WorldWideScience

Sample records for alfa 2b recombinante

  1. Intensive Farmaco- Surveillance of Interferon Alpha 2b Recombinant in Multiple Sclerosis. Farmacovigilancia intensiva al interferón alfa 2b recombinante en la esclerosis múltiple.

    Directory of Open Access Journals (Sweden)

    Hailen Bobillo López

    recombinant was safe in the treatment of the multiple sclerosis in these patients.

     

    Fundamento: El interferón alfa 2b recombinante, de producción nacional, se utiliza en el tratamiento de diferentes enfermedades, entre ellas la esclerosis múltiple. Para su comercialización se necesita conocer su margen de seguridad. Objetivo: Evaluar las reacciones adversas del interferón alfa 2b recombinante en el tratamiento de la esclerosis múltiple. Método: Durante el período comprendido entre 1996 y 2006, se revisaron las 70 historias clínicas y cuadernos de recogida de datos de los pacientes incluidos en el ensayo clínico nacional, fase IV aleatorizado, a doble ciegas, desarrollado en la Clínica de Esclerosis Múltiple del Hospital ¨Dr. Gustavo Aldereguía Lima¨ de Cienfuegos. Con respecto al total de reacciones adversas manifestadas, se analizó tipo, tiempo de duración, empleo de tratamiento o no para contrarrestarlas, grado de intensidad (leve, moderada, grave o mortal y de causalidad (definitiva, probable, posible, condicional o no relacionada. Resultados: Del total de pacientes, 53 presentaron 207 reacciones adversas al interferón. Las más frecuentes fueron: fiebre, cefalea, escalofríos, artralgia, astenia y mialgia, siendo la mayoría efectos colaterales moderados y de carácter definitivo. En 197 pacientes el desenlace fue favorable. Conclusiones: El uso del interferón alfarecombinante fue seguro en el tratamiento de la esclerosis múltiple en estos pacientes.

  2. Interferon Alfa-2b Injection

    Science.gov (United States)

    Interferon alfa-2b injection is used to treat a number of conditions.Interferon alfa-2b injection is used alone or in ... Hodgkin's lymphoma (NHL; a slow-growing blood cancer). Interferon alfa-2b is in a class of medications ...

  3. Establecimiento y validación de un ensayo inmunoenzimático tipo ELISA, empleado en el control de calidad del Interferón alfa 2b humano recombinante

    Directory of Open Access Journals (Sweden)

    Susset Valderrama

    2009-04-01

    Full Text Available Se estableció y validó un ELISA para la cuantificación del Interferón alfa 2b humano recombinante en el Ingrediente Farmacéutico Activo, definiéndose los criterios de validez del ensayo y basado en el cumplimiento de las Buenas Prácticas de Laboratorio. Se evaluaron los parámetros de: linealidad, especificidad, exactitud, rango, precisión y robustez. El ensayo establecido resultó específico, con una exactitud entre 84,3% y 102,4%, se demostró un ajuste cuadrático y un rango de trabajo entre 1 y 10 ng/mL; la repetibilidad y la precisión intermedia mostraron coeficientes de variación inferiores al 10% y 20% respectivamente, y se comprobó la robustez del método con respecto al efecto borde y la estabilidad de las soluciones.

  4. Psychiatric side effects of pegylated interferon alfa-2b as compared to conventional interferon alfa-2b in patients with chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    Michael R Kraus; Arne Sch(a)fer; Herbert Csef; Michael Scheurlen

    2005-01-01

    AIM: To assess systematically the spectrum and extent of depressive symptoms comparing patient groups receiving peginterferon or conventional interferon.METHODS: Ninety-eight patients with chronic hepatitis C and interferon-based therapy (+ribavirin) were consecutively enrolled in a longitudinal study. Patients were treated with conventional interferon alfa-2b (48/98patients; 5 MIU interferon alfa-2b thrice weekly) or peginterferon alfa-2b (50/98 patients; 80-150 μgpeginterferon alfa-2b) in combination with weight-adapted ribavirin (800-1 200 mg/d). Repeated psychometric testing was performed before, three times during and once after antiviral therapy: Depression was evaluated by the Hospital Anxiety and Depression Scale (HADS), anger/hostility by the Symptom Checklist-90 Items Revised (SCL-90-R).RESULTS: Therapy with pegylated interferon alfa-2bproduces comparable scores for depression (ANOVA:P = 0.875) as compared to conventional interferon.Maximums of depression scores were even higher and cases of clinically relevant depression were frequent during therapy with peginterferon. Scores for anger/hostility were comparable for both therapy subgroups.CONCLUSION: Our findings suggest that the extent and frequency of depressive symptoms in total are not reduced by peginterferon. Monitoring and management of neuropsychiatric toxicity especially depression have to be considered as much as in antiviral therapy with unmodified interferon.

  5. Relato do primeiro paciente brasileiro com a forma infantil da doença de Pompe tratado com alfa-glicosidase recombinante humana

    OpenAIRE

    2008-01-01

    Objetivo: Relatar o primeiro caso de forma infantil da doença de Pompe tratado no Brasil. Descrição: Trata-se de doença de depósito lisossomal que se caracteriza por defeitos da enzima alfa-glicosidase ácida, com acúmulo intracelular de glicogênio, principalmente nos músculos. São descritas a forma infantil e tardia. Desde 2006, está disponível tratamento com enzima recombinante humana. Descreve-se o primeiro caso de forma infantil da doença tratado no Brasil. Trata-se de menina com 2,5 meses...

  6. The efficacy and safety of double (cepeginterferon alfa-2b and ribavirin and triple (simeprevir, cepeginterferon alfa 2b and ribavirin treatment regimens in chronic hepatitis C patients. The experience of everyday clinical practice

    Directory of Open Access Journals (Sweden)

    N. P. Blokhina

    2016-01-01

    Full Text Available The objective. To evaluate the efficacy, safety and tolerability of double (cepeginterferon alfa-2b and ribavirin and triple (simeprevir, cepeginterferon alfa 2b and ribavirin treatment regimens in chronic hepatitis C patients in everyday clinical practice of the Hepatology Center in Clinical Infectious Diseases Hospital in Moscow.Materials and methods. From 2013 to 2015 a total of 289 patients with chronic hepatitis C received antiviral therapy with cepeginterferon alfa 2b. 267 patients received combination of cepeginterferon alfa 2b and ribavirin. 22 patients received triple antiviral therapy with simeprevir, cepeginterferon alfa 2b and ribavirin. Treatment efficacy was assessed by the rate of sustained virologic response on 12/24 week after completion of antiviral therapy (SVR 12/24. In safety analysis all 289 patients were included. All cases of deterioration of the patient’s condition and laboratory abnormalities were registered throughout the treatment period and follow up.Results. 267 patients (74,5%, n=199, with 2/3 genotype, 25,5%, n = 68, with 1 genotype received cepeginterferon alfa 2b 1,5 µg/kg/week and ribavirin 800-1400 daily (weight based. 22 patients with genotype 1 (the majority of them had advanced fibrosis (F3-F4 underwent triple therapy with simeprevir 150 mg once daily in combination with cepeginterferon alfa 2b 1,5 µg/kg/week and ribavirin 800-1400 mg daily (weight based for 12 weeks, followed by cepeginterferon alfa 2b/ ribavirin therapy for 12-36 weeks. SVR was observed in 85,6% (n=113 of genotype 2/3 infected patients and in 64,6% (n=31 of genotype 1 infected patients. Among patients with mild or moderate fibrosis SVR rate was 90,7% in genotype 2/3 patients and 75% in genotype 1 patients. 21 patient completed the course of triple therapy. SVR was observed in 71,4% (n=15 of patients. Registered adverse reactions were common for interferon/ribavirin based therapy. In most cases adverse events were moderate and matched

  7. Interferón alfa-2b tópico como primera opción en las neoplasias intraepiteliales corneoconjuntivales Topical interferon alfa-2b for primary treatment of conjunctiva-cornea intraepithelial neoplasia

    Directory of Open Access Journals (Sweden)

    M. Pérez de Arcelus

    2012-04-01

    Full Text Available Se describen dos casos de neoplasia intraepitlelial corneo-conjuntival (CIN tratados con interferón alfa-2b (IFN alfa-2b tópico como primera elección. El tratamiento clásico de los CIN ha sido tradicionalmente la resección completa con márgenes de seguridad seguida de crioterapia en el lecho quirúrgico. No obstante, y puesto que la tasa de recidivas puede alcanzar el 50% han sido propuestos coadyuvantes como la mitomicina C y el 5 fluoracilo, con el consiguiente riesgo de toxicidad corneal y límbica. El IFN alfa-2b presenta una eficacia similar a la cirugía en la erradicación completa de la masa tumoral como primera opción, con escasos efectos secundarios y nulo potencial carcinogénico, incluso en casos de recurrencia a terapia con mitomicina C, lesiones quirúrgicas residuales y formas difusas.We describe two cases of conjunctival-cornea intraepithelial neoplasia (CIN, treated with topical IFN alfa 2b. The traditional treatment for CIN is surgical excision usually with adjunctive cryotherapy. However, residual tumour may remain, which can lead to recurrence rates of more than 50%. 5-Fluorouracil, mitomicyn C and interferon alfa 2b are new pharmacological agents that have proved their efficacy in the treatment of CIN. As side effects are common, we present IFN alfa 2b as a single therapeutic agent as an effective and optimal treatment for presumed recurrent corneal and conjunctival intraepithelial neoplasia. It offers the benefits of topical therapy and avoids the risks of surgical or other interventions - specifically, ocular surface toxicity, cicatricial conjunctival changes, and limbal stem cell deficiency.

  8. Interferón alfa-2b tópico como primera opción en las neoplasias intraepiteliales corneoconjuntivales Topical interferon alfa-2b for primary treatment of conjunctiva-cornea intraepithelial neoplasia

    OpenAIRE

    M. Pérez de Arcelus; Aranguren, M.; J. Andonegui

    2012-01-01

    Se describen dos casos de neoplasia intraepitlelial corneo-conjuntival (CIN) tratados con interferón alfa-2b (IFN alfa-2b) tópico como primera elección. El tratamiento clásico de los CIN ha sido tradicionalmente la resección completa con márgenes de seguridad seguida de crioterapia en el lecho quirúrgico. No obstante, y puesto que la tasa de recidivas puede alcanzar el 50% han sido propuestos coadyuvantes como la mitomicina C y el 5 fluoracilo, con el consiguiente riesgo de toxicidad corneal ...

  9. A randomized controlled clinical study of lower-dose peginterferon alfa-2b in combination with ribavirin in the treatment of chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    罗端德

    2006-01-01

    Objective To compare the efficacy and safety of lower-dose peginterferon alfa-2b plus ribavirin versus standard interferon alfa-2b plus ribavirin for treatment of chronic hepatitis C in China. Methods 192 patients with chronic hepatitis C were assigned peginterferon alfa-2b 0.5μg/kg each week plus ribavirin 750~1050 mg/d or standard interferon alfa-2b 3 MIU TIW plus ribavirin 750~1050 mg/d for 48-week treatment and 24-week fellow

  10. Benefit of adjuvant interferon alfa-2b (IFN-α) therapy in melanoma patients with high serum MMP-8 levels

    DEFF Research Database (Denmark)

    Vihinen, Pia; Tervahartiala, Taina; Sorsa, Timo;

    2015-01-01

    Matrix metalloproteinases (MMPs) are important enzymes in tissue turnover and various inflammatory processes. In this study, it was evaluated whether serum MMP-8 can predict the response to adjuvant interferon alfa-2b (IFN-α) therapy in patients with operated high-risk cutaneous melanoma. Pre...

  11. Peg-Interferon Alfa 2-b Related Cellulitis in a 40 Years Man

    Directory of Open Access Journals (Sweden)

    Shahnaaz Sali

    2016-01-01

    Full Text Available Background: Pegylated interferon and ribavirin are currently one of the accepted treatment for chronic Hepatitis C. Dermatologic complications of interferon have been reported, but to date a few cases of bacterial cellulitis; a rare and severe complication, have been published. Cellulitis is a common infectious process affecting the skin and subcutaneous tissues which results in significant morbidity and holds considerable healthcare costs.Cases Report: Herein, we report a case of chronic hepatitis C genotype 1a who was on medication since 8 weeks prior to developing leg cellulitis, an uncommon pegylated interferon injection site. Considering no other possible risk factors were found to be in favor of bacterial cellulitis, our case is unique in its kind. Some reports reveal necrotizing vasculitis as basis for cutaneous lesions, which could be due to the high concentrations of drug at the injection site, a toxic effect of the diluents, or an immunological reaction.Conclusion: According to the latter mechanism patients could develop bacterial cellulitis in their different organs. Conclusively, we propose the hypothesis of a possible association between cellulitis to occur at any site as the complication of pegylated interferon Alfa 2b and would highlight the role of a careful skin examination that could be an asset in preventing local skin infections.

  12. Long-term results of the randomized phase III trial EORTC 18991 of adjuvant therapy with pegylated interferon alfa-2b versus observation in resected stage III melanoma

    NARCIS (Netherlands)

    A.M.M. Eggermont (Alexander); S. Suciu (Stefan); A. Testori (Alessandro); M. Santinami (Mario); W.H.J. Kruit (Wim); J. Marsden; C.J.A. Punt (Cornelis); F. Salès (François); R. Dummer (Reinhard); C. Robert (Caroline); D. Schadendorf (Dirk); P. Patel (Poulam); G. de Schaetzen (Gaetan); A. Spatz (Alan); U. Keilholz (Ulrich)

    2012-01-01

    textabstractPurpose: Adjuvant pegylated interferon alfa-2b (PEG-IFN-α-2b) was approved for treatment of resected stage III melanoma in 2011. Here, we present long-term follow-up results of this pivotal trial. Patients and Methods: In all, 1,256 patients with resected stage III melanoma were randomly

  13. Systemic lupus erythematosus following virological response to peginterferon alfa-2b in a transplanted patient with chronic hepatitis C recurrence

    Institute of Scientific and Technical Information of China (English)

    Francesca Lodato; Giuseppe Mazzella; Maria Rosa Tamé; Antonio Colecchia; Chiara Racchini; Francesco Azzaroli; Antonia D'Errico; Silvia Casanova; Antonio Pinna; Enrico Roda

    2006-01-01

    Autoimmune manifestations are common both in patients chronically infected by hepatitis C virus, and in patients transplanted for non-autoimmune diseases. A correlation between interferon based treatment and autoimmune diseases or the development of autoantibodies is well established in non-transplanted patients, but few data are available about transplanted patients. It is unclear whether interferon may increase the incidence of acute cellular rejection and there are few reports on the development of atypical autoimmune manifestations during post-liver transplantation interferon or pegylated interferon treatment. We describe a case of systemic lupus erythematosus following treatment with pegylated interferon alfa-2b in a transplanted patient with recurrence of chronic hepatitis C. Our experience suggest that pegylated interferon may induce autoimmune diseases in the immunosuppressed host, different from acute cellular rejection and call for a great attention to possible autoimmune disorders development during interferon based treatments in liver transplanted patients.

  14. Pegylated interferon alfa-2b alone or in combination with lamivudine for HBeAg-positive chronic hepatitis B : a randomised trial

    NARCIS (Netherlands)

    Janssen, Harry L A; van Zonneveld, Monika; Senturk, Hakan; Zeuzem, Stefan; Akarca, Ulus S; Cakaloglu, Yilmaz; Simon, Christopher; So, Thomas M K; Gerken, Guido; de Man, Robert A; Niesters, Hubert G M; Zondervan, Pieter; Hansen, Bettina; Schalm, Solko W

    2005-01-01

    BACKGROUND: Treatment of HBeAg-positive patients with chronic hepatitis B is not effective in most. A combination of immunomodulatory pegylated interferon alfa-2b and antiviral lamivudine might improve the rate of sustained response. METHODS: 307 HBeAg-positive patients with chronic hepatitis B were

  15. Reduction of circulating regulatory T cells by intravenous high-dose interferon alfa-2b treatment in melanoma patients.

    Science.gov (United States)

    Mozzillo, Nicola; Ascierto, Paolo

    2012-10-01

    High-dose interferon alfa-2b (IFNα-2b) is the only approved adjuvant systemic therapy for resected, high risk melanoma in the United States (Fecher and Flaherty, in Natl Compr Cancer Netw 7:295-304, 2009). Recently, two important meta-analyses of randomized trials (Wheatley et al., in J Clin Oncol, 2007; Mocellin et al. in J Natl Cancer Inst, 2010) investigating IFNα-2b versus observation in high risk melanoma patients, showed that adjuvant IFNα-2b has an impact both on relapse-free survival (RFS) and overall survival (OS) independently by dosage, duration and route compared with observation in high risk melanoma patients. Despite of an absolute benefits of 3 % (Wheatley et al., in J Clin Oncol, 2007), this treatment is associated with significant toxicity, which impacts on patient quality of life. A better understanding of the mechanism of action may help to potentiate the clinical efficacy and reduce the toxicity of IFNα-2b/Peg-IFNα-2b. Numerous studies suggest that interferon's mechanism of action in melanoma is primarily immunomodulatory (Table 1) (de La Salmoniere, in Clin Cancer Res 6:4713-4718, 2000; Stuckert, in J Clin Oncol 25:8506, 2007; Gogas et al., in N Engl J Med 354:709-718, 2006; Moschos et al., in J Clin Oncol 24:3164-3171, 2006; Ascierto and Kirkwood, in J Transl Med 6:62, 2008) Recent efforts to elucidate the mechanism of action for interferon have focused upon signal transducers and activators of transcription (STAT) (Simons et al., in J Transl Med 9:52, 2011) signaling and immunoregulatory responses mediated by regulatory T cells (Tregs) (Wang et al., in Clin Cancer Res 13:1523-1531, 2007; Clin Cancer Res 14:8314-8320, 2008). Tregs are a suppressive CD4+ T cell population that is present, along with primed effector T cells, in tumor and tumor-draining lymph nodes (Hiura et al. in J Immunol 175:5058-5066, 2005). Tregs express high levels of surface antigens such as CD25, cytotoxic T lymphocyte associated antigen 4 (CTLA-4), and

  16. Peginterferon alpha-2a is associated with higher sustained virological response than peginterferon alfa-2b in chronic hepatitis C: systematic review of randomized trials

    DEFF Research Database (Denmark)

    Awad, Tahany; Thorlund, Kristian; Hauser, Goran;

    2010-01-01

    A combination of weekly pegylated interferon (peginterferon) alpha and daily ribavirin represents the standard of care for the treatment of chronic hepatitis C according to current guidelines. It is not established which of the two licensed products (peginterferon alpha-2a or peginterferon alfa-2b......) is most effective. We performed a systematic review of head-to-head randomized trials to assess the benefits and harms of the two treatments. We searched the Cochrane Central Register of Controlled Trials, MEDLINE, EMBASE, and LILACS through July 2009. Using standardized forms, two reviewers independently......-2a is associated with higher SVR than peginterferon alfa-2b. However, the paucity of evidence on adverse events curbs the decision to definitively recommend one peginterferon over the other, because any potential benefit must outweigh the risk of harm....

  17. Health-related quality of life in patients with high-risk melanoma randomised in the Nordic phase 3 trial with adjuvant intermediate-dose interferon alfa-2b

    DEFF Research Database (Denmark)

    Brandberg, Y; Aamdal, S; Bastholt, Lars;

    2012-01-01

    To compare health-related quality of life (HRQoL) and side-effects in patients with high-risk melanoma participating in a randomised phase III trial of adjuvant interferon alfa-2b (IFN).......To compare health-related quality of life (HRQoL) and side-effects in patients with high-risk melanoma participating in a randomised phase III trial of adjuvant interferon alfa-2b (IFN)....

  18. Two different durations of adjuvant therapy with intermediate-dose interferon alfa-2b in patients with high-risk melanoma (Nordic IFN trial): a randomised phase 3 trial

    DEFF Research Database (Denmark)

    Hansson, Johan; Aamdal, Steinar; Bastholt, Lars;

    2011-01-01

    Adjuvant high-dose interferon alfa-2b improves relapse-free survival (RFS) in patients with high-risk melanoma, although benefits in overall survival are uncertain. Because of the toxic effects of high-dose regimens, intermediate doses are being explored. We investigated whether adjuvant therapy ...

  19. Ectoine and hydroxyectoine inhibit thermal-induced aggregation and increase thermostability of recombinant human interferon Alfa2b.

    Science.gov (United States)

    Salmannejad, Faranak; Nafissi-Varcheh, Nastaran

    2017-01-15

    This study is to investigate whether ectoines (ectoine and hydroxyectoine) can reduce aggregation of rhIFNα2b in aqueous solutions on thermal stress. The effect of thermal stress condition on the stability was therefore investigated using size exclusion-high performance liquid chromatography (SE-HPLC), different spectroscopic measurements, dynamic light scattering (DLS), electrophoresis, and differential scanning calorimetry (DSC). All experiments were performed in a sodium phosphate buffer system (100mM, pH7). The protein samples (100μg/ml) were incubated at 50°C for 14days in the absence or presence (1, 10, 20, and 100mM) of ectoines. In summary, thermal-induced aggregation was reduced in the presence of ectoines, regardless of the ectoines concentration in different periods of incubation time by analyzing with SE-HPLC and turbidity measurement. The inhibitory effect of ectoines on the aggregation was shown by other techniques used. The optimal ectoines concentration was 10mM for aggregation reduction, so samples containing of 10mM of ectoines were selected for further evaluation. Secondary structural and conformational stability increased in presence of ectoines as measured by far-UV circular dichroism and fluorescence spectroscopy, respectively. DSC showed slight increase in Tm of interferon in the presence of ectoines. Hydroxyectoine had superior protein-stabilizing properties than ectoine. In conclusion, this study demonstrates that ectoine and hydroxyectoine are highly effective excipients which can significantly reduce the thermal-induced aggregation of rhIFNα2b at low concentration.

  20. Methotrexate, Doxorubicin, and Cisplatin (MAP) Plus Maintenance Pegylated Interferon Alfa-2b Versus MAP Alone in Patients With Resectable High-Grade Osteosarcoma and Good Histologic Response to Preoperative MAP: First Results of the EURAMOS-1 Good Response Randomized Controlled Trial

    NARCIS (Netherlands)

    Bielack, S.S.; Smeland, S.; Whelan, J.S.; Marina, N.; Jovic, G.; Hook, J.M.; Krailo, M.D.; Gebhardt, M.; Papai, Z.; Meyer, J.; Nadel, H.; Randall, R.L.; Deffenbaugh, C.; Nagarajan, R.; Brennan, B.; Letson, G.D.; Teot, L.A.; Goorin, A.; Baumhoer, D.; Kager, L.; Werner, M.; Lau, C.C.; Hall, K.; Gelderblom, H.; Meyers, P.; Gorlick, R.; Windhager, R.; Helmke, K.; Eriksson, M.; Hoogerbrugge, P.M.; Schomberg, P.; Tunn, P.U.; Kuhne, T.; Jurgens, H.; Berg, H. van den; Bohling, T.; Picton, S.; Renard, M.; Reichardt, P.; Gerss, J.; Butterfass-Bahloul, T.; Morris, C.; Hogendoorn, P.C.; Seddon, B.; Calaminus, G.; Michelagnoli, M.; Dhooge, C.; Sydes, M.R.; Bernstein, M.

    2015-01-01

    PURPOSE: EURAMOS-1, an international randomized controlled trial, investigated maintenance therapy with pegylated interferon alfa-2b (IFN-alpha-2b) in patients whose osteosarcoma showed good histologic response (good response) to induction chemotherapy. PATIENTS AND METHODS: At diagnosis, patients a

  1. Relato do primeiro paciente brasileiro com a forma infantil da doença de Pompe tratado com alfa-glicosidase recombinante humana Report of the first Brazilian infantile Pompe disease patient to be treated with recombinant human acid alpha-glucosidase

    Directory of Open Access Journals (Sweden)

    Sandra J. Pereira

    2008-06-01

    Full Text Available Objetivo: Relatar o primeiro caso de forma infantil da doença de Pompe tratado no Brasil. Descrição: Trata-se de doença de depósito lisossomal que se caracteriza por defeitos da enzima alfa-glicosidase ácida, com acúmulo intracelular de glicogênio, principalmente nos músculos. São descritas a forma infantil e tardia. Desde 2006, está disponível tratamento com enzima recombinante humana. Descreve-se o primeiro caso de forma infantil da doença tratado no Brasil. Trata-se de menina com 2,5 meses de idade e progressão rápida da doença, com perda dos movimentos dos membros, miocardiopatia hipertrófica e insuficiência respiratória aos 7 meses de idade. Após 10 meses de tratamento, apresentou boa resposta clínica, com remissão da insuficiência respiratória, recuperação parcial dos movimentos dos membros e melhora importante do quadro cardiológico. Comentários: Apesar de pouco freqüente, a forma infantil da doença de Pompe é letal. A disponibilidade de tratamento eficaz aumenta a necessidade de conhecimento e diagnóstico precoce da doença.Objective: To describe the first case of infantile Pompe disease to be treated in Brazil. Description: Pompe disease is a glycogen storage disease related to defects in the acid alpha-glucosidase enzyme, leading to an intracellular accumulation of glycogen, mainly in muscles. Two forms are described: infantile and juvenile. Since 2006, treatment with recombinant human acid alpha-glucosidase has been available. This article describes the first case of infantile Pompe disease treated in Brazil. A girl presented at 2.5 months of age with rapid disease progression, exhibiting severe hypotonia, loss of movements in both upper and lower limbs and hypertrophic cardiomyopathy, progressing to respiratory failure by the age of 7 months. After 10 months of treatment, she exhibited a good clinical response, with remission of the respiratory failure, partial recovery of arm and leg movements and

  2. Polineuropatia desmielinizante inflamatória crônica pós-tratamento com interferon peguilado alfa 2b em um paciente co-infectado HIV/HCV: relato de caso Chronic inflammatory demyelinating polyneuropathy after treatment with pegylated interferon alpha 2b in a patient with HIV/HCV coinfection: case report

    Directory of Open Access Journals (Sweden)

    Bil Randerson Bassetti

    2010-02-01

    Full Text Available A polineuropatia desmielinizante inflamatória cônica possui forte associação com a infecção pelo HIV e HCV. Uma rara associação entre PDIC e o tratamento da hepatite C com interferon peguilado alfa foi descrita recentemente. Nós descrevemos o primeiro caso de polineuropatia desmielinizante inflamatória crônica em um paciente branco, sexo masculino infectado por HIV e HCV associado a interferon peguilado alfa 2b. O paciente recuperou-se completamente após o uso de imunoglobulina hiperimune endovenosa. Infectologistas e hapatologistas devem estar atentos à esta rara e grave associação, que exige imediata descontinuação da droga e tratamento precoce.Chronic inflammatory demyelinating polyneuropathy has a strong association with HIV and HCV infection. A rare association between chronic inflammatory demyelinating polyneuropathy and hepatitis C treatment with pegylated interferon alpha was described recently. We described the first case of chronic inflammatory demyelinating polyneuropathy associated with pegylated interferon alpha 2b in a white man infected with HIV and HCV. The patient recovered completely with the use of intravenous hyperimmune immunoglobulin. Infectologists and hepatologists should be alert regarding this rare and serious association, which requires immediately drug discontinuation and early treatment.

