475T76 a.o.) alloys.
Effect of aluminium on the passivation of zinc–aluminium alloys in artificial seawater at 80 °C
International Nuclear Information System (INIS)
Kaewmaneekul, Tanapat; Lothongkum, Gobboon
2013-01-01
Highlights: ► Pure Zn and Zn–Al alloys passivate and depassivate in artificial seawater. ► Al retards passivation of Zn–Al alloys. ► Passive film composes of the inner film and the outer charge transfer layers. ► Al increases current density but decreases corrosion resistance of passive films. ► Al increases the electrical conductivity and the capacitance of the films. - Abstract: The effect of Al (0.15, 0.3 and 1.0 wt.%) on the passivation of Zn–Al alloys in artificial seawater at 80 °C is investigated by electrochemical measurements, scanning electron microscopy (SEM) and X-ray diffraction (XRD). It is found that the presence of Al in Zn–Al alloys can retard passivation. Potentiodynamic polarization and electrochemical impedance spectroscopy (EIS) measurements show that Al increases the current density but decreases the corrosion resistance of passive films, respectively. Mott-Schottky analysis reveals that Al increases the electrical conductivity and the capacitance of the films. Passivation of Zn–Al alloys occurs in artificial seawater when the immersion time is between 120 and 288 h, due to the presence of various Zn and Al protective compounds at the surfaces. Depassivation occurs when the immersion time is between 288 and 720 h, probably due to the decrease of solution pH and the Cl − penetration mechanism.
ODS Alloys for Nuclear Applications
International Nuclear Information System (INIS)
Jang, Jin Sung
2006-01-01
ODS (oxide dispersion strengthening) alloy is one of the potential candidate alloys for the cladding or in reactor components of Generation IV reactors and for the structural material even for fusion reactors. It is widely accepted as very resistant material to neutron irradiation as well as strong material at high temperature due to its finely distributed and stable oxide particles. Among Generation IV reactors SFR and SCWR are anticipated in general to run in the temperature range between 300 and 550 .deg. C, and the peak cladding temperature is supposed to reach at about 620 .deg. C during the normal operation. Therefore Zr.base alloys, which have been widely known and adopted for the cladding material due to their excellent neutron economics, are no more adequate at these operating conditions. Fe-base ODS alloys in general has a good high temperature strength at the above high temperature as well as the neutron resistance. In this study a range of commercial grade ODS alloys and their applications are reviewed, including an investigation of the stability of a commercial grade 20% Cr Fe-base ODS alloy(MA956). The alloy was evaluated in terms of the fracture toughness change along with the aging treatment. Also an attempt of the development of 9% Cr Fe-base ODS alloys is introduced
Energy Technology Data Exchange (ETDEWEB)
Chabri, Sumit, E-mail: sumitchabri2006@gmail.com [Department of Metallurgy & Materials Engineering, Indian Institute of Engineering Science and Technology, Shibpur, Howrah 711103 (India); Bera, S. [Department of Metallurgical & Materials Engineering, National Institute of Technology, Durgapur 713209 (India); Mondal, B.N. [Department of Central Scientific Services, Indian Association for the Cultivation of Science, Jadavpur, Kolkata 700032 (India); Basumallick, A.; Chattopadhyay, P.P. [Department of Metallurgy & Materials Engineering, Indian Institute of Engineering Science and Technology, Shibpur, Howrah 711103 (India)
2017-03-15
Microstructure and magnetic behavior of nanocrystalline 50Cu–40Co–10Si (at%) alloy prepared by mechanical alloying and subsequent isothermal annealing in the temperature range of 450–650 °C have been studied. Phase evolution during mechanical alloying and isothermal annealing is characterized by X-ray diffraction (XRD), differential thermal analyzer (DTA), high resolution transmission electron microscopy (HRTEM) and magnetic measurement. Addition of Si has been found to facilitate the metastable alloying of Co in Cu resulting into the formation of single phase solid solution having average grain size of 9 nm after ball milling for 50 h duration. Annealing of the ball milled alloy improves the magnetic properties significantly and best combination of magnetic properties has been obtained after annealing at 550 °C for 1 h duration.
Oxide dispersion-strengthened ferritic alloys
International Nuclear Information System (INIS)
Asbroeck, P. van.
1976-10-01
The publication gives the available data on the DTO2 dispersion-strengthened ferritic alloy developed at C.E.N./S.C.K. Mol, Belgium. DTO2 is a Fe-Cr-Mo ferritic alloy, strengthened by addition of titanium oxide and of titanium leading to the formation of Chi phase. It was developed for use as canning material for fast breeder reactors. (author)
International Nuclear Information System (INIS)
Hofmann, P.
1994-08-01
To study the chemical interactions between graphite and a martensitic-ferritic steel (1.4914), an austenitic stainless steel (1.4919; AISI 316), and a Ni-base alloy (Hastelloy X) isothermal reaction experiments were performed in the temperature range between 900 and 1250 C. At higher temperatures a rapid and complete liquefaction of the components occurred as a result of eutectic interactions. The chemical interactions are diffusion-controlled processes and can be described by parabolic rate laws. The reaction behavior of the two steels is very similar. The chemical interactions of the steels with graphite are much faster above 1100 C than those for the Ni-base alloy. Below 1000 C the effect is opposite. (orig.) [de
Jalal, T.; Hossein Nedjad, S.; Khalili Molan, S.
2013-05-01
A nearly equiatomic MnNi alloy was fabricated from the elemental powders by means of mechanical alloying in a planetary ball milling apparatus. X-ray diffraction (XRD), scanning electron microscopy (SEM), differential scanning calorimetry (DSC), and measurements of magnetization were conducted to identify the structural states and properties of the prepared alloys. After ball milling for 20 h, a disordered face-centered cubic (f.c.c.) solid solution was formed which increased in lattice parameter by further milling up to 50 h. An exothermic reaction took place at around 300-400°C during continuous heating of the disordered f.c.c. solid solution. This reaction is attributed to a structural ordering leading to the formation of a face-centered tetragonal (f.c.t.) phase with L10 type ordering. Examination of the magnetic properties indicated that the structural ordering increases remnant magnetization and decreases coerecivity.
Energy Technology Data Exchange (ETDEWEB)
Hosni, B. [Equipe des Hydrures Métalliques, Laboratoire de Mécanique, Matériaux et Procédés, Ecole Nationale Supérieure d’Ingénieurs de Tunis, ENSIT Ex ESSTT, Université de Tunis, 5 Avenue Taha Hussein, 1008 Tunis (Tunisia); Li, X. [FEMTO-ST, MN2S, Université de Technologie de Belfort-Montbéliard, Site de Sévenans, 90010 Belfort cedex (France); Khaldi, C., E-mail: chokri.khaldi@esstt.rnu.tn [Equipe des Hydrures Métalliques, Laboratoire de Mécanique, Matériaux et Procédés, Ecole Nationale Supérieure d’Ingénieurs de Tunis, ENSIT Ex ESSTT, Université de Tunis, 5 Avenue Taha Hussein, 1008 Tunis (Tunisia); ElKedim, O. [FEMTO-ST, MN2S, Université de Technologie de Belfort-Montbéliard, Site de Sévenans, 90010 Belfort cedex (France); Lamloumi, J. [Equipe des Hydrures Métalliques, Laboratoire de Mécanique, Matériaux et Procédés, Ecole Nationale Supérieure d’Ingénieurs de Tunis, ENSIT Ex ESSTT, Université de Tunis, 5 Avenue Taha Hussein, 1008 Tunis (Tunisia)
2014-12-05
Highlights: • The Ti{sub 2}Ni alloy activation requires only one cycle of charge and discharge, regardless of the temperature. • By increasing the temperature the capacity loss, undergoes an increase and it is more pronounced for the 60 °C. • A good correlation is found between the evolutions of the different electrochemical parameters according to the temperature. - Abstract: The structure and the electrochemical hydrogen storage properties of amorphous Ti{sub 2}Ni alloy synthesized by ball milling and used as an anode in nickel–metal hydride batteries were studied. Nominal Ti{sub 2}Ni was synthesized under argon atmosphere at room temperature using a planetary high-energy ball mill. The structural and morphological characterization of the amorphous Ti{sub 2}Ni alloy is carried out by X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The electrochemical characterization of the Ti{sub 2}Ni electrodes is carried out by the galvanostatic charging and discharging, the constant potential discharge, the open circuit potential and the potentiodynamic polarization techniques. The Ti{sub 2}Ni alloy activation requires only one cycle of charge and discharge, regardless of the temperature. The electrochemical discharge capacity of the Ti{sub 2}Ni alloy, during the first eight cycles, and at a temperature of 30 °C, remained practically unchanged and a good held cycling is observed. By increasing the temperature, the electrochemical discharge capacity loss after eight cycles undergoes an increase and it is more pronounced for the temperature 60 °C. At 30 °C, the anodic corrosion current density is 1 mA cm{sup −2} and then it undergoes a rapid drop, remaining substantially constant (0.06 mA cm{sup −2}) in the range 40–60 °C, before undergoing a slight increase to 70 °C (0.3 mA cm{sup −2}). This variation is in good agreement with the maximum electrochemical discharge capacity values found for the
International Nuclear Information System (INIS)
Singh, B.N.; Edwards, D.J.; Eldrup, M.; Toft, P.
1997-01-01
Screening experiments were carried out to investigate the effect of bonding and bakeout thermal cycles on microstructure, mechanical properties and electrical resistivity of the oxide dispersion strengthened (GlidCop, CuAl-25) and the precipitation hardened (CuCrZr, CuNiBe) copper alloys. Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing, and bonding thermal treatment followed by re-ageing and the reactor bakeout treatment at 350 deg. C for 100 h. Tensile specimens of CuAl-25 were given the heat treatment corresponding to the bonding thermal cycle. A number of heat treated specimens were neuron irradiated at 250 deg. C to a dose level of ∼ 0.3 dpa in the DR-3 reactor at Risoe. Both unirradiated and irradiated specimens with various heat treatments were tensile tested at 250 deg. C. The microstructure and electrical resistivity of these specimens were determined in the unirradiated as well as irradiated conditions. The post-deformation microstructure of the irradiated specimens was also investigated. The fracture surfaces of both unirradiated and irradiated specimens were examined. Results of these investigations are reported in the present report. The main effect of the bonding thermal cycle heat treatment was a slight decrease in strength of CuCrZr and CuNiBe alloys. The strength of CuAl-25, on the other hand, remained almost unaltered. The post irradiation tests at 250 deg. C showed a severe loss of ductility in the case of CuNiBe alloy. The irradiated CuAl-25 and CuCrZr specimens, on the other hand, exhibited a reasonable amount of uniform elongation. The results are briefly discussed in terms of thermal and irradiation stability of precipitates and particles and irradiation-induced segregation, precipitation and recovery of dislocation microstructure. (au) 7 tabs., 28 ills., 15 refs
Manufacture and properties of molybdenum-rhenium alloys
International Nuclear Information System (INIS)
Fischer, B.; Freund, D.
2001-01-01
It is necessary to measure strength and creep behavior to guarantee the safe and reliable usage of refractory alloys at extremely high temperatures. In the literature there is very little information available about the properties of Mo-Re alloys at temperatures higher than 1000 C. A special test facility has been designed and built for stress-rupture testing at very high temperatures (up to 3000 C) of refractory metals and alloys in inert atmospheres. - The stress-rupture strength as well as the creep behavior of molybdenum-rhenium alloys with rhenium contents between 41 and 51 wt.% have been determined at temperatures ranging from 1200 to 2000 C, and rupture times of up to 10 hours using this facility. Previous measurements of stress-rupture strength and creep behavior of pure rhenium have been compared with the measurement results of Mo-Re alloys. - The discussion of the values measured is based on metallographic test results and scanning electron microscopy (SEM) images of Mo-Re alloy samples after stress-rupture testing. (orig.) [de
Oxide Morphology of a FeCrAl Alloy, Kanthal APMT, following Extended Aging at 300-600C
Energy Technology Data Exchange (ETDEWEB)
Li, Nan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Parker, Stephen Scott [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wood, Elizabeth Sooby [Univ. of Texas, San Antonio, TX (United States)
2017-09-19
Iron-chromium-aluminum (FeCrAl) alloys are of interest to the nuclear materials community due to their resistance to high temperature steam oxidation under accident conditions. The present work investigates oxide formation at temperatures relevant to light water reactor cladding operation following extended aging to assess growth kinetics, chemical composition, and microstructure of oxide formation on a commercial FeCrAl alloy, Fe-21wt.%Cr-5wt.%Al-3wt.%Mo (Kanthal APMT). Aging treatments were performed for 100-1000 hours in stagnant air at 300, 400, 500, and 600 °C, respectively. Oxide growth behavior under the investigated conditions follows a logarithmic time dependence. When the oxidization temperature is 400 °C or below, the oxide is amorphous. At 500 °C, isolated crystalline regions start to appear during short period aging time and expand with extended exposures. Crystalline α-Al2O3 oxide film develops at 600 °C and the correlated logarithmic rate constant decreases significantly, indicating enhanced oxidation resistance of the formed oxide film. In addition, Mo segregation at grain boundaries has been observed when the aging temperature exceeds 500 °C. The results of this study can be viewed as an upper bounding result for potential oxide coarsening during reactor operation.
Energy Technology Data Exchange (ETDEWEB)
Chiapetto, M., E-mail: mchiapet@sckcen.be [SCK-CEN, Nuclear Materials Science Institute, Boeretang 200, B-2400 Mol (Belgium); Unité Matériaux Et Transformations (UMET), UMR 8207, Université de Lille 1, ENSCL, F-59600 Villeneuve d’Ascq Cedex (France); Becquart, C.S. [Unité Matériaux Et Transformations (UMET), UMR 8207, Université de Lille 1, ENSCL, F-59600 Villeneuve d’Ascq Cedex (France); Laboratoire commun EDF-CNRS Etude et Modélisation des Microstructures pour le Vieillissement des Matériaux (EM2VM) (France); Domain, C. [EDF R& D, Département Matériaux et Mécanique des Composants, Les Renardières, F-77250 Moret sur Loing (France); Laboratoire commun EDF-CNRS Etude et Modélisation des Microstructures pour le Vieillissement des Matériaux (EM2VM) (France); Malerba, L. [SCK-CEN, Nuclear Materials Science Institute, Boeretang 200, B-2400 Mol (Belgium)
2015-06-01
Radiation-induced embrittlement of bainitic steels is one of the most important lifetime limiting factors of existing nuclear light water reactor pressure vessels. The primary mechanism of embrittlement is the obstruction of dislocation motion produced by nanometric defect structures that develop in the bulk of the material due to irradiation. The development of models that describe, based on physical mechanisms, the nanostructural changes in these types of materials due to neutron irradiation are expected to help to better understand which features are mainly responsible for embrittlement. The chemical elements that are thought to influence most the response under irradiation of low-Cu RPV steels, especially at high fluence, are Ni and Mn, hence there is an interest in modelling the nanostructure evolution in irradiated FeMnNi alloys. As a first step in this direction, we developed sets of parameters for object kinetic Monte Carlo (OKMC) simulations that allow this to be done, under simplifying assumptions, using a “grey alloy” approach that extends the already existing OKMC model for neutron irradiated Fe–C binary alloys [1]. Our model proved to be able to describe the trend in the buildup of irradiation defect populations at the operational temperature of LWR (∼300 °C), in terms of both density and size distribution of the defect cluster populations, in FeMnNi model alloys as compared to Fe–C. In particular, the reduction of the mobility of point-defect clusters as a consequence of the presence of solutes proves to be key to explain the experimentally observed disappearance of detectable point-defect clusters with increasing solute content.
Method to increase the toughness of aluminum-lithium alloys at cryogenic temperatures
Sankaran, Krishnan K. (Inventor); Sova, Brian J. (Inventor); Babel, Henry W. (Inventor)
2006-01-01
A method to increase the toughness of the aluminum-lithium alloy C458 and similar alloys at cryogenic temperatures above their room temperature toughness is provided. Increasing the cryogenic toughness of the aluminum-lithium alloy C458 allows the use of alloy C458 for cryogenic tanks, for example for launch vehicles in the aerospace industry. A two-step aging treatment for alloy C458 is provided. A specific set of times and temperatures to age the aluminum-lithium alloy C458 to T8 temper is disclosed that results in a higher toughness at cryogenic temperatures compared to room temperature. The disclosed two-step aging treatment for alloy 458 can be easily practiced in the manufacturing process, does not involve impractical heating rates or durations, and does not degrade other material properties.
International Nuclear Information System (INIS)
Chemingui, Mahmoud; Khitouni, Mohamed; Jozwiak, Karol; Mesmacque, Gerard; Kolsi, Abdelwaheb
2010-01-01
Fine-scale precipitation of the η' phase and its precursors are essential for the mechanical properties of Al-4.6 wt%Zn-1.2 wt%Mg alloy. This paper deals with an investigation of precipitation in an industrial Al-Zn-Mg alloy at various stages of a conventional two-step ageing treatment at 70 o C and 135 o C. The effect of microstructure on the mechanical properties was performed using microhardness and tensile tests, together with optical, scanning and transmission electron microscopy. After ageing at 135 o C, corresponding to the maximum value of hardness, small η' precipitates were observed in the alloy matrix. After two-step ageing at 70 o C plus at 135 o C, the volume fraction of this precipitate becomes higher. Consequently, the yield strength of the material increases and it maintains its ductility. This high precipitate density slows the dislocation movement and thus a higher stress was required for its bowing.
Monte Carlo dosimetry for 125I and 103Pd eye plaque brachytherapy
International Nuclear Information System (INIS)
Thomson, R. M.; Taylor, R. E. P.; Rogers, D. W. O.