  3. Thalidomide with peginterferon alfa-2b and ribavirin in the treatment of non-responders genotype 1 chronic hepatitis C patients: proof of concept Talidomida, peginterferón alfa-2b y ribavirina en el tratamiento de pacientes no respondedores con hepatitis crónica C genotipo 1: estudio piloto

    Directory of Open Access Journals (Sweden)

    Benjamín Pardo-Yules

    2011-12-01

    Full Text Available Background: fewer than half of patients infected with hepatitis C virus (HCV achieve sustained viral clearance after peginterferon alfa/ribavirin (Peg-IFN/RBV therapy. Aims: thalidomide posses anti-inflammatory and immunomodulatory properties through inhibition of tumor necrosis factor and costimulatory effect on human CD8+ T cells. Methods: we started a prospective, open label trial of retreatment of very-difficult-to-treat genotype 1 chronic hepatitis C patients (CHC patients, who had failed to respond to the (Peg-IFN/RBV, with a triple therapy consisting in these same antivirals plus thalidomide 200 mg/day (the TRITAL study. Results: none of the eleven patients fulfilling the inclusion criteria and included in the trial reached complete early virological response or sustained virological response. Viral load decline after 12 weeks of triple therapy thalidomide-based retreatment did not differ from viral dynamics during the first course. The triple therapy was well tolerated and only one patient developed mild bilateral neuropathy. Conclusions: thalidomide addition to standard therapy is tolerated and did not increase the SVR rate in very-difficult-to-treat genotype 1 CHC patients. Different schedules are warranted to improve attempting retreatment of non responder CHC patients.Antecedentes: menos de la mitad de los pacientes con hepatitis C logra eliminar el virus de manera sostenida después de la terapia con peginterferón alfa y ribavirina (Peg-IFN/RBV. Objetivos: la talidomida posee propiedades antiinflamatorias e inmunomoduladoras a través de la inhibición del TNF-α y al efecto estimulador sobre las células T CD8+. Métodos: se inició un estudio prospectivo y abierto de re-tratamiento de pacientes con hepatitis crónica C genotipo 1, no respondedores al tratamiento con Peg-IFN/RBV, mediante triple terapia añadiendo a los mismos antivirales 200 mg/día de talidomida. Resultados: ninguno de los once pacientes que fueron incluidos en

  4. Peginterferon Alfa-2b Injection (Sylatron)

    Science.gov (United States)

    ... the arms, hands, legs, or feet cough rash hair loss Some side effects can be serious. If ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...

  5. Peginterferon Alfa-2b (PEG-Intron)

    Science.gov (United States)

    ... diarrhea constipation heartburn weight loss headache dizziness confusion hair loss or thinning itching difficulty concentrating feeling cold ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...

  6. The ALFA Trigger Simulator

    CERN Document Server

    Dziedzic B

    2015-01-01

    The paper presents basic information about ALFA detectors used in the ATLAS experiment, and the structure of currently developed device used to test a new ALFA trigger interface. It discusses the block diagram of the device, principle of its operation, implementation details and future plans for developing the Simulator.

  7. ALFA Detector Control System

    CERN Document Server

    Oleiro Seabra, Luis Filipe; The ATLAS collaboration

    2015-01-01

    ALFA (Absolute Luminosity For ATLAS) is one of the sub-detectors of ATLAS (A Toroidal LHC Apparatus). The ALFA system is composed by four stations installed in the LHC tunnel 240 m away from the ATLAS interaction point. Each station has a vacuum and ventilation system, movement control and all the required electronics for signal processing. The Detector Control System (DCS) provides control and monitoring of several components and ensures the safe operation of the detector contributing to good Data Quality. This paper describes the ALFA DCS system including a detector overview, operation aspects and hardware control through a SCADA system, WinCC OA.

  8. ALFA Detector Control System

    CERN Document Server

    Oleiro Seabra, Luis Filipe; The ATLAS collaboration

    2015-01-01

    ALFA (Absolute Luminosity For ATLAS) is one of the sub-detectors of ATLAS/LHC. The ALFA system is composed by two stations installed in the LHC tunnel 240 m away from each side of the ATLAS interaction point. Each station has a vacuum and ventilation system, movement control and all the required electronic for signal processing. The Detector Control System (DCS) provides control and monitoring of several components and ensures the safe operation of the detector contributing to good Data Quality. This paper describes the ALFA DCS system including a detector overview, operation aspects and hardware control through a SCADA system, WinCC OA.

  9. Epoetin Alfa Injection

    Science.gov (United States)

    ... a medication used to treat human immunodeficiency virus (HIV). Epoetin alfa injection is also used before and ... record book.If you are being treated with dialysis (treatment to remove waste from the blood when ...

  10. Recombinant Interferon Alfa-2b in Treating Patients With Melanoma

    Science.gov (United States)

    2016-05-17

    Stage IA Skin Melanoma; Stage IB Skin Melanoma; Stage IIA Skin Melanoma; Stage IIB Skin Melanoma; Stage IIC Skin Melanoma; Stage IIIA Skin Melanoma; Stage IIIB Skin Melanoma; Stage IIIC Skin Melanoma; Stage IV Skin Melanoma

  11. Southwest Oncology Group S0008: A Phase III Trial of High-Dose Interferon Alfa-2b Versus Cisplatin, Vinblastine, and Dacarbazine, Plus Interleukin-2 and Interferon in Patients With High-Risk Melanoma—An Intergroup Study of Cancer and Leukemia Group B, Children's Oncology Group, Eastern Cooperative Oncology Group, and Southwest Oncology Group

    Science.gov (United States)

    Flaherty, Lawrence E.; Othus, Megan; Atkins, Michael B.; Tuthill, Ralph J.; Thompson, John A.; Vetto, John T.; Haluska, Frank G.; Pappo, Alberto S.; Sosman, Jeffrey A.; Redman, Bruce G.; Moon, James; Ribas, Antoni; Kirkwood, John M.; Sondak, Vernon K.

    2014-01-01

    Purpose High-dose interferon (IFN) for 1 year (HDI) is the US Food and Drug Administration–approved adjuvant therapy for patients with high-risk melanoma. Efforts to modify IFN dose and schedule have not improved efficacy. We sought to determine whether a shorter course of biochemotherapy would be more effective. Patients and Methods S0008 (S0008: Chemotherapy Plus Biological Therapy in Treating Patients With Melanoma) was an Intergroup phase III trial that enrolled high-risk patients (stage IIIA-N2a through IIIC-N3), randomly assigning them to receive either HDI or biochemotherapy consisting of dacarbazine, cisplatin, vinblastine, interleukin-2, IFN alfa-2b (IFN-α-2b) and granulocyte colony-stimulating factor given every 21 days for three cycles. Coprimary end points were relapse-free survival (RFS) and overall survival (OS). Results In all, 432 patients were enrolled. Grade 3 and 4 adverse events occurred in 57% and 7% of HDI patients and 36% and 40% of biochemotherapy patients, respectively. At a median follow-up of 7.2 years, biochemotherapy improved RFS (hazard ratio [HR], 0.75; 95% CI, 0.58 to 0.97; P = .015), with a median RFS of 4.0 years (95% CI, 1.9 years to not reached [NR]) versus 1.9 years for HDI (95% CI, 1.2 to 2.8 years) and a 5-year RFS of 48% versus 39%. Median OS was not different (HR, 0.98; 95% CI, 0.74 to 1.31; P = .55), with a median OS of 9.9 years (95% CI, 4.62 years to NR) for biochemotherapy versus 6.7 years (95% CI, 4.5 years to NR) for HDI and a 5-year OS of 56% for both arms. Conclusion Biochemotherapy is a shorter, alternative adjuvant treatment for patients with high-risk melanoma that provides statistically significant improvement in RFS but no difference in OS and more toxicity compared with HDI. PMID:25332243

  12. Elosulfase alfa: first global approval.

    Science.gov (United States)

    Sanford, Mark; Lo, Jin Han

    2014-04-01

    Elosulfase alfa (Vimizim™) is a recombinant form of N-acetylgalactosamine-6-sulfatase (GALNS) that was developed by BioMarin Pharmaceutical Inc. as an enzyme replacement therapy for patients with mucopolysaccharidosis type IVA (MPS IVA), also known as Morquio A syndrome. Patients with MPS IVA have a GALNS deficiency, which results in serious musculoskeletal, cardiorespiratory and other system disturbances. Elosulfase alfa was approved by the US FDA on 14 February 2014 for the treatment of MPS IVA. The European Medicines Agency Committee for Medicinal Products for Human Use (CHMP) has recently recommended that elosulfase alfa be approved for use in the EU in the same indication. Within the last year, the manufacturer has also filed applications for approval for the use of elosulfase alfa in MPS IVA in Brazil, Australia, Canada and Mexico. This article summarizes the milestones in the development of elosulfase alfa leading to its first global approval in MPS IVA.

  13. ALFA beam halo

    CERN Document Server

    Komarek, Tomas

    2014-01-01

    This note serves as a final report about CERN Summer Student Programme 2014 project. The beam halo is an undesired phenomenon for physics analyses on particle accelerators. It surrounds the beam core and constitutes an important part of background for signal measurements on some detectors, eg. in the forward region. In this study, the data from the ALFA detector were used, specifically from the run 191373 ($\\beta^*=90\\unit{m}$) and the run 213268 ($\\beta^*=1\\unit{km}$). Using the ROOT framework, a software for beam halo events selection was created and beam halo properties were examined. In the run 213268, excessive beam halo is suspected to be the reason for multiple beam scrapings that occurred. A kinematic reconstruction of beam halo particles is attempted in order to understand beam halo properties in the interaction point. Some further simulations are employed to find constraints for beam halo particles in order to survive in the accelerator for a longer time/many revolutions. This work represents a st...

  14. Análise de innterferon humano recombinante presente em formulações farmacêuticas por espectrometria de massa

    OpenAIRE

    Andrade, Sinéa Mendes de

    2010-01-01

    Os interferons (INFs) são proteínas produzidas por células animais em resposta a infecções virais. Essas substâncias possuem vários efeitos farmacológicos, incluindo antiviral, antitumoral e imunomodulatório. Com o advento da tecnologia do DNA recombinante, vários interferons passaram a ser produzidos e comercializados como Biofármacos. O mais importante é o α2b, que é uma das bases do tratamento das hepatites virais. A única norma oficial que regulamenta a produção de INF-α2b é a Farmacopéia...

  15. ALFA detector upgrade before LHC Run 2

    CERN Document Server

    Vorobel, Vit; The ATLAS collaboration

    2016-01-01

    The operation experience with ATLAS ALFA detectors in the LHC environment during the Run1 period has shown significant beam-induced heating. Subsequent comprehensive studies revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosities in the LHC Run2. During the first LHC long shutdown (LS1) all ALFA detectors have been removed from the LHC tunnel and their covers - Roman Pots - underwent a geometry upgrade to minimize the impedance losses. It will be shown that this modification together with a system improving the internal heat transfer and an air cooling system, significantly shifted the temperatures of ALFA detectors away from the critical limits throughout the LHC Run2. Also ALFA trigger system was considerably upgraded to keep measured data safely inside the Run2 ATLAS latency budget and to minimize dead time. The needed hardware changes of the trigger system will be presented in the second part of the talk.

  16. "Alfa" i "Võmpel" bez maski / Andrei Sharov

    Index Scriptorium Estoniae

    Sharov, Andrei

    2004-01-01

    Venemaa FSB keskuse, mille koosseisu kuuluvad ka eriüksused Alfa ja Võmpel, töötajad osalevad terroristide neutraliseerimise ja pantvangide vabastamise erioperatsioonides. Intervjuu keskuse staabi uue juhiga

  17. ALFA detector before LHC Run 2

    CERN Document Server

    Vorobel, Vit; The ATLAS collaboration

    2016-01-01

    The operation experience with ATLAS ALFA detectors in the LHC environment during the Run1 period has shown significant beam-induced heating. Subsequent comprehensive studies revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosities in the LHC Run2. During the first LHC long shutdown (LS1) all ALFA detectors have been removed from the LHC tunnel and their covers - Roman Pots - underwent a geometry upgrade to minimize the impedance losses. It will be shown that this modification together with a system improving the internal heat transfer and an air cooling system, significantly shifted the temperatures of ALFA detectors away from the critical limits throughout the LHC Run2. Also ALFA trigger system was considerably upgraded to keep measured data safely inside the Run2 ATLAS latency budget and to minimize dead time. The needed hardware changes of the trigger system are also described

  18. B2B marketing

    OpenAIRE

    Pospíšilová, Lucie

    2010-01-01

    The main goal of this bachelor thesis is to apply theoretical knowledge in B2B marketing to the example of marketing processes in a particular company, to evaluate the current situation of its activities with regard to B2B principles and to suggest relevant recommendations. The theoretical part focuses on specific characteristics of B2B marketing, describes its differences from marketing on consumer markets, deals with buying behaviour of organizations and specifies particular features of mar...

  19. Administration of follitropin alfa and lutropin alfa combined in a single injection: a feasibility assessment

    Directory of Open Access Journals (Sweden)

    Agostinetto Rita

    2009-05-01

    Full Text Available Abstract Background Gonadotrophins are routinely administered in assisted reproductive technology (ART treatment protocols. Recombinant human follicle-stimulating hormone (r-hFSH; follitropin alfa and recombinant human luteinizing hormone (r-hLH; lutropin alfa can be administered individually or in a fixed combination. The ability to vary the FSH to LH dose ratio in a single injection without compromising the bioactivity of either gonadotrophin or generating losses of active principle is important for physicians and patients alike. Methods This study investigated whether follitropin alfa (GONAL-f (R, as lyophilized powder for reconstitution or solution from the GONAL-f (R (filled-by-mass [FbM] Prefilled Pen, could be used to reconstitute Pergoveris TM (follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder. In Ratio Groups 1 and 2, the r-hFSH:r-hLH ratio was 3:1; in Ratio Groups 3 and 4, the ratios of r-hFSH:r-hLH were 5:1 and 8:1, respectively. The protein content and bioactivity of each mixed solution were evaluated. The r-hFSH and r-hLH content was determined using reverse-phase high performance liquid chromatography. The biological activity of r-hFSH and r-hLH was assessed using the Steelman-Pohley and Van Hell in vivo bioassays in rats, respectively. Results Follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder could be successfully mixed with follitropin alfa 75 IU FbM solution that was either reconstituted from lyophilized powder or injected directly from the prefilled pen to create solutions with ratios of r-hFSH and r-hLH from 3:1 to 8:1. The measured content of r-hFSH and r-hLH corresponded favourably with the target protein content in Ratio Groups 1–4. The in vivo target and measured bioactivity of r-hFSH and r-hLH were also closely matched in all Ratio Groups. Conclusion Follitropin alfa lyophilized powder or solution can be accurately mixed with follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder to

  20. Interferon alfa with or without ribavirin for chronic hepatitis C

    DEFF Research Database (Denmark)

    Kjaergard, L L; Krogsgaard, K; Gluud, C

    2001-01-01

    To assess the efficacy and safety of interferon alfa with or without ribavirin for treatment of chronic hepatitis C.......To assess the efficacy and safety of interferon alfa with or without ribavirin for treatment of chronic hepatitis C....

  1. Interferon-alfa treatment of facial infantile haemangiomas

    DEFF Research Database (Denmark)

    Fledelius, Hans C.; Illum, N.; Jensen, H.;

    2001-01-01

    ophthalmology, haemangiomas of the face, infancy, Interferon alfa, eye at risk, amblyopia, induced refractive change, ultrasound imaging......ophthalmology, haemangiomas of the face, infancy, Interferon alfa, eye at risk, amblyopia, induced refractive change, ultrasound imaging...

  2. ALFA: an automated line fitting algorithm

    CERN Document Server

    Wesson, Roger

    2015-01-01

    I present the Automated Line Fitting Algorithm, ALFA, a new code which can fit emission line spectra of arbitrary wavelength coverage and resolution, fully automatically. In contrast to traditional emission line fitting methods which require the identification of spectral features suspected to be emission lines, ALFA instead uses a list of lines which are expected to be present to construct a synthetic spectrum. The parameters used to construct the synthetic spectrum are optimised by means of a genetic algorithm. Uncertainties are estimated using the noise structure of the residuals. An emission line spectrum containing several hundred lines can be fitted in a few seconds using a single processor of a typical contemporary desktop or laptop PC. I show that the results are in excellent agreement with those measured manually for a number of spectra. Where discrepancies exist, the manually measured fluxes are found to be less accurate than those returned by ALFA. Together with the code NEAT (Wesson et al. 2012), ...

  3. Proteína recombinante para el diagnostico del síndrome de inmunodeficiencia adquirida (SIDA)

    OpenAIRE

    2004-01-01

    Proteína recombinante para el diagnóstico del síndrome de inmunodeficiencia adquirida (SIDA). La proteína recombinante comprende una proteína que presenta actividad b-galactosidasa en la que se ha insertado al menos una secuencia de aminoácidos que contiene al menos un epítopo del virus de la inmunodeficiencia humana (VIH). La presente invención se refiere a una proteína recombinante de fusión que tiene aplicación para el diagnóstico del síndrome de la inmunodeficiencia adquirida.

  4. Producción de proteínas recombinantes en Bacillus megaterium: estado del arte

    OpenAIRE

    Keyla Tortoló-Cabañas; Antonio Bell-García

    2015-01-01

    Se recoge una actualización del estado del arte del uso de Bacillus megaterium como hospedero para la expresión de proteínas recombinantes, las características de este microorganismo, así como las consideraciones generales y algunos aspectos a tener en cuenta.

  5. Fit 2-B FATHERS.

    Science.gov (United States)

    Maiorano, Joseph J.

    2001-01-01

    Fit 2-B FATHERS is a parenting-skills education program for incarcerated adult males. The goals of this program are for participants to have reduced recidivism rates and a reduced risk of their children acquiring criminal records. These goals are accomplished by helping participants become physically, practically, and socially fit for the demands…

  6. Asfotase alfa therapy for children with hypophosphatasia

    Science.gov (United States)

    Madson, Katherine L.; Phillips, Dawn; Reeves, Amy L.; McAlister, William H.; Yakimoski, Amy; Mack, Karen E.; Hamilton, Kim; Kagan, Kori; Fujita, Kenji P.; Thompson, David D.; Moseley, Scott; Odrljin, Tatjana; Rockman-Greenberg, Cheryl

    2016-01-01

    Background. Hypophosphatasia (HPP) is caused by loss-of-function mutation(s) of the gene that encodes the tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). Consequently, cell-surface deficiency of TNSALP phosphohydrolase activity leads to extracellular accumulation of inorganic pyrophosphate, a natural substrate of TNSALP and inhibitor of mineralization. Children with HPP can manifest rickets, skeletal pain, deformity, fracture, muscle weakness, and premature deciduous tooth loss. Asfotase alfa is a recombinant, bone-targeted, human TNSALP injected s.c. to treat HPP. In 2012, we detailed the 1-year efficacy of asfotase alfa therapy for the life-threatening perinatal and infantile forms of HPP. Methods. Here, we evaluated the efficacy and safety of asfotase alfa treatment administered to children 6–12 years of age at baseline who were substantially impaired by HPP. Two radiographic scales quantitated HPP skeletal disease, including comparisons to serial radiographs from similarly affected historical control patients. Results. Twelve children receiving treatment were studied for 5 years. The 6-month primary endpoint was met, showing significant radiographic improvement. Additional significant improvements included patient growth, strength, motor function, agility, and quality of life, which for most patients meant achieving normal values for age- and sex-matched peers that were sustained at 5 years of treatment. For most, pain and disability resolved. Mild to moderate injection-site reactions were common and were sometimes associated with lipohypertrophy. Low anti–asfotase alfa antibody titers were noted in all patients. No evidence emerged for clinically important ectopic calcification or treatment resistance. Conclusions. Asfotase alfa enzyme replacement therapy has substantial and sustained efficacy with a good safety profile for children suffering from HPP. Trial Registration. ClinicalTrials.gov NCT00952484 (https://clinicaltrials.gov/ct2/show

  7. Asfotase alfa therapy for children with hypophosphatasia.

    Science.gov (United States)

    Whyte, Michael P; Madson, Katherine L; Phillips, Dawn; Reeves, Amy L; McAlister, William H; Yakimoski, Amy; Mack, Karen E; Hamilton, Kim; Kagan, Kori; Fujita, Kenji P; Thompson, David D; Moseley, Scott; Odrljin, Tatjana; Rockman-Greenberg, Cheryl

    2016-06-16

    Background. Hypophosphatasia (HPP) is caused by loss-of-function mutation(s) of the gene that encodes the tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). Consequently, cell-surface deficiency of TNSALP phosphohydrolase activity leads to extracellular accumulation of inorganic pyrophosphate, a natural substrate of TNSALP and inhibitor of mineralization. Children with HPP can manifest rickets, skeletal pain, deformity, fracture, muscle weakness, and premature deciduous tooth loss. Asfotase alfa is a recombinant, bone-targeted, human TNSALP injected s.c. to treat HPP. In 2012, we detailed the 1-year efficacy of asfotase alfa therapy for the life-threatening perinatal and infantile forms of HPP. Methods. Here, we evaluated the efficacy and safety of asfotase alfa treatment administered to children 6-12 years of age at baseline who were substantially impaired by HPP. Two radiographic scales quantitated HPP skeletal disease, including comparisons to serial radiographs from similarly affected historical control patients. Results. Twelve children receiving treatment were studied for 5 years. The 6-month primary endpoint was met, showing significant radiographic improvement. Additional significant improvements included patient growth, strength, motor function, agility, and quality of life, which for most patients meant achieving normal values for age- and sex-matched peers that were sustained at 5 years of treatment. For most, pain and disability resolved. Mild to moderate injection-site reactions were common and were sometimes associated with lipohypertrophy. Low anti-asfotase alfa antibody titers were noted in all patients. No evidence emerged for clinically important ectopic calcification or treatment resistance. Conclusions. Asfotase alfa enzyme replacement therapy has substantial and sustained efficacy with a good safety profile for children suffering from HPP. Trial Registration. ClinicalTrials.gov NCT00952484 (https://clinicaltrials.gov/ct2/show

  8. Arecibo Pulsar and Transient Surveys Using ALFA

    Science.gov (United States)

    Cordes, J. M.

    2008-02-01

    A large scale survey for pulsars and transients is being conducted at the Arecibo Observatory using the Arecibo L-band Feed Array (ALFA). Data acquisition so far has been with correlation spectrometers that analyze a 0.1 GHz bandwidth at 1.4 GHz. The 256 frequency channels limit dispersion smearing to 1.2 ms at DMmax = 103 pc cm-3 while the sampling interval of 64 μs equals the dispersion smearing at DM~54 pc cm-3, providing high sensitivity to millisecond pulsars with standard periods out to implied distances of several kpc at low Galactic latitudes. In early 2008, we will use a new set of polyphase filter bank systems that provide the same time and frequency resolutions but over ALFA's full 0.3 GHz bandwidth. Currently the survey covers sky positions within 5° of the Galactic plane that are reachable with Arecibo. Preliminary results are given for some of the discoveries made so far, which include millisecond pulsars, a relativistic binary pulsar, a likely counterpart of a Compton GRO/EGRET gamma-ray source, and transient pulsars (including `RRATs''). We discuss the methodology of the survey, which includes archival of raw survey data at the Cornell Center for Advanced Computing and processing at distributed sites. The survey and follow up observations, which include timing observations, multiwavelength searches for orbital companions in the case of binary pulsars, etc. are organized through the Pulsar-ALFA (PALFA) Consortium. We expect the Galactic plane survey to continue until at least 2010, most likely involving multiple passes on each sky position to optimize detection of variable sources. The ALFA system will also be used to survey intermediate Galactic latitudes for millisecond pulsars, relativistic binaries with large systemic velocities, and runaway pulsars that will escape the Galaxy.

  9. Measurement of elastic scattering with ALFA

    CERN Document Server

    Jakobsen, S; The ATLAS collaboration

    2012-01-01

    The principal of ALFA is presented and then a detailed description of the detector, installation, triggering and beam based alignment. All this was needed in 2011 before the special optics runs with beta* = 90 m which was used for measuring elastic scattering. The first analysis steps of seeing tack patterns, making a global alignment of the detectors and finding correlations are presented. The plans for upcoming runs in 2012 are briefly discussed.

  10. Analysis of the trigger system of the ALFA detectors

    CERN Document Server

    Guerrero Llorente, Alonso

    2015-01-01

    During the CERN Summer Student Programme 2015 two different projects were carried out. Both related with the ALFA subdetector in ATLAS and its trigger system. The frst, and main, project aimed to do an study of the trigger effciency of the ALFA detector at $\\sqrt{s}=8 TeV$ and $\\beta^* = 90m$. The results can be found fully explained in the ATLAS note: "Trigger effciency for the ALFA detector at $\\sqrt{s}=8 TeV$ and $\\beta^* = 90m$". A secondary task consisted on systematical tests of new chips for an update of the ALFA trigger system.

  11. Tratamiento con eritropoyetina humana recombinante Human recombinant erythropoietin therapy

    Directory of Open Access Journals (Sweden)

    Hugo Donato

    2006-02-01

    Full Text Available La eritropoyetina recombinante (rHuEPO se ha transformado en la citoquina más utilizada terapéuticamente en el mundo. Luego del éxito obtenido en pacientes con insuficiencia renal terminal, se pudo establecer la utilidad de la terapia con rHuEPO para mejorar otras anemias, incluso en pacientes pediátricos y neonatos. El tratamiento o la prevención de la anemia del prematuro mediante el uso de rHuEPO llevó a una significativa reducción en cantidad de transfusiones y en exposición a dadores. Aún debe establecerse una clara definición sobre cuáles niños prematuros deben recibir tratamiento rutinariamente. Otras indicaciones en período neonatal incluyen anemias hiporregenerativas y hemolíticas. La eficacia de la rHuEPO en niños mayores, con excepción de la insuficiencia renal crónica, no ha sido tan exhaustivamente evaluada como en adultos. Mientras que durante los últimos años se han realizado gran cantidad de estudios en adultos con anemia asociada al cáncer o a infección por HIV, permitiendo establecer conclusiones claras sobre su eficacia, sólo escasa cantidad de estudios con pequeño número de pacientes han sido realizados en niños. Hasta la fecha, los resultados sugieren que la terapia con rHuEPO en niños es tan útil como en adultos, pero la realización de estudios aleatorizados prospectivos incluyendo gran número de pacientes es esencial para alcanzar conclusiones definitivas. Los resultados de estudios dirigidos a evaluar la eficacia de la rHuEpo para mantener una dosis adecuada de ribavirina en pacientes en tratamiento por hepatitis C son alentadores. La utilización potencial de los efectos no hemopoyéticos de la rHuEPO en neonatos es un terreno novedoso y apasionante. El rol de la Epo como citoprotector para sistema nervioso central y mucosa intestinal está bajo investigación exhaustiva.Recombinant human erythropoietin (rHuEpo has become the most widely used cytokine in the world. Following the success of

  12. The ALFA ZOA Deep Survey: First Results

    Science.gov (United States)

    McIntyre, T. P.; Henning, P. A.; Minchin, R. F.; Momjian, E.; Butcher, Z.

    2015-07-01

    The Arecibo L-band Feed Array Zone of Avoidance (ALFA ZOA) Deep Survey is the deepest and most sensitive blind H i survey undertaken in the ZOA. ALFA ZOA Deep will cover about 300 square degrees of sky behind the Galactic Plane in both the inner (30^\\circ ≤slant l≤slant 75^\\circ ;b≤slant | 2^\\circ | ) and outer (175^\\circ ≤slant l≤slant 207^\\circ ;-2^\\circ ≤slant b≤slant +1^\\circ ) Galaxy, using the Arecibo Radio Telescope. First results from the survey have found 61 galaxies within a 15 square degree area centered on l=192^\\circ and b = -2°. The survey reached its expected sensitivity of rms = 1 mJy at 9 km s-1 channel resolution, and is shown to be complete above integrated flux, FHi = 0.5 Jy km s-1. The positional accuracy of the survey is 28″ and detections are found out to a recessional velocity of nearly 19,000 km s-1. The survey confirms the extent of the Orion and Abell 539 clusters behind the plane of the Milky Way and discovers expansive voids, at 10,000 and 18,000 km s-1. Twenty-six detections (43%) have a counterpart in the literature, but only two of these have known redshifts. Counterparts are 20% less common beyond vhel = 10,000 km s-1 and 33% less common at extinctions higher than AB = 3.5 mag. The ALFA ZOA Deep survey is able to probe large scale structure beyond redshifts that even the most modern wide-angle surveys have been able to detect in the ZOA at any wavelength.

  13. Stock footage ATLAS-ALFA experiment September 2016

    CERN Multimedia

    2016-01-01

    Stock footage of the ATLAS- ALFA subdetector in the LHC tunnel at IP1 taken during the LHC technical shut-down in September 2016. The ATLAS/ALFA experiment and studies the elastic scattering of protons, which are not observable in normal operation runs. In the elastic scattering process, the two protons survive their encounter intact and only change directions by exchanging momentum.

  14. The ALFA ZOA Deep Survey: First Results

    CERN Document Server

    McIntyre, Travis P; Minchin, Robert F; Momjian, Emmanuel; Butcher, Zhon

    2015-01-01

    The Arecibo L-Band Feed Array Zone of Avoidance (ALFA ZOA) Deep Survey is the deepest and most sensitive blind Hi survey undertaken in the ZOA. ALFA ZOA Deep will cover about 300 square degrees of sky behind the Galactic plane in both the inner (30 deg < l < 75 deg; b < |2 deg|) and outer (175 deg < l < 207 deg; -2 deg < b < +1 deg) Galaxy, using the Arecibo Radio Telescope. First results from the survey have found 61 galaxies within a 15 square degree area centered on l = 192 deg and b = -2 deg. The survey reached its expected sensitivity of rms = 1 mJy at 9 km/s channel resolution, and is shown to be complete above integrated flux, F_HI = 0.5 Jy km/s. The positional accuracy of the survey is 28 arcsec and detections are found out to a recessional velocity of nearly 19,000 km/s. The survey confirms the extent of the Orion and Abell 539 clusters behind the plane of the Milky Way and discovers expansive voids, at 10,000 km/s and 18,000 km/s. 26 detections (43%) have a counterpart in the li...

  15. Sequential combination of glucocorticosteroids and alfa interferon versus alfa interferon alone for HBeAg-positive chronic hepatitis B

    DEFF Research Database (Denmark)

    Mellerup, M T; Krogsgaard, K; Mathurin, P;

    2002-01-01

    Chronic hepatitis B has serious effects on morbidity and mortality. Alfa interferon has been shown to increase the rates of HBeAg-clearance as well as seroconversion to anti-HBe, but response rates are unsatisfactory. Glucocorticosteroid pretreatment may increase the response to alfa interferon....

  16. Sequential combination of glucocorticosteroids and alfa interferon versus alfa interferon alone chronic hepatitis B. Protocol for a Cochrane Review

    DEFF Research Database (Denmark)

    Mellerup, M T; Krogsgaard, K; Mathurin, P;

    2000-01-01

    Chronic hepatitis B has serious effects on morbidity and mortality. Alfa interferon has been shown to increase the rates of HBeAg-clearance as well as seroconversion to anti-HBe, but response rates are unsatisfactory. Glucocorticosteroid pretreatment may increase the response to alfa interferon....

  17. Sistemas de expresión para proteínas terapéuticas recombinantes

    OpenAIRE

    María Elisa Drago Serrano; Teresita del R. Sainz Espuñes

    2006-01-01

    Diversos biofármacos basados en proteínas recombinantes son producidos en la actualidad por la industria biofarmacéutica. Los sistemas de expresión para la obtención de biofármacos, se basan en vectores que permiten la clonación del gen que codifica la proteína de interés en una célula hospedera como bacterias, levaduras y líneas celulares. Diversos biofármacos como factores de coagulación, hormonas, citocinas y enzimas han sido aprobados para su distribución comercial. La demanda creciente d...

  18. Vectores recombinantes basados en el virus Vaccinia modificado de Ankara (MVA) como vacunas contra la leishmaniasis

    OpenAIRE

    Pérez Jiménez, Eva; Larraga, Vicente; Esteban, Mariano

    2005-01-01

    Vectores recombinantes basados en el virus vaccinia modificado de Ankara (MVA) como vacunas contra la leishmaniasis. Los vectores de la invención contienen secuencias codificantes de la proteína LACK, preferentemente insertadas en el locus de hemaglutinina del virus y bajo el control de un promotor que permite su expresión a lo largo del ciclo de infección del virus. Son vectores seguros, estables, que dan lugar a una potente respuesta inmune que confiere protección frente a la leishmaniasis,...

  19. LA SOMATOTROPINA BOVINA RECOMBINANTE Y LA REPRODUCCIÓN EN BOVINOS, OVINOS Y CAPRINOS

    OpenAIRE

    Joel Hernández-Cerón; C. Guillermo Gutierrez-Aguilar

    2013-01-01

    En vacas, la somatotropina bovina recombinante (rbST) se utiliza para incrementar la producción de leche. La rbST aumenta las concentraciones séricas del factor de crecimiento parecido a la insulina tipo I (IGF-I) y ambas hormonas regulan los procesos fisiológicos para incrementar la lactopoyesis. Además de sus efectos en la lactación, la somatotropina y el IGF-I favorecen la maduración del ovocito, tasa de fertilización, desarrollo embrionario temprano, función del cuerpo lúteo y reconocimie...

  20. Somatotropina bovina recombinante en sincronización de estros y prolificidad de ovejas Pelibuey

    OpenAIRE

    2014-01-01

    Con la finalidad de estudiar si la administración de la Somatotropina Bovina Recombinante (bST) dos días antes del retiro del progestágeno, tiene efecto en la sincronización de estros, inicio del estro, fertilidad, prolificidad y tipo de parto en ovejas Pelibuey, a 180 ovejas de 4,0 ± 0,32 años de edad, se les inserto un dispositivo intravaginal impregnado con progesterona (CIDR P4 0,3 g), por nueve días. Dos días antes del retiro del dispositivo, las ovejas se asignaron aleatoriamente a uno ...

  1. Estrategias de obtención de proteínas recombinantes en Escherichia coli

    OpenAIRE

    José García; Zeila Santana; Lourdes Zumalacárregui; Marisel Quintana; Diamilé González; Gustavo Furrazola; Oscar Cruz

    2013-01-01

    La expresión de proteínas recombinantes se ha favorecido con el uso de Escherichia coli debido a su relativo bajo costo, alta densidad de cultivo, su fácil manipulación genética y a las diversas herramientas biotecnológicas disponibles que son compatibles. En este artículo se presentan algunas estrategias para la expresión de Escherichia coli; se destacan factores genéticos y fisiológicos que incluyen: número de copias del vector de expresión, características del gen, estabilidad del ácido ri...

  2. Efficacy and safety of peginterferon alfa-2a and ribavirin treatment of chronic hepatitis C in the Republic of Serbia

    Directory of Open Access Journals (Sweden)

    Božić Milena

    2012-01-01

    Full Text Available Introduction. Hepatitis C virus (HCV infection is one of the main causes of chronic liver disease worldwide. Pegylated interferon alfa-2a or 2b (PEG IFN alfa-2a or 2b and ribavirin (RBV represent a standard treatment of chronic hepatitis C (CHC. Sustained virological response (SVR, defined as continued undetectable HCV RNA 24 weeks after completion of treatment, is universally considered as an indicator of treatment efficacy. Objective. The aim of this study was to determine efficacy and safety of PEG IFN alfa-2a and RBV treatment in patients with CHC in Serbia. Methods. One hundred seventy-six patients with CHC were included in this multicenter trial from 8 reference centers in Serbia. The patients were treated with standard PEG IFN alfa- 2a and RBV protocol. We performed the following virological testing: anti-HCV (ELISA, HCV RNK (quantitative PCR, HCV genotype (type-specific PCR, HBsAg, anti-HBs, anti-HBc and anti-HIV (ELISA. Histological activity and the degree of fibrosis were determined according to the Metavir scoring system. Potential predictors for achieving SVR were evaluated using multivariable logistic regression analysis. Results. Of the treated patients with CHC 65.9% were male, and 60.2% of them aged over 40 years. Of the treated patients 68.2% had infection over 5 years, 63% had HCV RNA >400.000 IU/mL, 76.1% had HCV G1/4, and 60.1% had a mild to moderate liver fibrosis. SVR was achieved in 78.9% of patients (G1/4 79.1%; G2/3 78.1%. The factors that indicated a poorer efficacy of the treatment were age >40 (p<0.05, high basal viremia (p=0.013, and the reduction of PEG IFN alfa-2a and RBV doses, with interruption of therapy (p<0.001. Of the treated patients 45.9% had adverse affects (G1/4 50.8%; G2/3 29.7%. Conclusion. Treatment of CHC with PEG IFN alfa-2a and RBV was efficient in 78.9% of patients. The safety profile of therapy was satisfactory. Longer therapy increases the possibility of the development of adverse affects. No

  3. Evaluación inmunológica de proteínas recombinantes de fusión de dengue 1 y dengue 2 en monos

    OpenAIRE

    Bernardo Reyes, Lídice

    2010-01-01

    El desarrollo de subunidades recombinantes que contienen al dominio III de la proteína de la envoltura (E) de los virus del dengue (DEN) es una alternativa para el desarrollo de una vacuna segura contra esta entidad. En este trabajo caracterizamos la respuesta inmune inducida en monos por proteínas recombinantes de fusión de DEN 1 y DEN 2 que contienen al dominio III de la proteína E fusionado a la proteína P64k de Neisseria meningitidis. Se demostró que la proteína recombinante P64k-domin...

  4. JSC “ALFA-BANK” marketing policy. problems and perspectives

    OpenAIRE

    Kirillov, A.; Kuznetcova, E.; Martirosian, M.

    2013-01-01

    The article is devoted to the results of JSC “Alfa-Bank” consumers’ segmentation and the following complex marketing research. The article suggests the ways of the bank’s marketing policy improvement.

  5. Treatment of anemia with darbepoetin alfa in systolic heart failure

    DEFF Research Database (Denmark)

    Swedberg, Karl; Young, James B; Anand, Inder S

    2013-01-01

    Patients with systolic heart failure and anemia have worse symptoms, functional capacity, and outcomes than those without anemia. We evaluated the effects of darbepoetin alfa on clinical outcomes in patients with systolic heart failure and anemia.......Patients with systolic heart failure and anemia have worse symptoms, functional capacity, and outcomes than those without anemia. We evaluated the effects of darbepoetin alfa on clinical outcomes in patients with systolic heart failure and anemia....

  6. PRODUCCIÓN DE PROTEÍNAS RECOMBINANTES EN Escherichia coli

    OpenAIRE

    Lara, Alvaro R.

    2011-01-01

    La producción de proteínas recombinantes (PR) es una de las aportaciones más importantes de la biotecnología moderna. El hospedero bacteriano más importante para la producción de PR es Escherichia coli, aunque otros como Bacillus subtilis y Bacillus megaterium están cobrando cada vez más importancia. Debido a su impacto económico y en el sector de la salud humana, el presente trabajo se enfocará principalmente a la producción de PR terapéuticas en E. coli. Se abordarán en general los aspectos...

  7. Role of elosulfase alfa in mucopolysaccharidosis IVA.

    Science.gov (United States)

    Regier, Debra S; Tanpaiboon, Pranoot

    2016-01-01

    Mucopolysaccharidosis type IVA (MPS IVA or Morquio A) is an autosomal recessive lysosomal storage disease which results in a striking skeletal phenotype, but does not negatively impact the intellect of the patient. MPS IVA has a phenotypic continuum that ranges from a severe and rapidly progressing form to a slowly progressive form. The clinical diagnosis is often made in the preschool years based on abnormal bone findings on physical examination and dysplasia on radiographic imaging. Supportive care has been the mainstay in caring for patients. Orthopedic physicians often form the core of the care team due to the early and severe skeletal abnormalities; however, systemic disease is common and requires aggressive monitoring and management. Interdisciplinary care teams often consist of medical geneticists, cardiologists, pulmonary specialists, gastroenterologists, otolaryngologists, audiologists, and ophthalmologists. With the US Food and Drug Administration's approval of elosulfase alfa, patients >5 years of age now have access to this medication from the time of diagnosis. The clinical trial with once weekly intravenous dosing (2.0 mg/kg per week) showed improvement in the 6-minute walk test. The composite end point analysis to evaluate the combining changes from baseline in 6-minute walk test, 3-minute stair climb test, and respiratory function showed that at a dose of 2.0 mg/kg per week, subjects performed better when compared to placebo. This indication was clinically meaningful in the treatment group. The treatment was generally well tolerated, and the uncommon infusion reactions responded well to traditional enzyme replacement therapy infusion reaction management algorithms. Currently, clinical trials are underway to determine the efficacy and safety in MPS IVA patients <5 years of age.

  8. Epoetin alfa ja namaluva nefrotoksicnosta inducirana so cisplatin kaj staorci

    Directory of Open Access Journals (Sweden)

    Dimce Zafirov

    2006-06-01

    Full Text Available Klinickata efikasnost na cisplatin kako antitumorski lek e nesomnena, no dozno-limitiracki faktor za negova upotreba pretstavuva izrazitata nefrotoksicnost. Najnovite istrazuvawa pokazuvaat deka epoetin alfa moze da ima znacajna uloga ne samo vo terapiski celi za korekcija na razni vidovi na anemii, tuku istiot moze da bide efikasen i kako nevroprotektiv, hepatoprotektiv, kardioprotektiv i osobeno znacajno kako nefroprotektiv kaj nefrotoksicnost inducirana od preparati na baza na platina. Glavna cel na ovaa studija bese da se utvrdi efektot na epoetin alfa vo prevencijata na nefrotoksicnost eksperimentalno inducirana so dolgotrajna administracija na cisplatin vo doza od 2 mg/kg/t.t./nedela vo tek na 8 nedeli, kaj Wistar staorci. Dobienite rezultati od ovaa studija pokazuvaat deka epoetin alfa signifikantno gi ublazuva funkcionalnite bubrezni poremetuvawa inducirani so dolgotrajna administracija na cisplatin, ja podobruva opstata sostojba i go namaluva mortalitetot kaj ispituvanite zivotni.

  9. Conestat alfa for the treatment of angioedema attacks

    Directory of Open Access Journals (Sweden)

    Davis B

    2011-07-01

    Full Text Available Benjamin Davis, Jonathan A BernsteinUniversity of Cincinnati College of Medicine, Department of Internal Medicine, Division of Immunology/Allergy Section, Cincinnati, OH, USAAbstract: Recently, multiple C1 inhibitor (C1-INH replacement products have been approved for the treatment of hereditary angioedema (HAE. This review summarizes HAE and its current treatment modalities and focuses on findings from bench to bedside trials of a new C1-INH replacement, conestat alfa. Conestat alfa is unique among the other C1-INH replacement products because it is produced from transgenic rabbits rather than derived from human plasma donors, which can potentially allow an unlimited source of drug without any concern of infectious transmission. The clinical trial data generated to date indicate that conestat alfa is safe and effective for the treatment of acute HAE attacks.Keywords: androgens, adverse events, patients, HAE attacks 

  10. Resolution and t-spectrum for the ALFA detector

    CERN Document Server

    Guergouri, Hichem

    2016-01-01

    My report as Summer Student is in two parts. In the first part I report about my attendance to the run of the ALFA detector to test different collimation schemas and find a new way to get rid of the background. The second part is about the measurement of the resolution of the ALFA detector and comparing the real data with the Monte-Carlo (MC) simulations. First of all I tried to be more familiar with ROOT, worked on understanding the code used to access to the data in the trees inside the Ntuples, plotting histograms,… This was done using old Ntuples which contain MC data.

  11. Rayleigh scattering and laser spot elongation problems at ALFA

    CERN Document Server

    Viard, E; Hubin, N; Ageorges, N; Davies, R

    1999-01-01

    This paper describes the qualitative effects of LGS spot elongation and Rayleigh scattering on ALFA wavefront sensor images. An analytical model of Rayleigh scattering and a numerical model of laser plume generation at the altitude of the Na-layer were developed. These models, integrated into a general AO simulation, provide the sensor sub-aperture images. It is shown that the centroid measurement accuracy is affected by these phenomena. The simulation was made both for the ALFA system and for the VLT Nasmyth Adaptive Optics System (NAOS).

  12. Darbepoetin alfa once every 2 weeks for treatment of anemia in dialysis patients

    DEFF Research Database (Denmark)

    Mann, J; Kessler, M; Villa, Giulio Palludan

    2007-01-01

    AIM: Darbepoetin alfa has a longer half-life than epoetin-(EPO) alfa or beta, allowing administration at less frequent intervals for the treatment of renal anemia. The aim of the present analysis was to evaluate the efficacy and tolerability of an every-2-week (Q2W) schedule of darbepoetin alfa...

  13. Inmunogenicidad de una vacuna recombinante anti-HBs en trabajadores de la salud, del Instituto de Medicina Legal de Colombia

    Directory of Open Access Journals (Sweden)

    Heber Siachoque

    2007-12-01

    Full Text Available Objetivo: Evaluar la inmunogenicidad de la vacuna recombinante Hepavax-Gene para hepatitis B desde la última dosis administrada en trabajadores del INML.Materiales y métodos: Estudio de corte transversal en 603 trabajadores de la salud con mínimo 3 dosis de vacuna recombinante (0, 1, 6 meses donde se midieron los niveles de anticuerpos anti-HBs con la técnica de ELISA entre diciembre de 2000 y enero de 2001 desde la aplicación de la última dosis de la vacuna, que varió entre 1 y 6 años.Resultados: El grupo de estudio lo conformaron 344 hombres y 259 mujeres, con un promedio de edad de 38.8±7.3 años. El nivel de protección fue 90.7% (>10 U/l que disminuyó significativamente con el tiempo de aplicación de la última dosis de la vacuna (p45 (RRI=3.58, IC 95%:1.83, 6.99 con respecto a <40 años. Conclusión: La vacuna recombinante Hepavax-Gene anti-HBs tiene alta efectividad en los trabajadores de la salud (90.7% aunque presenta disminución de protección a mayor tiempo de aplicación de la última dosis y al aumentar la edad del trabajador.

  14. HBcrAg Identifies Patients Failing to Achieve HBeAg Seroconversion Treated with Pegylated Interferon Alfa-2b

    Directory of Open Access Journals (Sweden)

    Hui Ma

    2016-01-01

    Conclusions: Effective antiviral treatment can decrease HBcrAg levels in the serum. The NPVs of HBcrAg for predicting HBeAg seroconversion at 24-week follow-up was 100%, but the PPVs were not satisfactory (all <31%. The serum HBcrAg levels of the patients with HBeAg seroconversion at the end of the 24-week follow-up steadily declined or even became undetectable during the LTFU.

  15. Physics prospects with the ALFA and AFP detectors

    CERN Document Server

    Hamal, Petr; The ATLAS collaboration

    2013-01-01

    The ATLAS ALFA and AFP detectors - the experimental challenge of measuring forward protons at the LHC. We will describe the experimental challenge presented by the measurement of the forward protons at the LHC. The ATLAS ALFA and AFP projects involve the deployment of detectors capable of detecting protons that emerge intact from the interaction with very small scattering angles. In the case of the ALFA detector, located at ±240m from the ATLAS interaction point, this measurement has to be performed using special high \\beta* beam optics. The detector chosen for the task is a nearly edgeless scintillating fibre tracker capable of making measurements at very low t – below 10-3 GeV2 – in the Nuclear Coulomb interference region. In order to reach these very small t-values we need to deploy the detector very near to the beam line utilizing Roman Pots. The main purpose of the ALFA detector is to measure the total p-p cross-section, a fundamental quantity in hadronic physics of importance to particle and to cos...

  16. Astronaut Scott Carpenter practices in the ALFA trainer at Langley

    Science.gov (United States)

    1962-01-01

    Project Mercury Astronaut M. Scott Carpenter practices in the Air Lubricated Free Attitude (ALFA) trainer located at NASA's Manned Spacecraft Center at Langley AFB, Virginia. This trainer allows the astronaut to see the image of the earth's surface at his feet while manually controlling the spacecraft.

  17. Drotrecogin alfa (activated) in adults with septic shock.

    NARCIS (Netherlands)

    Ranieri, V.M.; Thompson, B.T.; Barie, P.S.; Dhainaut, J.F.; Douglas, I.S.; Finfer, S.; Gardlund, B.; Marshall, J.C.; Rhodes, A.; Artigas, A.; Payen, D.; Tenhunen, J.; Al-Khalidi, H.R.; Thompson, V.; Janes, J.; Macias, W.L.; Vangerow, B.; Williams, M.D.; Pickkers, P.; Raemaekers, J.M.

    2012-01-01

    BACKGROUND: There have been conflicting reports on the efficacy of recombinant human activated protein C, or drotrecogin alfa (activated) (DrotAA), for the treatment of patients with septic shock. METHODS: In this randomized, double-blind, placebo-controlled, multicenter trial, we assigned 1697 pati

  18. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  19. Estrategias de obtención de proteínas recombinantes en Escherichia coli

    Directory of Open Access Journals (Sweden)

    José García

    2013-08-01

    Full Text Available La expresión de proteínas recombinantes se ha favorecido con el uso de Escherichia coli debido a su relativo bajo costo, alta densidad de cultivo, su fácil manipulación genética y a las diversas herramientas biotecnológicas disponibles que son compatibles. En este artículo se presentan algunas estrategias para la expresión de Escherichia coli; se destacan factores genéticos y fisiológicos que incluyen: número de copias del vector de expresión, características del gen, estabilidad del ácido ribonucleico mensajero, promotor empleado, cepa utilizada, composición del medio de cultivo, parámetros de operación en el fermentador y también se abordan la conservación de cepas y la estrategia de cultivo y purificación.

  20. Structural Analysis Of Alfa Fibers After Chemical Treatment

    Directory of Open Access Journals (Sweden)

    Zakaria Mouallif

    2015-02-01

    Full Text Available Nowadays, natural fibers are used as reinforcement in composite materials. The Alfa fibers have undergone an alkaline treatment with sodium hydroxide NaOH at a concentration of 10%, during an immersion period of two days. After drying, the Fourier transform infrared spectroscopy by attenuated total reflection (FTIR-ATR and X-ray diffraction (XRD were used for the analysis of the chemical properties of these fibers which were extracted from the plant Alfa of the region Al Haouz (Morocco in order to study the modifications resulting from the alkaline treatment. The results proved the presence of the cellulose, with an increase in its proportion in those fibers which have undergone an alkaline treatment with NaOH, the presence of lignin and pectin, as well as their disappearance after the alkaline extraction.