2008-01-01
A Monte Carlo study of dosimetry for eye plaque brachytherapy is performed. BrachyDose, an EGSnrc user code which makes use of Yegin's multi-geometry package, is used to fully model 125 I (model 6711) and 103 Pd (model 200) brachytherapy seeds and the standardized plaques of the Collaborative Ocular Melanoma Study (COMS). Three-dimensional dose distributions in the eye region are obtained. In general, dose to water is scored; however, the implications of replacing water with eye tissues are explored. The effect of the gold alloy (Modulay) backing is investigated and the dose is found to be sensitive to the elemental composition of the backing. The presence of the silicone polymer (Silastic) seed carrier results in substantial dose decreases relative to water, particularly for 103 Pd. For a 20 mm plaque with a Modulay backing and Silastic insert, fully loaded with 24 seeds, the dose decrease relative to water is of the order of 14% for 125 I and 20% for 103 Pd at a distance of 1 cm from the inner sclera along the plaque's central axis. For the configurations of seeds used in COMS plaques, interseed attenuation is a small effect within the eye region. The introduction of an air interface results in a dose reduction in its vicinity which depends on the plaque's position within the eye and the radionuclide. Introducing bone in the eye's vicinity also causes dose reductions. The dose distributions in the eye for the two different radionuclides are compared and, for the same prescription dose, 103 Pd generally offers a lower dose to critical normal structures. BrachyDose is sufficiently fast to allow full Monte Carlo dose calculations for routine clinical treatment planning.
Lifescience Database Archive (English)
Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006
Lifescience Database Archive (English)
Full Text Available ucing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 1...05 4e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 CP0015
Absolute calibration of the Rh-103 (n, n') Rh-103m reaction rate
Energy Technology Data Exchange (ETDEWEB)
Taylor, W.H.; Murphy, M.F.; March, M.R. [Reactor Physics Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)
1979-05-15
The uncertainties in determining the absolute values of the Rh-103 (n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to {approx}{+-}5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the I.A.E.A. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Commerce. 1220.103 Section 1220.103 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.103 Commerce. The term commerce means interstate, foreign, or intrastate commerce. ...
Hot mechanical behaviour of dispersion strengthened Cu alloys
International Nuclear Information System (INIS)
Garcia G, Jose; Espinoza G, Rodrigo; Palma H, Rodrigo; Sepulveda O, Aquiles
2003-01-01
This work is part of a research project which objective is the improvement of the high-temperature mechanical properties of copper, without an important decrease of the electrical or thermal conduction properties. The general hypothesis is that this will be done by the incorporation of nanometric ceramic dispersoids for hindering the dislocation and grain boundaries movement. In this context, the object of the present work is the study of the resistance to hot deformation of dispersion-strengthened copper alloys which have prepared by reactive milling. Two different alloys, Cu-2,39wt.%Ti-0.56wt.%C and Cu-1.18wt.%Al, were prepared so as obtain a copper matrix reinforced with nanometric TiC y Al 2 O 3 particles with a nominal total amount of 5 vol.%. The particles were developed by an in-situ formation process during milling. The materials were prepared in an attritor mill, and consolidated by extrusion at 750 o C, with an area reduction rate of 10:1. The resistance to hot deformation was evaluated by hot compression tests at 500 and 850 o C, at initial strain rates of 10 -3 and 10 -4 s-1. To evaluate the material softening due temperature, annealing at 400, 650 y 900 o C during 1h were applied; after that, hardness was measured at room temperature. Both studies alloys presented a higher resistance to hot deformation than pure copper, with or without milling. Moreover, the Cu-Ti-C alloy presented a mechanical resistance higher than that of the Cu-Al one. Both alloys presented strain-stress compression curves with a typical hot-work shape: an initial maximum followed by a stationary plateau. The Cu-Ti-C alloy had a higher hardness and did not present a hardness decay even after annealings at the higher temperature imposed (900 o C), while the Cu-Al alloy did exhibit a strong decay of hardness after the annealing at 900 o C. The best behaviour exhibited by the Cu-Ti C alloy, was attributed to the formation of a major quantity of dispersoids that in the Cu-Al alloy. In
Hot corrosion behavior of Ni-Cr-W-C alloys in impure helium gas
International Nuclear Information System (INIS)
Ohmura, Taizo; Sahira, Kensho; Sakonooka, Akihiko; Yonezawa, Noboru
1976-01-01
Influence of the minor alloy constituents such as Al, Mn and Si on the hot corrosion behavior of Ni-20Cr-20W-0.07C alloy was studied in 99.995% helium gas at 1000 0 C, comparing with that behavior of commercial Ni-base superalloys (Hastelloy X and Inconel 617). The low oxidizing potential in the impure helium gas usually causes selective oxidation of these elements and the growth of oxide whiskers on the surface of specimen at elevated temperature. The intergranular attack was caused by selective oxidation of Al, Si and Mn. The spalling of oxide film was restrained by addition of Mn and Si, providing tough spinel type oxide film on the surface and 'Keyes' on the oxide-matrix interface respectively. The amount and the morphology of the oxide whiskers depended on Si and Mn content. More than 0.29% of Si content without Mn always caused the growth of rather thinner whiskers with smooth surface, and the whiskers analyzed by electron diffraction patterns and EPMA to be Cr 2 O 3 containing Si. Mn addition changed the whiskers to thicker ones of spinel type oxide (MnCr 2 O 1 ) with rough surface. On the basis of these results, the optimum content of Al, Mn and Si to minimize the growth of whiskers, the intergranular attack and the spalling of oxide film was discussed. (auth.)
Chellman, D. J.; Gurganus, T. B.; Walker, J. A.
1992-01-01
The results of a series of material studies performed by the Lockheed Aeronautical Systems Company over the time period from 1980 to 1991 are discussed. The technical objective of these evaluations was to develop and characterize advanced aluminum alloy materials with temperature capabilities extending to 350 F. An overview is given of the first five alloy development efforts under this contract. Prior work conducted during the first five modifications of the alloy development program are listed. Recent developments based on the addition of high Zr levels to an optimum Al-Cu-Mg alloy composition by powder metallurgy processing are discussed. Both reinforced and SiC or B4C ceramic reinforced alloys were explored to achieve specific target goals for high temperature aluminum alloy applications.
Directory of Open Access Journals (Sweden)
Wojciech Szkliniarz
2018-03-01
Full Text Available One of the major barriers limiting the suitability of TiAl intermetallic alloys for use in the demanding aircraft and automotive industries is their susceptibility to degradation as a result of oxidation at temperatures exceeding 760 °C. Paper presents the characteristics of resistance to cyclic oxidation at 950 °C for Ti–45Al–8Nb–0.5(B, C alloy with and without protective coating obtained as a result of aluminizing using out of pack method. The characteristics of surface condition were determined by scanning electron microscope with EDS system, transmission electron microscope, and X-ray diffractometer. The favorable behavior of the Ti–45Al–8Nb–0.5(B, C alloy with a protective coating under cyclic oxidation conditions is a result of a higher content of Al2O3 in the microstructure of the scale and the presence of Al and Nb-rich phases at the substrate interface, which probably constitue a barrier for oxidation process. The high temperature oxidation test revealed that aluminide coating was responsible for a remarkable improvement in the oxidation resistance.
Phase transformations on Zr-Nb alloys
International Nuclear Information System (INIS)
Doi, Sergio Norifumi
1980-01-01
This research intended the laboratory scale experimental development of Zr-Nb alloys with adequate characteristics for use as fuel element cladding or for the making of irradiation capsules. Zr-Nb alloys with different Nb contents were melted and the resulting material was characterised. The following metallurgical aspects were considered: preparation of Zr-Nb alloys with various Nb contents; heat and thermomechanical treatments; microstructural characterization; mechanical properties; oxidation properties. The influence of the heat treatment and thermomechanical treatment, on the out-of-pile mechanical and oxidation properties of the Zr-Nb alloys were studied. It was found that the alloy microhardness increases with the Nb content and/or with the thermomechanical treatment. Mechanical properties such as yield and ultimate tensile strength as well as elongation were determined by means of compression tests. The results showed that the alloy yield stress increases with the Nb content and with the thermomechanical treatment, while its elongation decreases. Thermogravimetric analysis determined the alloy oxidation kinetics, in the 400 - 800 deg C interval, at 1 atm. oxygen pressure. The results showed that the alloy oxidation rate increases with the temperature and Nb content. It was also observed that the oxidation rate increases considerably for temperatures higher than 600 deg C.(author)
High-alloy steels and nickel alloys for construction of industrial plants. Pt. 2
International Nuclear Information System (INIS)
2007-01-01
Vol. 2 of the 8. Dresden Corrosion Protection Seminar comprises eight papers, most of which are in the form of PowerPoint presentations: High-temperature materials and their applications in chemical engineering (J. Kloever); Alloy 602 CA in metal dusting conditions; Material requirements in future power plants (H. Schneider); Status report on material qualification for the 700 C technology in coal power plants (R. Mohrmann); Materials for nuclear fusion (M. Paju); The degradation mechanism relaxation cracking as exemplified by the alloys 800 H and 617 (H.C. van Wortel); Specific requirements on the design of a pressurised manifold of Alloy 800 H in refineries, a case study (I. Rommerskirchen et al.); Materials for electro-surfacing for corrosion protection in conditions of high-temperature corrosion (M.Spiegel) [de
Directory of Open Access Journals (Sweden)
Tao-Hsing Chen
2016-03-01
Full Text Available The deformation behavior and fracture characteristics of NiAl intermetallic alloy containing 5~7 at% Cu are investigated at room temperature under strain rates ranging from 1 × 10−3 to 5 × 103 s−1. It is shown that the copper contents and strain rate both have a significant effect on the mechanical behavior of the NiAl alloy. Specifically, the flow stress increases with an increasing copper content and strain rate. Moreover, the ductility also improves as the copper content increases. The change in the mechanical response and fracture behavior of the NiAl alloy given a higher copper content is thought to be the result of the precipitation of β-phase (Ni,CuAl and γ'-phase (Ni,Cu3Al in the NiAl matrix.
Wang, Peng; Zong, Lanlan; Guan, Zhongjie; Li, Qiuye; Yang, Jianjun
2018-02-01
An economic and effective Pt-based alloy cocatalyst has attracted considerable attention due to their excellent catalytic activity and reducing Pt usage. In this study, PtNi alloy cocatalyst was successfully decorated on the g-C3N4/GO hybrid photocatalyst via a facile chemical reduction method. The Eosin Y-sensitized g-C3N4/PtNi/GO-0.5% composite photocatalyst yields about 1.54 and 1178 times higher hydrogen evolution rate than the Eosin Y-sensitized g-C3N4/Pt/GO-0.5% and g-C3N4/Ni/GO-0.5% samples, respectively. Mechanism of enhanced performance for the g-C3N4/PtNi/GO composite was also investigated by different characterization, such as photoluminescence, transient photocurrent response, and TEM. These results indicated that enhanced charge separation efficiency and more reactive sites are responsible for the improved hydrogen evolution performance due to the positive synergetic effect between Pt and Ni. This study suggests that PtNi alloy can be used as an economic and effective cocatalyst for hydrogen evolution reaction. [Figure not available: see fulltext.
International Nuclear Information System (INIS)
Luo, J.S.; Merchant, N.; Maroni, V.A.; Gruen, D.M.; Tani, B.S.; Sandhage, K.H.; Craven, C.A.
1991-11-01
Textured superconducting films of YbBa 2 Cu 3 O 7-δ supported on single and polycrystalline substrates were prepared by oxidation of a liquid precursor alloy. The substrates were coated by dipping them into a molten alloy (YbBa 2 Cu 3 , m.p. ∼870 degree C), withdrawing them from the melt, then oxidizing the adhering liquid alloy layer to the corresponding oxide phase, i.e., YbBa 2 Cu 3 O 7-δ . Samples prepared in this way exhibited a superconducting transition at ∼80 K following annealing in pure OP 2 at 500 degree C. With SrTiO 3 (100) and MgO (100) substrates, evidence was seen for the epitaxial growth of YbBa 2 Cu 3 O 7-δ crystals having their c-axis parallel to the [100] direction of the substrate. For polycrystalline MgO, x-ray diffraction and microstructural examination showed that the high-T c crystallites in the films were also oriented with their c-axis perpendicular to the substrate surface, but the a and b axes directions were randomly oriented rather than epitaxial
Point defects in B.C.C. Fe-Al, Fe-Co, and Fe-Co-V ordered alloys
International Nuclear Information System (INIS)
Riviere, J.P.; Dinhut, J.F.
1982-01-01
Radiation damage produced at 20 K by 2.5 MeV electrons is studied in three B 2 type Fe-40 at % Al, Fe-Co, Fe-Co-V ordered alloys. The resistivity damage in Fe-40 at % Al ordered single crystals is found less effective in the directions. The results suggest that replacement collision chains are difficult to propagate along the direction. Frenkel pair creation superimposed with disordering can account for the resistivity damage in the initially ordered Fe-Co alloy. Informations concerning replacement collision sequences in direction are derived. During the recovery of all the alloys, three main stages are observed and an ordering enhancement occurs. (author)
Separation of rhodium-103m from ruthenium-103 by solvent extraction
International Nuclear Information System (INIS)
Chiu, J.H.; Landolt, R.R.; Kessler, W.V.
1978-01-01
The results for eight replications of the solvent extraction and purification procedures were /sup 103m/Rh yield, 100.9 +- 2.1% and 103 Ru contamination, 0.0%. The use of sodium hypochlorite as the oxidizing agent eliminated the need for fuming with 1:1 H 2 SO 4 to eliminate chlorides as was required when ceric sulfate was used as the oxidizing agent. The optimum pH for extraction of RuO 4 into CCl 4 was determined to be in the range 6.5 to 7.5. A boiling procedure was used to purify the extracted aqueous solution of /sup 103m/Rh
Structure and properties of alloys of A15 type compounds with carbon
International Nuclear Information System (INIS)
Savitskij, E.M.; Efimov, Yu.V.; Myasnikova, E.A.
1983-01-01
Microstructure and some properties of the alloys on the base of the phases of A15 type in the V-Si-C, Nb-Si-C, Nb-Sn-C, Nb-Al-C, Nb-Ga-C, V-Ga-C ternary systems are investigated. It is established that in the niobium-rich corners of the A-B-C ternary systems the new ternary conpounds do not form, as a rule, bUt the wide ranges of threephase equilibrium A-A 3 B-C exist. New ternary phases with A15 type structure stabilized with carbon are established only in the Nb-Si-C and V-Al-C systems. Alloying with carbon results in sharp refining of structural components of stable and metastable alloys, promotes transition of the alloys into amorphous state at super fast cooling of the melts as well as increases stability of metastable state of the alloys against tempering. After super fast quenching and tempering Tsub(c) of the ternary alloys close to the A15 phases exceed Tsub(c) of equilibrium samples
Annealing behavior of high permeability amorphous alloys
International Nuclear Information System (INIS)
Rabenberg, L.
1980-06-01
Effects of low temperature annealing on the magnetic properties of the amorphous alloy Co 71 4 Fe 4 6 Si 9 6 B 14 4 were investigated. Annealing this alloy below 400 0 C results in magnetic hardening; annealing above 400 0 C but below the crystallization temperature results in magnetic softening. Above the crystallization temperature the alloy hardens drastically and irreversibly. Conventional and high resolution transmission electron microscopy were used to show that the magnetic property changes at low temperatures occur while the alloy is truly amorphous. By imaging the magnetic microstructures, Lorentz electron microscopy has been able to detect the presence of microscopic inhomogeneities in this alloy. The low temperature annealing behavior of this alloy has been explained in terms of atomic pair ordering in the presence of the internal molecular field. Lorentz electron microscopy has been used to confirm this explanation
International Nuclear Information System (INIS)
Ngo Xuan Hung; Pham Duc Thai; Nguyen The Khanh; Vu Quang Chat; Nguyen Huu Quyet
2007-01-01
Up to now, hospitals in Vietnam have mostly imported radioactive equipments from America, German, France, England to treat cancer. Accompany with those equipments, alloy, namely Cyroben having low melting temperature (≤ 80 o C) is used to cover patients good tissues in order to protect them against harmful rays and help radioactive rays get through the cast hole to kill cancer cells. This project is carried out for determining chemical compositions and melting temperatures of researched alloy to create alloy having low melting temperature (≤ 80 o C) to meet demand for treating cancer in Vietnam. (author)
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Application. 646.103 Section 646.103 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad-Highway Insurance Protection § 646.103 Application. (a) This part applies: (1) To a contractors' legal...
33 CFR 174.103 - Administration.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Administration. 174.103 Section 174.103 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED....103 Administration. The State casualty reporting system must be administered by a State agency that...
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Location. 960.103 Section 960.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EXECUTIVE BOARDS § 960.103 Location. Federal Executive Boards have been established and shall continue in...
Gupta, Sharad; Mehta, Aruna S
2012-01-01
Remelting previously cast base metal alloy can adversely affect the mechanical properties of the alloy and necessitates addition of new alloy. To study the effect of remelting different combinations of new and used cobalt-chromium (Co-Cr) alloy on its mechanical properties and microstructure. Using induction casting, 24 tensile test specimens were prepared for eight different combinations of new and used Co-Cr alloy. The test specimens were assessed for yield strength and percentage elongation. Microhardness was evaluated using Vickers's hardness tester. The tensile testing was carried out on a 50 kN servo-hydraulic universal testing machine. Microstructure analysis was done using an optical photomicroscope on the fractured samples after acid etching. The mean values (±standard deviation) and coefficient of variation were calculated. Student's 't' test was used for statistical analysis. Statistical significance was assumed at P=.05. The mean yield strength of eight different combination groups were as follows: group A: 849 MPa, group B ₁ : 834 MPa, group B ₂ : 915 MPa, group B ₃ : 897 MPa, group C ₁ : 874 MPa, group C ₂ : 859 MPa, group D ₁ : 845 MPa, and group D ₂ : 834 MPa. The mean percentage elongation for the different groups were as follows: group A: 7%, group B ₁ : 7%, group B ₂ : 8%, group B ₃ : 7%, group C ₁ : 8%, group C ₂ : 7%, group D ₁ : 7%, and group D 2 : 8%. The mean hardness values were as follows: group A: 373 VHN, group B ₁ : 373 VHN, group B ₂ : 346 VHN, group B ₃ : 346 VHN, group C ₁ : 364 VHN, group C ₂ : 343 VHN, group D ₁ : 376 VHN, and group D ₂ : 373 VHN. Repeated remelting of base metal alloy for dental casting without addition of new alloy can affect the mechanical properties of the alloy. Microstructure analysis shows deterioration upon remelting. However, the addition of 25% and 50% (by weight) of new alloy to the remelted alloy can bring about improvement both in mechanical properties and in
International Nuclear Information System (INIS)
Lu, H.; Li, C.X.; Yin, F.X.; Fang, Q.F.; Umezawa, O.