  1. Pathophysiology of hypophosphatasia and the potential role of asfotase alfa

    Directory of Open Access Journals (Sweden)

    Orimo H

    2016-05-01

    Full Text Available Hideo Orimo Division of Metabolism and Nutrition, Department of Biochemistry and Molecular Biology, Nippon Medical School, Tokyo, Japan Abstract: Hypophosphatasia (HPP is an inherited systemic bone disease that is characterized by bone hypomineralization. HPP is classified into six forms according to the age of onset and severity as perinatal (lethal, perinatal benign, infantile, childhood, adult, and odontohypophosphatasia. The causative gene of the disease is the ALPL gene that encodes tissue-nonspecific alkaline phosphatase (TNAP. TNAP is expressed ubiquitously, and its physiological role is apparent in bone mineralization. A defect in bone mineralization can manifest in several ways, including rickets or osteomalacia in HPP patients. Patients with severe forms suffer from respiratory failure because of hypoplastic chest, which is the main cause of death. They sometimes present with seizures due to a defect in vitamin B6 metabolism resulting from the lack of alkaline phosphatase activity in neuronal cells, which is also lethal. Patients with a mild form of the disease exhibit rickets or osteomalacia and a functional defect of exercise. Odontohypophosphatasia shows only dental manifestations. To date, 302 mutations in the ALPL gene have been reported, mainly single-nucleotide substitutions, and the relationships between phenotype and genotype have been partially elucidated. An established treatment for HPP was not available until the recent development of enzyme replacement therapy. The first successful enzyme replacement therapy in model mice using a modified human TNAP protein (asfotase alfa was reported in 2008, and subsequently success in patients with severe form of the disease was reported in 2012. In 2015, asfotase alfa was approved in Japan in July, followed by in the EU and Canada in August, and then by the US Food and Drug Administration in the USA in October. It is expected that therapy with asfotase alfa will drastically change

  2. Tratamento da Doença de Pompe - deficiência da alfa-glicosidase ácida

    Directory of Open Access Journals (Sweden)

    Micaela Inês KUHN

    2014-12-01

    Full Text Available Este trabalho tem como objetivos descrever a patogênese e o tratamento da doença de Pompe. Foi realizado um estudo de revisão bibliográfica mediante busca de artigos científicos publicados entre 2004 e 2014. Portadores de deficiência na enzima alfa acido glicosidase, desenvolvem a doença de Pompe, que resulta em um acumulo de glicogênio dentro do lisossomo, originando danos e disfunções orgânicas no tecido muscular, ocasionando dificuldades na respiração, locomoção, fala e audição. A terapia de reposição enzimática é a alternativa de tratamento específica para Pompe, melhorando significativamente a função cardíaca e reduzindo a mortalidade. Contudo, a necessidade de injeção de altas doses da enzima, a perda de 80% da enzima por conta do metabolismo hepático e o alto custo do tratamento dificultam o seu uso. A dose que mostrou melhores resultados foi de 20 mg/kg da enzima a cada duas semanas. Todavia, apesar do alto custo do tratamento, os benefícios de diminuição de sintomas dos pacientes são importantes, como melhora na realização de atividades da vida diária, aumento da força muscular, redução da fadiga e incrementos na função pulmonar. Existem ainda, tratamentos alternativos, mas que ainda estão em fase de estudos. Dentre os tratamentos, aquele que possui um melhor prognóstico é a reposição com a enzima humana recombinante. A terapia de reposição enzimática trouxe sobrevida a diversos pacientes devido à diminuição da hipertrofia cardíaca e melhora nos sintomas motores.

  3. Somatotropina bovina recombinante (rbST) en la sincronización de estros y prolificidad de ovejas pelibuey.

    OpenAIRE

    2012-01-01

    El objetivo del presente estudio fue determinar si la administración de la Somatotropina Bovina Recombinante (rbST) dos días antes del retiro del progestágeno, influye en la sincronización de estros y prolificidad en ovejas Pelibuey. Se utilizaron 180 ovejas de 4±0.32 años de edad, a las cuales se les inserto un dispositivo intravaginal impregnado con progesterona (CIDR P4 0.3 g) por nueve días. Dos días antes del retiro del dispositivo, las ovejas se asignaron aleatoriamente a tres tratamie...

  4. Tecnología recombinante y el control de la rabia en animales domésticos y salvajes

    OpenAIRE

    Gallo, Guillermo G.

    1999-01-01

    La rabia es todavía un importante problema público en muchas partes del mundo. En 1993 y 1994 la Organización Mundial de la Salud O.M.S. comunicó más de 30.000 casos de rabia humana cada año. Las vacunas de rabia convencionales por vía parenteral han demostrado alta eficacia y seguridad y estas vacunas controlaron la rabia en animales domésticos. Sin embargo, la erradicación no es completa en los reservorios salvajes. Un recombinante del virus de vaccinia fue construido al insertar un gen de ...

  5. Método de producción de repertorios complejos de moléculas recombinantes

    OpenAIRE

    Orzáez, Diego; Julve, José Manuel; Granell, Antonio; Sarrion-Perdigones, Alejandro; Gutiérrez Cabrera, Carlos

    2012-01-01

    La presente invención describe un método de producción de repertorios complejos de moléculas recombinantes de forma consistente y reproducible, mediante la generación de forma transitoria de plantas multi-transgénicas que dan lugar a mosaicos somáticos inducidos por replicones virales que se excluyen entre sí. La presente invención también hace referencia a la planta multi-transgénica o un fragmento de la misma así obtenida, así como a los extractos o fracciones pur...

  6. Eficacia de la eritropoyetina recombinante humana, sin albúmina, cubana en pacientes en hemodiálisis iterada

    OpenAIRE

    Pérez-Oliva Díaz, Jorge Francisco

    2011-01-01

    La corrección de la anemia renal con eritropoyetina recombinante humana cambió la calidad de vida del enfermo en hemodiálisis. Un producto nacional se emplea desde 1998, en una formulación con albúmina como estabilizante con demostrada eficacia y seguridad. El objetivo de este ensayo clínico fue evaluar un nuevo biosimilar, cubano, sin albúmina, su eficacia y seguridad Método: ensayo clínico, controlado, monocéntrico, a doble ciega y aleatorizado, en enfermos hemodializados en el Instituto de...

  7. Extração de pró-insulina humana recombinante produzida em sementes de milho transgênico

    OpenAIRE

    Cristiane Sanchez Farinas

    2004-01-01

    Resumo: Bioprodutos de aplicação fannacêutica têm sido produzidos em sistemas transgênicos diversos, incluindo células de animais, bactérias e leveduras. No futuro, é esperado que a demanda por novas proteínas terapêuticas cresça substancialmente, sendo que o uso de plantas como bioITeatores tem se mostrado como uma das alternativas economicamente mais atraentes para a produção de proteínas recombinantes em larga escala. O objetivo deste trabalho foi estudar o processo de extração da pró-insu...

  8. Physics prospects with the ALFA and AFP detectors

    CERN Document Server

    Hamal, P; The ATLAS collaboration

    2013-01-01

    We will describe the experimental challenge presented by the measurement of the forward protons at the LHC. The ATLAS ALFA and AFP projects involve the deployment of detectors capable of detecting protons that emerge intact from the interaction with very small scattering angles. In the case of the ALFA detector, located at $\\pm${240}~m from the ATLAS interaction point, this measurement has to be performed using special high $\\beta^*$ beam optics. The detector chosen for the task is a nearly edgeless scintillating fibre tracker capable of making measurements at very low $t$ - below $10^{-3} \\text{GeV}^2$ - in the Nuclear Coulomb interference region. In order to reach these very small $t$ values we need to deploy the detector very near to the beam line utilizing Roman Pots. The main purpose of the ALFA detector is to measure the total p-p cross-section, a fundamental quantity in hadronic physics of importance to particle and to cosmic ray physicists and to provide absolute measurement of luminosity which includ...

  9. Upgrade of ATLAS-ALFA for Run2

    CERN Document Server

    Jakobsen, Sune; The ATLAS collaboration

    2016-01-01

    Early experience with the operation of the ALFA detectors in the LHC environment has shown significant beam-induced heating. Comprehensive studies on the effects of heating with a spare detector module have furthermore revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosity. A temporary solution was implemented and kept the detectors below the critical temperature in 2012. In LS1 all ALFA stations have been removed from LHC and are undergoing an upgrade of the geometry of Roman Pots to minimize the impedance losses. When the stations were re-installed ~4 m distance was added between them to gain level arm in the angular measurement between the stations. The updated geometry of the Roman Pot, together with a system to improve the internal heat transfer and an air cooling system, is expected to keep the temperatures of ALFA detectors below critical limits throughout the LHC Run2 and first results from the performance in 2016 will be presented. ...

  10. Estreptoquinasa recombinante en pacientes con infarto agudo del miocardio. Cardiocentro de Camaguey, 2008

    Directory of Open Access Journals (Sweden)

    Héctor Mariño Cano

    2015-12-01

    Full Text Available Se realizó un estudio descriptivo longitudinal, con el objetivo de valorar la eficacia de la utilización de la Estreptoquinasa Recombinante en pacientes con Infarto Agudo de Miocardio (IMA en el Cardiocentro del Hospital Provincial Docente “Manuel Ascunce Doménech” en la provincia de Camagüey, en el período comprendido de enero a diciembre del 2008. El universo estuvo constituido por 200 pacientes, a los que se les diagnosticó Infarto Agudo de Miocardio y la muestra quedó formada por 80 pacientes que recibieron tratamiento trombolítico, las historias clínicas de los pacientes fueron la principal fuente de obtención de la información, utilizando  las  siguientes  variables: resultados criterio de perfusión, evolución clínica, criterio de reacciones adversas y la influencia que ejerce el tiempo puerta-aguja,  así como los cuidados de enfermería. Al terminar se observó que  el criterio de repercusión de mayor incidencia fue el eléctrico; la mayor cantidad de pacientes tuvieron buena evolución clínica; la hipotensión fue la reacción adversa más frecuente; el tiempo de puerta-aguja  que más incidió  fue el menor, de 3h; a todos los pacientes diagnosticados con infarto, que recibieron tratamiento trombolítico, se les  brindaron  cuidados de enfermería.

  11. Daclatasvir plus peginterferon alfa and ribavirin for treatment-naive chronic hepatitis C genotype 1 or 4 infection

    DEFF Research Database (Denmark)

    Hézode, Christophe; Hirschfield, Gideon M; Ghesquiere, Wayne

    2015-01-01

    undetectable HCV-RNA at Weeks 4 and 12 (extended rapid virologic response, eRVR) and at 24 weeks post-treatment (sustained virologic response, SVR24) among genotype 1-infected patients. RESULTS: Overall, eRVR was achieved by 54.4% (80/147) of genotype 1-infected patients receiving daclatasvir 20 mg, 54.1% (79......OBJECTIVE: To evaluate the safety and efficacy of daclatasvir, an HCV NS5A inhibitor with pangenotypic activity, administered with peginterferon-alfa-2a/ribavirin. DESIGN: In this Phase 2b double-blind, placebo-controlled study, treatment-naive adults with HCV genotype 1 (N=365) or 4 (N=30......) infection were randomly assigned (2:2:1) to daclatasvir 20 mg or 60 mg, or placebo once daily plus weekly peginterferon-alfa-2a and twice-daily ribavirin. Daclatasvir recipients achieving protocol-defined response (PDR; HCV-RNA

  12. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    Directory of Open Access Journals (Sweden)

    Emmanuel eStrahm

    2013-06-01

    Full Text Available Nandrolone (19-nortestosterone is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17 are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are the two main enzymes responsible of 19-norandrosterone glucuronidation. However, the identity of the enzyme involved in nandrolone metabolism in vivo together with their relative contribution and regulation remain unknown.Inhibition assays using human liver microsomes incubated with 19-norandrosterone and selective inhibitors confirmed that UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation, since the presence of the specific UGT2B7 and UGT2B15 inhibitors gemfibrosil and valproic acid inhibited the 19-norandrosterone glucuronidation by 35 and 45 %, respectively. Human liver microsomes were genotyped for UGT2B15 D85Y, UGT2B7 H268Y and the UGT2B17 deletion polymorphism. The glucuronidation activity on 19 norandrosterone was significantly higher in UGT2B15 DD than in the other UGT2B15 genotypes (p<0.05. Moreover, human liver cancer HepG2 cells were exposed to androgens to determine if the transcriptional activity of the genes of interest was affected. Only UGT2B7 mRNA expression was significantly increased (1.8-folds after incubation with nandrolone decanoate.These results show that the UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation and that the UGT2B15 polymorphism (D85Y is the only UGT genetic variation that influences the glucuronidation activity. This could partly explain the inter-individual variation in 19 norandrosterone excretion.

  13. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    OpenAIRE

    Emmanuel eStrahm; Ulf eSjöberg; Mats eGarle; Anders eRane; Lena eEkström

    2013-01-01

    Nandrolone (19-nortestosterone) is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17) are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are...

  14. Pathophysiology of hypophosphatasia and the potential role of asfotase alfa

    Science.gov (United States)

    Orimo, Hideo

    2016-01-01

    Hypophosphatasia (HPP) is an inherited systemic bone disease that is characterized by bone hypomineralization. HPP is classified into six forms according to the age of onset and severity as perinatal (lethal), perinatal benign, infantile, childhood, adult, and odontohypophosphatasia. The causative gene of the disease is the ALPL gene that encodes tissue-nonspecific alkaline phosphatase (TNAP). TNAP is expressed ubiquitously, and its physiological role is apparent in bone mineralization. A defect in bone mineralization can manifest in several ways, including rickets or osteomalacia in HPP patients. Patients with severe forms suffer from respiratory failure because of hypoplastic chest, which is the main cause of death. They sometimes present with seizures due to a defect in vitamin B6 metabolism resulting from the lack of alkaline phosphatase activity in neuronal cells, which is also lethal. Patients with a mild form of the disease exhibit rickets or osteomalacia and a functional defect of exercise. Odontohypophosphatasia shows only dental manifestations. To date, 302 mutations in the ALPL gene have been reported, mainly single-nucleotide substitutions, and the relationships between phenotype and genotype have been partially elucidated. An established treatment for HPP was not available until the recent development of enzyme replacement therapy. The first successful enzyme replacement therapy in model mice using a modified human TNAP protein (asfotase alfa) was reported in 2008, and subsequently success in patients with severe form of the disease was reported in 2012. In 2015, asfotase alfa was approved in Japan in July, followed by in the EU and Canada in August, and then by the US Food and Drug Administration in the USA in October. It is expected that therapy with asfotase alfa will drastically change treatments and prognosis of HPP. PMID:27274262

  15. Reconocimiento de expresiones faciales empleando memorias asociativas Alfa-Beta

    OpenAIRE

    Márquez Olivera, Moisés Vicente

    2016-01-01

    El presente trabajo de tesis orienta su atención en la compleja tarea del reconocimiento automático de las expresiones faciales, el propósito principal es probar la asertividad y competitividad de las memorias asociativas de tipo Alfa-Beta en el reconocimiento automático de expresiones faciales. La primera parte de la tesis brinda una breve introducción, la cual enfatiza la importancia de las expresiones faciales en la comunicación humana, incluyendo los estudios más relevantes dedicados a...

  16. Desarrollo de un sitio web para el proyecto Alfa Gaviota

    OpenAIRE

    Trelles Labairu, Hilton

    2013-01-01

    Este proyecto muestra todos los pasos a seguir para recolectar, organizar, tratar y construir un portal web para el grupo de universidades partícipes en el proyecto Alfa Gaviota III utilizando un sistema gestor de contenidos. Se parte de una base de información recopilada en unas cuántas páginas html realizadas con la tecnología de google docs. Es un requisito indispensable conseguir una forma de almacenar toda la información del proyecto consumiendo el mínimo espacio y recurso...

  17. Estado actual de la vacuna recombinante contra el virus del papiloma humano

    Directory of Open Access Journals (Sweden)

    Wendy Chan Acón

    2008-12-01

    Full Text Available La infección por el virus del papiloma humano (VPH es una enfermedad de transmisión sexual común. Alrededor del mundo millones de personas están infectadas y el resto de la población en general tiene un riesgo de contraer la infección superior al 50%. El virus se asocia aproximadamente a un 100% de los casos de cáncer cervical; a un 100% de las neoplasias cervicales intraepiteliales grados 1, 2, 3; a un 40% de los casos de cáncer de vulva, vagina y pene, 100% de las verrugas genitales; a un 100% de las papilomatosis respiratorias recurrentes; a un 90% del cáncer anal y a un 12% del cáncer de cabeza y cuello, predominantemente en orofaringe y amígdala. Actualmente, el uso de dos vacunas está aprobado en diversos países: Gardasil® y Cervarix®. Ambas están compuestas por proteínas L1 de VPH, en forma de partículas no infecciosas similares al virus (VLPs producidas por tecnología de ADN recombinante, adsorbidas en adyuvantes que contienen aluminio. La eficacia hallada en diversos estudios en sujetos no expuestos previamente al virus se encuentran en el rango del 98.8% al 100.0% para la prevención de neoplasias cervicales, vulvares y vaginales intraepiteliales, grados 2 y 3, relacionados con el VPH-16/18, además de los adenocarcinomas in situ y verrugas genitales causadas por VPH- 16/18/6/11 en el caso de Gardasil® y una eficacia del 100% en el caso de Cervarix® para la prevención de neoplasias cervicales grado 2 y 3 relacionados con el VPH-16/18. La eficacia de ambas se mantiene alrededor de los 5 años. Hasta el momento no se le ha atribuido a la vacuna ningún efecto terapéutico, solo se administra con fines profilácticos, sin embargo, esta no debe ser considerada como un sustituto de las pruebas de tamizaje para la prevención del cáncer cervical.

  18. 意大利精灵——Alfa Romeo MITO

    Institute of Scientific and Technical Information of China (English)

    柳柽

    2008-01-01

    Alfa Romeo 是一个对激情执着的品牌,即便是对于MITO这样一部掀背小车也不例外,这部意大利制造的Alfa Romeo MITO上,会让你感受到一种热辣奔放的别样风情。

  19. De radioimmunochemische bepaling van de prostaglandines E2 en F2alfa

    NARCIS (Netherlands)

    Elvers LH; Smit PJ; Loeber JG

    1986-01-01

    In het kader van het onderzoek naar het werkingsmechanisme van de tumorpromotor activiteit van chemische stoffen (LCM, project 658113) werden radioimmunochemische bepalingsmethoden (RIA) voor de prostaglandines E2 (PGE2) en F2alfa (PGF2alfa) ontwikkeld. Het onderzoeksmateriaal, celextracten en medi

  20. Peginterferon alfa-2a for AIDS-associated Kaposi sarcoma: experience with 10 patients.

    Science.gov (United States)

    Rokx, Casper; van der Ende, Marchina E; Verbon, Annelies; Rijnders, Bart J A

    2013-11-01

    In this observational cohort study, 10 patients with extensive or treatment-refractory AIDS-associated Kaposi sarcoma were treated with peginterferon alfa-2a. Tumor responses were observed in 9 patients with a median progression-free survival of 645 days. Peginterferon alfa-2a could be an effective therapy for extensive or treatment-resistant Kaposi sarcoma.

  1. Stock footage ATLAS-ALFA experiment November 2016

    CERN Multimedia

    2016-01-01

    This footage shows an ALFA station of the ATLAS experiment in the LHC tunnel. This detector aims to measure the elastic proton scattering and to determine from these data the elastic and total cross sections, as well as the luminosity. Altogether there are two times two stations at both sides of ATLAS at Point 1 in a distance of about 240m. Each station consist of two Roman Pots which are equipped with scintillating fiber detectors. They are used under special beam conditions (high beta*) when the detectors are moved close to the circulating LHC beams (as close as 1mm). In standard high intensity LHC runs the Pots remain in parking position. The movie records the composition of an ALFA station at the C-side of ATLAS in the tunnel section *** 7L1. All stations are placed on the outgoing beams where scattered protons are expected. That's why the station mechanics is partly covered by the tubes of incoming beam lines. The stations are placed in between the large boxes with DQR resistors to absorb the magnet curr...

  2. Alternative method for quantification of alfa-amylase activity

    Directory of Open Access Journals (Sweden)

    DF. Farias

    Full Text Available A modification of the sensitive agar diffusion method was developed for macro-scale determination of alfa-amylase. The proposed modifications lower costs with the utilisation of starch as substrate and agar as supporting medium. Thus, a standard curve was built using alfa-amylase solution from Aspergillus oryzae, with concentrations ranging from 2.4 to 7,500 U.mL-1. Clear radial diffusion zones were measured after 4 hours of incubation at 20 °C. A linear relationship between the logarithm of enzyme activities and the area of clear zones was obtained. The method was validated by testing α-amylase from barley at the concentrations of 2.4; 60; 300 and 1,500 U.mL-1. The proposed method turned out to be simpler, faster, less expensive and able to determine on a macro-scale α-amylase over a wide range (2.4 to 7,500 U.mL-1 in scientific investigation as well as in teaching laboratory activities.

  3. Therapeutic efficacy of a biosimilar epoetin alfa in hemodialysis patients

    Directory of Open Access Journals (Sweden)

    Amel Harzallah

    2015-01-01

    Full Text Available Anemia is a frequent complication in patients with chronic kidney disease. However, human recombinant erythropoietin (rHu-EPO has revolutionized the management of anemia in chronically dialyzed patients. Epomax ® is a new rHu-EPO alfa manufactured in Tunisia (Medis Laboratories. The aim of this study was to evaluate the efficacy and tolerance of Epomax ® in chronic hemodialysis (HD patients in a phase-III, multicenter, clinical trial. Fiftythree HD patients (mean age 47.7 ± 13 years who received a stable dose of rHu-EPO (Hemax ® , a rHu-EPO alfa manufactured by Biosidus Laboratories subcutaneously were switched to Epomax ® via the same route of administration. At baseline, the mean systolic pressure was 132 ± 18 mm Hg and the mean diastolic pressure was 79 ± 8 mm Hg. The mean blood hemoglobin was 10.2 g/dL and the median ferritin level was 667 ng/mL. After a follow-up of 43 days, the mean blood hemoglobin was 10.5 g/dL under the effect of Epomax ® . There was no significant difference in the mean hemoglobin levels between the treatments with both drugs. Few adverse events were reported during the study. We conclude that Epomax ® was effective at maintaining the hemoglobin levels at target concentrations and was well tolerated in HD patients.

  4. ESTUDO DE METODOLOGIAS PARA AVALIAÇÃO DO HORMÔNIO DA PARATIREÓIDE HUMANO RECOMBINANTE

    OpenAIRE

    Fernanda Pavani Stamm

    2013-01-01

    O hormônio da paratireóide humano (hPTH) é um polipeptídio constituído de 84 aminoácidos e tem função essencial como regulador da homeostase dos íons cálcio e fosfato, e manutenção da estrutura óssea. O hormônio da paratireóide humano recombinante, rhPTH (1-34), é produzido pela tecnologia do DNA em Escherichia coli, apresenta a sequência de aminoácidos responsável pela porção biologicamente ativa do paratormônio natural e é usado clinicamente para o tratamento da osteoporose d...

  5. Eritropoyetina recombinante humana en pacientes con enfermedad renal crónica en etapa de prediálisis

    OpenAIRE

    María del Carmen Popoca Martínez; Iván Henríquez Moreu; Antonio Méndez Durán; Jorge Revilla Beltri; Aarón Molina Pérez

    2008-01-01

    Objetivo: evaluar el efecto de la eritropoyetina recombinante humana en pacientes con anemia y enfermedad renal crónica, en etapa de prediálisis, y su repercusión en la calidad de vida. Material y métodos: se seleccionaron 20 pacientes con enfermedad renal crónica en etapa de prediálisis, a quienes se realizó biometría hemática completa y química sanguínea en cada visita médica; la escala de calidad de vida se aplicó en la visita inicial y final del tratamiento. se administraron 50 Ul/g de er...

  6. INMUNOGENICIDAD DE LA PROTEÍNA RECOMBINANTE ASP1R DE Ancylostoma caninum EN UN MODELO MURINO

    Directory of Open Access Journals (Sweden)

    Maria Giraldo G

    2009-08-01

    Full Text Available Objetivo. Construir un plásmido recombinante que exprese la proteína ASP1r de Ancylostoma caninum y evaluar su capacidad inmunogénica en un modelo murino. Materiales y métodos. Se realizó extracción de ARN de parásitos adultos de Ancylostoma caninum, se amplificó por RT –PCR el gen de la proteína ASP1. Este gen fue insertado en el vector pcDNA3. El inserto fue digerido con Bamh1 y EcoR1 y clonado direccionalmente. Posteriormente, se llevó a cabo transformación y selección de las células de E. coli DH5a competentes con el producto de la ligación. Se realizó un tamizaje por PCR confirmando la presencia del gen ASP1. El vector pcDNA3-ASP1 fue administrado vía intraglandular en la parotida e intramuscular en ratones Balb/c. En estos animales se les realizó determinación de anticuerpos en suero y saliva mediante las técnicas de ELISA e inmunohistoquímica. Resultados. Se determinó que el plásmido pcDNA3-ASP1 fue incorporado y expresado células E. coli DH5a. Este plásmido recombinante indujo la producción de anticuerpos Anti-ASP1 específicos en ratones Balb/c. Conclusiones. Se logró demostrar que la utilización de pcDNA3-ASP1 no produjo reacciones desfavorables en ratones Balb/c, además indujo respuesta humoral contra la proteína pcDNA3-ASP1 de excreción/secreción de Ancylostoma caninum en ratones.

  7. Investigation of Class 2b Trucks

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.

    2002-04-03

    The popularity of trucks in the class 2 category--that is, those with a 6,000 to 10,000 pounds (lbs) gross vehicle weight rating (GVWR)--has increased since the late 1970s/early 1980s. The purpose of this research is to identify and examine vehicles in the upper portion of the class 2 weight range (designated as vehicle class 2b) and to assess their impact. Vehicles in class 2b (8,500-10,000 lbs GVWR) include pickup trucks, sport utility vehicles (SUVs), and large vans (i.e., not minivans). Oak Ridge National Laboratory researched each individual truck model to determine which models were class 2b trucks and arrived at four methodologies to derive sales volumes. Two methods--one for calendar year and one for model year sales--were recommended for producing believable and reliable results. The study indicates that 521,000 class 2b trucks were sold in calendar year 1999--6.4% of sales of all trucks under 10,000 lbs. Eighty-two percent of class 2b trucks sold in 1999 were pickups; one third of class 2b trucks sold in 1999 were diesel. There were 5.8 million class 2b trucks on the road in 2000, which amounts to 7.8% of all trucks under 10,000 lbs. Twenty-four percent of the class 2b truck population is diesel. Estimates show that class 2b trucks account for 8% of annual miles traveled by trucks under 10,000 lbs and 9% of fuel use. Data on class 2b trucks are scarce. As the Tier 2 standards, which apply to passenger vehicles in the 8,500-10,000 lb GVWR category, become effective, additional data on class 2b trucks may become available--not only emissions data, but data in all areas. At the moment, distinguishing class 2b trucks from class 2 trucks in general is a substantial task requiring data on an individual model level.

  8. Vectores recombinantes basados en el virus modificado de ankara (MVA) como vacunas preventivas y terapéuticas contra el SIDA

    OpenAIRE

    Jonathan L Heeney; Mooij, Petra; Nájera García, José Luis; Jiménez, Victoria; Esteban, Mariano; Gómez, Carmen E.

    2005-01-01

    Vectores Recombinantes basados en el Virus Modificado de Ankara (MVA) como Vacunas Preventivas y Terapéuticas contra el SIDA. Losvirus recombinantes de la invención contienen secuencias que se encuentran insertadas en el mismo sitio de inserción del MVA y permiten la expresión simultánea de varios antígenos, una proteína Env del VIH-I consistente en una proteína gpl20 carente de secuencias correspondientes a la proteína gp41, y una proteína quiméricade fusión de Gag, Pol y Nef. Son virus esta...