2012-01-01
Highlights: ► The O Snoek-type relaxation in the Ti–Nb–X–O alloys was investigated. ► The dipole shape factor (δλ) and critical temperature T c were deduced from the peak. ► The δλ and T c were analyzed in terms of the d-orbital energy level (Md). ► With decreasing Md, the δλ increases and saturates at last while the T c decreases. ► The Md can be taken as a key parameter in designing high damping β-Ti alloys. - Abstract: The effect of alloying elements on the oxygen Snoek-type relaxation in the Ti–24Nb–X–1.7O alloys (X = 1Al, 2Al, 1Sn, 2Sn, 2Cr, 2Mn) was investigated in order to develop high damping materials based on point defect relaxation process. The relaxation strength of the Ti–Nb–Al–O and Ti–Nb–Sn–O alloys is the highest while that of the Ti–Nb–Mn–O and Ti–Nb–Cr–O alloys is the lowest. The dipole shape factor (δλ) and critical temperature T c , which are intrinsic to the Snoek-type relaxation, were figured out and analyzed in terms of the d-orbital energy level (Md) for each alloy based on the measured damping peak. With the decreasing Md, the δλ increases and saturates at last when the Md decreases to a certain value (about 2.435 eV), while the critical temperature T c decreases linearly. The parameter Md can be taken as a key parameter in designing high damping β-Ti alloys, that is, to design an intermediate value of Md at which the values of both δλ and T c are as high as possible.
Corrosion of alloys of the niobium--titanium--aluminium system
International Nuclear Information System (INIS)
Andreeva, V.V.; Alekseeva, E.L.; Dontsov, S.N.; Moiseeva, I.S.
The mechanical properties and corrosion resistance of niobium--titanium--aluminum alloys in 20 percent HCl and 40--75 percent H 2 SO 4 at 40 and 100 0 C are considered. Current density vs potential and corrosion rate vs potential potentiostatic curves plotted in 75 percent H 2 SO 4 at 140 0 C for the alloys with different titanium contents at a constant content of aluminum and also for alloys with a constant titanium content at different contents of aluminum are given. It was shown that the corrosion resistance of the alloys in 75 percent H 2 SO 4 at 140 0 C is an exponential function of the atomic content of the alloying components (Ti, Al) in them; aluminum vitiates the corrosion resistance very strongly
The W alloying effect on thermal stability and hardening of nanostructured Cu-W alloyed thin films.
Zhao, J T; Zhang, J Y; Hou, Z Q; Wu, K; Feng, X B; Liu, G; Sun, J
2018-05-11
In order to achieve desired mechanical properties of alloys by manipulating grain boundaries (GBs) via solute decoration, it is of great significance to understand the underlying mechanisms of microstructural evolution and plastic deformation. In this work, nanocrystalline (NC) Cu-W alloyed films with W concentrations spanning from 0 to 40 at% were prepared by using magnetron sputtering. Thermal stability (within the temperature range of 200 °C-600 °C) and hardness of the films were investigated by using the x-ray diffraction, transmission electron microscope (TEM) and nanoindentation, respectively. The NC pure Cu film exhibited substantial grain growth upon all annealing temperatures. The Cu-W alloyed films, however, displayed distinct microstructural evolution that depended not only on the W concentration but also on the annealing temperature. At a low temperature of 200 °C, all the Cu-W alloyed films were highly stable, with unconspicuous change in grain sizes. At high temperatures of 400 °C and 600 °C, the microstructural evolution was greatly controlled by the W concentrations. The Cu-W films with low W concentration manifested abnormal grain growth (AGG), while the ones with high W concentrations showed phase separation. TEM observations unveiled that the AGG in the Cu-W alloyed thin films was rationalized by GB migration. Nanoindentation results showed that, although the hardness of both the as-deposited and annealed Cu-W alloyed thin films monotonically increased with W concentrations, a transition from annealing hardening to annealing softening was interestingly observed at the critical W addition of ∼25 at%. It was further revealed that an enhanced GB segregation associated with detwinning was responsible for the annealing hardening, while a reduced solid solution hardening for the annealing softening.
14 CFR 1201.103 - Administration.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Administration. 1201.103 Section 1201.103 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION STATEMENT OF ORGANIZATION AND GENERAL INFORMATION Introduction § 1201.103 Administration. (a) NASA is headed by an Administrator, who is appointed...
International Nuclear Information System (INIS)
Garner, F.A.; Brager, H.R.
1986-03-01
The swelling of pure copper and various copper-base alloys has been determined at 47.2 dpa after irradiation in FFTF-MOTA at ∼450 0 C. Data are also becoming available at 63.3 dpa. The alloys tend to fall into two broad categories, those that swell appreciably, sometimes with an S-shaped behavior, and those that resist swelling to very high neutron exposures. It appears that copper may have an intrinsic swelling rate of ∼1%/dpa that is often not reached due to its tendency toward saturation of swelling. The most swelling-resistant alloys examined to date are CuAl25, MZC and Cu-2.0Be
Superconductivity in CeCu/sub 2/Si/sub 2/: dependence of Tsub(c) on alloying and stoichiometry
Energy Technology Data Exchange (ETDEWEB)
Spille, H; Rauchschwalbe, U; Steglich, F [Technische Hochschule Darmstadt (Germany, F.R.). Inst. fuer Festkoerperphysik
1938-01-01
The authors have determined the transition temperatures of the alloy systems (Ce,M)Cu/sub 2/Si/sub 2/ with M = La, Y, Sc, Ce(Cu,T)/sub 2/Si/sub 2/ with T = Ag, Au, Mn, Ru, Rh, Pd and CeCu/sub 2/(Si,Ge)/sub 2/ as well as of CeCu/sub 2/Si/sub 2/ samples with varying stoichiometry. In each case, alloying is found to depress Tsub(c), the critical concentrations necessary to destroy superconductivity ranging between < 1 at.% and 10 at.%. Off-stoichiometry samples with a Cu- or Ce-deficiency of a few at.% are not superconducting, while samples prepared with a comparable excess of Cu or Ce show sharp transitions at Tsub(c) >approx. 600 mK. It is inferred that stoichiometric CeCu/sub 2/Si/sub 2/ contains substantial concentrations of Cu- and Ce-vacancies, which hinder superconductivity. First results on CeCu/sub 2/Si/sub 2/ single crystals, which exhibit bulk superconductivity, are also reported.
Localized Corrosion Susceptibility Of Alloy 22 In Na-K-Cl()NO3 Brines At 110 To 150?C
International Nuclear Information System (INIS)
Lian, T; Felker, S J; Hailey, P D; Staggs, K J; Gdowski, G E
2006-01-01
Electrochemical cyclic potentiodynamic polarization experiments were conducted to assess crevice corrosion of Alloy 22 in de-aerated aqueous solutions of chloride and nitrate salts of potassium and sodium in the temperature range 110-150 C. The tests were run in neutral and slightly acidic aqueous solutions. The Alloy 22 specimens were multiple creviced weld prisms. No evidence of crevice corrosion was observed in the range 125-150 C. In the 120 to 160 C temperature range, the anionic concentration of stable aqueous solutions is dominated by nitrate relative to chloride. At nominally 120 C, the minimum nitrate to chloride ratio is about 4.5, and it increases to about 22 at nominally 155 C. The absence of localized corrosion susceptibility in these solutions is attributed to the known inhibiting effect of the nitrate anion. Aqueous solution chemistry studies indicate that nitrate to chloride ratios of less than 0.5 are possible for temperatures up to nominally 116 C. At 110 C, aqueous solutions can have dissolved chloride well in excess of nitrate. Localized corrosion was observed at nitrate to chloride ratios up to 1.0, the highest ratio tested. The extent of localized corrosion was confined to the crevice region of the samples, and was limited for nitrate to chloride ratios greater than or equal to 0.3
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 308.103 Section 308.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS VOLUNTEER SERVICE § 308.103 Authority. Section 301 of the Civil Service Reform Act of 1978, Public Law 95-454, authorized Federal...
Lifescience Database Archive (English)
Full Text Available ificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL15...142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA ...(cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006
Structure, mechanical properties, and grindability of dental Ti-Zr alloys.
Ho, Wen-Fu; Chen, Wei-Kai; Wu, Shih-Ching; Hsu, Hsueh-Chuan
2008-10-01
Structure, mechanical properties and grindability of a series of binary Ti-Zr alloys with zirconium contents ranging from 10 to 40 wt% have been investigated. Commercially pure titanium (c.p. Ti) was used as a control. Experimental results indicated that the diffraction peaks of all the Ti-Zr alloys matched those for alpha Ti. No beta-phase peaks were found. The hardness of the Ti-Zr alloys increased as the Zr contents increased, and ranged from 266 HV (Ti-10Zr) to 350 HV (Ti-40Zr). As the concentration of zirconium in the alloys increased, the strength, elastic recovery angles and hardness increased. Moreover, the elastically recoverable angle of Ti-40Zr was higher than of c.p. Ti by as much as 550%. The grindability of each metal was found to be largely dependent on the grinding conditions. The Ti-40Zr alloy had a higher grinding rate and grinding ratio than c.p. Ti at low speed. The grinding rate of the Ti-40Zr alloy at 500 m/min was about 1.8 times larger than that of c.p. Ti, and the grinding ratio was about 1.6 times larger than that of c.p. Ti. Our research suggested that the Ti-40Zr alloy has better mechanical properties, excellent elastic recovery capability and improved grindability at low grinding speed. The Ti-40Zr alloy has a great potential for use as a dental machining alloy.
Process for the manufacture of adhering NbC layers on components consisting of NiCr alloys
International Nuclear Information System (INIS)
Kleemann, W.
1985-01-01
The invention concerns a process for the manufacture of adhering NbC layers on Ni Cr alloys, whose adhesion is guaranteed in a helium atmosphere even at high temperatures (≥ 950 0 C). Differing from the conventional process in which such layers are applied by thermal spraying, and which does not provide layers adhering at high temperatures, the NbC layers are formed in situ, by applying a niobium layer on the components to be coated and by subsequent carburisation of the niobium layer by means of existing CH 4 impurities in the helium atmosphere. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Kim, JunKi; Oh, YoungMin; Kim, YongDeog; Kim, SeonJin [Hanyang Univ., Seoul (Korea, Republic of); Kim, ByungChul [KOREA ATOMIC RESEARCH INSTITUTE, TAEJON (Korea, Republic of)
1997-05-01
The room and elevated temperature tensile strength of mechanically alloyed Al-8wt%. Ti alloy increased by substituting Ce for Ti up to 25at.%. However, further substitution of Ce for Ti decreased the tensile strength. It was considered to be due to the decrease of volume fraction of Ce contained dispersoid. In the meantime, the decrease of tensile strength due to the isothermal aging was effectively reduced by the addition of Ce at 400 deg. C but not 510 deg. C. The activation energies for the deformation of Al-80wt.%(Ti+Ce)alloys measured at the temperature between 300 deg. C{approx}510 deg. C were about 1.3{approx}1.9 times higher than that for pure Al self-diffusion(142 kJ/mole). Thus, it was considered that the elevated temperature deformation of Al-8wt.%(Ti+Ce)alloys was governed by Orowan mechanism (author). 9 refs. 6 figs.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Discovery. 1386.103 Section 1386.103 Public... Hearing Procedures § 1386.103 Discovery. The Department and any party named in the Notice issued pursuant to § 1386.90 has the right to conduct discovery (including depositions) against opposing parties as...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 535.103 Section 535.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CRITICAL POSITION PAY AUTHORITY § 535.103 Authority. (a) Subject to a grant of authority from OPM in consultation with OMB and all other...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 304.103 Section 304.103... APPOINTMENTS § 304.103 Authority. (a) Basic authority. (1) When authorized by an appropriation or other statute... expert or consultant who works on a strictly intermittent basis may be appointed under this authority...
International Nuclear Information System (INIS)
Kalezic-Glisovic, A.; Novakovic, L.; Maricic, A.; Minic, D.; Mitrovic, N.
2006-01-01
The differential scanning calorimetry method was used for investigating the crystallization process of the Fe 89.8 Ni 1.5 Si 5.2 B 3 C 0.5 amorphous alloy. It was shown that the examined alloy crystallizes in three stages. The first crystallization stage occurs at 799 K, the second at 820 K and the third at 888 K. Temperature dependence of the magnetic susceptibility relative change was investigated by the modified Faraday method in the temperature region from room temperature up to 900 K. It has been established that the Curie temperature is about 700 K for amorphous state. The magnetic susceptibility increases by 30% after the first heating up to 710 K. During the second heating up to 840 K the alloy loses its ferromagnetic features in the temperature region from 710 to 750 K, upon which it again regains the same. After the second heating magnetic susceptibility decreases by 23% as compared to the amorphous starting value and by 53% as compared to the value before the second heating. The crystallized alloy maintains ferromagnetic features in the whole temperature region during the heating up to 900 K
Energy Technology Data Exchange (ETDEWEB)
Kalezic-Glisovic, A. [Joint Laboratory for Advanced Materials of SASA, Section for Amorphous Systems, Technical Faculty Cacak, Svetog Save 65, 32000 Cacak (Serbia and Montenegro)]. E-mail: aleksandrakalezic@eunet.yu; Novakovic, L. [Faculty of Physics, Studentski trg 16, 11000 Belgrade (Serbia and Montenegro); Maricic, A. [Joint Laboratory for Advanced Materials of SASA, Section for Amorphous Systems, Technical Faculty Cacak, Svetog Save 65, 32000 Cacak (Serbia and Montenegro); Minic, D. [Faculty of Physical Chemistry, Studentski trg 16, 11000 Belgrade (Serbia and Montenegro); Mitrovic, N. [Joint Laboratory for Advanced Materials of SASA, Section for Amorphous Systems, Technical Faculty Cacak, Svetog Save 65, 32000 Cacak (Serbia and Montenegro)]. E-mail: nmitrov@tfc.kg.ac.yu
2006-07-15
The differential scanning calorimetry method was used for investigating the crystallization process of the Fe{sub 89.8}Ni{sub 1.5}Si{sub 5.2}B{sub 3}C{sub 0.5} amorphous alloy. It was shown that the examined alloy crystallizes in three stages. The first crystallization stage occurs at 799 K, the second at 820 K and the third at 888 K. Temperature dependence of the magnetic susceptibility relative change was investigated by the modified Faraday method in the temperature region from room temperature up to 900 K. It has been established that the Curie temperature is about 700 K for amorphous state. The magnetic susceptibility increases by 30% after the first heating up to 710 K. During the second heating up to 840 K the alloy loses its ferromagnetic features in the temperature region from 710 to 750 K, upon which it again regains the same. After the second heating magnetic susceptibility decreases by 23% as compared to the amorphous starting value and by 53% as compared to the value before the second heating. The crystallized alloy maintains ferromagnetic features in the whole temperature region during the heating up to 900 K.
Corrosion of titanium alloys in concentrated chloride solutions at temperature up to 160 deg C
International Nuclear Information System (INIS)
Ruskol, Yu.S.; Viter, L.I.; Balakin, A.I.; Fokin, M.N.
1982-01-01
Resistance of VT1-0 titanium and 4200, 4207 titanium alloys to pitting and total corrosion in chlorides of cadmium, potassium, nickel, ammonium, barium, calcium, lithium, magnesium in respect to pH value and temperature (120,140,160 deg C) is determined. The results obtained are presented as nomograms of stability. Possible reasons for corrosion behaviour of titanium in each of the chlorides are discussed
Directory of Open Access Journals (Sweden)
Piątkowski J.
2013-09-01
Full Text Available The paper presents the results of studies on the effect of the AlSi17Cu5 alloy overheating to atemperature of 920°C and modification with phosphorus (CuP10 on the resultingmechanical (HB, Rm, R0.2 and plastic (A5 and Z properties. It has been shown that, so-called, "timethermal treatment" (TTT of an alloy in the liquid state, consisting inoverheating the metal to about 250°C above Tliq,holding at this temperature by 30 minutes improvesthe mechanical properties. It has also been found that overheating of alloy above Tliq.enhances the process of modification, resulting in the formation of fine-grain structure. The primary silicon crystals uniformly distributed in the eutectic and characteristics ofthe α(Al solution supersaturated with alloying elements present in the starting alloy composition (Cu, Fe provide not only an increase of strength at ambient temperature but also at elevated temperature (250°C.
Energy Technology Data Exchange (ETDEWEB)
Kim, Seon Jin; Dew, Rando T. [Pukyong National Univ., Busan (Korea, Republic of); Kim, Woo Gon; Kim, Min Hwan [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-05-15
Low cycle fatigue (LCF) is an important design consideration for high temperature IHX components. Moreover, some of the components are joined by welding techniques and therefore the welded joints are unavoidable in the construction of mechanical structures. Since Alloy 617 was introduced in early 1970s, many attempts have been made in the past two decades to evaluate the LCF and creep-fatigue behavior in Alloy 617 base metal at room temperature and high temperature. However, little research has focused on the evaluation and characterization of the Alloy 617 welded joints. butt-welded joint specimens was performed at room temperature and 850 .deg. C. Fatigue lives of GTAW welded joint specimens were lower than those of base metal specimens. LCF cracking and failure in welded specimens initiated in the weld metal zone and followed transgranluar dendritic paths for both at RT and 850 .deg. C.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Definitions. 410.103 Section 410.103 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.103 Definitions...
Study of the oxidation of Fe-Cr alloys at high temperatures
International Nuclear Information System (INIS)
Carneiro, J.F.; Sabioni, A.C.S.