  9. Vectores recombinantes basados en el virus modificado de Ankara (MVA) com vacunas preventivas y terapeúticas contra la hepatitis C

    OpenAIRE

    Esteban, Mariano; Gómez, Carmen E.; Perdiguero, Beatriz

    2014-01-01

    [ES] Los virus recombinantes de la invención contienen secuencias que se encuentran insertadas en el mismo sitio de inserción del MVA y que permiten la expresión simultáneamente de varios antígenos del VHC, concretamente las proteínas maduras estructurales (Core, E1, E2 y p7) y no estructurales (NS2, NS3, NS4A, NS4B, NS5A más los 201 aminoácidos de la región N-terminal de NS5B). Con ello se consiguen virus recombinantes estables, que permiten el desencadenamiento de una respuesta inmune contr...

  10. AFP and ALFA detectors as a momentum spectrometer system - feasibility study

    CERN Document Server

    ABDUL KHALEK, Rabah

    2015-01-01

    We consider a possibility to measure a leading proton momentum using simultaneously the AFP and ALFA detectors. The idea is based on the simple fact that the proton trajectory through the magnetic field between the AFP and ALFA$_{1}$ detectors, depends on the proton's momentum loss $\\xi$. The feasibility of the proton momentum measurement is directly related to the availability of the magnetic fields and their configuration, the overlap between ALFA and AFP detectors and their resolutions as well as energy losses and the multiple scattering effect that could wash away little actions from the magnets on the proton.

  11. Nebulised dornase alfa versus placebo or hypertonic saline in adult critically ill patients

    DEFF Research Database (Denmark)

    Claudius, Casper; Perner, Anders; Møller, Morten Hylander

    2015-01-01

    BACKGROUND: Nebulised dornase alfa is used off-label in critically ill patients. We aimed to assess the benefits and harms of nebulised dornase alfa versus placebo, no prophylaxis, or hypertonic saline on patient-important outcome measures in adult critically ill patients. METHODS: We performed...... a systematic review with meta-analysis and trial sequential analysis (TSA) using the Cochrane Collaboration methodology. Eligible trials were randomised clinical trials comparing nebulised dornase alfa with placebo, no prophylaxis, or hypertonic saline. The predefined outcome measures were all-cause mortality...

  12. Fast radio burst discovered in the Arecibo pulsar ALFA survey

    Energy Technology Data Exchange (ETDEWEB)

    Spitler, L. G.; Freire, P. C. C.; Lazarus, P.; Lee, K. J. [Max-Planck-Institut für Radioastronomie, D-53121 Bonn (Germany); Cordes, J. M.; Chatterjee, S.; Wharton, R. S.; Brazier, A. [Department of Astronomy and Space Sciences, Cornell University, Ithaca, NY 14853 (United States); Hessels, J. W. T. [ASTRON, Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Lorimer, D. R.; McLaughlin, M. A. [Department of Physics and Astronomy, West Virginia University, Morgantown, WV 26506 (United States); Crawford, F. [Department of Physics and Astronomy, Franklin and Marshall College, Lancaster, PA 17604-3003 (United States); Deneva, J. S. [Naval Research Laboratory, 4555 Overlook Ave SW, Washington, DC 20375 (United States); Kaspi, V. M.; Karako-Argaman, C. [Department of Physics, McGill University, Montreal, QC H3A 2T8 (Canada); Allen, B. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee, WI 53211 (United States); Bogdanov, S.; Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Jenet, F. A. [Center for Gravitational Wave Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); Knispel, B., E-mail: lspitler@mpifr-bonn.mpg.de [Leibniz Universität, Hannover, D-30167 Hannover (Germany); and others

    2014-08-01

    Recent work has exploited pulsar survey data to identify temporally isolated, millisecond-duration radio bursts with large dispersion measures (DMs). These bursts have been interpreted as arising from a population of extragalactic sources, in which case they would provide unprecedented opportunities for probing the intergalactic medium; they may also be linked to new source classes. Until now, however, all so-called fast radio bursts (FRBs) have been detected with the Parkes radio telescope and its 13-beam receiver, casting some concern about the astrophysical nature of these signals. Here we present FRB 121102, the first FRB discovery from a geographic location other than Parkes. FRB 121102 was found in the Galactic anti-center region in the 1.4 GHz Pulsar Arecibo L-band Feed Array (ALFA) survey with the Arecibo Observatory with a DM = 557.4 ± 2.0 pc cm{sup –3}, pulse width of 3.0 ± 0.5 ms, and no evidence of interstellar scattering. The observed delay of the signal arrival time with frequency agrees precisely with the expectation of dispersion through an ionized medium. Despite its low Galactic latitude (b = –0.°2), the burst has three times the maximum Galactic DM expected along this particular line of sight, suggesting an extragalactic origin. A peculiar aspect of the signal is an inverted spectrum; we interpret this as a consequence of being detected in a sidelobe of the ALFA receiver. FRB 121102's brightness, duration, and the inferred event rate are all consistent with the properties of the previously detected Parkes bursts.

  13. Toxicidad de δ-endotoxinas recombinantes de Bacillus thuringiensis sobre larvas de la polilla guatemalteca (Tecia solanivora (Lepidóptera: Gelechiidae

    Directory of Open Access Journals (Sweden)

    Javier Hernández-Fernández

    2009-01-01

    Full Text Available Con el objetivo de determinar la actividad tóxica específica de las proteínas recombinantes Cry1Aa, Cry1Ac, Cry1B y Cry1C de Bacillus thuringiensis (Bt, sobre larvas de primer instar de Tecia solanivora se estableció la CL50 para las toxinas. Para este fin se implementó la cría masiva de este insecto bajo condiciones de laboratorio, 58±5% de humedad relativa, 18±5ºC de temperatura y un fotoperiodo de 23 h oscuridad y 1 h luz. Se utilizó una dieta seminatural consistente en láminas de papa variedad parda pastusa autoclavada con solución preservante (ácido ascórbico 7 g/L y metilparabeno 5 g/L, ya que fue estable en el tiempo, garantizó la reproducibilidad de los resultados y fue de fácil evaluación. Las proteínas recombinantes se evaluaron a una concentración de 0,1 μg/cm2. Los resultados obtenidos de porcentaje de mortalidad indicaron que no había diferencias entre las delta-endotoxinas recombinantes Cry1Aa, Cry1Ac, Cry1B y Cry1C de Bt (PPalabras clave: Bacillus thuringiensis; proteínas recombinantes; Tecia solanivora; papa parda pastusa; Bacillus thuringiensis; bioassay; recombinant endotoxin; Tecia solanivora; pastusa potato variety.

  14. Investigation of Mechanical Behavior of Alfa and Gamma Nano- Alumina/ Epoxy Composite Made By Vartm

    Directory of Open Access Journals (Sweden)

    P. Ghabezi

    2016-06-01

    Full Text Available In this paper, the mechanical properties (flexural and tensional modulus and strength are investigated by manufacturing Epoxy/Glass Nano-composite samples with different Nano-particle wt% (Nano-Alumina to find optimum conditions. The alpha and Gamma grade of Nano alumina were added to the epoxy system with the weight percentage of 1, 2, 3, 4, 5 and 6. The experimental results show that the maximum flexural stiffness in Alfa and Gamma Nano-alumina composite is related to 6 wt% and 4 wt% samples, respectively. And the highest tensional stiffness in Alfa and Gamma Nano-alumina composite is related to 4 wt% and 5 wt% samples, respectively. Also the highest toughness for Alfa and Gamma Nano-composites is observed for 4 wt% and 3 wt% samples and in the same way Nano-alumina in grade Alfa with 1 wt% and Gamma with 3 wt% have highest failure strain.

  15. Measurement of the total cross section with ALFA Detector at ATLAS

    CERN Document Server

    Trzebinski, M; The ATLAS collaboration

    2017-01-01

    The main goals of the Absolute Luminosity For ATLAS (ALFA) detector is to provide an absolute luminosity and total cross section measurement. The measurement method used, the detector alignment and the quality of the collected data are discussed.

  16. Simulation of the ATLAS ALFA detector in comparison with testbeam data

    CERN Document Server

    Pfeiffer, Felix-Fabian; Stenzel, H

    2010-01-01

    ALFA (Absolute Luminosity for ATLAS) is a scintillating fiber detector for the determination of the absolute luminosity. ALFA con- sists of eight Roman Pots, four on each side of ATLAS at a distance of 240 m. Each detector is made of scintillating fibers with quadratic cross section, glued in UV geometry on ten double sided layers. The detectors are mounted in moveable Roman Pots and can approach the LHC beam up to 1.5 mm, to determine the luminosity from the differential t spectrum of elastically scattered protons using the optical theorem. This is done in special LHC calibration runs with large β ∗ , special focusing and low instant luminosity. The results of ALFA are needed for the calibration of ATLAS luminosity monitors like LUCID. This diploma thesis deals with the simulation of ALFA and the most recent testbeam campaign. A special focus is put on the comparison of results from simulation and testbeam.

  17. Alfa tahab TeliaSonerat Türgis üle pakkuda / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2005-01-01

    TeliaSoneraga, kellele kuulub 37 protsenti Türgi operaatorfirma Turkcell aktsiatest, konkureerib täiendava 27 protsendise aktsiapaki ostmises Venemaa operaatorfirmaga Alfa Telecom. Lisa: Kaasosanike huvid põrkuvad. Diagramm: Konkurendid Vene MegaFonis

  18. Clonamiento, expresión y seroreactividad del antígeno recombinante flagelina de Bartonella bacilliformis

    Directory of Open Access Journals (Sweden)

    Karen Gallegos V

    2005-03-01

    Full Text Available Objetivos. Clonar el gen de la flagelina A (flaA de Bartonella bacilliformis, expresar y evaluar preliminarmente la seroreactividad de la proteína recombinante a sueros de pacientes con Bartonelosis por B. bacilliformis. Materiales y Métodos. Se diseñó una pareja de oligonucleótidos iniciadores -BbFlaA1 y BbFlaA2- para la amplificación del gen completo de la flagelina flaA de B. bacilliformis. El producto de amplificación obtenido se clonó en pGEM y luego se subclonó en el vector de expresión pGEX4T-1. Se indujo la expresión de la proteína de fusión rBbFlaA-GST con isopropil tio-β -D-galactosido (IPTG. La proteνna de fusiσn producida fue digerida con trombina para liberarla de GST. Finalmente, una prueba de ELISA fue estandarizada para detectar los anticuerpos IgG contra la proteína de fusión rBbFlaA-GST y rBbflaA libre de GST. Se evaluaron sueros de pacientes con diagnóstico de Bartonelosis por B. Bacilliformis (n= 30, sueros de individuos sanos (n= 20 y sueros de pacientes con otras enfermedades de posible reactividad cruzada; entre ellas, Brucelosis (n= 3, leptospirosis (n= 3 y salmonelosis (n=7. Resultados. Se determinó que para la expresión óptima en E. coli BL21 de la proteína de fusión rBbFlaA se requiere que el cultivo crezca en caldo LB/ampicilina a 30 °C suplementado con 2% de glucosa a partir de un preinóculo de 100 µL (crecido por toda la noche, hasta que alcance una densidad óptica de 1 OD600 y se induzca por dos horas con 2,5 mM de IPTG. Finalmente, el 57,6 % (17 de 30 sueros de pacientes con diagnóstico confirmado de bartonelosis reaccionaron con la proteína recombinante BbFlaA en el formato de ELISA. Conclusiones. Se logró expresar exitosamente en E. coli la proteína recombinante BbFlaA de B. bacilliformis, determinándose un protocolo de expresión y de purificación de rBbFlaA para la producción de esta proteína. Así también, el antígeno rBbFlaA es reconocido por anticuerpos de sueros de

  19. Elosulfase Alfa: a review of its use in patients with mucopolysaccharidosis type IVA (Morquio A syndrome).

    Science.gov (United States)

    Lyseng-Williamson, Katherine A

    2014-10-01

    Elosulfase alfa (Vimizim(®)) is a recombinant form of the human lysosomal enzyme N-acetylgalactosamine-6-sulfatase (GALNS) that is lacking in patients with mucopolysaccharidosis type IVA (MPS IVA; Morquio A syndrome). It is the first, and currently only, disease-specific treatment option for this very rare, progressively degenerative, autosomal-recessive lysosomal storage disorder. Enzyme replacement therapy with elosulfase alfa aims to restore GALNS activity, thereby preventing the accumulation of keratan sulfate (KS) and chondroitin-6-sulfate in lysosomal compartments of cells that results in the clinical manifestations of MPS IVA. In clinical trials in children and adults with MPS IVA, intravenous elosulfase alfa 2 mg/kg/week provided significant and sustained improvements in urinary levels of KS (a pharmacodynamic biomarker for the disease). In the key placebo-controlled, 24-week, phase 3 trial in patients with MPS IVA aged ≥5 years, elosulfase alfa 2 mg/kg/week significantly improved endurance [least squares mean placebo-adjusted change from baseline in 6-min walk test distance 22.5 m (95 % CI 4.0-40.9)]. Infusion-associated reactions, the primary tolerability issue associated with elosulfase alfa, are generally mild to moderate in severity, self-limiting, and manageable. In the absence of a cure, GALNS enzyme replacement therapy with elosulfase alfa is an important achievement in the treatment of MPS IVA.

  20. Combination of "low-dose" ribavirin and interferon alfa-2a therapy followed by interferon alfa-2a monotherapy in chronic HCV-infected non-responders and relapsers after interferon alfa-2a monotherapy

    Institute of Scientific and Technical Information of China (English)

    Perdita Wietzke-Braun; Volker Meier; Felix Braun; Giuliano Ramadori

    2001-01-01

    AIM To report on the efficacy, safety and tolerability of interferon alfa-2a combined with a "low dose" of ribavirin for relapsers and non responders to alpha interferon monotherapy.METHODS Thirty-four chronic hepatitis C virus-infected non-responders to interferon alfa2a monotherapy (a course of at least 3 months treatment) and 13 relapsers to interferon alfa 2a monotherapy (a dose of 3 to 6 million units three times per week for at least 20 weeks but not more than 18 months) were treated with the same dose of interferon alfa-2a used before (3 to 6 million units three times per week) and ribavirin (10 mg/ kg daily) for 6 months. In complete responders, interferon alfa-2a was administered for further 6 months at the same dose used before as monotherapy.RESULTS Seven (20.6%) of 34 non-responders stopped the combined therapy due to adverse events, including two patients with histological and clinical Child A cirrhosis. In 17/27 (63%)non-responders, the combined therapy was stopped after three months because of non-response. Ten of the 27 non-responders completed the 1;2-month treatment course. At a mean follow up of 28 months (16- 37 months)after the treatment, 4/10 (15%) previous non-responders still remained complete responders,All 13 previous relapsers completed the 12-month treatment course. At a mean follow up of 22months (9 - 36 months) after treatment, 6/13(46%) the previous relapsers were stillsustained complete responders.CONCLUSION Our treatment schedule of the combined therapy for 6 months of interferon alfa2a with a low dose of ribavirin (10 mg/kg/day)followed by 6 months of interferon alfa-2amonotherapy is able to induce a sustainedcomplete response rate in 15% of non-responders and 46% of relapsers with chronic hepatitis C virus-related liver diseases comparable to those obtained with the standarddoses of ribavirin 1000 - 1200 mg/day.Randomized prospective controlled trials using lower total amounts of ribavirin in combination with interferon should be

  1. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  2. B2B Pioneer A Millionaire Maker

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    China should soon see its largest group of instant millionaires after Jack Ma,Chief Executive Officer and Chairman of Alibaba Group,announced on July 27 that the China’s preeminent e-commerce company has initiated the listing of its B2B unit alibaba.com

  3. Fast Radio Burst Discovered in the Arecibo Pulsar ALFA Survey

    CERN Document Server

    Spitler, L G; Hessels, J W T; Lorimer, D R; McLaughlin, M A; Chatterjee, S; Crawford, F; Deneva, J S; Kaspi, V M; Wharton, R S; Allen, B; Bogdanov, S; Brazier, A; Camilo, F; Freire, P C C; Jenet, F A; Karako-Argaman, C; Knispel, B; Lazarus, P; Lee, K J; van Leeuwen, J; Lynch, R; Lyne, A G; Ransom, S M; Scholz, P; Siemens, X; Stairs, I H; Stovall, K; Swiggum, J K; Venkataraman, A; Zhu, W W; Aulbert, C; Fehrmann, H

    2014-01-01

    Recent work has exploited pulsar survey data to identify temporally isolated, millisecond-duration radio bursts with large dispersion measures (DMs). These bursts have been interpreted as arising from a population of extragalactic sources, in which case they would provide unprecedented opportunities for probing the intergalactic medium; they may also be linked to new source classes. Until now, however, all so-called fast radio bursts (FRBs) have been detected with the Parkes radio telescope and its 13-beam receiver, casting some concern about the astrophysical nature of these signals. Here we present FRB 121102, the first FRB discovery from a geographic location other than Parkes. FRB 121102 was found in the Galactic anti-center region in the 1.4-GHz Pulsar ALFA survey with the Arecibo Observatory with a DM = 557.4 $\\pm$ 3 pc cm$^{-3}$, pulse width of $3\\; \\pm 0.5$ ms, and no evidence of interstellar scattering. The observed delay of the signal arrival time with frequency agrees precisely with the expectation...

  4. Performance evaluation and optimization of the luminosity detector ALFA

    CERN Document Server

    Jakobsen, Sune; Grafström, P; Joram, C

    2010-01-01

    The startup of the LHC (Large Hadron Collider) has initialized a new era in particle physics. The standard model of particle physics has for the last 40 years with tremendous success described all measurements with phenomenal precision. The experiments at the LHC will test the standard model in a new energy regime. To normalize the measurements and understand the potential discoveries of the LHC experiments it is often crucial to know the interaction rate - the absolute luminosity. The ATLAS (A Toroidal LHC ApparatuS) detector will measure luminosity by numerous methods. But for most of the methods only the relative luminosity is measured with good precision. The absolute scale has to be provided from elsewhere. Therefore ATLAS plans to measure the flux of protons scattered under very small angles as this flux relates directly and with good precision to the absolute luminosity. This will be done by the ALFA (Absolute Luminosity For ATLAS) detector. The detectors will be positioned about 240 m from the interac...

  5. Expresión y sororreactividad de la lipoproteína recombinante de 43-kda de Bartonella bacilliformis

    Directory of Open Access Journals (Sweden)

    Carlos Padilla R

    2006-07-01

    Full Text Available Objetivo: La lipoproteína de 43-kDa de Bartonella bacilliformis fue obtenida en su forma recombinante (rBbLppB y purificada para evaluar su serorreactividad mediante ELISA. Materiales y métodos: Los niveles de anticuerpos IgG e IgM humanos en los sueros de pacientes con Bartonelosis confirmada y sueros de otras enfermedades (salmonelosis, Brucelosis y leptospirosis frente a rBbLppB fueron evaluados por ELISA, se utilizó sueros de personas sanas como controles. Resultados: La sensibilidad y la especificidad del ELISA IgG fueron 70,4% y 90% respectivamente. Asimismo, la sensibilidad y especificidad de ELISA IgM fueron 85,2% y 90% respectivamente. Conclusiones: Estos resultados demuestran que el ELISA usando rBbLppB tiene una buena sensibilidad y especificidad y puede ser considerada como un buen antígeno para el diagnóstico de Bartonelosis causada por B. bacilliformis.

  6. Taliglucerase alfa: an enzyme replacement therapy using plant cell expression technology.

    Science.gov (United States)

    Grabowski, Gregory A; Golembo, Myriam; Shaaltiel, Yoseph

    2014-05-01

    Gaucher disease (GD) is a rare, genetic lysosomal storage disorder caused by functional defects of acid β-glucosidase that results in multiple organ dysfunction. Glycosylation of recombinant acid human β-glucosidase and exposure of terminal mannose residues are critical to the success of enzyme replacement therapy (ERT) for the treatment of visceral and hematologic manifestations in GD. Three commercially available ERT products for treatment of GD type 1 (GD1) include imiglucerase, velaglucerase alfa, and taliglucerase alfa. Imiglucerase and velaglucerase alfa are produced in different mammalian cell systems and require production glycosylation modifications to expose terminal α-mannose residues, which are needed for mannose receptor-mediated uptake by target macrophages. Such modifications add to production costs. Taliglucerase alfa is a plant cell-expressed acid β-glucosidase approved in the United States and other countries for ERT in adults with GD1. A plant-based expression system, using carrot root cell cultures, was developed for production of taliglucerase alfa and does not require additional processing for postproduction glycosidic modifications. Clinical trials have demonstrated that taliglucerase alfa is efficacious, with a well-established safety profile in adult, ERT-naïve patients with symptomatic GD1, and for such patients previously treated with imiglucerase. These included significant improvements in organomegaly and hematologic parameters as early as 6months, and maintenance of achieved therapeutic values in previously treated patients. Ongoing clinical trials will further characterize the long-term efficacy and safety of taliglucerase alfa in more diverse patient populations, and may help to guide clinical decisions for achieving optimal outcomes for patients with GD1.

  7. WTS-2 b: Too close for comfort?

    Directory of Open Access Journals (Sweden)

    Kovács G.

    2013-04-01

    Full Text Available We report the discovery of WTS-2 b, a typical hot Jupiter in an unusually close 1.02-day orbit to a K-dwarf star. This is the second planet to be discovered in the infrared light curves of the WFCAM Transit Survey (WTS and is only one-and-a-half times the separation from its host star at which is would be destroyed by Roche lobe overflow. The predicted remaining lifetime of the planet is just 38 Myrs, assuming a tidal dissipation quality factor of Q'* = 106. The magnitude of Q'* is largely unconstrained by observations, thus WTS-2 b provides a useful calibration point for theories describing how frictional processes within a host star affect the tidal orbital evolution of its companion giant planets. It is expected that stars with large convective envelopes are more efficient at dissipating the orbital energy of the planet, and WTS-2 b provides an observational constraint in the sparsely populated K-dwarf regime. In addition, despite its relatively faint magnitude, the favourable size ratio of the WTS-2 star-planet system and the predicted hot equilibrium temperature of the planet will make it possible to characterise the planet's atmosphere via secondary eclipse measurements using existing ground-based instrumentation.

  8. Effects of MAPP Compatibilization and Acetylation Treatment Followed by Hydrothermal Aging on Polypropylene Alfa Fiber Composites

    Directory of Open Access Journals (Sweden)

    Noura Hamour

    2015-01-01

    Full Text Available This work investigates the effect of hydrothermal aging on the properties of polypropylene/alfa fiber composites. Hydrothermal aging was induced in an environmental testing chamber at 65°C and 75% relative humidity (RH over a 1000 h period. At the beginning (t=0 h, the results showed that Young’s moduli of the untreated alfa fibers and the acetylation-treated fibers increased by 21% and 36%, respectively, compared with the virgin polypropylene (PP. Additionally, Young’s moduli decreased by 7% for the compatibilized composites composed of maleic anhydride grafted polypropylene (MAPP. After 1000 h of aging, Young’s moduli decreased by 36% for untreated alfa fibers and 29% for the acetylation-treated alfa fibers and the compatibilized composites. Significant degradation was observed in the untreated alfa fiber samples. The Fourier transformed infrared (FTIR allows us to distinguish the characteristic absorption bands of the main chemical functions present in the composite material before and after aging. The thermal properties showed that the thermal stability and the degree of crystallinity of the composites decreased after hydrothermal aging; this result was corroborated by the dynamical mechanical analysis (DMA results.

  9. Home infusion program for Fabry disease: experience with agalsidase alfa in Argentina

    Directory of Open Access Journals (Sweden)

    Isaac Kisinovsky

    2013-02-01

    Full Text Available Fabry disease is an X-linked lysosomal storage disorder caused by inherited deficiency of the enzyme α-galactosidase A. Enzyme replacement treatment using agalsidase alfa significantly reduces pain, improves cardiac function and quality of life, and slows renal deterioration. Nevertheless, it is a life-long treatment which requires regular intravenous infusions and entails a great burden for patients. Our objective was to evaluate retrospectively the safety and tolerability of the home infusion of agalsidase alfa in patients with Fabry disease in Argentina. We evaluated all the patients with Fabry disease who received home infusion with agalsidase alfa 0.2 mg/kg between January 2005 and June 2011. The program included 87 patients; 51 males (mean age: 30 years and 36 females (mean age: 34 years. A total of 5229 infusions (mean: 59 per patient; range: 1-150 were administered. A total of 5 adverse reactions were seen in 5 patients (5.7% of patients and 0.9% of the total number of infusions. All were mild in severity and resolved by reducing the rate of infusion and by using antihistaminics. All these 5 patients were positive for IgG antibodies, but none of them presented IgE antibodies and none suffered an anaphylactic shock. In our group 18 patients were switched from agalsidase beta to agalsidase alfa without complications. Home infusion with agalsidase alfa is safe, well tolerated and is associated to high compliance.

  10. Pesquisa de IgA contra o antígeno recombinante HspX de Mycobacterium tuberculosis no diagnóstico de tuberculose pleural

    OpenAIRE

    Limongi,Loanda Carvalho Sant' Ana; Olival,Liliane; Conde, Marcus Barreto; Junqueira-Kipnis, Ana Paula

    2011-01-01

    OBJETIVO: Avaliar a acurácia da dosagem de IgA contra o antígeno recombinante HspX no líquido pleural e no soro de pacientes com derrame pleural para o diagnóstico de tuberculose pleural. MÉTODOS: Estudo transversal de teste diagnóstico. Amostras de líquido pleural e de soro de pacientes com derrame pleural e suspeita de tuberculose pleural foram avaliadas para a determinação da densidade óptica de IgA contra HspX utilizando ELISA indireto. RESULTADOS: Foram avaliadas amostras de líquido pleu...

  11. Estudio en poblaciones seleccionadas de la fiabilidad de nuevos protocolos de detección de consumo de hormonas recombinantes (hgH y EPO)

    OpenAIRE

    Abellán Sánchez, María Rosario

    2006-01-01

    Las hormonas recombinantes eritropoyetina (EPO) y hormona de crecimiento (GH), prácticamente iguales a las endógenas y de corta vida media en circulación, son de difícil detección directa en el control antidopaje. Se determinaron los valores poblacionales de los biomarcadores indirectos EPO, receptor soluble de la transferrina, insulin-like growth factor-I (IGF-I) y procolágeno tipo III péptido (P-III-P), en poblaciones seleccionadas de deportistas, y el efecto del ejercicio y los distintos t...

  12. Dificuldades na identificação laboratorial da talassemia alfa

    OpenAIRE

    Dias-Penna,Karlla Greick Batista; Melo-Reis,Paulo Roberto de; Mesquita, Mauro Meira de; Silva, Jairo Batista da; Bataus,Luiz Artur Mendes

    2010-01-01

    Introdução: Talassemia alfa é uma síndrome associada à redução da síntese de cadeias de globina do tipo alfa. A gravidade das manifestações clínicas está relacionada com a quantidade de globinas produzida e a estabilidade das cadeias beta presentes em excesso. A talassemia alfa mínima resulta da deleção de apenas um dos quatro genes a (-α/αα). Clinicamente apresenta anemia leve com microcitose ou ausência de anemia, sendo o diagnóstico realizado por meio de visualização da hemo...

  13. Design and Manufacture of the Irradiation Complex "Alfa" for Track Membranes Production

    CERN Document Server

    Alenitsky, Yu G; Vylov, T D; Glazov, A A; Danilov, V I; Denisov, Yu N; Dmitrievsky, V P; Dolya, S N; Zaplatin, N L; Ivashkevich, S A; Kadyshevskij, V G; Kalinichenko, V V; Karamysheva, G A; Klimkin, I P; Kochkin, V A; Morozov, N A; Novikov, D L; Smolkov, A V; Tolstoy, N S; Tychkov, Yu I; Utkin, V A; Fedorenko, S B; Chesnov, A F

    2004-01-01

    The film irradiation complex "Alfa" intended for exposing the polymer films used in the track membranes production was designed and manufactured at the Joint Institute for Nuclear Research for "Trackpore Technology" holding company. The complex consists of the isochronous cyclotron with external injection of ions, the extraction system, the beam transport of accelerated ions and the film irradiation chamber. The complex "Alfa" produces polyethylene terephthalate track membranes with less than 25 {\\mu}m thickness and less than 40 cm width. The film irradiation complex "Alfa" started working in August 2002. Argon ions were accelerated to the project energy - 2.4 MeV/nucleon, extracted beam intensity was about 200 nA, extraction efficiency totaled \\sim 50 %.

  14. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  15. What Happened with Spectrometer Magnet 2B

    Energy Technology Data Exchange (ETDEWEB)

    Green, Michael A

    2010-05-27

    The spectrometer solenoid is supposed to be the first magnets installed in MICE [1]-[4]. This report described what happened during the test of the MICE spectrometer solenoid 2B. First, the report describes the temperatures in the magnet, the cooler top plate and the shield during the run where the magnet quenched at 258 A. During this quench, a lead between the bottom of the HTS leads and the diode bank burned out causing the magnet to quench. Second, three methods for measuring the net heat flow into the cold mass are described. Third, there is a discussion of possible resistive heating in the HTS leads between liquid helium temperature and the copper plate, which is at about 50 K. Fourth, there is a discussion of the measured first stage heat loads in the magnet, when there is no current in the magnet. The first stage heat load calculations are based on knowing the first stage temperatures of the three two-stage pulse tube coolers and the single stage GM cooler. Fifth, the estimated heat load to the first stage when the magnet has current in it is discussed. Sixth, there is a comparison of the stage 1 heat loads in magnet 1A [5], magnet 2A [6], and magnet 2B [7]. Finally there is a discussion of recommended changes for improving the spectrometer solenoids so that the coolers can keep them cold.

  16. Baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF)

    NARCIS (Netherlands)

    McMurray, John J. V.; Anand, Inder S.; Diaz, Rafael; Maggioni, Aldo P.; O'Connor, Christopher; Pfeffer, Marc A.; Solomon, Scott D.; Tendera, Michal; van Veldhuisen, Dirk J.; Albizem, Moetaz; Cheng, Sunfa; Scarlata, Debra; Swedberg, Karl; Young, James B.

    2013-01-01

    Aims This report describes the baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) which is testing the hypothesis that anaemia correction with darbepoetin alfa will reduce the composite endpoint of death from any cause or hospital ad

  17. Alternativa terapeutica en la isquemia cerebral empleando la Eritropoyetina humana recombinante (rHu-EPO CIM como neuroprotector.

    Directory of Open Access Journals (Sweden)

    Iliana Sosa Testé

    2005-01-01

    Full Text Available Las enfermedades vasculares constituyen las terceras causas de muerte en Cuba. Su variante isquémica es causa de invalidez y perdida de la calidad de la vida. La búsqueda de agentes neuroprotectores es muy importante sí tenemos en cuenta que nuestra población está envejecida. Muchos son las razones por la que una molécula con propiedades neuroprotectoras en los modelos animales no tenga los resultados en ensayos clínicos en humanos. Este trabajo analiza y discute como mejorar estos aspectos. La Eritropoyetina humana recombinante (rHu EPO, conocido por su papel en la diferenciación del eritrocito, ha mostrado ser neuroprotector durante la isquemia cerebral en los modelos de animales adultos. De esta molécula se exponen los mecanismos de acción, que son las bases de los resultados positivos alcanzaron en las investigaciones preclínicas y los ensayos clínicos, que lo proponen como el neuroprotector ideal. Finalmente se comparan los resultados alcanzados por los autores en las investigaciones con la rHu EPO producida por el Centro Molecular de Inmunología de Cuba (CIM. El efecto de la aplicación de rHu EPO se evidenció por la disminución del edema cerebral, preservación de la conducta exploratoria y la disminución de la incidencia de señales clínicas de infarto cerebral y alteraciones patológicas. El grupo de resultados demostró las diferencias significantes entre los animales controles y tratados con el rHu EPO con los no tratados que sugieren que el rHu EPO debe ser considerado como una alternativa terapéutica contra el infarto cerebral en su fase aguda.

  18. High-Dose Recombinant Interferon Alfa-2B, Ipilimumab, or Pembrolizumab in Treating Patients With Stage III-IV High Risk Melanoma That Has Been Removed by Surgery

    Science.gov (United States)

    2016-10-10

    Metastatic Non-Cutaneous Melanoma; Non-Cutaneous Melanoma; Recurrent Melanoma of the Skin; Recurrent Non-Cutaneous Melanoma; Stage III Mucosal Melanoma of the Head and Neck; Stage IIIA Skin Melanoma; Stage IIIB Skin Melanoma; Stage IIIC Skin Melanoma; Stage IV Skin Melanoma; Stage IVA Mucosal Melanoma of the Head and Neck; Stage IVB Mucosal Melanoma of the Head and Neck; Stage IVC Mucosal Melanoma of the Head and Neck

  19. Agregación de alfa-sinucleína y degeneración Parkinsoniana

    OpenAIRE

    Fernández-Espejo, Emilio

    2013-01-01

    La alfa-sinucleína es la proteína principal de los cuerpos de Lewy, marcador anatomopatológico de la enfermedad de Parkinson. Dicha proteína puede ver alterada su conformación y adquirir capacidad autoagregante, lo que se relaciona con el depósito de agregados proteináceos en las neuronas y podría constituir un factor fisiopatológico importante en dicha enfermedad. Los agregados poseen fibrillas de alfa-sinucleína alterada, y las moléculas se encuentran unidas entre sí por enlaces no...

  20. The ATLAS ALFA and AFP detectors - the experimental challenge of measuring forward protons at the LHC

    CERN Document Server

    Trzebinski, M; The ATLAS collaboration

    2013-01-01

    The Absolute Luminosity For ATLAS (ALFA) and ATLAS Forward Protons (AFP) detectors are introduced. The forward proton trajectories are shown. The similarities and differences between these two detector systems are described. Finally, the physics possible to be done in these forward detectors is discussed. In particular, in case of ALFA the elastic scattering and exclusive di-pion production are described. In case of AFP, the hard diffractive processes like: Single Diffractive Jet, Double Pomeron Exchange Jet, Exclusive Jet and anomalous coupling production are described.

  1. ESTABILIZACIÓN DE HOLO-alfa-LACTOALBÚMINA EN PRESENCIA DE POLIOLES

    Directory of Open Access Journals (Sweden)

    Alberto Albis

    2010-02-01

    Full Text Available En este trabajo se presenta un estudio sistemático sobre el efecto de las soluciones acuosas de eritritol, xilitol, sorbitol e inositol con diferentes concentraciones, sobre la estabilidad térmica de la holo- alfa-lactoalbúmina bovina con pH 6,5 usando espectroscopia UV-VIS. Los resultados obtenidos muestran que los polioles usados estabilizan la holo-alfa-lactoalbúmina en un grado significativamente menor al reportado para otras proteínas. Se sugiere que este menor efecto de estabilización ocurre debido a que esta proteína presenta un estado desnaturalizado parcialmente desdoblado.

  2. VizieR Online Data Catalog: Arecibo Pulsar-ALFA (PALFA) survey. IV. (Lazarus+, 2015)

    Science.gov (United States)

    Lazarus, P.; Brazier, A.; Hessels, J. W. T.; Karako-Argaman, C.; Kaspi, V. M.; Lynch, R.; Madsen, E.; Patel, C.; Ransom, S. M.; Scholz, P.; Swiggum, J.; Zhu, W. W.; Allen, B.; Bogdanov, S.; Camilo, F.; Cardoso, F.; Chatterjee, S.; Cordes, J. M.; Crawford, F.; Deneva, J. S.; Ferdman, R.; Freire, P. C. C.; Jenet, F. A.; Knispel, B.; Lee, K. J.; van Leeuwen, J.; Lorimer, D. R.; Lyne, A. G.; McLaughlin, M. A.; Siemens, X.; Spitler, L. G.; Stairs, I. H.; Stovall, K.; Venkataraman, A.

    2016-02-01

    The Arecibo Pulsar-ALFA (PALFA) survey observations have been restricted to the two regions of the Galactic plane (|b|<5°) visible from the Arecibo observatory, the inner Galaxy (32°<~l<~77°), and the outer Galaxy (168°<~l<~214°). Integration times are 268s and 180s for inner and outer Galaxy observations, respectively. Observations conducted with the 7-beam Arecibo L-band Feed Array (ALFA) receiver of the Arecibo Observatory William E. Gordon 305m Telescope have a bandwidth of 322MHz centered at 1375MHz. PALFA survey data have been recorded with the Mock spectrometers since 2009. (2 data files).

  3. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  4. DESARROLLO DE UN POXVIRUS RECOMBINANTE QUE EXPRESA LA GLICOPROTEÍNA D DEL HERPESVIRUS BOVINO-1 Development of a Recombinant Poxvirus Expressing Bovine Herpesvirus-1 Glycoprotein D

    Directory of Open Access Journals (Sweden)

    JULIÁN RUIZ SÁENZ

    2012-12-01

    Full Text Available El herpesvirus bovino-1 (BHV-1 es un virus de genoma DNA perteneciente a la familia Herpesviridae, el cual afecta al bovino en el que provoca un amplio espectro de manifestaciones clínicas y pérdidas económicas. El principal componente inmunogénico de su envoltura es la glicoproteína D (gD, la cual ha sido caracterizada y utilizada como inmunógeno en distintos sistemas de expresión. El objetivo de este trabajo fue generar un poxvirus recombinante (Raccoonpox [RCN] que expresara una versión truncada de la gD del BHV-1 para ser usado como inmunógeno. Para ello, se amplificó el gen que codifica para la versión truncada de la gD, la cual se clonó en el plásmido de transferencia pTK/ IRES/tpa que posee sitios de homología a la timidinakinasa del poxvirus, un sitio interno de entrada al ribosoma (IRES y una señal secretoria (tPA, generando el constructo pTK/gD/IRES/tpa. Para generar el RCN recombinante, se tomaron células BSC-1, se infectaron con una cepa Silvestre del RCN (CDC/V71-I-85A a un índice de multiplicidad de infección de 0,05 y se transfectaron con el constructo pTK/gD/IRES/tpa; generándose diferentes poblaciones virales con y sin el gen de interés. Para seleccionar los virus recombinantes que expresaban el gen de interés, se realizó una selección de recombinantes negativos para timidina kinasa y positivos para la gD por tres rondas de purificación de placas en monocapas de células RAT-2 las cuales son mutantes para timidina kinasa y en presencia de bromodeoxiuridina. Los virus recombinantes se confirmaron por PCR y secuenciación de nucleótidos y se denominaron RCN-gD.Bovine Herpesvirus-1 is a DNA virus belonging to the family Herpesviridae, which affects cattle, causing a wide spectrum of clinical manifestations and economic losses. The main immunogenic component is its envelope glycoprotein D (gD, which has been characterized and used as immunogen in different expression systems. The aim of this work was to

  5. The Synchrony and Diachrony of Bosnian-Croatian-Serbian Adjectival Long-Form Allomorphy (ALFA)

    Science.gov (United States)

    Pennington, James Joshua

    2010-01-01

    In Bosnian-Croatian-Serbian (BCS), the gentive (G) and dative/locative (DL) cases exhibit adjectival long-form allomorphy (ALFA). The genitive -"og" -"oga" and the DL -"om" -"ome" -"omu" stand in free variation, inasmuch as when one form is substituted for another the truth value of an utterance…

  6. A Trial of Darbepoetin Alfa in Type 2 Diabetes and Chronic Kidney Disease

    NARCIS (Netherlands)

    Pfeffer, Marc A.; Burdmann, Emmanuel A.; Chen, Chao-Yin; Cooper, Mark E.; de Zeeuw, Dick; Eckardt, Kai-Uwe; Feyzi, Jan M.; Ivanovich, Peter; Kewalramani, Reshma; Levey, Andrew S.; Lewis, Eldrin F.; McGill, Janet B.; McMurray, John J. V.; Parfrey, Patrick; Parving, Hans-Henrik; Remuzzi, Giuseppe; Singh, Ajay K.; Solomon, Scott D.; Toto, Robert

    2009-01-01

    BACKGROUND Anemia is associated with an increased risk of cardiovascular and renal events among patients with type 2 diabetes and chronic kidney disease. Although darbepoetin alfa can effectively increase hemoglobin levels, its effect on clinical outcomes in these patients has not been adequately te

  7. A trial of darbepoetin alfa in type 2 diabetes and chronic kidney disease

    DEFF Research Database (Denmark)

    Pfeffer, Marc A; Burdmann, Emmanuel A; Chen, Chao-Yin

    2009-01-01

    BACKGROUND: Anemia is associated with an increased risk of cardiovascular and renal events among patients with type 2 diabetes and chronic kidney disease. Although darbepoetin alfa can effectively increase hemoglobin levels, its effect on clinical outcomes in these patients has not been adequatel...

  8. Artur Gas, editor de Josep Pla: breu història d'Ediciones Alfa

    OpenAIRE

    Pla, Xavier

    1997-01-01

    Repàs de la trajectòria professional com a editor, començant com a editor de caire socialista i acabant col·laborant amb la dictadura de Primo de Rivera. Es fa especial menció al seu paper com a editor de Josep Pla i a la seva editorial, Ediciones Alfa

  9. High antibody titer in an adult with Pompe disease affects treatment with alglucosidase alfa.

    Science.gov (United States)

    de Vries, Juna M; van der Beek, Nadine A M E; Kroos, Marian A; Ozkan, Lale; van Doorn, Pieter A; Richards, Susan M; Sung, Crystal C C; Brugma, Jan-Dietert C; Zandbergen, Adrienne A M; van der Ploeg, Ans T; Reuser, Arnold J J

    2010-12-01

    Clinical trials have demonstrated beneficial effects of enzyme replacement therapy (ERT) with alglucosidase alfa in infants, children and adults with Pompe disease. Recent studies have shown that high antibody titers can occur in patients receiving ERT and counteract the effect of treatment. This particularly occurs in those patients with classic-infantile Pompe disease that do not produce any endogenous acid α-glucosidase (CRIM-negative). It is still unclear to what extent antibody formation affects the outcome of ERT in adults with residual enzyme activity. We present the case of a patient with adult-onset Pompe disease. He was diagnosed at the age of 39years by enzymatic testing (10.7% residual activity in fibroblasts) and DNA analysis (genotype: c.-32-13T>G/p.Trp516X). Infusion-associated reactions occurred during ERT and the patient's disease progressed. Concurrently, the antibody titer rose to a similarly high level as reported for some CRIM-negative patients with classic-infantile Pompe disease. Using newly developed immunologic-assays we could calculate that approximately 40% of the administered alglucosidase alfa was captured by circulating antibodies. Further, we could demonstrate that uptake of alglucosidase alfa by cultured fibroblasts was inhibited by admixture of the patient's serum. This case demonstrates that also patients with an appreciable amount of properly folded and catalytically active endogenous acid α-glucosidase can develop antibodies against alglucosidase alfa that affect the response to ERT.

  10. Diagnóstico molecular da talassemia ALFA+ (DELEÇÃO -3.7) em indivíduos com microcitose e/ou hipocromia

    OpenAIRE

    Bezerra, Christiane Medeiros

    2009-01-01

    A talassemia alfa, uma das doenças monogênicas mais comuns no mundo, resulta de um desequilíbrio na síntese das cadeias alfa da hemoglobina devido, principalmente, à deleção de um ou ambos os genes da globina alfa, sendo a deleção - a mais freqüente. A talassemia alfa, juntamente com a deficiência de ferro e a talassemia beta, representa uma importante causa de microcitose e hipocromia. Com o objetivo de diagnosticar e verificar a prevalência da talassemia alfa (-3.7) em indivíduos co...

  11. Drotrecogin alfa (activated in severe sepsis: a systematic review and new cost-effectiveness analysis

    Directory of Open Access Journals (Sweden)

    Brophy James M

    2007-06-01

    Full Text Available Abstract Background Activated drotrecogin alfa (human activated protein C, rhAPC, is produced by recombinant DNA technology, and purports to improve clinical outcomes by counteracting the inflammatory and thrombotic consequences of severe sepsis. Controversy exists around the clinical benefits of this drug and an updated economic study that considers this variability is needed. Methods A systematic literature review was performed using Medline, Embase and the International Network of Agencies for Health Technology Assessment (INAHTA databases to determine efficacy, safety and previous economic studies. Our economic model was populated with systematic estimates of these parameters and with population life tables for longer term survival information. Monte Carlo simulations were used to estimate the incremental cost-effectiveness ratios (ICERs and variance for the decision analytic models. Results Two randomized clinical trials (RCTS of drotrecogin alfa in adults with severe sepsis and 8 previous economic studies were identified. Although associated with statistical heterogeneity, a pooled analysis of the RCTs did not show a statistically significant 28-day mortality benefit for drotrecogin alfa compared to placebo either for all patients (RR: 0.93, 95% CI: 0.69, 1.26 or those at highest risk as measured by APACHE II ≥ 25 (RR: 0.90, 95% CI: 0.54, 1.49. Our economic analysis based on the totality of the available clinical evidence suggests that the cost-effectiveness of drotrecogin alfa is uncertain ( Conclusion The evidence supporting the clinical and economic attractiveness of drotrecogin alfa is not conclusive and further research appears to be indicated.

  12. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  13. 7 CFR 301.80-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.80-2b Section 301.80-2b....80-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines. (a) The following articles are exempt from the certification and permit...

  14. 7 CFR 301.85-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles...

  15. Genetics Home Reference: CHMP2B-related frontotemporal dementia

    Science.gov (United States)

    ... Conditions CHMP2B-related frontotemporal dementia CHMP2B-related frontotemporal dementia Enable Javascript to view the expand/collapse boxes. ... Open All Close All Description CHMP2B -related frontotemporal dementia is a progressive brain disorder that affects personality, ...

  16. Papel del factor de crecimiento epidérmico recombinante humano “Heberprot-P” en un paciente con Lepra Multibacilar

    Directory of Open Access Journals (Sweden)

    Wilver Velázquez Chacón

    2014-08-01

    Full Text Available Se presenta el caso de un paciente masculino de 59 años de edad, tratado por vías convencionales a causa de lesiones ulcerativas de miembros inferiores, de más de siete años de evolución, sin diagnóstico y tratamiento. La evolución ulterior permitió reconocer la aparición subsecuente de lepra multibacilar. La basiloscopía fue positiva, indicando el diagnóstico de las lesiones ulcerativas, que se trataron con el uso de factor de crecimiento epidérmico recombinante humano en su formulación Heberprot-P, permitiendo la granulación de las lesiones en toda su extensión en un plazo corto, de 16 días, sin que se presentaran eventos adversos graves. Su resultado final fue satisfactorio

  17. Stroke in patients with type 2 diabetes mellitus, chronic kidney disease, and anemia treated with Darbepoetin Alfa

    DEFF Research Database (Denmark)

    Skali, Hicham; Parving, Hans-Henrik; Parfrey, Patrick S

    2011-01-01

    More strokes were observed in the Trial to Reduce Cardiovascular Events With Aranesp Therapy (TREAT) among patients assigned to darbepoetin alfa. We sought to identify baseline characteristics and postrandomization factors that might explain this association....

  18. Obtención de anticuerpos monoclonales de ratón contra proteasa de cisteína 5 recombinante de Entamoeba histolytica

    Directory of Open Access Journals (Sweden)

    Juanita Trejos S.

    2012-08-01

    Full Text Available Objetivo. Obtener anticuerpos monoclonales de ratón contra la proteasas de cisteína 5 (EhCP5 de Entamoeba histolytica. Materiales y métodos. Se inmunizaron ratones BALB/c por vía intraperitoneal con adyuvante de Freund completo e incompleto con la proteína recombinante EhCP5 obtenida a partir del cultivo de E.coli DH5α trasfectada con el vector recombinante pJC45 que expresa dicha proteína. Se seleccionó el animal con mejor respuesta de anticuerpos. Al cual se le extrajo su bazo como fuente de linfocitos B, los cuales se fusionaron utilizando PEG con células de mieloma de ratón SP2-0/Ag14. Se procedió a selección de los hibridomas y a la evaluación de los sobrenadantes de las colonias que crecieron a los 7 días mediante ELISA. Los hibridomas con valores más altos de anticuerpos específicos contra la proteína EhCP5r se seleccionaron, y los clones obtenidos por diluciones limitantes fueron expandidos. Resultados. A partir de un clon secretor estable se purifico el anticuerpo monoclonal anti EhCP5r del isotipo IgG1 por cromatografía de afinidad con proteína G. Los clones fueron expandidos in vivo e in vitro. Con el anticuerpo purificado se diseñaron tres sistemas de captura para evaluar la aplicabilidad del anticuerpo monoclonal anti EhCP5r como método inmunodiagnóstico. Conclusiones. Se logro la producción de un anticuerpo monoclonal específico contra EhCP5r que permite diferenciar Entamoeba histolytica de Entamoeba dispar.

  19. Darbepoietin-alfa has comparable erythropoietic stimulatory effects to recombinant erythropoietin whilst preserving the bone marrow microenvironment.

    Science.gov (United States)

    Dewamitta, Sita R; Russell, Megan R; Nandurkar, Harshal; Walkley, Carl R

    2013-05-01

    Erythropoiesis stimulating agents are widely used for the treatment of anemia. Recently, we reported erythroid expansion with impaired B lymphopoiesis and loss of trabecular bone in C57BL/6 mice following ten days of treatment with low-dose short acting recombinant human erythropoietin. We have assessed erythropoietin against longer-acting darbepoietin-alfa at a comparable erythroid stimulatory dosage regime. Darbepoietin-alfa and erythropoietin induced similar in vivo erythropoietic expansion. Both agents induced an expansion of the colony-forming unit-erythroid populations. However, unlike erythropoietin, darbepoietin-alfa did not impair bone marrow B lymphopoiesis. Strikingly the bone loss observed with erythropoietin was not apparent following darbepoietin-alfa treatment. This analysis demonstrates that whilst darbepoietin-alfa has similar in vivo erythropoietic potency to erythropoietin, it preserves the bone marrow microenvironment. Thus erythropoietin and darbepoietin-alfa manifest different action showing that erythropoiesis stimulating agents have differential non-erythroid effects dependent on their duration of action.

  20. Estado actual de la vacuna recombinante contra el virus del papiloma humano State of the art on human papillomavirus vaccine

    Directory of Open Access Journals (Sweden)

    Wendy Chan Acón

    2008-12-01

    Full Text Available La infección por el virus del papiloma humano (VPH es una enfermedad de transmisión sexual común. Alrededor del mundo millones de personas están infectadas y el resto de la población en general tiene un riesgo de contraer la infección superior al 50%. El virus se asocia aproximadamente a un 100% de los casos de cáncer cervical; a un 100% de las neoplasias cervicales intraepiteliales grados 1, 2, 3; a un 40% de los casos de cáncer de vulva, vagina y pene, 100% de las verrugas genitales; a un 100% de las papilomatosis respiratorias recurrentes; a un 90% del cáncer anal y a un 12% del cáncer de cabeza y cuello, predominantemente en orofaringe y amígdala. Actualmente, el uso de dos vacunas está aprobado en diversos países: Gardasil® y Cervarix®. Ambas están compuestas por proteínas L1 de VPH, en forma de partículas no infecciosas similares al virus (VLPs producidas por tecnología de ADN recombinante, adsorbidas en adyuvantes que contienen aluminio. La eficacia hallada en diversos estudios en sujetos no expuestos previamente al virus se encuentran en el rango del 98.8% al 100.0% para la prevención de neoplasias cervicales, vulvares y vaginales intraepiteliales, grados 2 y 3, relacionados con el VPH-16/18, además de los adenocarcinomas in situ y verrugas genitales causadas por VPH- 16/18/6/11 en el caso de Gardasil® y una eficacia del 100% en el caso de Cervarix® para la prevención de neoplasias cervicales grado 2 y 3 relacionados con el VPH-16/18. La eficacia de ambas se mantiene alrededor de los 5 años. Hasta el momento no se le ha atribuido a la vacuna ningún efecto terapéutico, solo se administra con fines profilácticos, sin embargo, esta no debe ser considerada como un sustituto de las pruebas de tamizaje para la prevención del cáncer cervical.Genital human papillomavirus (HPV is one of the most common sexually transmitted infections worldwide. Millions of persons are now infected and the lifetime risk of HPV

  1. PTK2b function during fertilization of the mouse oocyte

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Jinping [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); McGinnis, Lynda K. [Department of Molecular and Integrative Physiology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Carlton, Carol [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Beggs, Hilary E. [Department of Ophthalmology, University of California, San Francisco, CA (United States); Kinsey, William H., E-mail: wkinsey@kumc.edu [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States)

    2014-08-01

    Highlights: • PTK2b is expressed in oocytes and is activated following fertilization. • PTK2b suppression in oocytes prevents fertilization, but not parthenogenetic activation. • PTK2b suppression prevents the oocyte from fusing with or incorporating bound sperm. • PTK2b suppressed oocytes that fail to fertilize do not exhibit calcium oscillations. - Abstract: Fertilization triggers rapid changes in intracellular free calcium that serve to activate multiple signaling events critical to the initiation of successful development. Among the pathways downstream of the fertilization-induced calcium transient is the calcium-calmodulin dependent protein tyrosine kinase PTK2b or PYK2 kinase. PTK2b plays an important role in fertilization of the zebrafish oocyte and the objective of the present study was to establish whether PTK2b also functions in mammalian fertilization. PTK2b was activated during the first few hours after fertilization of the mouse oocyte during the period when anaphase resumption was underway and prior to the pronuclear stage. Suppression of PTK2b kinase activity in oocytes blocked sperm incorporation and egg activation although sperm-oocyte binding was not affected. Oocytes that failed to incorporate sperm after inhibitor treatment showed no evidence of a calcium transient and no evidence of anaphase resumption suggesting that egg activation did not occur. The results indicate that PTK2b functions during the sperm-egg fusion process or during the physical incorporation of sperm into the egg cytoplasm and is therefore critical for successful development.