2010-01-01
The high temperature oxidation behavior of Fe-1.5%Cr, Fe-5.0%Cr, Fe-10%Cr and Fe- 15%Cr model alloys were investigated from 700 to 850 deg C, in air atmosphere. The oxidation treatments were performed in a thermobalance with a sensitivity of 1μg. The oxide films grown by oxidation of the alloys were characterized by scanning electronic microscopy (SEM), energy dispersive X-ray spectroscopy (EDS) and X-ray diffraction (XRD). The oxide films are Fe-Cr spinels with variable composition depending on the alloy composition. For all conditions studied, the oxidation kinetics of these alloys follow a parabolic law. The comparison of the oxidation rates of the four alloys, at 700 deg C, shows that the parabolic oxidation constants decrease from 1.96x10 -9 g 2 .cm -4 .s -1 , for the alloy Fe-1.5% Cr, to 1.18 x 10-14g 2 .cm -4 .s -1 for the alloy Fe-15% Cr. Comparative analysis of the oxidation behavior of the Fe-10%Cr and Fe-15%Cr alloys, between 700 and 850 deg C, shows that the oxidation rates of these alloys are comparable to 800 deg C, above this temperature the Fe-10%Cr alloy shows lower resistance to oxidation. (author)
Polystyrene films as barrier layers for corrosion protection of copper and copper alloys.
Románszki, Loránd; Datsenko, Iaryna; May, Zoltán; Telegdi, Judit; Nyikos, Lajos; Sand, Wolfgang
2014-06-01
Dip-coated polystyrene layers of sub-micrometre thickness (85-500nm) have been applied on copper and copper alloys (aluminium brass, copper-nickel 70/30), as well as on stainless steel 304, and produced an effective barrier against corrosion and adhesion of corrosion-relevant microorganisms. According to the dynamic wettability measurements, the coatings exhibited high advancing (103°), receding (79°) and equilibrium (87°) contact angles, low contact angle hysteresis (6°) and surface free energy (31mJ/m(2)). The corrosion rate of copper-nickel 70/30 alloy samples in 3.5% NaCl was as low as 3.2μm/a (44% of that of the uncoated samples), and in artificial seawater was only 0.9μm/a (29% of that of the uncoated samples). Cell adhesion was studied by fluorescence microscopy, using monoculture of Desulfovibrio alaskensis. The coatings not only decreased the corrosion rate but also markedly reduced the number of bacterial cells adhered to the coated surfaces. The PS coating on copper gave the best result, 2×10(3)cells/cm(2) (1% of that of the uncoated control). © 2013 Elsevier B.V. All rights reserved.
Tungsten-zirconium carbide-rhenium alloys with extraordinary thermal stability
Energy Technology Data Exchange (ETDEWEB)
Yang, X.D. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Xie, Z.M.; Miao, S. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, R.; Jiang, W.B. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Zhang, T., E-mail: zhangtao@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Wang, X.P., E-mail: xpwang@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Fang, Q.F. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, C.S., E-mail: csliu@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Luo, G.N. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Liu, X. [Southwest Institute of Plasma Physics, Chengdu (China)
2016-05-15
The low recrystallization temperature (1200 °C) of pure W is a serious limitation for application as facing plasma materials in fusion reactor. In this paper, W-0.5wt.%ZrC-1wt.%Re (WZR) alloy with recrystallization temperature up to 1800 °C was prepared by mechanical milling and spark plasma sintering. The grain size of WZR alloy is about 2.6 μm, smaller than that of pure W (4.4 μm), which keeps unchanged until the annealing temperature increases to 1800 °C. Tensile tests indicate that the WZR alloys exhibit excellent comprehensive properties: the ductile to brittle transition temperature of WZR is in the range from 400 °C to 500 °C, about 200 °C lower than that of pure W prepared by the same process; the total elongation (TE) of WZR at 600 °C is above 30%, which is about 2 times that of pure W (at 700 °C). Meanwhile its tensile strength keeps ∼450 MPa before and after 1800 °C annealing as well as its TE increases after annealing. WZR alloy exhibits higher hardness (489HV) than that of pure W (453HV) at room temperature. Microstructure analysis indicates that the strengthening of nano-sized ZrC particles dispersion and Re solid solution improve tensile properties and thermal stability of WZR alloy.
SCC Initiation Testing of Alloy 600 in High Temperature Water
Etien, Robert A.; Richey, Edward; Morton, David S.; Eager, Julie
Stress corrosion cracking (SCC) initiation tests have been conducted on Alloy 600 at temperatures from 304 to 367°C. Tests were conducted with in-situ monitored smooth tensile specimens under a constant load in hydrogenated environments. A reversing direct current electric potential drop (EPD) system was used for all of the tests to detect SCC initiation. Tests were conducted to examine the effects of stress (and strain), coolant hydrogen, and temperature on SCC initiation time. The thermal activation energy of SCC initiation was measured as 103 ± 18 kJ/mol in hydrogenated water, which is similar to the thermal activation energy for SCC growth. Results suggest that the fundamental mechanical parameter which controls SCC initiation is plastic strain not stress. SCC initiation was shown to have a different sensitivity than SCC growth to dissolved hydrogen level. Specifically, SCC initiation time appears to be relatively insensitive to hydrogen level in the nickel stability region.
Decagonal quasicrystalline phase in as-cast and mechanically alloyed Al–Cu–Cr alloys
International Nuclear Information System (INIS)
Shevchukov, A.P.; Sviridova, T.A.; Kaloshkin, S.D.; Tcherdyntsev, V.V.; Gorshenkov, M.V.; Churyukanova, M.N.; Zhang, D.; Li, Z.
2014-01-01
Highlights: ► Microstructure of as-cast Al–Cu–Cr alloys was investigated. ► Composition of decagonal quasicrystalline phase was determined. ► Single-phase decagonal quasicrystalline powder was obtained. ► Phase composition changes during heating were controlled using DSC and X-ray diffraction. -- Abstract: Microstructure and phase composition of three Al-rich as-cast alloys of Al–Cu–Cr system were investigated by X-ray diffraction analysis (XRD) and scanning electron microscopy (SEM). The decagonal quasicrystalline phase is contained in all alloys under study and has grains with faceted shape, its composition lies in the range of 71–73 at.% Al, 11–12 at.% Cu and 15–18 at.% Cr. The heating in calorimeter of the mechanically alloyed Al 73 Cu 11 Cr 16 powder up to 600 °C leads to the formation of the pure decagonal phase. Total thermal effect in the temperature range 250–600 °C corresponding to the quasicrystalline phase formation is about 15 kJ/mol
Oxidation properties of laser clad Nb-Al alloys
International Nuclear Information System (INIS)
Tewari, S.K.; Mazumder, J.
1992-01-01
This paper reports on laser cladding parameters for non-equilibrium synthesis for several ternary and complex Nb-Al base alloys containing Ti, Cr, Si, Ni, B and C that have been established. Phase transformations occurring below 1500 degrees C have been determined using differential thermal analysis. Ductility of the clads is qualitatively evaluated from the extent of cracking around the microhardness indentations. Oxidation resistance of the clads in flowing air is measured at 800 degrees C, 1200 degrees C and 1400 degrees C and parabolic rate constants are calculated. Microstructure of the clads is studied using optical and scanning electron microscopes. X-ray diffraction and EDX techniques are used for identification of the oxides formed and the phases formed in as clad material. Oxide morphology is studied using SEM. Effect of alloying additions on the ductility and oxidation resistance of the laser clad Nb-Al alloys is discussed. The results are compared with those reported in literature for similar alloys produced by conventional processing methods
Structure and grindability of dental Ti-Cr alloys
International Nuclear Information System (INIS)
Hsu, H.-C.; Wu, S.-C.; Chiang, T.-Y.; Ho, W.-F.
2009-01-01
The purpose of this study was to investigate the structure and microhardness of a series of binary Ti-Cr alloys with Cr contents up to 30 wt%. In addition, the grindability was also evaluated using an electric dental handpiece with SiC wheels, with the goal of developing a titanium alloy with better mechanical properties and machinability than commercially pure titanium (c.p. Ti), a metal generally considered to be difficult to machine. This study evaluated the phase and structure of Ti-Cr alloys, using an X-ray diffraction (XRD) for phase analysis and optical microscope for microstructure of the etched alloys. Grindability was evaluated by measuring the amount of metal volume removed after grinding for 1 min. Results indicated that the structure of Ti-Cr alloys is sensitive to the Cr content. The cast c.p. Ti has a hexagonal α phase. With 5 wt% Cr, metastable β phase starts to be retained. With Cr contents higher than 10 wt%, the equi-axed β phase is almost entirely retained. In addition, athermal ω phase was found in the Ti-5Cr and Ti-10Cr alloys. The largest quantity of ω phase and highest microhardness were found in Ti-10Cr alloy. The grinding rate of the Ti-Cr alloys showed a similar tendency to the microhardness. The Ti-10Cr alloy exhibited the best grindability, especially at 1000 m/min, which presumably due to the brittle nature of the alloy containing the ω phase in the β matrix.
Fatigue properties of particle reinforced aluminium alloys
International Nuclear Information System (INIS)
Tabernig, B.J.
2000-06-01
In this work the particle reinforced Al-alloys 359 T6 + 20 % SiC and 2124 + 17 % SiC which differ significantly in their production and microstructure are investigated. Standard and in-situ tensile tests show, that in the powder metallurgically produced alloy 2124 reinforcement leads to a higher Young's modulus, yield and ultimate tensile stress where the cast alloy 359 + 20 % SiC exhibit increased stiffness, but low ductility due to cast porosity of some 100 μm. The failure mechanism governed by microstructural parameters is found to play an important role for ductility. The fatigue properties are investigated with specific regard to the influence of the in-service condition (load ratio, temperature, variable amplitude loading) in the foreseen applications in the automobile- and aerospace industry. Standard fatigue tests point out that the endurance limit is improved by reinforcement, but is strongly dependent on the size of given initial defects. The fatigue crack properties are characterised by standard crack growth curves and r(esistance)-curves for the threshold of stress intensity factor range. Both composites exhibit a higher effective threshold than their unreinforced alloys. Furthermore the fatigue resistance described by the R-curve as well as the long crack threshold are improved in the alloy 2124 + 17 % SiC. While in crack growth tests under constant amplitude loading the alloy 2124 + 17 % SiC shows lower crack growth rates than its unreinforced alloy, the opposite case is in the alloy 359 + 20 % SiC at high DK. Periodic overloads lead in the 359 + 20 % SiC to particle fracture at the crack tip and to a steeper increase in the crack growth rate. In the 2124 + 17% SiC the fatigue crack grows predominately in the matrix and a retardation effect due to overloads is observed. In order to describe the fatigue limit of components as a function of initial defect size an analytical concept is developed assuming that the fatigue limit is controlled by the
Sun, Junjie; Jiang, Tao; Liu, Hongji; Guo, Shengwu; Liu, Yongning
2016-12-01
The effect of delamination toughening of martensitic steel was investigated both at room and low temperatures [253 K and 233 K (-20 °C and -40 °C)]. Two low-alloy martensitic steels with and without Al alloying were both prepared. Layered structure with white band and black matrix was observed in Al alloyed steel, while a homogeneous microstructure was displayed in the steel without Al. Both steels achieved high strength (tensile strength over 1600 MPa) and good ductility (elongation over 11 pct), but they displayed stark contrasts on impact fracture mode and Charpy impact energy. Delamination fracture occurred in Al alloyed steel and the impact energies were significantly increased both at room temperature (from 75 to 138 J, i.e., nearly improved up to 2 times) and low temperatures [from 47.9 to 71.3 J at 233 K (-40 °C)] compared with the one without Al. Alloying with Al promotes the segregation of Cr, Mn, Si and C elements to form a network structure, which is martensite with higher carbon content and higher hardness than that of the matrix. And this network structure evolved into a band structure during the hot rolling process. The difference of yield stress between the band structure and the matrix gives rise to a delamination fracture during the impact test, which increases the toughness greatly.
Study of U - Pu - Fe alloys (Masurca critical experiment)
International Nuclear Information System (INIS)
Barthelemy, P.; Boucher, R.
1965-01-01
Three compositions have been studied: 73.5 U - 25 Pu - 1.5 Fe (weight %) 74 U - 25 Pu - 1 Fe 74.5 U - 25 Pu - 0.5 Fe Elaboration and Casting are easy. After two weeks in air 74.5 U - 25 Pu - 0.5 Fe alloys are reduced in powder. As-cast alloys containing 1 and 1,5% Fe are kept undamaged during several months. A rapid oxidisation of the alloys is however observed when the samples undergo the phase transformation (at 595 deg. C and 590 deg. C respectively). Ignition tests in the presence of air show that the oxidisation starts at about 250 deg. C and that the reaction does not spread. Ignition is not observed during heating from 20 to 660 deg. C. The transformation temperature, the melting temperature and the thermal expansion coefficients have been determined by dilatometry. Below the transformation temperature, the principal phases are U-Pu zeta and (U, Pu) 6 Fe. Thermal conductibility, Young modulus, density and heat of fusion have been measured. Compatibility tests show that between U-Pu-Fe and stainless steel a phase of (U, Pu) 6 Fe type is formed. The 74 U - 25 Pu - 1% Fe alloy seems to behave better than 73.5 U - 25 Pu - 1.5% Fe alloy because the (U, Pu) 6 Fe layer is two or three times smaller. Finally, the thermal stability has been studied with the 74 U - 25 Pu - 1% Fe alloy. A dilatometric anomaly (very weak expansion) occurs when the sample is heated above transformation temperature and cooled. But there is no anomaly by thermal cycling from 50 deg. C to 400 deg. C and there is no deterioration of alloys by heat treatments at 100 deg. C, 200 deg. C, 300 deg. C during 5 months under vacuum. (authors) [fr
International Nuclear Information System (INIS)
Contreras P, H.
1992-01-01
Corrosion rate for pure nickel, Inconel 600 and Monel alloys in a 1 Molar hydrofluoric acid solution at a 40 0 C temperature were determined. For contrasting purposes both SAE 304 SS and SAE 316 SS were included. As expected these Stainless Steels do not show good corrosion performance in the solution used. Several expressions correlating the weight and thickness loss v/s time were obtained. In the particular case of Monel, up to 2.021 hours, two expressions for the weight loss and three expressions for the thickness loss were obtained with a close to 1,0 correlation coefficient value. The Monel showed the best overall corrosion performance among the tested alloys. (author)
Fabrication and Magnetic Properties of Co₂MnAl Heusler Alloys by Mechanical Alloying.
Lee, Chung-Hyo
2018-02-01
We have applied mechanical alloying (MA) to produce nanocrystalline Co2MnAl Heusler alloys using a mixture of elemental Co50Mn25Al25 powders. An optimal milling and heat treatment conditions to obtain a Co2MnAl Heusler phase with fine microstructure were investigated by X-ray diffraction, differential scanning calorimeter and vibrating sample magnetometer measurements. α-(Co, Mn, Al) FCC phases coupled with amorphous phase are obtained after 3 hours of MA without any evidence for the formation of Co2MnAl alloys. On the other hand, a Co2MnAl Heusler alloys can be obtained by the heat treatment of all MA samples up to 650 °C. X-ray diffraction result shows that the average grain size of Co2MnAl Heusler alloys prepared by MA for 5 h and heat treatment is in the range of 95 nm. The saturation magnetization of MA powders decreases with MA time due to the magnetic dilution by alloying with nonmagnetic Mn and Al elements. The magnetic hardening due to the reduction of the grain size with ball milling is also observed. However, the saturation magnetization of MA powders after heat treatment increases with MA time and reaches to a maximum value of 105 emu/g after 5 h of MA. It can be also seen that the coercivity of 5 h MA sample annealed at 650 °C is fairly low value of 25 Oe.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Security. 1786.103 Section 1786.103 Agriculture... Prepayments on RUS Notes in the Event of a Merger of Certain RUS Electric Borrowers § 1786.103 Security. If... of providing security for loans the proceeds of which were used to prepay RUS Notes. Such lien...
Hot corrosion behavior of Ni-Cr-W-C alloys in impure He gas
International Nuclear Information System (INIS)
Ohmura, Taizo; Sahira, Kensho; Sakonooka, Akihiko; Yonezawa, Noboru
1977-01-01
Influence of the minor alloy constituents such as Al, Mn and Si on the hot corrosion behavior of Ni-20Cr-20W-0.07C alloy was studied in 99.995%He gas at 1,000 0 C, in comparison with the behavior of commercial Ni-base superalloys (Hastelloy X and Inconel 617). The low oxidizing potential in the impure He gas usually causes selective oxidation of the elements described above and the growth of oxide whiskers on the surface of specimen at elevated temperatures. The intergranular attack was caused by selective oxidation of Al, Si and Mn. The spalling of oxide film was restrained by additions of Mn and Si, providing tough spinel type oxide film on the surface and 'keys' on the oxide-matrix interface respectively. The amount and morphology of the oxide whiskers depended on Si and Mn contents. Si of more than 0.29% without Mn always caused the growth of rather thinner whiskers with smooth surface, and the whiskers analyzed by electron diffraction patterns and EPMA to be Cr 2 O 3 containing Si. Mn addition changes the whiskers to thicker ones of spinel type oxide (MnCr 2 O 4 ) with rough surface. On the basis of these results, the optimum contents of Al, Mn and Si to minimize the growth of whiskers, the intergranular attack, and the spalling of oxide film were discussed. (auth.)
Microstructures and oxidation behavior of some Molybdenum based alloys
Energy Technology Data Exchange (ETDEWEB)
Ray, Pratik Kumar [Iowa State Univ., Ames, IA (United States)
2011-01-01
The advent of Ni based superalloys revolutionized the high temperature alloy industry. These materials are capable of operating in extremely harsh environments, comprising of temperatures around 1050 C, under oxidative conditions. Demands for increased fuel efficiency, however, has highlighted the need for materials that can be used under oxidative conditions at temperatures in excess of 1200 C. The Ni based superalloys are restricted to lower temperatures due to the presence of a number of low melting phases that melt in the 1250 - 1450 C, resulting in softening of the alloys above 1000 C. Therefore, recent research directions have been skewed towards exploring and developing newer alloy systems. This thesis comprises a part of such an effort. Techniques for rapid thermodynamic assessments were developed and applied to two different systems - Mo-Si alloys with transition metal substitutions (and this forms the first part of the thesis) and Ni-Al alloys with added components for providing high temperature strength and ductility. A hierarchical approach towards alloy design indicated the Mo-Ni-Al system as a prospective candidate for high temperature applications. Investigations on microstructures and oxidation behavior, under both isothermal and cyclic conditions, of these alloys constitute the second part of this thesis. It was seen that refractory metal systems show a marked microstructure dependence of oxidation.