  2. Development of a detector (ALFA) to measure the absolute LHC luminosity at ATLAS

    CERN Document Server

    Mapelli, A; Ask, S; Barrillon, P; Blanchot, G; Blin, S; Braem, André; Cheiklali, C; de La Taille, C; Di Girolamo, B; Efthymiopoulos, I; Faustino, J; Fournier, D; Franz, S; Grafström, P; Gurriana, L; Haguenauer, M; Hedberg, V; Heller, M; Hoffmann, S; Iwanski, W; Joram, C; Kocnar, A; Lavigne, B; Lundberg, B; Maio, A; Maneira, M J P; Marques, C; Mjörnmark, U; Conde-Muíño, P; Puzo, P; Rijssenbeeck, M; Santos, J P; Saraiva, J G; Seguin-Moreau, N; Soares, S; Stenzel, H; Thioye, M; Valladolid-Gallego, E; Vorobel, V; 10th ICATPP Conference on Astroparticle, Particle, Space Physics, Detectors and Medical Physics Applications

    2008-01-01

    The ATLAS collaboration plans to determine the absolute luminosity of the CERN LHC at Interaction Point 1 by measuring the trajectory of protons elastically scattered at very small angles ($\\mu rad$). A scintillating fibre tracker system called ALFA (Absolute Luminosity For ATLAS) is proposed for this measurement. Detector modules will be placed above and below the LHC beam axis in roman pot units at a distance of 240 m on each side of the ATLAS interaction point. They allow the detectors to approach the beam axis to millimeter distance. Overlap detectors also based on the scintillating fibre technology, will measure the precise relative position of the two detector modules. Results obtained during beam tests at DESY and at CERN validate the detectors design and demonstrate the achievable resolution. We also report about radiation hardness studies of the scintillating fibres to estimate the lifetime of the ALFA system at different operating conditions of the LHC.

  3. Deficiência de alfa-1 antitripsina: diagnóstico e tratamento

    OpenAIRE

    2008-01-01

    A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que de...

  4. Haplotypes frequencies of CYP2B6 in Malaysia

    Directory of Open Access Journals (Sweden)

    N Musa

    2012-01-01

    Full Text Available Background: Drugs with complex pharmacology are used in the management of drug use disorder (DUD and HIV/AIDS in Malaysia and in parts of South-East Asia. Their multiethnic populations suggest complexity due to the genetic polymorphism, such as CYP2B6 that metabolizes methadone and anti-retroviral. Aims: Our aim was to explore the genetic polymorphism of CYP2B6 among Malays, Chinese, Indians, and opiate-dependent individuals in Malaysia. Settings and Design: The study utilized DNA from our previous studies on CYPs and new recruitments from opiate-dependent individuals. Materials and Methods: For the new recruitment, after obtaining consent and baseline demography, 5 ml blood was obtained from patients attending methadone maintenance therapy (MMT Clinics. Genomic DNA was extracted using standard methods. 10 nucleotide changes associated with CYP2B6FNx0110, CYP2B6FNx012, CYP2B6FNx0117, CYP2B6FNx0111, CYP2B6FNx018, CYP2B6FNx0114, CYP2B6FNx019, CYP2B6FNx014, CYP2B6FNx016, CYP2B6FNx0127, and CYP2B6FNx0120 were determined using multiplex nested allele-specific PCR. Statistical Analysis: Descriptive statistics were used to summarize demographic data. Differences in allele frequencies between populations were tested using Chi-squared test and were corrected using the Bonferroni test. Results: CYP2B6 polymorphism in Malaysia is variable with trends that suggest an ethnic difference. Reduced activity CYP2B6FNx016 occurred in 13% to 26% among Malays, Chinese, Indians and opiate-dependent individuals. Another ′reduced activity′, CYP2B6FNx012 allele, was found at much lower percentages in the groups. Conclusions: The relative commonness of reduced-activity CYP2B6 alleles in our study called for attention in terms of dosage requirements for MMT and ARV in Malaysia. It also implored follow-up association studies to determine its relevance and consequences in personalized medicine for drug use disorder and HIV/AIDS.

  5. The Arecibo Legacy Fast ALFA Survey: II. Results of Precursor Observations

    CERN Document Server

    Giovanelli, R; Kent, B R; Perillat, P; Catinella, B; Hoffman, G L; Momjian, E; Rosenberg, J L; Saintonge, A; Spekkens, K; Stierwalt, S; Brosch, N; Masters, K L; Springob, C M; Karachentsev, I D; Karachentseva, V E; Koopmann, R A; Müller, E; Van Driel, W; Van Zee, L; Giovanelli, Riccardo; Haynes, Martha P.; Kent, Brian R.; Perillat, Philip; Catinella, Barbara; Momjian, Emmanuel; Rosenberg, Jessica L.; Saintonge, Amelie; Spekkens, Kristine; Stierwalt, Sabrina; Brosch, Noah; Masters, Karen L.; Springob, Christopher M.; Karachentsev, Igor D.; Karachentseva, Valentina E.; Koopmann, Rebecca A.; Muller, Erik; Driel, Wim van; Zee, Liese van

    2005-01-01

    In preparation for the full Arecibo Legacy Fast ALFA extragalactic HI survey, precursor observations were carried out in Aug--Sep 2004 with the 7-beam Arecibo L-band feed array (ALFA) receiver system and the WAPP spectral processors. While these observations were geared mainly at testing and debugging survey strategy, hardware and software, approximately 36 hours of telescope time yielded science--quality data. From those observations, an initial list of 730 tentative detections of varying degree of reliability was extracted. Ninety--eight high signal-to-noise candidates were deemed to be bona fide HI line detections. To test our ability to discriminate cosmic signals from RFI and noise, 165 candidates ranging in reliability likelihood were re--observed with the single beam L--band wide system at Arecibo in Jan--Feb 2005. Of those, 41% were confirmed as real. We present the results of both the ALFA and single beam observations for the sample of 166 confirmed HI sources, as well as our assessment of their opti...

  6. Preparation And Properties Of Bionanocomposite Films Reinforced With Nanocellulose Isolated From Moroccan Alfa Fibres

    Directory of Open Access Journals (Sweden)

    Youssef Benyoussif

    2015-09-01

    Full Text Available Nanocellulose (NC were extracted from the Moroccan Alfa plant (Stipa tenacissima L. and characterised. These Alfa cellulosic nanoparticles were used as reinforcing phase to prepare bionanocomposite films using carboxymethyl cellulose as matrix. These films were obtained by the casting/evaporation method. The crystallinity of NC was analysed by X-ray diffraction, the dimension of NC by atomic force microscopy, molecular interactions due to incorporation of NC in carboxymethyl cellulose (CMC matrix were supported by Fourier transforms infrared (FTIR spectroscopy. The properties of the ensuing bionanocomposite films were investigated using tensile tests, water vapour permeability (WVP study and thermogravimetric analysis. With the progress of purification treatment of cellulose, the crystallinity is improved compared to the untreated fibres; this can be explained by the disappearance of the amorphous areas in cellulose chain of the plant. Consequently, the tensile modulus and tensile strength of CMC film increased by 60 and 47%, respectively, in the bionanocomposite films with 10 wt% of NC, and decrease by 8.6% for WVP with the same content of NC. The NC obtained from the Moroccan Alfa fibres can be used as a reinforcing agent for the preparation of bionanocomposites, and they have a high potential for the development of completely biodegradable food packaging materials.

  7. Analysis list: GTF2B [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available GTF2B Blood,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GT...F2B.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GTF2B.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/hg19/target/GTF2B.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/GTF2B.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/GTF2B.Uterus.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Uterus.gml ...

  8. Estudo da toxicidade de proteínas (Cry) recombinantes de Bacillus thuringiensis, utilizando o sistema de expressão baseado em baculovírus e células de inseto

    OpenAIRE

    Aguiar, Raimundo Wagner de Souza

    2007-01-01

    Os genes cry1Ca, cry2Ab e cry10Aa de diferentes estirpes brasileiras de Bacillus thuringiensis foram amplificados por PCR, clonados em um vetor de clonagem e seqüenciados. As análises das seqüências mostraram alta identidade com outros genes cry já descritos. Os genes foram removidos dos vetores de clonagem e introduzidos em um plasmídeo vetor de transferência (pSynXIVVI+X3) para construção de baculovírus recombinantes por recombinação homóloga. Os vírus recombinantes foram purificados por di...

  9. Main: 1I2B [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I2B シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Udp-Sulfoquinovose Syntha...AAM47379.1; -.|PIR; T05311; T05311.|PDB; 1I24; X-ray; A=74-477.|PDB; 1I2B; X-ray; A=74-477.|PDB; 1I2C; X-ray...CVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1I2B.jpg ...

  10. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  11. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I;

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient. ...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  12. RAZVOJ B2B PORTALA ZA POTREBE ELEKTRONSKEGA POSLOVANJA

    OpenAIRE

    Slanič, Matej

    2011-01-01

    V diplomski nalogi opredelimo vlogo B2B portalov in pomen elektronskega poslovanja. B2B portale smo razvrstili glede na različne kriterije in predstavili različne modele trgovanja na njih. Velik del pozornosti smo posvetili tudi strateškemu načrtovanju B2B poslovanja in vključevanju podjetij na B2B portale, dotaknili pa smo se tudi vizije elektronskega poslovanja. Osrednji del naloge obsega predstavitev gradnje specifičnega portala Bbuines.com ter z njo povezane oblikovne in tehnološke rešitv...

  13. Scientific core hole Valles caldera No. 2b (VC-2b), New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Garner, J.N.; Hulen, J.B.; Lysne, P.; Jacobson, R.; Goff, F.; Nielson, D.L.; Pisto, L.; Criswell, C.W.; Gribble, R. (Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Sandia National Labs., Albuquerque, NM (USA); Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Tonto Drilling Services, Inc., Salt Lake City, UT (USA); Los Alamo

    1989-01-01

    Research core hole was continuously cored to 1.762 km on the western flank of the caldera's resurgent dome in 1988. Bottom hole temperature is about 295{degree}C within Precambrian (1.5 Ga) quartz monzonite, deep within the liquid-dominated portions of the Sulphur Springs hydrothermal system. VC-2b may be the deepest, hottest, continuously cored hole in North America. Core recovery was 99.2%. The only major drilling problems encountered were when temperatures at the bit exceeded 225{degree}C below depths of about 1000 m. The result of these conditions was loss of viscosity and/or lubricity in the mud, apparently caused by breakdown of the high temperature polymers. Lithologies in caldera-fill indicate the drill site may be proximal to ignimbrite vents and that an intracaldera lake with temperatures approaching boiling formed soon after the caldera itself. Structural correlations between VC-2b and the 528-m-deep companion hole VC-2a indicate the earlier Toledo caldera (1.45 Ma; Otowi Member tuffs) and even older Lower Tuffs caldera experienced no structural resurgence similar to the 1.12 million year old Valles caldera. The hydrothermal system penetrated by these bores, consists of a shallow vapor-rich cap, which has evolved from an earlier 200{degree}C liquid-dominated system, overlying stacked, liquid-dominated zones up to about 300{degree}C. Geochemistry of mud returns collected during drilling suggests chloride-rich geothermal fluids were entering the bore and mixing with the drilling fluids in the fractured lower Paleozoic and Precambrian sections. 23 refs., 5 figs., 1 tab.

  14. Genetic and bibliographic information: HTR2B [GenLibi

    Lifescience Database Archive (English)

    Full Text Available HTR2B 5-hydroxytryptamine (serotonin) receptor 2B human alcoholism (MeSH) Disorders... of Environmental Origin (C21) > Substance-Related Disorders (C21.739) > Alcohol-Related Disorders (C21.739.100) > Alcoholism (C21.739.100.250) 01A0634580 ...

  15. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  16. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient....... These mutations lead to C-terminal truncations of the CHMP2B protein and we will review recent advances in our understanding of the molecular effects of these mutant truncated proteins on vesicular fusion events within the endosome-lysosome and autophagy degradation pathways. We will also review the clinical...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  17. Diversidade alfa e beta no cerrado sensu strictu da Chapada Pratinha, Brasil Alfa and Beta diversity in the cerrado sensu stricto

    Directory of Open Access Journals (Sweden)

    Maria Cristina Felfili

    2001-08-01

    Full Text Available O bioma cerrado possui uma das mais ricas floras dentre as savanas mundiais com mais de 6000 espécies, abrange uma vasta extensão territorial, contém as três maiores bacias hidrográficas sul americanas, e se destaca pela elevada biodiversidade. O objetivo deste trabalho, que faz parte do Projeto Biogeografia do Bioma Cerrado, foi analisar as diversidades alfa e beta em comunidades de cerrado sensu stricto. Foram amostrados o Parque Nacional de Brasília, a Estação Ecológica de Águas Emendadas, a Area de Proteção Ambiental (APA Gama-Cabeça de Veado, Silvânia-GO, Paracatu-MG e Patrocínio-MG. A amostragem foi aleatória com 10 parcelas de 20x50m em cada área de estudo. Foram incluídas plantas lenhosas, exceto lianas, que tivessem no mínimo 5cm de diâmetro. Foi calculada a diversidade alfa pelo teste de Shannon & Wienner e o de Simpson. A diversidade beta foi calculada pelo índice de Whittaker que mede a mudança ou taxa de substituição na composição de espécies de um local para outro. Foi efetuada a curva espécie-área para as 60 parcelas amostradas e efetuada a classificação por TWINSPAN. O cerrado sensu stricto da Chapada Pratinha pode ser diferenciado em duas zonas fitogeográficas: Distrito Federal-Silvânia e Paracatu-Patrocínio. Estas coincidem com um zoneamento por sistemas de terra que classifica a primeira zona como terras altas em contraposição à segunda.The cerrado flora is one of the richest among the world's savannas with more than 6000 species. The cerrado covers a large territory, contains the three most important hydrographycal basins in South America and a high diversity. The objective of this work, that is part of the project Biogeography of the Cerrado Biome, was to analyse alfa and beta diversity in the cerrado sensu stricto. The sampled places were: Brasília National Park -- DF, Águas Emendadas Ecological Station -- DF, Environmentally protected Area of Gama-Cabeça de Veado -- DF, Silv

  18. Incorporação do hormônio do crescimento humano recombinante (rhGH em matriz de polímero biodegradável

    Directory of Open Access Journals (Sweden)

    Ricardo Fernandes Garcia

    Full Text Available ResumoObjetivoIncorporar o hormônio de crescimento recombinante humano em um polímero biodegradável (PLGA.Material e métodoAs matrizes foram confeccionadas através da técnica de evaporação de solventes. Foi feita uma mistura do polímero (poli ácido glicólico lático e do hormônio do crescimento humano recombinante (Saizen® Merck Serono S.A. Aubonne, Suíça. Essa mistura foi vertida em moldes de silicone circulares de 1 cm de diâmetro e aproximadamente 2 mm de espessura, e levada para secagem em uma câmara de evaporação de solvente por 48 horas. Após esse período, as matrizes foram imersas em PBS e passaram por um banho termostatizado (ensaio de degradação hidrolítica, in vitro, à temperatura de 37°C. As amostras foram retiradas do banho no intervalo de 1, 2, 3, 4, 7, 10 e 14 dias. Foram aferidas a perda de massa, a variação do pH e a concentração do hormônio liberado em função do tempo.ResultadoA concentração do hormônio liberado em função do tempo foi aumentando até o terceiro dia. No quarto dia, houve uma queda e, no sétimo, ocorreu um aumento do hormônio liberado, estendendo-se até o décimo dia; no 14° dia, houve queda novamente. O pH teve uma queda brusca de 7,4 para 3,2 no primeiro dia, mantendo uma pequena queda até o 14° dia. A perda de massa foi gradual em relação ao tempo, como já era esperado.ConclusãoO PLGA é um bom biomaterial para confecção de matrizes com hormônio do crescimento. Revelou-se possível incorporar o rhGH nessa matriz, de modo a, então, desenvolver-se um substituto ósseo.

  19. Somatotropina bovina recombinante (rBST sobre o desempenho e a digestibilidade aparente de novilhas (½ Nelore x ½ Red Angus em confinamento

    Directory of Open Access Journals (Sweden)

    Nascimento Willian Gonçalves do

    2003-01-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da somatotropina bovina recombinante (rBST - análogo do BST, obtido comercialmente pela técnica do DNA recombinante, sobre ganho médio diário (GMD, ingestão de matéria seca (IMS, matéria orgânica (IMO, energia metabolizável (IEM e fibra em detergente neutro (IFDN, ingestão de matéria seca em relação ao peso vivo (IMS/PV, conversão alimentar (CA, rendimento de carcaça (RC e digestibilidade aparente da matéria seca (DAMS, matéria orgânica (DAMO, proteína bruta (DAPB, energia bruta (DAEB e fibra em detergente neutro (DAFDN. Foram utilizadas 24 novilhas mestiças (½ Nelore x ½ Red Angus, com aproximadamente 18 meses de idade e peso médio 255 kg. Os animais foram alimentados com uma dieta contendo silagem de milho, como volumoso, e polpa de citrus e farelo de soja, como concentrado, durante 84 dias. Essa dieta foi utilizada para os três tratamentos, que se diferenciaram pela aplicação de 250 mg de rBST, por via subcutânea, na fossa ísqueo-retal, onde: tratamento 1 controle (aplicação de dois mL de solução salina; 2 dose única e 3 uma dose a cada 14 dias. Os animais foram distribuídos em delineamento inteiramente casualizado, com três tratamentos e oito repetições. O GMD foi determinado a cada 14 dias. A ingestão de alimentos e a conversão da MS foram determinadas ao final do experimento. A digestibilidade aparente (DA foi determinada durante um período de sete dias com uso de indicador interno. Não houve diferença entre animais tratados ou não com rBST sobre o GMD, IMS, IPB, IEM, IMO e IFDN, CAMS e RC. No entanto, a DA da MS, MO, PB, EB e FND foi superior para as novilhas que receberam rBST a cada 14 dias.

  20. B2B virksomheders brug af sociale medier

    OpenAIRE

    Persdatter Gotfredsen, Karoline

    2016-01-01

    Purpose: The aim of this master thesis is to explore how B2B firms perceive their own usage of social media to establish and strengthen successful relational exchanges. Approach: In-depth interviews were carried out with three key informants responsible for social media marketing at large B2B firms. The findings from the three interviews were then analysed case-by-case and finally a cross case analysis was conducted. Findings: In relation to the market B2B firms mainly see social media...

  1. Homeopathic dilutions of TNF-alfa in psoriasis and rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Ioana Cridon

    2012-09-01

    Full Text Available Aim: Clinical and biological studies in the past years underlined the proinflammatory action of the citokine Tumoral Necrosis Factor in the pathophysiolology of psoriasis, psoriatic arthritis, rheumatoid arthritis. Knowing that the high dilution of substances can have an inverted effect, our hypotesis was that dillution made of TNF-alfa can decrease the clinical manifestation of such diseases. Materials and method: We included as a pilot group 10 patients presented in Lotus Life Integrative Medicine Center or Profamilia Medical Center Iasi with psoriasis and rheumatoid arthritis previously diagnosed by specialists, under speciality treatment with insufficient results and patients who deliberately expressed their preference for alternative treatment. We decided to exclude the patients which during the study could present aggravation of symptoms. The treatment protocol consisted in the administration under the tongue of the dilution of TNF-alfa 9CH in liquid form, 12 drops twice a day for at least 3 months. This was prepared diluting from Guna TNF-alfa 4CH in distiled water, completing with 30% of alcohol in the last solution. Patients under other medications continued to take their previous treatment unchanged. We called the patients for follow-up after 3 months. We took the written consent from the patients and the approval of the Ethical Committee of the University of Medicine and Pharmacy "Gr. T. Popa" of Iasi. Results: To analize the results we followed the subjective evolution of the patients, the total surface and thickness of eruptions in psoriasis patients and the pain intensity and stiffness in arthritis patients. Under this conditions, all the patients showed amelioration, with 2 out of 6 psoriasis patients showing complete clearance of eruptions. No patient reported adverse reactions during the treatment Conclusions: Even though the group of patients was small and not appropriate for statistical data the presence of a clinical

  2. Prospective surveillance study of haemophilia A patients switching from moroctocog alfa or other factor VIII products to moroctocog alfa albumin-free cell culture (AF-CC) in usual care settings.

    Science.gov (United States)

    Parra Lopez, Rafael; Nemes, Laszlo; Jimenez-Yuste, Victor; Rusen, Luminita; Cid, Ana R; Charnigo, Robert J; Baumann, James A; Smith, Lynne; Korth-Bradley, Joan M; Rendo, Pablo

    2015-10-01

    This prospective, open-label, postauthorisation safety surveillance study assessed clinically significant inhibitor development in patients with severe haemophilia A transitioning from moroctocog alfa or other factor VIII (FVIII) replacement products to reformulated moroctocog alfa (AF-CC). Males aged ≥ 12 years with severe haemophilia A (FVIII:C) 150 exposure days (EDs) to recombinant or plasma-derived FVIII products, and no detectable inhibitor at screening were enrolled. Primary end point was the incidence of clinically significant FVIII inhibitor development. Secondary end points included annualised bleeding rate (ABR), less-than-expected therapeutic effect (LETE), and FVIII recovery. Patients were assigned to one of two cohorts based on whether they were transitioning to moroctocog alfa (AF-CC) from moroctocog alfa (cohort 1; n=146) or from another recombinant or plasma-derived FVIII product (cohort 2; n=62). Mean number of EDs on study was 94 (range, 1-139). Six positive FVIII inhibitor results, as determined by local laboratories, were reported in four patients; none were confirmed by a central laboratory, no inhibitor-related clinical manifestations were reported, and all anti-FVIII antibody assays were negative. Median ABRs were 23.4 and 3.4 in patients categorised at baseline as following on-demand and prophylactic regimens, respectively; 86.5% of bleeding episodes resolved after one infusion. LETE incidence was 0.06% and 0.19% in the on-demand and prophylaxis settings, respectively. FVIII recovery remained constant throughout the study. No new safety concerns were identified. This study found no increased risk of clinically significant FVIII inhibitor development in patients transitioning from moroctocog alfa or other FVIII replacement products to moroctocog alfa (AF-CC).

  3. Expressão local do fator de necrose tumoral alfa na ruptura prematura de membranas

    OpenAIRE

    Roveran,Valquíria; SILVA, Maria Antonieta Longo Galvão; Yamano,Lucia; Rodrigues,Lilian de Paiva; Vasquez,Mônica Lopez; Piato, Sebastião

    2009-01-01

    OBJETIVO: comparar a expressão do fator de necrose tumoral alfa (TNF-α) em membranas ovulares com ruptura prematura (RPM) e com ruptura oportuna das mesmas; verificar a associação entre a expressão do TNF-α em membranas ovulares e o grau de corioamnionite das mesmas e correlacionar a expressão do TNF-α e o tempo de ruptura das membranas. MÉTODOS: foram analisadas as membranas ovulares de 31 parturientes com RPM, com idade gestacional acima de 34 semanas, e de 14 parturientes co...

  4. Corifollitropin alfa followed by rFSH in a GnRH antagonist protocol for poor ovarian responder patients

    DEFF Research Database (Denmark)

    Polyzos, Nikolaos P; Devos, Michel; Humaidan, Peter;

    2013-01-01

    OBJECTIVE: To identify whether women with poor ovarian response may benefit from treatment with corifollitropin alfa in a GnRH antagonist protocol. DESIGN: Retrospective pilot study. SETTING: University-based tertiary care center. PATIENT(S): Poor ovarian responders fulfilling the Bologna criteria...... developed by European Society for Human Reproduction and Embryology Consensus Group. INTERVENTION(S): Corifollitropin alfa (150 μg) followed by 300 IU rFSH in a GnRH antagonist protocol. MAIN OUTCOME MEASURE(S): Endocrinologic profile and ongoing pregnancy rates. RESULT(S): Among 43 women treated...... compared with a cohort of patients treated during 2011 with the standard protocol for poor responders in our center (short agonist-hMG) (7% vs. 6.3%). CONCLUSION(S): Treatment of poor ovarian responders, as described by the Bologna criteria, with corifollitropin alfa in a GnRH antagonist protocol results...

  5. Mapping Hydrogen in the Galaxy, Galactic Halo, and Local Group with ALFA: The GALFA-HI Survey Starting with TOGS

    CERN Document Server

    Gibson, S J; Heiles, C; Korpela, E J; Peek, J E G; Putman, M E; Stanimirović, S

    2008-01-01

    Radio observations of gas in the Milky Way and Local Group are vital for understanding how galaxies function as systems. The unique sensitivity of Arecibo's 305m dish, coupled with the 7-beam Arecibo L-Band Feed Array (ALFA), provides an unparalleled tool for investigating the full range of interstellar phenomena traced by the HI 21cm line. The GALFA (Galactic ALFA) HI Survey is mapping the entire Arecibo sky over a velocity range of -700 to +700 km/s with 0.2 km/s velocity channels and an angular resolution of 3.4 arcminutes. We present highlights from the TOGS (Turn on GALFA Survey) portion of GALFA-HI, which is covering thousands of square degrees in commensal drift scan observations with the ALFALFA and AGES extragalactic ALFA surveys. This work is supported in part by the National Astronomy and Ionosphere Center, operated by Cornell University under cooperative agreement with the National Science Foundation.