Study of sintering on Mg-Zn-Ca alloy system
Annur, Dhyah; Lestari, Franciska P.; Erryani, Aprilia; Kartika, Ika
2018-05-01
Magnesium and its alloy have gained a lot of interest to be used in biomedical application due to its biodegradable and biocompatible properties. In this study, sintering process in powder metallurgy was chosen to fabricatenonporous Mg-6Zn-1Ca (in wt%) alloy and porous Mg-6Zn-1Ca-10 Carbamide alloy. For creating porous alloy, carbamide (CO(NH2)2 was added to alloy system as the space holder to create porous structure material. Effect of the space holder addition and sintering temperature on porosity, phase formation, mechanical properties, and corrosion properties was observed. Sintering process was done in a tube furnace under Argon atmosphere in for 5 hours. The heat treatment was done in two steps; heated up at 250 °C for 4 hours to decompose spacer particle, followed by heated up at 580 °C or 630 °C for 5 hours. The porous structure of the resulted alloys was examined using Scanning Electron Microscope (SEM), while the phase formation was characterized by X-ray diffraction (XRD) analysis. Mechanical properties were examined using compression testing. From this study, increasing sintering temperature up to 630 °C reduced the mechanical properties of Mg-Zn-Ca alloy.
Tensile properties of V-Cr-Ti alloys after exposure in oxygen-containing environments
International Nuclear Information System (INIS)
Natesan, K.; Soppet, W.K.
1998-01-01
A systematic study was conducted to evaluate the oxidation kinetics of V-4Cr-4Ti (44 alloy) and V-5Cr-5Ti alloys (55 alloy) and to establish the role of oxygen ingress on the tensile behavior of the alloys at room temperature and at 500 C. The oxidation rate of the 44 alloy is slightly higher than that of the 55 alloy. The oxidation process followed parabolic kinetics. Maximum engineering stress for 55 alloy increased with an increase in oxidation time at 500 C. The maximum stress values for 55 alloy were higher at room temperature than ta 500 C for the same oxidation treatment. Maximum engineering stresses for 44 alloy were substantially lower than those for 55 alloy in the same oxidation ∼500 h exposure in air at 500 C; the same values were 4.8 and 6.1%, respectively, at 500 C after ∼2060 h oxidation in air at 500 C. Maximum engineering stress for 44 alloy at room temperature was 421.6--440.6 MPa after ∼250 h exposure at 500 C in environments with a pO 2 range of 1 x 10 -6 to 760 torr. The corresponding uniform and total elongation values were 11--14.4% and 14.5--21.7%, respectively. Measurements of crack depths in various specimens showed that depth is independent of pO 2 in the preexposure environment and was of 70--95 microm after 250--275 h exposure at 500 C
Irradiation-assisted stress corrosion cracking in HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.
1995-01-01
In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water to determine the irradiation-assisted stress corrosion cracking (IASCC) behavior of HTH Alloy X-750 and direct-aged Alloy 625. New data confirm previous results showing that high irradiation levels reduce SCC resistance in Alloy X-750. Heat-to-heat variability correlates with boron content, with low boron heats showing improved IASCC properties. Alloy 625 is resistant to IASCC, as no cracking was observed in any Alloy 625 specimens. Microstructural, microchemical and deformation studies were performed to characterize the mechanisms responsible for IASCC in Alloy X-750 and the lack of an effect in Alloy 625. The mechanisms under investigation are: boron transmutation effects, radiation-induced changes in microstructure and deformation characteristics, and radiation-induced segregation. Irradiation of Alloy X-750 caused significant strengthening and ductility loss that was associated with the formation of cavities and dislocation loops. High irradiation levels did not cause significant segregation of alloying or trace elements in Alloy X-750. Irradiation of Alloy 625 resulted in the formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to the loops and precipitates was apparently offset by a partial dissolution of γ double-prime precipitates, as Alloy 625 showed no irradiation-induced strengthening or ductility loss. In the nonirradiated condition, an IASCC susceptible HTH heat containing 28 ppm B showed grain boundary segregation of boron, whereas a nonsusceptible HTH heat containing 2 ppm B and Alloy 625 with 20 ppm B did not show significant boron segregation. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in Alloy X-750, and the absence of these two effects results in the superior IASCC resistance displayed by Alloy 625
International Nuclear Information System (INIS)
Hawthorne, J.R.
1984-01-01
During this period, irradiation exposures at 300 0 C and 150 0 C to approx. 8 x 10 19 n/cm 2 , E > 0.1 MeV, were completed for the Alloy HT-9 plate and the modified Alloy 9Cr-1Mo plates, respectively. Postirradiation tests of Charpy-V (C/sub v/) specimens were completed for both alloys; other specimen types included in the reactor assemblies were fatigue precracked Charpy-V (PCC/sub v/), half-size Charpy-V, and in the case of the modified 9Cr-1Mo, 2.54 mm thick compact tension specimens
Energy Technology Data Exchange (ETDEWEB)
Dadashpour, M.; Yeşildal, R. [University of Ataturk, Erzurum (Turkmenistan); Mostafapour, A.; Rezazade, V. [University of Tabriz, Tabriz (Iran, Islamic Republic of)
2016-02-15
In this paper, the effect of heat treatment and number of passes on microstructure and mechanical properties of friction stir processed AZ91C magnesium alloy samples were investigated. From six samples of as-cast AZ91C magnesium alloy, three plates were pre-heated at temperature of 375°C for 3 hours, and then were treated at temperature of 415°C for 18 hours and finally were cooled down in air. Three plates were relinquished without heat treatment. 8 mm thick as-cast AZ91C magnesium alloy plates were friction stir processed at constant traverse speed of 40 mm/min and tool rotation speed of 1250 rpm. After process, microstructural characterization of samples was analyzed using optical microscopy and tensile and Vickers hardness tests were performed. It was found that heat treated samples had finer grains, higher hardness, improved tensile strength and elongation relative to non-heat treated ones. As the number of passes increased, higher UTS and TE were achieved due to finer grains and more dissolution of β phase (Mg17Al12). The micro-hardness characteristics and tensile improvement of the friction stir processed samples depend significantly on grain size, removal of voids and porosities and dissolution of β phase in the stir zone.
The microstructure of Mg–4Zn–2Al–0.5Ca aged alloy
International Nuclear Information System (INIS)
Lin Xiaoping; Dong Yun; Ye Jie; Song Boyang
2012-01-01
Highlights: ► The microstructure of Mg–4Zn–2Al–0.5Ca aged alloy was investigated by TEM. ► Edge dislocations, ordered zones and moiré fringes are found in alloy. ► Ca can improve the thermal stability of precipitates. - Abstract: In this study, we investigated the microstructure of a new Mg–4Zn–2Al–0.5Ca aged alloy with TEM and HRTEM. The age hardening process of Mg–4Zn–2Al–0.5Ca alloy aged at 120 °C or 160 °C follows a similar pattern: a period of fluctuation of hardness present before the alloy reaches its maximum hardness. The atomic arrangement is different in different areas of the microstructure possibly due to the difference of the segregated degree of the solute atoms in the alloy. The microstructure of alloy aged at 120 °C for 230 h consists of cellular textures, ordered zone, elongated precipitates and disc-like precipitates, while the microstructure of the alloy aged at 160 °C for 32 h consists of edge dislocations, ordered zones and moiré fringe. No MgZn precipitates are found in the peak aged microstructures of alloys aged at 120 °C and 160 °C. It is reasonable to believe that Ca is a particularly effective trace addition in improving the thermal stability of precipitation in Mg–4Zn–2Al alloy aged at 120 °C and 160 °C.
International Nuclear Information System (INIS)
Xin Tang Huang
2000-01-01
High critical current density and in-plane aligned YBa 2 Cu 3 O 7-x (YBCO) film on a textured yttria-stabilized zirconia (YSZ) buffer layer deposited on NiCr alloy (Hastelloy c-275) tape by laser ablation with only O + ion beam assistance was fabricated. The values of the x-ray phi-scan full width at half-maximum (FWHM) for YSZ(202) and YBCO(103) are 18 deg. and 11 deg., respectively. The critical current density of YBCO film is 7.9 x 105 A cm -2 at liquid nitrogen temperature and zero field, and its critical temperature is 90 K. (author)
Phase analysis and magnetocaloric properties of Zr substituted Gd-Si-Ge alloys
International Nuclear Information System (INIS)
Prabahar, K.; Raj Kumar, D.M.; Manivel Raja, M.; Chandrasekaran, V.
2011-01-01
The structure, microstructure, magneto-structural transition and magnetocaloric effect have been investigated in series of (Gd 5-x Zr x )Si 2 Ge 2 alloys with 0≤x≥0.20. X-ray powder diffraction analysis revealed the presence of orthorhombic structure for Zr containing alloys at room temperature in contrast to the monoclinic structure observed in the parent Gd 5 Si 2 Ge 2 alloy. The microstructural studies reveal that, low Zr addition (x≤0.1) resulted in low volume fraction of detrimental Gd 5 Si 3 -type secondary phase compared to that present in the parent alloy. All the Zr containing alloys have shown the presence of only second order magnetic transition unlike the parent alloy showing both first order structural and second order magnetic transition. A moderate (ΔS) M value of -5.5 J/kg K was obtained for the x=0.05 alloy at an enhanced operating temperature of 292 K compared to -7.8 J/kg K at 274 K of the parent alloy for an applied field of 2 T. The interesting feature of Zr (x=0.05) containing alloy is the wide operating temperature range of ∼25 K than that of ∼10-12 K for the parent, which resulted in enhanced net refrigerant capacity of 103 J/kg compared to that of 53 J/kg for the parent alloy. - Research highlights: → Zr addition in Gd 5 Si 2 Ge 2 alloy has been investigated for the first time to reduce the 5:3-type (Gd 5 Si 3 ) secondary phase formed when using commercial grade elements in Gd 5 Si 2 Ge 2 alloy. → It is interesting to observe that Zr addition decrease the volume fraction 5:3. → The refrigerator capacity and transition temperature of Zr added alloy is greater than the pure Gd 5 Si 2 Ge 2 which makes this alloy promising for room temperature application.
Passive Corrosion Behavior of Alloy 22
International Nuclear Information System (INIS)
R.B. Rebak; J.H. Payer
2006-01-01
Alloy 22 (NO6022) was designed to stand the most aggressive industrial applications, including both reducing and oxidizing acids. Even in the most aggressive environments, if the temperature is lower than 150 F (66 C) Alloy 22 would remain in the passive state having particularly low corrosion rates. In multi-ionic solutions that may simulate the behavior of concentrated ground water, even at near boiling temperatures, the corrosion rate of Alloy 22 is only a few nano-meters per year because the alloy is in the complete passive state. The corrosion rate of passive Alloy 22 decreases as the time increases. Immersion corrosion testing also show that the newer generation of Ni-Cr-Mo alloys may offer a better corrosion resistance than Alloy 22 only in some highly aggressive conditions such as in hot acids
Tyrman, Muriel; Ahmim, Smail; Pasko, Alexandre; Etgens, Victor; Mazaleyrat, Frédéric; Quetel-Weben, Simon; Perrière, Loïc; Guillot, Ivan
2018-05-01
The metastable τ-phase of MnAl equi-atomic compound belongs to a family of ferromagnetic alloys with L10 crystal structure. Stabilization of the phase by adding 2 at. % using manganese carbide (Mn23C6) enhances the magnetization in relation with the increase in lattice volume. It is thus a promising candidate for rare-earth-free permanent magnets. Coercivity of Mn-Al-C alloys being still weak, there is an interest to see to which extend sintering/transformation of the ɛ-phase by Spark Plasma Sintering (SPS) can increase the coercivity and the anisotropy. The structural and the magnetic properties were studied for samples sintered at 550 °C under uniaxial pressure of 100, 200, 300 and 400 MPa. Coercivity, remanence and anistotropy appears with the sintering pressure. The high pressure applied while sintering produces preferential orientation of the flake-shaped grains which influences the remanence.
Characteristics of laser clad α-Ti/TiC+(Ti,W)C1-x/Ti2SC+TiS composite coatings on TA2 titanium alloy
Zhai, Yong-Jie; Liu, Xiu-Bo; Qiao, Shi-Jie; Wang, Ming-Di; Lu, Xiao-Long; Wang, Yong-Guang; Chen, Yao; Ying, Li-Xia
2017-03-01
TiC reinforced Ti matrix composite coating with Ti2SC/TiS lubricant phases in-situ synthesized were prepared on TA2 titanium alloy by laser cladding with different powder mixtures: 40%Ti-19.5%TiC-40.5%WS2, 40%Ti-25.2%TiC-34.8%WS2, 40%Ti-29.4%TiC-30.6%WS2 (wt%). The phase compositions, microstructure, microhardness and tribological behaviors and wear mechanisms of coatings were investigated systematically. Results indicate that the main phase compositions of three coatings are all continuous matrix α-Ti, reinforced phases of (Ti,W)C1-x and TiC, lubricant phases of Ti2SC and TiS. The microhardness of the three different coatings are 927.1 HV0.5, 1007.5 HV0.5 and 1052.3 HV0.5, respectively. Compared with the TA2 titanium alloy (approximately 180 HV0.5), the microhardness of coatings have been improved dramatically. The coefficients of friction and the wear rates of those coatings are 0.41 and 30.98×10-5 mm3 N-1 m-1, 0.30 and 18.92×10-5 mm3 N-1 m-1, 0.34 and 15.98×10-5 mm3 N-1 m-1, respectively. Comparatively speaking, the coating fabricated with the powder mixtures of 40%Ti-25.2%TiC-34.8%WS2 presents superior friction reduction and anti-wear properties and the main wear mechanisms of that are slight plastic deformation and adhesive wear.
Magnesium and related low alloys
International Nuclear Information System (INIS)
Bernard, J.; Caillat, R.; Darras, R.
1959-01-01
In the first part the authors examine the comparative corrosion of commercial magnesium, of a magnesium-zirconium alloy (0,4 per cent ≤ Zr ≤ 0,7 per cent) of a ternary magnesium-zinc-zirconium alloy (0,8 per cent ≤ Zn ≤ 1,2 per cent) and of english 'Magnox type' alloys, in dry carbon dioxide-free air, in damp carbon dioxide-free air, and in dry and damp carbon dioxide, at temperatures from 300 to 600 deg. C. In the second part the structural stability of these materials is studied after annealings, of 10 to 1000 hours at 300 to 450 deg. C. Variations in grain after these heat treatments and mechanical stretching properties at room temperature are presented. Finally various creep rate and life time diagrams are given for these materials, for temperatures ranging from 300 to 450 deg. C. (author) [fr
Pt/Cu single-atom alloys as coke-resistant catalysts for efficient C-H activation
Marcinkowski, Matthew D.; Darby, Matthew T.; Liu, Jilei; Wimble, Joshua M.; Lucci, Felicia R.; Lee, Sungsik; Michaelides, Angelos; Flytzani-Stephanopoulos, Maria; Stamatakis, Michail; Sykes, E. Charles H.
2018-03-01
The recent availability of shale gas has led to a renewed interest in C-H bond activation as the first step towards the synthesis of fuels and fine chemicals. Heterogeneous catalysts based on Ni and Pt can perform this chemistry, but deactivate easily due to coke formation. Cu-based catalysts are not practical due to high C-H activation barriers, but their weaker binding to adsorbates offers resilience to coking. Using Pt/Cu single-atom alloys (SAAs), we examine C-H activation in a number of systems including methyl groups, methane and butane using a combination of simulations, surface science and catalysis studies. We find that Pt/Cu SAAs activate C-H bonds more efficiently than Cu, are stable for days under realistic operating conditions, and avoid the problem of coking typically encountered with Pt. Pt/Cu SAAs therefore offer a new approach to coke-resistant C-H activation chemistry, with the added economic benefit that the precious metal is diluted at the atomic limit.
Superconducting properties of a copper-ternary alloy
International Nuclear Information System (INIS)
Sharma, R.G.; Aleksivskii, N.E.
1975-01-01
The superconducting properties of a copper-ternary alloy of the type Cu 93 Nb 5 Sn 2 , subjected to a variety of mechanical and heat treatments, are discussed. The as-cast alloy does not turn superconducting down to 4.5K; but the cold-work and subsequent prescribed heat treatments are found to raise the transition temperature Tsub(c) to values as high as 18.1K and the critical current density Jsub(c) (of the Nb 3 Sn formed during annealing) to a value of 3.6x10 5 Acm -2 (at 4.2K and 30kOe). Various possibilities to improve Jsub(c) of this alloy to still higher values are discussed. The as-cast alloy is ductile, easy to draw, and economical from a technical point of view, and the annealed wires and strips are flexible enough for winding. (author)
Ethanol tolerant Pt-alloy cathodes for DEFC applications
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Valera, F.J. [CINVESTAV Unidad Saltillo, Coahuila (Mexico). Grupo de Recursos Minerales y Energeticos; Savadogo, O. [Ecole Polytechnique de Montreal, Montreal, PQ (Canada). Laboratoire de nouveaux materiaux pour l' energie et l' electrochimie
2008-07-01
Direct ethanol fuel cells (DEFCs) based on Ru/C cathodes have interesting current density versus cell voltage behaviour. In particular, the selectivity towards the oxygen reduction reaction (ORR) in acid medium in the presence of ethanol was improved when this cathode material was used. This study quantified the degree of tolerance to ethanol and the electrocatalytic activity for the ORR. It compared the specific activity towards the ORR for Pt1Co1/C and Pt3Cr1/C. The study showed that these cathodes have a high tolerance to this alcohol and demonstrated the good performance of this type of Pt-alloy in a DEFC as oxygen reduction cathodes. The performance of the Pt1Co1/C alloy was shown to be better than the Pt3Cr1/C, even when the former had a lower Pt content. The enhanced catalytic behaviour of the PtCo/C alloy can be attributed to the higher degree of allying or a smaller mean particle size and a larger surface area. Polarization measurements with relatively high ethanol concentrations confirmed the good catalytic behaviour of the PtCo/C alloy as cathode in a DEFC operating at 90 degrees C. Current work is focusing on the variation of Co content in the alloy structure and the analysis of this change in terms of ORR activity, tolerance to ethanol and electrochemical behaviour in a DEFC. 10 refs., 5 figs.
Nanoindentation of Electropolished FeCrAl Alloy Welds
Energy Technology Data Exchange (ETDEWEB)
Weaver, Jordan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aydogan, Eda [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mara, Nathan Allan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maloy, Stuart Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-02-13
The present report summarizes Berkovich nanoindentation modulus and hardness measurements on two candidate FeCrAl alloys (C35M and C37M) on as-received (AR) and welded samples. In addition, spherical nanoindentation stress-strain measurements were performed on individual grains to provide further information and demonstrate the applicability of these protocols to mechanically characterizing welds in FeCrAl alloys. The indentation results are compared against the reported tensile properties for these alloys to provide relationships between nanoindentation and tensile tests and insight into weldsoftening for these FeCrAl alloys. Hardness measurements revealed weld-softening for both alloys in good agreement with tensile test results. C35M showed a larger reduction in hardness at the weld center from the AR material compared to C37M; this is also consistent with tensile tests. In general, nanohardness was shown to be a good predictor of tensile yield strength and ultimate tensile stress for FeCrAl alloys. Spherical nanoindentation measurements revealed that the fusion zone (FZ) + heat affected zone (HAZ) has a very low defect density typical of well-annealed metals as indicated by the frequent pop-in events. Spherical nanoindentation yield strength, Berkovich hardness, and tensile yield strength measurements on the welded material all show that the C37M welded material has a higher strength than C35M welded material. From the comparison of nanoindentation and tensile tests, EBSD microstructure analysis, and information on the processing history, it can be deduced that the primary driver for weld-softening is a change in the defect structure at the grain-scale between the AR and welded material. These measurements serve as baseline data for utilizing nanoindentation for studying the effects of radiation damage on these alloys.
Energy Technology Data Exchange (ETDEWEB)
Edwards, D.J. [Pacific Northwest National Lab., Richland, WA (United States); Singh, B.N.; Toft, P.; Eldrup, M.
1997-04-01
Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing and bonding thermal treatment with additional specimens re-aged and given a reactor bakeout treatment at 350{degrees}C for 100 h. CuAl-25 was also heat treated to simulate the effects of a bonding thermal cycle on the material. A number of heat treated specimens were neutron irradiated at 250{degrees}C to a dose level of {approximately}0.3 dpa in the DR-3 reactor as Riso. The main effect of the bonding thermal cycle heat treatment was a slight decrease in strength of CuCrZr and CuNiBe alloys. The strength of CuAl-25, on the other hand, remained almost unaltered. The post irradiation tests at 250{degrees}C showed a severe loss of ductility in the case of the CuNiBe alloy. The irradiated CuAl-25 and CuCrZr specimens exhibited a reasonable amount of uniform elongation, with CuCrZr possessing a lower strength.
Grain refinement of 7075Al alloy microstructures by inoculation with Al-Ti-B master alloy
Hotea, V.; Juhasz, J.; Cadar, F.
2017-05-01
This paper aims to bring some clarification on grain refinement and modification of high strength alloys used in aerospace technique. In this work it was taken into account 7075 Al alloy, and the melt treatment was carried out by placing in the form of master alloy wire ternary AlTiB the casting trough at 730°C. The morphology of the resulting microstructures was characterized by optical microscopy. Micrographs unfinished and finished with pre-alloy containing ternary Al5Ti1B evidence fine crystals, crystal containing no columnar structure and highlights the size of the dendrites, and intermetallic phases occurring at grain boundaries in Al-Zn-Mg-Cu alloy. It has been found that these intermetallic compounds are MgZn2 type. AlTiB master alloys finishing ensures a fine eutectic structure, which determines the properties of hardware and improving the mechanical properties of aluminum alloys used in aeronautical engineering.
Feasibility test for production and separation of 103Pd
International Nuclear Information System (INIS)
Szuecs, Z.; Takacs, S.; Hunyadi, M.; Gacsi, Z.; Zeevaart, J.R.
2011-01-01
Complete text of publication follows. 103 Pd as a well-known Auger-emitter is commonly employed in brachytherapy, but the ultra-short range stopping of Auger-electrons can be more potentially exploited in applications of targeted radionuclide therapy in the future. The no-carrier-added production of 103 Pd is practically possible through charged particle induced reactions. However, separation techniques of 103 Pd from the target material (typically Rh), as well as its recovery by wet chemistry are expensive, and yields high amounts of radioactive waste. An alternative and more efficient procedure, called drydistillation method (DDM), is based on differences between the isothermal vapor pressures of the radionuclide element and the target element. In an appropriately selected temperature region the diffusion and out-gassing rates of radionuclides from the solid matrix of the target material are enhanced. Optimal irradiation parameters were determined in previous experiments at ATOMKI. Separation of 103 Pd was demonstrated at the Isotope Separator Laboratory with an evaporating-condensing system (Fig. 1). Figure 1. Evaporation-condensation system at the Isotope Separator Laboratory of ATOMKI. The irradiated Rh foil was kept above 1800?C in vacuum for several hours. The evaluation of γ-spectra of the Rh foil and the 103 Pd condensed on a low-temperature substrate (Fig. 2). The analysis resulted in a radiochemical yield of about 99.5% for 103 Pd and a radionuclidic purity of better than 99% with respect to the level of 101 Rh in the end product. Acknowledgement. The work was partly supported by the Hungarian TeT Bilateral Cooperation (OMFB- 00138/2009) and by the South African NRF (UID 68768).
Studies of the AA2519 Alloy Hot Rolling Process and Cladding with EN AW-1050A Alloy
Directory of Open Access Journals (Sweden)
Płonka B.
2016-03-01
Full Text Available The objective of the study was to determine the feasibility of plastic forming by hot rolling of the AA2519 aluminium alloy sheets and cladding these sheets with a layer of the EN AW-1050A alloy. Numerous hot-rolling tests were carried out on the slab ingots to define the parameters of the AA2519 alloy rolling process. It has been established that rolling of the AA2519 alloy should be carried out in the temperature range of 400-440°C. Depending on the required final thickness of the sheet metal, appropriate thickness of the EN AW-1050A alloy sheet, used as a cladding layer, was selected. As a next step, structure and mechanical properties of the resulting AA2519 alloy sheets clad with EN AW-1050A alloy was examined. The thickness of the coating layer was established at 0,3÷0,5mm. Studies covered alloy grain size and the core alloy-cladding material bond strength.
Development of ODS-Fe{sub 3}Al alloys
Energy Technology Data Exchange (ETDEWEB)
Wright, I.G.; Pint, B.A.; Tortorelli, P.F.; McKamey, C.G. [Oak Ridge National Lab., TN (United States)
1997-12-01
The overall goal of this program is to develop an oxide dispersion-strengthened (ODS) version of Fe{sub 3}Al that has sufficient creep strength and resistance to oxidation at temperatures in the range 1000 to 1200 C to be suitable for application as heat exchanger tubing in advanced power generation cycles. The main areas being addressed are: (a) alloy processing to achieve the desired alloy grain size and shape, and (b) optimization of the oxidation behavior to provide increased service life compared to semi-commercial ODS-FeCrAl alloys intended for the same applications. The recent studies have focused on mechanically-alloyed powder from a commercial alloy vendor. These starting alloy powders were very clean in terms of oxygen content compared to ORNL-produced powders, but contained similar levels of carbon picked up during the milling process. The specific environment used in milling the powder appears to exert a considerable influence on the post-consolidation recrystallization behavior of the alloy. A milling environment which produced powder particles having a high surface carbon content resulted in a consolidated alloy which readily recrystallized, whereas powder with a low surface carbon level after milling resulted in no recrystallization even at 1380 C. A feature of these alloys was the appearance of voids or porosity after the recrystallization anneal, as had been found with ORNL-produced alloys. Adjustment of the recrystallization parameters did not reveal any range of conditions where recrystallization could be accomplished without the formation of voids. Initial creep tests of specimens of the recrystallized alloys indicated a significant increase in creep strength compared to cast or wrought Fe{sub 3}Al, but the specimens failed prematurely by a mechanism that involved brittle fracture of one of the two grains in the test cross section, followed by ductile fracture of the remaining grain. The reasons for this behavior are not yet understood. The
Study of phase transformations in Fe-Mn-Cr Alloys
International Nuclear Information System (INIS)
Schule, W.; Panzarasa, A.; Lang, E.
1988-01-01
Nickel free alloys for fusion reactor applications are examined. Phase changes in fifteen, mainly austenitic iron-manganese-chromium-alloys of different compositions were investigated in the temperature range between -196 0 C and 1000 0 C after different thermo-mechanical treatments. A range of different physical measuring techniques was employed to investigate the structural changes occurring during heating and cooling and after cold-work: electrical resistivity techniques, differential thermal analysis, magnetic response, Vickers hardness and XRD measurement. The phase boundary between the α Fe-phase and the γ-phase of the iron manganese alloy is approximately maintained if chromium is added to the two component materials. Consequently all the alloy materials for contents of manganese smaller than about 30% Mn are not stable below 500 0 C. This concerns also the AMCR alloys. However the α Fe-phase is not formed during slow cooling from 1000 0 C to ambient temperature and is only obtained if nucleation sites are provided and after very long anneals. A cubic α Mn-type-phase is found for alloys with 18% Cr and 15% Mn, with 13% Cr and 25% Mn, with 10% Cr and 30% Mn, and with 10% Cr and 40% Mn. For these reasons the γ-phase field of the iron-chromium-manganese alloys is very small below 600 0 C and much narrower than reported in the literature. 95 figs. 22 refs
International Nuclear Information System (INIS)
Wenzel, M.; Wu, Y.
1988-01-01
The tropanol esters of the carboxylic acids of ferrocene, 103 Ru-ruthenocene and sup(103m)Rh-rhodocinium were synthezised. The organ distribution of the 103 Ru or sup(103m)Rh labelled tropanol-esters were investigated. Only the 103 Ru labelled ester showed a high heart/blood ratio. (author)
Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C
International Nuclear Information System (INIS)
Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa
2009-01-01
Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)
International Nuclear Information System (INIS)
Farkoosh, A.R.; Pekguleryuz, M.
2015-01-01
Strategies to improve the strength of Al–Si alloys at elevated temperatures can follow two routes: (i) improving the age-hardening behavior and/or (ii) producing effective dispersoid strengthening. In this study, the influence of Mg (in the range of 0.3–0.7 wt%) on the precipitation characteristics and mechanical properties of the Al–7Si–0.5Cu–(Mg) alloy was investigated. Thermodynamic calculations were performed via the CALPHAD method which showed that Q-Al 5 Mg 8 Cu 2 Si 6 is the main thermodynamically stable precipitate at 300 °C. The calculations were validated by transmission electron microscopy and differential scanning calorimetry analyses. Increasing the Mg level from 0.3 wt% to the maximum solubility limit of ∼0.5 wt% increased the amount of the Q-Al 5 Mg 8 Cu 2 Si 6 precipitates at 300 °C by ∼60 wt% and significantly improved the tensile strength and creep resistance at the expense of some ductility. Mg in excess of the solubility limit was seen to remain within the microstructure in the form of the large π-Al 8 FeMg 3 Si 6 and β-Mg 2 Si intermetallics after solution treatment at 530 °C. Cracking of the brittle π-Al 8 FeMg 3 Si 6 intermetallics during deformation was accounted for the decreased ductility of the alloys at high Mg levels. It is concluded that the Mg level can be increased to 0.5 wt% in the A–7Si–0.5Cu alloys to improve strength. However, for elevated temperature applications in which both strength and ductility are required (e.g. Diesel engine), modification of the π-Al 8 FeMg 3 Si 6 intermetallics would be required to improve the ductility of the alloys with high Mg contents
International Nuclear Information System (INIS)
Ligotke, M.W.; Pool, K.H.; Lerner, B.D.
1994-10-01
This report is to provide analytical results for use in safety and toxicological evaluations of the vapor space of Hanford single-shell waste storage tanks C-103. Samples were analysed to determine concentrations of ammonia, nitric oxide, nitrogen dioxide, sulfur oxides, and hydrogen cyanide. In addition to the samples, controls were analyzed that included blanks, spiked blanks, and spiked samples. These controls provided information about the suitability of sampling and analytical methods. Also included are the following: information describing the methods and sampling procedures used; results of sample analyses; and Conclusions and recommendations
Directory of Open Access Journals (Sweden)
Aritza Brizuela-Velasco
2017-01-01
Full Text Available The objective of the study is to characterise the mechanical properties of Ti-15Zr binary alloy dental implants and to describe their biomechanical behaviour as well as their osseointegration capacity compared with the conventional Ti-6Al-4V (TAV alloy implants. The mechanical properties of Ti-15Zr binary alloy were characterised using Roxolid© implants (Straumann, Basel, Switzerland via ultrasound. Their biomechanical behaviour was described via finite element analysis. Their osseointegration capacity was compared via an in vivo study performed on 12 adult rabbits. Young’s modulus of the Roxolid© implant was around 103 GPa, and the Poisson coefficient was around 0.33. There were no significant differences in terms of Von Mises stress values at the implant and bone level between both alloys. Regarding deformation, the highest value was observed for Ti-15Zr implant, and the lowest value was observed for the cortical bone surrounding TAV implant, with no deformation differences at the bone level between both alloys. Histological analysis of the implants inserted in rabbits demonstrated higher BIC percentage for Ti-15Zr implants at 3 and 6 weeks. Ti-15Zr alloy showed elastic properties and biomechanical behaviours similar to TAV alloy, although Ti-15Zr implant had a greater BIC percentage after 3 and 6 weeks of osseointegration.
Sulfidation behavior of Fe20Cr alloys
International Nuclear Information System (INIS)
Pillis, Marina Fuser
2001-01-01
Alloys for use in high temperature environments rely on the formation of an oxide layer for their protection. Normally, these protective oxides are Cr 2 O 3 , Al 2 O 3 and, some times, SiO 2 . Many industrial gaseous environments contain sulfur. Sulfides, formed in the presence of sulfur are thermodynamically less stable, have lower melting points and deviate much more stoichiometrically, compared to the corresponding oxides. The mechanism of sulfidation of various metals is as yet not clear, in spite of the concerted efforts during the last decade. To help address this situation, the sulfidation behavior of Fe20Cr has been studied as a function of compositional modifications and surface state of the alloy. The alloys Fe20Cr, Fe20Cr0.7Y, Fe20Cr5Al and Fe20Cr5Al0.6Y were prepared and three sets of sulfidation tests were carried out. In the first set, the alloys were sulfidized at 700 deg C and 800 deg C for 10h. In the second set, the alloys were pre-oxidized at 1000 deg C and then sulfidized at 800 deg C for up to 45h. In the third set of tests, the initial stages of sulfidation of the alloys was studied. All the tests were carried out in a thermobalance, in flowing H 2 /2%H 2 S, and the sulfidation behavior determined as mass change per unit area. Scanning electron microscopy coupled to energy dispersive spectroscopy and X-ray diffraction analysis were used to characterize the reaction products. The addition of Y and Al increased sulfidation resistance of Fe20Cr. The addition of Y altered the species that diffused predominantly during sulfide growth. It changed from predominant cationic diffusion to predominant anionic diffusion. The addition of Al caused an even greater increase in sulfidation resistance of Fe20Cr, with the parabolic rate constant decreasing by three orders of magnitude. Y addition to the FeCrAl alloy did not cause any appreciable alteration in sulfidation resistance. Pre-oxidation of the FeCrAl and FeCrAlY alloys resulted in an extended
Electron microscopy characterization of mechanically alloyed and hot consolidates Cu-Cr3C2 particles
Directory of Open Access Journals (Sweden)
López, M.
2005-08-01
Full Text Available Mechanically alloyed copper-ceramic composites have been obtained with the purpose of studying their use as copper-based material for electrical equipment. For high-temperature applications, dispersion-strengthened copper alloys are attractive due to their excellent combination of thermal and electrical conductivity, mechanical strength retention and microstructural stability. In this work, powder mixtures of pure copper with 2 vol % Cr3C2, milled during 4, 6, 10, 12 and 15 h in a high-energy planetary balls mill under argon atmosphere, were consolidated by hot isostatic pressing, applying a pressure of 100 MPa at 1073 K for two hours, to obtain materials with a fine microstructure. The Cu-Cr3C2 alloys were studied by scanning electron microscopy (SEM, electron microprobe (EPMA and transmission electron microscopy (TEM. Mechanical properties and electrical conductivity were also studied. The average tensile strength and electrical conductivity were found to be 500 MPa and 50 % IACS, respectively. The Cr3C2 ceramics show good stability during hot consolidation. Contributing to a further strengthening of the alloy during the hot consolidation, uniformly-distributed Fe-carbide particles of nanometric size precipitated in the copper matrix. Fe-Cr oxycarbides formed in the interphase between Cr3C2 particles and the copper matrix cause the low ductility of Cu-Cr3C2 alloys. Said particles are attributed to impurities/contamination generated from the milling process.
Se obtuvieron aleaciones compuestas de Cu-Cr3C2, aleadas mecánicamente, para estudiar futuras aplicaciones en componentes eléctricos. A altas temperaturas, las aleaciones de base cobre reforzadas por dispersión, son atractivas por su excelente conductividad térmica y eléctrica, propiedades mecánicas y estabilidad microstructural. En este estudio
Nanocrystal Growth in Thermally Treated Fe75Ni2Si8B13C2 Amorphous Alloy
Czech Academy of Sciences Publication Activity Database
Minić, Dragica M.; Blagojević, V.; Minić, Dušan M.; David, Bohumil; Pizúrová, Naděžda; Žák, Tomáš
43A, č. 9 (2012), s. 3062-3069 ISSN 1073-5623 R&D Projects: GA MŠk 1M0512 Institutional support: RVO:68081723 Keywords : Nanocrystal growth * Fe75Ni2Si8B13C2 * Amorphous alloy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.627, year: 2012
Effect of neutron irradiation on vanadium alloys
International Nuclear Information System (INIS)
Braski, D.N.
1986-01-01
Neutron-irradiated vanadium alloys were evaluated for their susceptibility to irradiation hardening, helium embrittlement, swelling, and residual radioactivity, and the results were compared with those for the austenitic and ferritic stainless steels. The VANSTAR-7 and V-15Cr-5Ti alloys showed the greatest hardening between 400 and 600 0 C while V-3Ti-1Si and V-20Ti had lower values that were comparable to those of ferritic steels. The V-15Cr-5Ti and VANSTAR-7 alloys were susceptible to helium embrittlement caused by the combination of weakened grain boundaries and irradiation-hardened grain matrices. Specimen fractures were entirely intergranular in the most severe instances of embrittlement. The V-3Ti-1Si and V-20Ti alloys were more resistant to helium embrittlement. Except for VANSTAR-7 irradiated to 40 dpa at 520 0 C, all of the vanadium alloys exhibited low swelling that was similar to the ferritic steels. Swelling was greater in specimens that were preimplanted with helium using the tritium trick. The vanadium alloys clearly exhibit lower residual radioactivity after irradiation than the ferrous alloys
Effect of neutron irradiation on vanadium alloys
Energy Technology Data Exchange (ETDEWEB)
Braski, D.N.
1986-01-01
Neutron-irradiated vanadium alloys were evaluated for their susceptibility to irradiation hardening, helium embrittlement, swelling, and residual radioactivity, and the results were compared with those for the austenitic and ferritic stainless steels. The VANSTAR-7 and V-15Cr-5Ti alloys showed the greatest hardening between 400 and 600/sup 0/C while V-3Ti-1Si and V-20Ti had lower values that were comparable to those of ferritic steels. The V-15Cr-5Ti and VANSTAR-7 alloys were susceptible to helium embrittlement caused by the combination of weakened grain boundaries and irradiation-hardened grain matrices. Specimen fractures were entirely intergranular in the most severe instances of embrittlement. The V-3Ti-1Si and V-20Ti alloys were more resistant to helium embrittlement. Except for VANSTAR-7 irradiated to 40 dpa at 520/sup 0/C, all of the vanadium alloys exhibited low swelling that was similar to the ferritic steels. Swelling was greater in specimens that were preimplanted with helium using the tritium trick. The vanadium alloys clearly exhibit lower residual radioactivity after irradiation than the ferrous alloys.
International Nuclear Information System (INIS)
Epperson, C.E.; Landolt, R.R.; Kessler, W.V.
1976-01-01
/sup 103m/Rh in equilibrium with parent 103 Ru was separated in yields of 94 percent of those theoretically possible. 103 Ru chloride was first converted to the tetroxide which was then extracted from an aqueous solution of the equilibrium mixture with carbon tetrachloride
International Nuclear Information System (INIS)
Gibson, R.C.; Korenko, M.K.
1980-01-01
Nickel based alloy, the characteristic of which is that it mainly includes in percentages by weight: 57-63 Ni, 7-18 Cr, 10-20 Fe, 4-6 Mo, 1-2 Nb, 0.2-0.8 Si, 0.01-0.05 Zr, 1.0-2.5 Ti, 1.0-2.5 Al, 0.02-0.06 C and 0.002-0.015 B. The aim is to create new nickel-chromium alloys, hardened in a solid solution and by precipitation, that are stable, exhibit reduced swelling and resistant to plastic deformation inside the reactor. These alloys of the gamma prime type have improved mechanical strengthm swelling resistance, structural stability and welding properties compared with Inconel 625 [fr
Amorphization of Fe-based alloy via wet mechanical alloying assisted by PCA decomposition
Energy Technology Data Exchange (ETDEWEB)
Neamţu, B.V., E-mail: Bogdan.Neamtu@stm.utcluj.ro [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 103-105, Muncii Avenue, 400641, Cluj-Napoca (Romania); Chicinaş, H.F.; Marinca, T.F. [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 103-105, Muncii Avenue, 400641, Cluj-Napoca (Romania); Isnard, O. [Université Grenoble Alpes, Institut NEEL, F-38042, Grenoble (France); CNRS, Institut NEEL, 25 rue des martyrs, BP166, F-38042, Grenoble (France); Pană, O. [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath Street, 400293, Cluj-Napoca (Romania); Chicinaş, I. [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 103-105, Muncii Avenue, 400641, Cluj-Napoca (Romania)
2016-11-01
Amorphization of Fe{sub 75}Si{sub 20}B{sub 5} (at.%) alloy has been attempted both by wet and dry mechanical alloying starting from a mixture of elemental powders. Powder amorphization was not achieved even after 140 hours of dry mechanical alloying. Using the same milling parameters, when wet mechanical alloying was used, the powder amorphization was achieved after 40 h of milling. Our assumption regarding the powder amorphization capability enhancement by contamination with carbon was proved by X-ray Photoelectron Spectroscopy (XPS) measurements which revealed the presence of carbon in the chemical composition of the wet mechanically alloyed sample. Using shorter milling times and several process control agents (PCA) (ethanol, oleic acid and benzene) with different carbon content it was proved that the milling duration required for powder amorphization is linked to the carbon content of the PCA. Differential Scanning Calorimetry (DSC), thermomagnetic (TG) and X-ray Diffraction (XRD) measurements performed to the heated samples revealed the fact that, the crystallisation occurs at 488 °C, thus leading to the formation of Fe{sub 3}Si and Fe{sub 2}B. Thermogravimetry measurements performed under H{sub 2} atmosphere, showed the same amount of contamination with C, which is about 2.3 wt%, for the amorphous samples regardless of the type of PCA. Saturation magnetisation of the wet milled samples decreases upon increasing milling time. In the case of the amorphous samples wet milled with benzene up to 20 h and with oleic acid up to 30 h, the saturation magnetisation has roughly the same value, indicating the same degree of contamination. The XRD performed on the samples milled using the same parameters, revealed that powder amorphization can be achieved even via dry milling, just by adding the equivalent amount of elemental C calculated from the TG plots. This proves that in this system by considering the atomic species which can contaminate the powder, they can be
The W alloying effect on thermal stability and hardening of nanostructured Cu–W alloyed thin films
Zhao, J. T.; Zhang, J. Y.; Hou, Z. Q.; Wu, K.; Feng, X. B.; Liu, G.; Sun, J.
2018-05-01
In order to achieve desired mechanical properties of alloys by manipulating grain boundaries (GBs) via solute decoration, it is of great significance to understand the underlying mechanisms of microstructural evolution and plastic deformation. In this work, nanocrystalline (NC) Cu–W alloyed films with W concentrations spanning from 0 to 40 at% were prepared by using magnetron sputtering. Thermal stability (within the temperature range of 200 °C–600 °C) and hardness of the films were investigated by using the x-ray diffraction, transmission electron microscope (TEM) and nanoindentation, respectively. The NC pure Cu film exhibited substantial grain growth upon all annealing temperatures. The Cu–W alloyed films, however, displayed distinct microstructural evolution that depended not only on the W concentration but also on the annealing temperature. At a low temperature of 200 °C, all the Cu–W alloyed films were highly stable, with unconspicuous change in grain sizes. At high temperatures of 400 °C and 600 °C, the microstructural evolution was greatly controlled by the W concentrations. The Cu–W films with low W concentration manifested abnormal grain growth (AGG), while the ones with high W concentrations showed phase separation. TEM observations unveiled that the AGG in the Cu–W alloyed thin films was rationalized by GB migration. Nanoindentation results showed that, although the hardness of both the as-deposited and annealed Cu–W alloyed thin films monotonically increased with W concentrations, a transition from annealing hardening to annealing softening was interestingly observed at the critical W addition of ∼25 at%. It was further revealed that an enhanced GB segregation associated with detwinning was responsible for the annealing hardening, while a reduced solid solution hardening for the annealing softening.
Energy Technology Data Exchange (ETDEWEB)
Guo, Lili; Qin, Lin, E-mail: qinlin@tyut.edu.cn; Kong, Fanyou; Yi, Hong; Tang, Bin
2016-12-01
Highlights: • The Mo alloyed layers were successfully prepared on TLM surface by DG-PSA. • The surface microhardness of TLM is remarkably enhanced by Mo alloying. • The TLM samples after Mo alloying exhibit good wettability. • The Mo alloyed TLM samples show excellent tribological properties. - Abstract: Molybdenum, an alloying element, was deposited and diffused on Ti-5Zr-3Sn-5Mo-15Nb (TLM) substrate by double glow plasma surface alloying technology at 900, 950 and 1000 °C. The microstructure, composition distribution and micro-hardness of the Mo modified layers were analyzed. Contact angles on deionized water and wear behaviors of the samples against corundum balls in simulated human body fluids were investigated. Results show that the surface microhardness is significantly enhanced after alloying and increases with treated temperature rising, and the contact angles are lowered to some extent. More importantly, compared to as-received TLM alloy, the Mo modified samples, especially the one treated at 1000 °C, exhibit the significant improvement of tribological properties in reciprocating wear tests, with lower specific wear rate and friction coefficient. To conclude, Mo alloying treatment is an effective approach to obtain excellent comprehensive properties including optimal wear resistance and improved wettability, which ensure the lasting and safety application for titanium alloys as the biomedical implants.
Interfaces between Model Co-W-C Alloys with Various Carbon Contents and Tungsten Carbide
Directory of Open Access Journals (Sweden)
Igor Konyashin
2018-03-01
Full Text Available Interfaces between alloys simulating binders in WC-Co cemented carbides and tungsten carbide were examined on the micro-, nano-, and atomic-scale. The precipitation of fine WC grains and η-phase occurs at the interface of the alloy with the low carbon content. The precipitation of such grains almost does not occur in the alloy with the medium-low carbon content and does not take place in the alloy with the high carbon content. The formation of Co nanoparticles in the binder alloy with the medium-low carbon content was established. Interfaces in the alloy with the medium-low carbon content characterized by complete wetting with respect to WC and with the high carbon content characterized by incomplete wetting were examined at an atomic scale. The absence of any additional phases or carbon segregations at both of the interfaces was established. Thus, the phenomenon of incomplete wetting of WC by liquid binders with high carbon contents is presumably related to special features of the Co-based binder alloys oversaturated with carbon at sintering temperatures.
International Nuclear Information System (INIS)
Chen, Zhe Jay; Bongiorni, Paul; Nath, Ravinder
2010-01-01
Purpose: Although several dosimetric characterizations using Monte Carlo simulation and thermoluminescent dosimetry (TLD) have been reported for the new Advantage Pd-103 source (IsoAid, LLC, Port Richey, FL), no AAPM consensus value has been established for the dosimetric parameters of the source. The aim of this work was to perform an additional dose-rate constant (Λ) determination using a recently established photon spectrometry technique (PST) that is independent of the published TLD and Monte Carlo techniques. Methods: Three Model IAPD-103A Advantage Pd-103 sources were used in this study. The relative photon energy spectrum emitted by each source along the transverse axis was measured using a high-resolution germanium spectrometer designed for low-energy photons. For each source, the dose-rate constant was determined from its emitted energy spectrum. The PST-determined dose-rate constant ( PST Λ) was then compared to those determined by TLD ( TLD Λ) and Monte Carlo ( MC Λ) techniques. A likely consensus Λ value was estimated as the arithmetic mean of the average Λ values determined by each of three different techniques. Results: The average PST Λ value for the three Advantage sources was found to be (0.676±0.026) cGyh -1 U -1 . Intersource variation in PST Λ was less than 0.01%. The PST Λ was within 2% of the reported MC Λ values determined by PTRAN, EGSnrc, and MCNP5 codes. It was 3.4% lower than the reported TLD Λ. A likely consensus Λ value was estimated to be (0.688±0.026) cGyh -1 U -1 , similar to the AAPM consensus values recommended currently for the Theragenics (Buford, GA) Model 200 (0.686±0.033) cGyh -1 U -1 , the NASI (Chatsworth, CA) Model MED3633 (0.688±0.033) cGyh -1 U -1 , and the Best Medical (Springfield, VA) Model 2335 (0.685±0.033) cGyh -1 U -1 103 Pd sources. Conclusions: An independent Λ determination has been performed for the Advantage Pd-103 source. The PST Λ obtained in this work provides additional information
International Nuclear Information System (INIS)
Sun, Ting; Wu, Xiaozhi; Wang, Rui; Li, Weiguo
2015-01-01
The adhesion and ductility of (100) and (110) Al/TiC interfaces alloyed by Mg, Zn, Cu, Fe, and Ti have been investigated using first-principles methods. Fe and Ti can enhance the adhesion of (100) and (110) interfaces. Mg and Zn have the opposite effect. Interfacial electronic structures have been created to analyze the changes of the work of adhesion. It is found that more charge is accumulated at interfaces alloyed by Fe and Ti compared with pure Al/TiC. There is also an obvious downward shift in the Fermi energy of Fe, Ti at the interface. Furthermore, the unstable stacking fault energies of the interfaces are calculated; the results demonstrate that the preferred slip direction is the 〈110〉 direction for (100) and (110) Al/TiC. Based on the Rice criterion of ductility, the results predict that Mg, Fe, and Ti are promising candidates for improving the ductility of Al/TiC interfaces. (paper)
Chen, Tao; Liu, Defu; Wu, Fan; Wang, Haojun
2017-01-01
To solve the lack of wear resistance of titanium alloys for use in biological applications, various prepared coatings on titanium alloys are often used as wear-resistant materials. In this paper, TiC bioinert coatings were fabricated on Ti6Al4V by laser cladding using mixed TiC and ZrO2 powders as the basic pre-placed materials. A certain amount of CeO2 powder was also added to the pre-placed powders to further improve the properties of the TiC coatings. The effects of CeO2 additive on the ph...
Lifescience Database Archive (English)
Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin
In-Vitro Corrosion Studies of Bioabsorbable Alloys
Gill, P.; Munroe, N.
Magnesium alloys have inspired a significant amount of attention from researchers all over the world for cardiovascular and orthopedic applications due to their light weight, mechanical integrity and degradation behavior. In this investigation, cast manufactured binary, ternary and quaternary magnesium alloys were studied for their degradation behavior by potentiodynamic polarization tests in phosphate buffer saline solution (PBS) and PBS containing amino acids (cysteine, C and tryptophan, W) at 37 °C. Electrochemical impedance spectroscopy (EIS) tests were performed to determine the charge transfer resistance and immersion tests were performed to assess corrosion rate and hydrogen evolution from the alloys. Furthermore, the surface morphology and surface chemistry of the alloys were observed by scanning electron microscopy (SEM) and X-ray diffraction (XRD).
Corrosion performance of new Zircaloy-2-based alloys
International Nuclear Information System (INIS)
Rudling, P.; Mikes-Lindbaeck, M.; Lethinen, B.; Andren, H.O.; Stiller, K.
1994-01-01
A material development project was initiated to develop a new zirconium alloy, outside the ASTM specifications for Zircaloy-2 and Zircaloy-4, with optimized hydriding and corrosion properties for both boiling water reactors and pressurized water reactors. A number of different alloys were manufactured. These alloys were long-term corrosion tested in autoclaves at 400 C in steam. Also, a 520 C/24 h steam test was carried out. The zirconium metal microstructure and the chemistry of precipitates were characterized by analytical electron microscopy. The metal matrix chemistry was determined by atom probe analysis. The paper describes the correlations between corrosion material performance and zirconium alloy microstructure
Postirradiation deformation behavior in ferritic Fe-Cr alloys
International Nuclear Information System (INIS)
Hamilton, M.L.; Gelles, D.S.; Gardner, P.L.
1992-06-01
It has been demonstrated that fast-neutron irradiation produces significant hardening in simple Fe-(3-18)Cr binary alloys irradiated to about 35 dpa in the temperature range 365 to 420 degrees C, whereas irradiation at 574 degrees C produces hardening only for 15% or more chromium. The irradiation-induced changes in tensile properties are discussed in terms of changes in the power law work-hardening exponent. The work-hardening exponent of the lower chromium alloys decreased significantly after low-temperature irradiation (≤ 420 degrees C) but increased after irradiation at 574 degrees C. The higher chromium alloys failed either in cleavage or in a mixed ductile/brittle fashion. Deformation microstructures are presented to support the tensile behavior
The modification of some properties of Al-2%Mg alloy by Ti &Li alloying elements
Directory of Open Access Journals (Sweden)
Talib Abdulameer Jasim
2017-11-01
Full Text Available Aluminium-Magnisium alloys are light, high strength with resistance to corrosion and good weldability. When the content of magnesium exceeds 3% there is a tendency to stress corrosion . This work is an attempt is to prepare low density alloy with up to approximately 2.54 g / cm3 by adding different contents of Ti, and lithium to aluminum-2%Magnisium alloy. The lithium is added in two aspects, lithium chloride and pure metal. The casting performed using conventional casting method. Moreover, solution heat treatment (SHT at 520 ºC for 4 hrs, quenching in cold water, and aging at 50ºC for 4 days were done to get better mechanical properties of all samples. Microstructure was inspected by light optical microscope before and after SHT. Alloy3 which contains 1.5%Ti was tested by SEM and EDS spectrometer to exhibit the shape and micro chemical analysis of Al3Ti phase. Hardness, ultimate tensile strength, and modulus of elasticity were tested for all alloys. The results indicated that Al3Ti phase precipitates in alloys contain 0.5%T, 1%Ti, And 1.5%Ti. The phases Al3Li as well as Al3Ti were precipitated in alloy4 which contains 2%Ti, and 2.24%Li. Mechanical properties test results also showed that the alloy4 has achieved good results, the modulus of elasticity chanced from 310.65GPa before SHT to 521.672GPa, after SHT and aging, the ultimate tensile strength was changed from 365MPa before SHT to 469MPa, after SHT and aging, and hardness was increased from 128 to 220HV.
Effect of TiC addition on fracture toughness of Al6061 alloy
Raviraj, M. S.; Sharanprabhu, C. M.; Mohankumar, G. C.
2018-04-01
Al 6061 matrix was reinforced with different proportions of TiC particles such as 3wt%, 5wt% and 7wt% and the effect on fracture toughness was studied. Al-TiC metal matrix composites were produced by stir casting method to ensure uniform distribution of the TiC particulates in the Al matrix. LEFM (Linear Elastic Fracture Mechanics) has been used to characterize the fracture toughness using various specimen geometries. The compact tension (CT) specimens with straight through notch were machined as per ASTM E399 specifications. All the specimens were machined to have constant a/W=0.5 and B/W was varied from 0.2 to 0.7. A sharp crack initiation was done at the end of notch by fatigue loading using servo-hydraulic controlled testing machine. Load v/s crack mouth opening displacement (CMOD) data was plotted and stress intensity factor, KQ determined. Critical stress intensity factor KIC was obtained by plotting KQ v/s thickness of specimen data. The fracture toughness of the composites varied between 16-19 MPa√m as compared to 23MPa√m for base alloy Al6061. Composites with 3wt% and 7wt% TiC showed better fracture toughness than 5wt% TiC reinforced Al metal matrix composites.
Energy Technology Data Exchange (ETDEWEB)
Behnamian, Yashar, E-mail: behnamia@ualberta.ca [Department of Chemical and Materials Engineering, University of Alberta, Edmonton, Alberta T6G 1H9 (Canada); Mostafaei, Amir [Department of Mechanical Engineering and Materials Science, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Kohandehghan, Alireza [Department of Chemical and Materials Engineering, University of Alberta, Edmonton, Alberta T6G 1H9 (Canada); Amirkhiz, Babak Shalchi [Canmet MATERIALS, Natural Resources Canada, Hamilton, Ontario L8P 0A5 (Canada); Serate, Daniel [Department of Chemical and Materials Engineering, University of Alberta, Edmonton, Alberta T6G 1H9 (Canada); Zheng, Wenyue [Canmet MATERIALS, Natural Resources Canada, Hamilton, Ontario L8P 0A5 (Canada); Guzonas, David [Canadian Nuclear Laboratories, Chalk River Laboratories, Chalk River, Ontario K0J 1J0 (Canada); Chmielus, Markus [Department of Mechanical Engineering and Materials Science, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Chen, Weixing, E-mail: Weixing@ualberta.ca [Department of Chemical and Materials Engineering, University of Alberta, Edmonton, Alberta T6G 1H9 (Canada); Luo, Jing Li, E-mail: Jingli.luo@ualberta.ca [Department of Chemical and Materials Engineering, University of Alberta, Edmonton, Alberta T6G 1H9 (Canada)
2016-10-15
The oxide scale grown of static capsules made of alloy 310S stainless steel was investigated by exposure to the supercritical water at 500 °C 25 MPa for various exposure times up to 20,000 h. Characterization techniques such as X-ray diffraction, scanning/transmission electron microscopy, energy dispersive spectroscopy, and fast Fourier transformation were employed on the oxide scales. The elemental and phase analyses indicated that long term exposure to the SCW resulted in the formation of scales identified as Fe{sub 3}O{sub 4} (outer layer), Fe-Cr spinel (inner layer), Cr{sub 2}O{sub 3} (transition layer) on the substrate, and Ni-enrichment (chrome depleted region) in the alloy 310S. It was found that the layer thickness and weight gain vs. exposure time followed parabolic law. The oxidation mechanism and scales grown on the alloy 310S stainless steel exposed to SCW are discussed. - Highlights: •Oxidation of alloy 310S stainless steel exposed to SCW (500 °C/25 MPa) •The layer thickness and weight gain vs. exposure time followed parabolic law. •Oxide layers including Fe{sub 3}O{sub 4} (outer), Fe-Cr spinel (inner) and Cr{sub 2}O{sub 3} (transition) •Ni element is segregated by the selective oxidation of Cr.
International Nuclear Information System (INIS)
Xiao Zhu; Li Zhou; Fang Mei; Xiong Shiyun; Sheng Xiaofei; Zhou Mengqi
2008-01-01
The fabrication conditions of Cu-Al-Ni-Mn alloy powder by mechanical alloying and powder metallurgy have been systematically studied. The mechanically alloyed powder (MAed powder) was fabricated at a speed between 100 rpm and 300 rpm for various milling times with and without process control agent (PCA). With an increasing of milling time, the size of crystallite grain decreases. Only the Cu diffraction pattern appear as the rotation speed is up to 300 rpm for 25 h. The elemental powders with PCA agglomerate slightly, but the degree of alloying is lower than that without PCA. The shape memory recovery of the quenched sample hot-extruded at extrusion rate of 50:1 is measured to be 100% recovered in 250 deg. C oil bath for 40 s after deformed to 4.0%. After aging at 120 deg. C for 10 days, the shape memory recovery of the alloy remains 98%
Austenitic alloys Fe-Ni-Cr dominating
International Nuclear Information System (INIS)
Gibson, R.C.; Korenko, M.K.
1980-01-01
Austenitic alloy essentially comprising 42 to 48% nickel, 11 to 13% chromium, 2.6 to 3.4% niobium, 0.2 to 1.2% silicon, 0.5 to 1.5% vanadium, 2.6 to 3.4% molybdenum, 0.1 to 0.3% aluminium, 0.1 to 0.3% titanium, 0.02 to 0.05% carbon, 0.002 to 0.015% boron, up to 0.06% zirconium, the balance being iron. The characteristic of this alloy is a conventional elasticity limit to within 2% of at least 450 MPa, with a maximum tensile strength of at least 500 MPa at a test temperature of 650 0 C after immersion annealing at 1038 0 C and 30% hardening. To this effect the invention concerns Ni-Cr-Fe high temperature alloys possessing excellent mechanical strength characteristics, that can be obtained with lower levels of nickel and chromium than those used in alloys of this kind in the present state of the technique, a higher amount of niobium than in the previous alloys and with the addition of 0.5 to 1.5% vanadium [fr
High-strength Ti Alloy Prepared via Promoting Interstitial-Carbon Diffusion
Energy Technology Data Exchange (ETDEWEB)
Kim, Bo-Young; Lee, Jae-Chul [Korea University, Seoul (Korea, Republic of); Ko, Se-Hyun [KITECH, Incheon (Korea, Republic of)
2017-05-15
Feasibility studies are performed to determine the suitability of a novel simple synthesis technique for fabricating a new Ti alloy with improved strength and ductility, while exhibiting lower cell toxicity. Through consolidating pure Ti powders under a C atmosphere at elevated temperatures, a bulk form of the Ti alloy, in which a quantifiable amount of C is dissolved, is synthesized. While the alloy is free from toxic elements such as Al and V, the strength and ductility of the developed alloy are comparable to, or better than, those of its commercial Ti-6Al-4V alloy counterpart. In this study, the method to design the alloy, its synthesis, and the resultant properties are reported.
Investigation of microstructure in hot-pressed Nb–23Ti–15Al alloy
International Nuclear Information System (INIS)
Shi, Zhiwu; Wei, Hua; Zhang, Hongyu; Wu, Duoli; Jin, Tao; Sun, Xiaofeng; Zheng, Qi
2015-01-01
Highlights: • The Ti(O, C), a new strengthening phase, is found in Nb–Ti–Al alloys. • Ti(O, C) has a face-centered cubic structure and a lattice parameter of 4.27 Å. • Two different morphologies of Ti(O, C) are observed. • β and δ phases exhibit as large irregular blocks and equiaxed particles. • Ordering of β phase is observed in hot-pressed Nb–Ti–Al alloy. - Abstract: Microstructure of hot-pressed Nb–23Ti–15Al alloy has been systematically investigated, with emphasis on the characterization of Ti(O, C) phase. The microstructure and composition of Nb–23Ti–15Al alloy were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM) and electron probe microanalysis (EPMA). The results indicate the presence of β, δ and Ti(O, C) phases in the alloy. The β phase exhibits as large irregular blocks, while the δ phase presents as small equiaxed particles linked together around β blocks. Ordering of β phase is shown by related selected area electronic diffraction (SAED) patterns and dark-field micrograph. The Ti(O, C), a solid-solution of TiO or TiC, is characterized for the first time in Nb–Ti–Al alloy. The Ti(O, C) has a face-centered cubic (FCC) structure and a moderate lattice parameter between that of TiO and TiC. Two different morphologies of Ti(O, C) are observed in the alloy: large cobblestone-like aggregated particles and small dispersive particles. The formation of Ti(O, C) phase can potentially increase high-temperature strength of Nb–Ti–Al alloy
Investigation of microstructure in hot-pressed Nb–23Ti–15Al alloy
Energy Technology Data Exchange (ETDEWEB)
Shi, Zhiwu; Wei, Hua; Zhang, Hongyu; Wu, Duoli; Jin, Tao; Sun, Xiaofeng; Zheng, Qi, E-mail: qzheng@imr.ac.cn
2015-07-05
Highlights: • The Ti(O, C), a new strengthening phase, is found in Nb–Ti–Al alloys. • Ti(O, C) has a face-centered cubic structure and a lattice parameter of 4.27 Å. • Two different morphologies of Ti(O, C) are observed. • β and δ phases exhibit as large irregular blocks and equiaxed particles. • Ordering of β phase is observed in hot-pressed Nb–Ti–Al alloy. - Abstract: Microstructure of hot-pressed Nb–23Ti–15Al alloy has been systematically investigated, with emphasis on the characterization of Ti(O, C) phase. The microstructure and composition of Nb–23Ti–15Al alloy were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM) and electron probe microanalysis (EPMA). The results indicate the presence of β, δ and Ti(O, C) phases in the alloy. The β phase exhibits as large irregular blocks, while the δ phase presents as small equiaxed particles linked together around β blocks. Ordering of β phase is shown by related selected area electronic diffraction (SAED) patterns and dark-field micrograph. The Ti(O, C), a solid-solution of TiO or TiC, is characterized for the first time in Nb–Ti–Al alloy. The Ti(O, C) has a face-centered cubic (FCC) structure and a moderate lattice parameter between that of TiO and TiC. Two different morphologies of Ti(O, C) are observed in the alloy: large cobblestone-like aggregated particles and small dispersive particles. The formation of Ti(O, C) phase can potentially increase high-temperature strength of Nb–Ti–Al alloy.
Hydrofluoric Acid Corrosion Study of High-Alloy Materials
International Nuclear Information System (INIS)
Osborne, P.E.
2002-01-01
A corrosion study involving high-alloy materials and concentrated hydrofluoric acid (HF) was conducted in support of the Molten Salt Reactor Experiment Conversion Project (CP). The purpose of the test was to obtain a greater understanding of the corrosion rates of materials of construction currently used in the CP vs those of proposed replacement parts. Results of the study will help formulate a change-out schedule for CP parts. The CP will convert slightly less than 40 kg of 233 U from a gas (UF 6 ) sorbed on sodium fluoride pellets to a more stable oxide (U 3 O 8 ). One by-product of the conversion is the formation of concentrated HF. Six moles of highly corrosive HF are produced for each mole of UF 6 converted. This acid is particularly corrosive to most metals, elastomers, and silica-containing materials. A common impurity found in 233 U is 232 U. This impurity isotope has several daughters that make the handling of the 233 U difficult. Traps of 233 U may have radiation fields of up to 400 R at contact, a situation that makes the process of changing valves or working on the CP more challenging. It is also for this reason that a comprehensive part change-out schedule must be established. Laboratory experiments involving the repeated transfer of HF through 1/2-in. metal tubing and valves have proven difficult due to the corrosivity of the HF upon contact with all wetted parts. Each batch of HF is approximately 1.5 L of 33 wt% HF and is transferred most often as a vapor under vacuum and at temperatures of up to 250 C. Materials used in the HF side of the CP include Hastelloy C-276 and Monel 400 tubing, Haynes 230 and alloy C-276 vessels, and alloy 400 valve bodies with Inconel (alloy 600) bellows. The chemical compositions of the metals discussed in this report are displayed in Table 1. Of particular concern are the almost 30 vendor-supplied UG valves that have the potential for exposure to HF. These valves have been proven to have a finite life due to failure
International Nuclear Information System (INIS)
Wille, G.W.; Davis, J.W.
1981-04-01
The titanium alloys that offer properties worthy of consideration for fusion reactors are Ti-6Al-4V, Ti-6Al-2Sn-4Zr-2Mo-Si (Ti-6242S) and Ti-5Al-6Sn-2Zr-1Mo-Si (Ti-5621S). The Ti-6242S and Ti-5621S are being considered because of their high creep resistance at elevated temperatures of 500 0 C. Also, irradiation tests on these alloys have shown irradiation creep properties comparable to 20% cold worked 316 stainless steel. These alloys would be susceptible to slow strain rate embrittlement if sufficient hydrogen concentrations are obtained. Concentrations greater than 250 to 500 wppm hydrogen and temperatures lower than 100 to 150 0 C are approximate threshold conditions for detrimental effects on tensile properties. Indications are that at the elevated temperature - low hydrogen pressure conditions of the reactors, there would be negligible hydrogen embrittlement
High strength cast aluminum alloy development
Druschitz, Edward A.
The goal of this research was to understand how chemistry and processing affect the resulting microstructure and mechanical properties of high strength cast aluminum alloys. Two alloy systems were investigated including the Al-Cu-Ag and the Al-Zn-Mg-Cu systems. Processing variables included solidification under pressure (SUP) and heat treatment. This research determined the range in properties that can be achieved in BAC 100(TM) (Al-Cu micro-alloyed with Ag, Mn, Zr, and V) and generated sufficient property data for design purposes. Tensile, stress corrosion cracking, and fatigue testing were performed. CuAl2 and Al-Cu-Fe-Mn intermetallics were identified as the ductility limiting flaws. A solution treatment of 75 hours or longer was needed to dissolve most of the intermetallic CuAl 2. The Al-Cu-Fe-Mn intermetallic was unaffected by heat treatment. These results indicate that faster cooling rates, a reduction in copper concentration and a reduction in iron concentration might increase the ductility of the alloy by decreasing the size and amount of the intermetallics that form during solidification. Six experimental Al-Zn-Mg-Cu series alloys were produced. Zinc concentrations of 8 and 12wt% and Zn/Mg ratios of 1.5 to 5.5 were tested. Copper was held constant at 0.9%. Heat treating of the alloys was optimized for maximum hardness. Al-Zn-Mg-Cu samples were solution treated at 441°C (826°F) for 4 hours before ramping to 460°C (860°F) for 75 hours and then aged at 120°C (248°F) for 75 hours. X-ray diffraction showed that the age hardening precipitates in most of these alloys was the T phase (Mg32Zn 31.9Al17.1). Tensile testing of the alloys showed that the best mechanical properties were obtained in the lowest alloy condition. Chilled Al-8.2Zn-1.4Mg-0.9Cu solidified under pressure resulted in an alloy with a yield strength of 468MPa (68ksi), tensile strength of 525MPa (76ksi) and an elongation of 9%.
International Nuclear Information System (INIS)
Mousavi, S. A. A. Akbari; Ebrahimzadeh, H.
2011-01-01
Copper-beryllium and soft magnetic alloys must be joined in electrical and electro-mechanical applications. There is a high difference in melting temperatures of these alloys which cause to make the joining process very difficult. In addition, copper-beryllium alloys are of age hardenable alloys and precipitations can brittle the weld. 49Ni-Fe alloy is very hot crack sensitive. Moreover, these alloys have different heat transfer coefficients and reflection of laser beam in laser welding process. Therefore, the control of welding parameters on the formation of adequate weld puddle composition is very difficult. Laser welding is an advanced technique for joining of dissimilar materials since it can precisely control and adjust the welding parameters. In this study, a 100W Nd:YAG pulsed laser machine was used for joining 49Ni-Fe soft magnetic to C17300 copper-beryllium alloys. Welding of samples was carried out autogenously by changing the pulse duration, diameter of beam, welding speed, voltage and frequency. The spacing between samples was set to almost zero. The ample were butt welded. It was required to apply high voltage in this study due to high reflection coefficient of copper alloys. Metallography, SEM analysis, XRD and microhardness measurement was used for survey of results. The results show that the weld strength depends upon the chemical composition of the joints. To change the wells composition and heat input of the welds, it was attempted to deviate the laser focus away from the weld centerline. The best strength was achieved by deviation of the laser beam away about 0.1mm from the weld centerline. The result shows no intermetallic compounds if the laser beam is deviated away from the joint.
Tungsten wire-nickel base alloy composite development
Brentnall, W. D.; Moracz, D. J.
1976-01-01
Further development and evaluation of refractory wire reinforced nickel-base alloy composites is described. Emphasis was placed on evaluating thermal fatigue resistance as a function of matrix alloy composition, fabrication variables and reinforcement level and distribution. Tests for up to 1,000 cycles were performed and the best system identified in this current work was 50v/o W/NiCrAlY. Improved resistance to thermal fatigue damage would be anticipated for specimens fabricated via optimized processing schedules. Other properties investigated included 1,093 C (2,000 F) stress rupture strength, impact resistance and static air oxidation. A composite consisting of 30v/o W-Hf-C alloy fibers in a NiCrAlY alloy matrix was shown to have a 100-hour stress rupture strength at 1,093 C (2,000 F) of 365 MN/square meters (53 ksi) or a specific strength advantage of about 3:1 over typical D.S. eutectics.
Electrodeposition of engineering alloy coatings
DEFF Research Database (Denmark)
Christoffersen, Lasse
Nickel based electrodeposited alloys were investigated with respect to their deposition process, heat treatment, hardness, corrosion resistance and combined wear-corrosion resistance. The investigated alloys were Ni-B, Ni-P and Ni-W, which are not fully developed for industrial utilisation...... are written in brackets). Temperature and especially pH influenced the cathodic efficiency of the electrodeposition processes for Ni-W and Ni-P. Mass balance problems of the development alloy processes are identified.Heat treatment for one hour at approx. 350°C, 400°C and 600°C of electrodeposited Ni-B, Ni......-P and Ni-W, respectively, resulted in hardness values of approx. 1000 HV0.1 in the case of Ni-P(6), approx. 1100 HV0.1 in the case of Ni-W(40-53) and approx. 1300 HV0.1 in the case of Ni-B(5). Cracks, which emerged during electrodeposition and heat treatment, were observed on Ni-W and Ni-B.The corrosion...