  6. GSI Helmholz Centre for Heavy Ion Research - ALFA: Next generation concurrent framework for ALICE and FAIR experiments

    CERN Document Server

    CERN. Geneva

    2015-01-01

    FAIR is a new, unique international accelerator facility for the research with antiprotons and ions. It is being built at the GSI Darmstadt in Hesse, Germany. The commonalities between the ALICE and FAIR experiments and their computing requirements led to the development of a common software framework in an experiment independent way; ALFA (ALICE-FAIR framework). ALFA is designed for high quality parallel data processing and reconstruction on heterogeneous computing systems. It provides a data transport layer and the capability to coordinate multiple data processing components. ALFA is a flexible, elastic system which balances reliability and ease of development with performance by using a message based multi-processing in addition to multi-threading. The framework allows for usage of heterogeneous computing architectures by offloading (portions of code are accelerated on the device) or natively (where the full program is executed on the device ).

  7. Secretion of human interferon alpha 2b by Streptomyces lividans.

    Science.gov (United States)

    Pimienta, E; Fando, R; Sánchez, J C; Vallin, C

    2002-02-01

    Biologically active human interferon alpha 2b (HuIFNalpha-2b) was secreted into the culture medium by Streptomyces lividans transformed with recombinant plasmids coding for HuIFNalpha-2b fused to the Streptomyces exfoliatus M11 lipase A signal sequence. Levels were low, 15 or 100 ng/ml, depending on the plasmid used. Neither processed nor unprocessed HuIFNalpha-2b was detected in cell lysates of the transformants secreting the recombinant product. However, the secreted recombinant product was found to partially degrade when cultures reached the stationary phase by the action of an, as yet, unidentified mycelium-associated factor. Experimental evidence suggests that the degrading factor is related to mycelium-associated proteolytic activity.

  8. Rf2a and rf2b transcription factors

    Science.gov (United States)

    Beachy, Roger N.; Petruccelli, Silvana; Dai, Shunhong

    2007-10-02

    A method of activating the rice tungro bacilliform virus (RTBV) promoter in vivo is disclosed. The RTBV promoter is activated by exposure to at least one protein selected from the group consisting of Rf2a and Rf2b.

  9. Study on pharmacodynamics of recombinant interferon α-2b suppository

    Institute of Scientific and Technical Information of China (English)

    LIU Miao; LIU Zheng; SUN Liang

    2008-01-01

    Objective To investigate the antiviral activity of recombinant interferona-2b suppository (IFNα-2b) in vivo and in vitro. Methods The cytopathic-effect inhibition assay was applied in this study to investigate the antiviral activity of this drug as well as yingtelong and axiluowei as positive control. The guinea pig model of vaginitis and skin infection caused by HSV-2 infection were established, treated with IFNα-2b suppository at dosages of 60000、180000、540000 IU, using IFNα-2b injection 180000 IU·kg-1 as controls. Score the pathological changes of appearance and skin, the virus activities of vaginal secretion and tissue sections of viginae were assayed after treatment. Results The TD50 of IFN α-2b and yingtelong for Vero cells was ( 100)μg·mL-1 and ( 100000) IU·mL-1, respectively. The IC50 of IFNα-2b and yingtelong and axiluowei for Herpes virus type 1 was (0.29±0.08)μg·mL-1 and (185.0±28.8) IU·mL-1 and (0.19± 0.03)μg·mL-1, respectively. The mean scores for vaginal and skin lesion of the treated groups were lower than those of untreated group. Among these concentrations, the IFNα-2b suppository of 540000 IU·kg-1 group. Showed highest anti-viral activity. The virus activity in vaginal secretion of treated group was lower than that of untreated group too (P<0.01 or P<0.05). Tissue sections of viginae after treatment with IFNα-2b suppository showed significantly therapeutical effects on the degrees of vaginal lesion. At the same dosage, The anti-HSV activity of IFNα-2b suppository was also compared with IFNα-2b injection , the resuits showed that the activity of suppository of 540000 IU·kg-1 group was similar to that of the injection. Conclusions The IFNα-2b suppository has anti-viruses function both in vivo and in vitro.

  10. Branding of electricity in B2B markets

    OpenAIRE

    Rolanda Simenaite 1986

    2013-01-01

    Branding has gained an important role in the B2B (business-to-business) market. Liberation of the energy markets in recent years has increased competition and branding could create a competitive advantage. This thesis analyzes the branding of electricity in a business-to-business context. In depth, this thesis explores the supplier of electricity brand importance for business customers in both Icelandic and Lithuanian B2B markets. The focus of the thesis is to research how much brands matter ...

  11. Expression of zebrafish nos2b surrounds oral cavity.

    Science.gov (United States)

    Poon, Kar-Lai; Richardson, Michael; Korzh, Vladimir

    2008-06-01

    Inducible nitric oxide synthase (NOS2) catalyzes the production of nitric oxide (NO), and is one of the factors establishing innate immunity. In zebrafish, Nos2 is represented by nos2a and nos2b. Here, we report the cloning and expression pattern of the zebrafish nos2b gene, which does not seem to participate in induced immune response. nos2b was mapped to zebrafish linkage group 15. The spatial and temporal expression pattern of nos2b in embryonic zebrafish was analyzed by whole-mount in situ hybridization. nos2b is expressed constitutively in two primordia located along the ventral midline. The first group of cells contributes to the neurohypophysis. Initially at the level of the ventral hindbrain, the second group of cells migrates closely with the thyroid primordium to its final position at the basihyal by 3 dpf. Thus, the analysis of expression pattern of nos2b reveals complex morphogenetic movements resulting in its expression surrounding the oral cavity.

  12. EVALUACIÓN DE LA PRODUCCIÓN DE ETANOL UTILIZANDO CEPAS RECOMBINANTES DE Saccharomyces cerevisiae A PARTIR DE MELAZA DE CAÑA DE AZÚCAR

    Directory of Open Access Journals (Sweden)

    CAROLINA PEÑA

    2009-01-01

    Full Text Available Se evaluó la producción de etanol, el crecimiento celular y el consumo de sustrato de tres cepas de Saccharomyces cerevisiae: CBS8066 (control y dos recombinantes desarrolladas en la Unidad de Biotecnología Vegetal de CIB, GG570-CIBI y GG570-CIBII. Dichas cepas estuvieron bajo el efecto de dos concentraciones de sacarosa (170 y 250g/L y dos sustratos (industrial con melaza caña azúcar y sintético con sacarosa. Durante la fermentación en sustrato industrial se obtuvo mayor producción de etanol a concentración de 250g sacarosa/L. Bajo estas condiciones, la cepa GG570-CIBII produjo en promedio 2,34g etanol/L mas con respecto a la cepa control y en adición, a las 10h, produjo 8,02g/L por encima de la cepa control. Por otro lado, la cepa GG570- CIBI produjo 3,46g etanol/L menos que la cepa control. De esta forma, se encontró que la cepa GG570-CIBII es tolerante a alta concentración de sacarosa, y además, es capaz de producir una concentración mayor de etanol con respecto a la cepa control en melaza caña azúcar con 250g/L sacarosa.

  13. Fermentation of sweet whey by recombinant Escherichia coli K011 Fermentação de soro de leite por Escherichia coli KO11 recombinante

    Directory of Open Access Journals (Sweden)

    Amarildo Ricardo Leite

    2000-09-01

    Full Text Available The production of ethanol from sweet whey using the recombinant Escherichia coli KO11, in batch fermentation, was tested. The maximum ethanol yield was reached after 96h, representing only 38% of the theoretical yield. The supplementation of whey with components of LB broth increased the maximum yield to 96% in 72h. The addition of 0.5% yeast extract to whey resulted in maximum yield of 74% at 36h and it increased to over 100% when yeast extract and trace metals solution (Fe++, Mn++ and Zn++ were added.A produção de etanol a partir de soro de leite empregando a cepa Escherichia coli KO11 recombinante, em fermentação de batelada, foi testada. O rendimento máximo de etanol foi obtido em 96h, representando apenas 38% do rendimento teórico. A suplementação do soro com os componentes do caldo LB aumentou o rendimento para 96% em 72h. A adição de 0,5% de extrato de levedura ao soro resultou em um rendimento máximo de 74% em 36h que aumentou para acima de 100% quando se adicionou extrato de levedura e uma solução de metais traço (Fe++, Mn++ e Zn++.

  14. Vanillin production by recombinant strains of Escherichia coli Produção de vanilina por linhagens recombinantes de Escherichia coli

    Directory of Open Access Journals (Sweden)

    Attilio Converti

    2003-11-01

    Full Text Available Vanillin production from ferulate was studied using different recombinant strains of Escherichia coli. To prevent the occurrence of aerobic conditions and then possible product oxidation, tests were performed in Erlenmeyer flasks under mild mixing (150 rpm. Among other transformants, E. coli JM109(pBB1 appeared to be the best vanillin producer, being able to convert no less than 95% of starting ferulate to the product within 1h. This yield decreased down to 72% after 72h, likely because of a non-specific oxidase activity responsible for vanillin oxidation to vanillate.A produção de vanilina a partir de ácido ferúlico foi estudada utilizando-se diferentes linhagens recombinantes de Escherichia coli. Para prevenir a ocorrência de condições de aerobiose e a possível oxidação do produto, os ensaios foram realizados em frascos Erlenmeyer sob agitação moderada (150 rpm. E. coli JM109 (pBBI mostrou-se o melhor produtor de vanilina entre os demais agentes transformantes, sendo capaz de converter 95% do ácido ferúlico inicial em produto após 1h, rendimento este que decresceu para 72% após 72h, provavelmente devido à atividade de uma oxidase não-específica responsável pela oxidação de vanilina a ácido vanílico.

  15. De-squeeze the beams: the TOTEM and ATLAS/ALFA experiments

    CERN Multimedia

    Stefania Pandolfi

    2016-01-01

    A special week-long proton–proton run with larger beam sizes at the interaction point is intended to probe the p-p elastic scattering regime at small angles.   Nicola Turini, deputy spokesperson for TOTEM, in front of one of the experiment’s ‘Roman Pot’ detectors in the LHC tunnel. (Photo: Maximilien Brice/CERN) Usually, the motto of the LHC is “maximum luminosity”. But for a few days per year, the LHC ignores its motto to run at very low luminosity for the forward experiments. This week, the LHC will provide the TOTEM and ATLAS/ALFA experiments with data for a broad physics programme. The TOTEM experiment at Point 5 and the ATLAS/ALFA experiment at Point 1 study the elastic scattering of protons, which are not observable in normal operation runs. In the elastic scattering process, the two protons survive their encounter intact and only change directions by exchanging momentum. To allow this special run, the operators play with the so-c...

  16. Drotrecogin alfa (activated)...a sad final fizzle to a roller-coaster party.

    Science.gov (United States)

    Angus, Derek C

    2012-02-06

    Following the failure of PROWESS-SHOCK to demonstrate efficacy, Eli Lilly and Company withdrew drotrecogin alfa (activated) from the worldwide market. Drotrecogin was initially approved after the original trial, PROWESS, was stopped early for overwhelming efficacy. These events prompt consideration of both the initial approval decision and the later decision to withdraw. It is regrettable that the initial decision was made largely on a single trial that was stopped early. However, the decision to approve was within the bounds of normal regulatory practice and was made by many approval bodies around the world. Furthermore, the overall withdrawal rate of approved drugs remains very low. The decision to withdraw was a voluntary decision by Eli Lilly and Company and likely reflected key business considerations. Drotrecogin does have important biologic effects, and it is probable that we do not know how best to select patients who would benefit. Overall, there may still be a small advantage to drotrecogin alfa, even used non-selectively, but the costs of determining such an effect with adequate certainty are likely prohibitive, and the point is now moot. In the future, we should consider ways to make clinical trials easier and quicker so that more information can be available in a timely manner when considering regulatory approval. At the same time, more sophisticated selection of patients seems key if we are to most wisely test agents designed to manipulate the septic host response.

  17. Mango resistance to fruit flies. II - resistance of the alfa cultivar

    Energy Technology Data Exchange (ETDEWEB)

    Rossetto, C.J.; Bortoletto, N., E-mail: rossetto@iac.sp.gov.b [Agencia Paulista de Tecnologia dos Agronegocios (APTA), Votuporanga, SP (Brazil). Polo Regional do Noroeste Paulista; Walder, J.M.M.; Mastrangelo, T. de A., E-mail: jmwalder@cena.usp.b [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil); Carvalho, C.R.L.; Castro, J.V. de, E-mail: climonta@iac.sp.gov.b, E-mail: josalba@iac.sp.gov.b [Instituto Agronomico de Campinas, SP (Brazil); Pinto, A.C. de Q. [EMBRAPA, Brasilia, DF (Brazil); Cortelazzo, A.L., E-mail: angelo@unicamp.b [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Inst. de Biologia

    2006-07-01

    The percentage of infested mango fruits of five selected mango varieties was evaluated during three years under field conditions. Three varieties with field resistance to fruit flies had less then 10% of fruits infested. Tommy Atkins, the susceptible commercial check, had 42,9% and the susceptible check had 98.9 % of infested fruits. The three field resistant varieties plus the susceptible commercial check, Tommy Atkins, were further tested in laboratory, under caged conditions, with artificial infestation of Anastrepha obliqua. The attempts of oviposition and the number of pupae developed from each fruit were evaluated. Under caged conditions, the cultivar Alfa maintained its field resistance and Espada Stahl and IAC 111 lost the field resistance and were as susceptible as Tommy Atkins. The attempts of oviposition were positively and highly correlated with the number of pupae developed in the fruits. Non preference for oviposition was confirmed as the main mechanism of resistance of mango fruits to fruit flies. In the absence of a more susceptible variety (no choice test) the cultivar Alfa has kept the resistance (author)

  18. FTIR spectroscopy and X-ray powder diffraction characterization of microcrystalline cellulose obtained from alfa fibers

    Directory of Open Access Journals (Sweden)

    Trache D.

    2013-07-01

    Full Text Available Many cereal straws have been used as raw materials for the preparation of microcrystalline cellulose (MCC. These raw materials were gradually replaced with wood products; nevertheless about 10% of the world overall pulp production is obtained from non-wood raw material. The main interest in pulp made from straw is that it provides excellent fibres for different industries with special properties, and that it is the major available source of fibrous raw material in some geographical areas. The aim of the present work was to characterize microcrystalline cellulose prepared from alfa fibers using the hydrolysis process. The products obtained are characterized with FTIR spectroscopy and X-ray powder diffraction. As a result, FTIR spectroscopy is an appropriate technique for studying changes occurred by any chemical treatment. The spectrum of alfa grass stems shows the presence of lignin and hemicelluloses. However, the cellulose spectrum indicates that the extraction of lignin and hemicellulose was effective. The X-ray analysis indicates that the microcrystalline cellulose is more crystalline than the source material.

  19. Papel de la IL-6 y TNF-alfa en la enfermedad periodontal

    Directory of Open Access Journals (Sweden)

    A. Carrillo de Albornoz Sainz

    Full Text Available La periodontitis se inicia por una serie de patógenos que inducen una cascada inflamatoria que estimula la destrucción de los tejidos mediada por el huésped. Están implicados un gran número de mediadores inflamatorios, entre los que destacan IL-6 y TNF-alfa. La IL-6 es una citoquina pleiotrópica de compleja actividad biológica, cuya función principal vinculada a la periodontitis es la inducción de la reabsorción ósea. TNF-alfa es una citoquina proinflamatoria cuya función más destacada es el reclutamiento y estimulación de neutrófilos y monocitos. Su papel en la periodontitis es diverso, ya que promueve tanto la inflamación, como la pérdida ósea y la destrucción del tejido conectivo, a la vez que limita la capacidad de reparación del periodonto.

  20. Pharmacogenetics of Cytochrome P450 2B6 (CYP2B6: Advances on Polymorphisms, Mechanisms, and Clinical Relevance

    Directory of Open Access Journals (Sweden)

    Ulrich M Zanger

    2013-03-01

    Full Text Available Cytochrome P450 2B6 (CYP2B6 belongs to the minor drug metabolizing P450s in human liver. Expression is highly variable both between individuals and within individuals, owing to nongenetic factors, genetic polymorphisms, inducibility and irreversible inhibition by many compounds. Drugs metabolized mainly by CYP2B6 include artemisinin, bupropion, cyclophosphamide, efavirenz, ketamine, and methadone. CYP2B6 is one of the most polymorphic CYP genes in humans and variants have been shown to affect transcriptional regulation, splicing, mRNA and protein expression, and catalytic activity. Some variants appear to affect several functional levels simultaneously, thus, combined in haplotypes, leading to complex interactions between substrate-dependent and -independent mechanisms. The most common functionally deficient allele is CYP2B6*6 [Q172H, K262R], which occurs at frequencies of 15 to over 60% in different populations. The allele leads to lower expression in liver due to erroneous splicing. Recent investigations suggest that the amino acid changes contribute complex substrate-dependent effects at the activity level, although data from recombinant systems used by different researchers are not well in agreement with each other. Another important variant, CYP2B6*18 [I328T], occurs predominantly in Africans (4 to 12% and does not express functional protein. A large number of uncharacterized variants are currently emerging from different ethnicities in the course of the 1000 Genomes Project. The CYP2B6 polymorphism is clinically relevant for HIV-infected patients treated with the reverse transcriptase inhibitor efavirenz, but it is increasingly being recognized for other drug substrates. This review summarizes recent advances on the functional and clinical significance of CYP2B6 and its genetic polymorphism, with particular emphasis on the comparison of kinetic data obtained with different substrates for variants expressed in different recombinant

  1. Antibody responses elicited in mice immunized with Bacillus subtilis vaccine strains expressing Stx2B subunit of enterohaemorragic Escherichia coli O157:H7 Resposta de anticorpos obtidas em camundongos imunizados com linhagens vacinais de Bacillus subtilis expressando a subunidade B da Stx2 de Escherichia coli O157:H7 enterohemorrágica

    Directory of Open Access Journals (Sweden)

    P.A.D.P. Gomes

    2009-06-01

    Full Text Available No effective vaccine or immunotherapy is presently available for patients with the hemolytic uremic syndrome (HUS induced by Shiga-like toxin (Stx producedbyenterohaemorragic Escherichia coli (EHEC strains, such as those belonging to the O157:H7 serotype. In this work we evaluated the performance of Bacillus subtilis strains, a harmless spore former gram-positive bacterium species, as a vaccine vehicle for the expression of Stx2B subunit (Stx2B. A recombinant B. subtilis vaccine strain expressing Stx2B under the control of a stress inducible promoter was delivered to BALB/c mice via oral, nasal or subcutaneous routes using both vegetative cells and spores. Mice immunized with vegetative cells by the oral route developed low but specific anti-Stx2B serum IgG and fecal IgA responses while mice immunized with recombinant spores developed anti-Stx2B responses only after administration via the parenteral route. Nonetheless, serum anti-Stx2B antibodies raised in mice immunized with the recombinant B. subtilis strain did not inhibit the toxic effects of the native toxin, both under in vitro and in vivo conditions, suggesting that either the quantity or the quality of the induced immune response did not support an effective neutralization of Stx2 produced by EHEC strains.Até o presente o momento, não há vacina ou imunoterapia disponível para pacientes com Síndrome Hemolítica Urêmica (SHU induzida pela toxina Shiga-like (Stx produzida por linhagens de Escherichia coli entero-hemorragica (EHEC, tais como as pertencentes ao sorotipo O157:H7. Neste trabalho, avaliamos a performance de Bacillus subtilis, uma espécie bacteriana gram-positiva não-patogênica formadora de esporos, como veículo vacinal para a expressão da subunidade B da Stx2B (Stx2B. Uma linhagem vacinal recombinante de B. subtilis expressando Stx2B, sob o controle de um promoter induzível por estresse, foi administrada a camundongos BALB/c por via oral, nasal ou subcutânea usando

  2. Interferon alfa-2a versus combination therapy with interferon alfa-2a, interleukin-2, and fluorouracil in patients with untreated metastatic renal cell carcinoma (MRC RE04/EORTC GU 30012): an open-label randomised trial.

    NARCIS (Netherlands)

    Gore, M.E.; Griffin, C.L.; Hancock, B.; Patel, P.M.; Pyle, L.; Aitchison, M.; James, N.; Oliver, R.T.D.; Mardiak, J.; Hussain, T.; Sylvester, R.; Parmar, M.K.; Royston, P.; Mulders, P.F.A.

    2010-01-01

    BACKGROUND: In metastatic renal cell carcinoma combinations of interferon alfa-2a, interleukin-2, and fluorouracil produce higher response rates and longer progression-free survival than do single agents. We aimed to compare overall survival in patients receiving combination treatment or interferon

  3. Lithium insertion in nanostructured TiO(2)(B) architectures.

    Science.gov (United States)

    Dylla, Anthony G; Henkelman, Graeme; Stevenson, Keith J

    2013-05-21

    Electric vehicles and grid storage devices have potentialto become feasible alternatives to current technology, but only if scientists can develop energy storage materials that offer high capacity and high rate capabilities. Chemists have studied anatase, rutile, brookite and TiO2(B) (bronze) in both bulk and nanostructured forms as potential Li-ion battery anodes. In most cases, the specific capacity and rate of lithiation and delithiation increases as the materials are nanostructured. Scientists have explained these enhancements in terms of higher surface areas, shorter Li(+) diffusion paths and different surface energies for nanostructured materials allowing for more facile lithiation and delithiation. Of the most studied polymorphs, nanostructured TiO2(B) has the highest capacity with promising high rate capabilities. TiO2(B) is able to accommodate 1 Li(+) per Ti, giving a capacity of 335 mAh/g for nanotubular and nanoparticulate TiO2(B). The TiO2(B) polymorph, discovered in 1980 by Marchand and co-workers, has been the focus of many recent studies regarding high power and high capacity anode materials with potential applications for electric vehicles and grid storage. This is due to the material's stability over multiple cycles, safer lithiation potential relative to graphite, reasonable capacity, high rate capability, nontoxicity, and low cost (Bruce, P. G.; Scrosati, B.; Tarascon, J.-M. Nanomaterials for Rechargeable Lithium Batteries. Angew. Chem., Int. Ed.2008, 47, 2930-2946). One of the most interesting properties of TiO2(B) is that both bulk and nanostructured forms lithiate and delithiate through a surface redox or pseudocapacitive charging mechanism, giving rise to stable high rate charge/discharge capabilities in the case of nanostructured TiO2(B). When other polymorphs of TiO2 are nanostructured, they still mainly intercalate lithium through a bulk diffusion-controlled mechanism. TiO2(B) has a unique open crystal structure and low energy Li

  4. Evaluation of the immune response to CRA and FRA recombinant antigens of Trypanosoma cruzi in C57BL/6 mice Avaliação da resposta imune em camundongos C57BL/6 imunizados com os antígenos recombinantes CRA e FRA de Trypanosoma cruzi

    Directory of Open Access Journals (Sweden)

    Valéria Rêgo Alves Pereira

    2003-07-01

    Full Text Available Humoral and cellular immune responses were evaluated in 44 C57BL/6 mice immunized with the Trypanosoma cruzi recombinant antigens CRA and FRA. Both antigens induced cutaneous immediate-type hypersensitivity response. The levels of IgG1, IgG2a, IgG2b and IgG3 were high in CRA immunized mice. IgG3 was the predominant isotype. Although no difference in antibody levels was observed in FRA-immunized mice when compared to control mice, both antigens were able to induce lymphoproliferation in immunized mice. Significant differences were observed between incorporation of [³H]- thymidine by spleen cell stimulated in vitro with CRA or FRA and the control group. These results suggest that CRA and FRA could be involved in mechanisms of resistance to Trypanosoma cruzi infection.As respostas imune humoral e celular foram avaliadas em 44 camundongos C57Bl/6 imunizados com os antígenos recombinantes CRA e FRA de Trypanosoma cruzi. Ambos antígenos induziram reação de hipersensibilidade do tipo imediato. Os níveis de IgG1, IgG2a, IgG2b e IgG3 foram elevados nos camundongos imunizados com CRA. IgG3 foi o isotipo predominante. Nenhuma diferença nos níveis de anticorpos foi observada em camundongos imunizados com FRA em relação aos animais controle. No entanto, ambos antígenos foram capazes de induzir proliferação de linfócitos em camundongos imunizados. Diferenças significativas foram observadas entre a incorporação da timidina - [³H] pelas células esplênicas estimuladas com CRA ou FRA e o grupo controle. Esses resultados sugerem que CRA e FRA poderão estar envolvidos nos mecanismos de resistência à infecção pelo Trypanosoma cruzi.

  5. Cytochrome P450 2B (CYP2B)-mediated activation of methyl-parathion in rat brain extracts.

    Science.gov (United States)

    Albores, A; Ortega-Mantilla, G; Sierra-Santoyo, A; Cebrián, M E; Muñoz-Sánchez, J L; Calderón-Salinas, J V; Manno, M

    2001-10-15

    The role of cytochrome P450 (CYP) and the CYP isoform involved in the activation of the widely used pesticide methyl-parathion (MePA) were investigated in rat brain extracts by measuring the effect of different CYP inhibitors on acetylcholinesterase (AChE) inhibition by MePA. Brain extracts provide a useful tool to study the activation mechanisms of organophosphorus compounds (OP) since they contain both the activating enzyme(s) and the molecular target for OP toxicity. As expected, in incubations of rat brain extract supplemented with NADPH, AChE activity was non-competitively inhibited by the presence of MePA, indicating that MePA was activated to its reactive metabolite methyl-paraoxon (MePO). Indeed, Vmax(app) decreased from 13.4 to 8.7 micromol thionitrobenzoic acid (TNB)/min per mg protein. MePA activation by rat brain extracts, as measured by the AChE inhibition produced by the presence of the pesticide in the incubation, was fully prevented by previously bubbling the incubation mix with CO, by the presence of monoclonal anti-rat CYP2B1/2B2 antibodies and by the addition of phenobarbital (PB), a CYP2B substrate. Interestingly, MePA showed a greater affinity for CYP2B than PB. CYP1A1 antibodies showed no effect on MePA activation. The presence of cytochrome P450 2B (CYP2B) in the rat brain extracts was confirmed by immunoblotting. These results demonstrate indisputably the responsibility of CYP2B in MePA activation in the rat brain in vitro, suggesting that metabolic activation of OP compounds in situ might be crucial for their organ specific toxicity to the central nervous system also in vivo.

  6. Substrate Recognition of Histone H2B by DUBm

    Science.gov (United States)

    Henderson, Elizabeth; Berndsen, Christopher; Wolberger, Cynthia

    2011-03-01

    The SAGA complex is a transcriptional coactivator that regulates gene expression in eukaryotes via histone acetylation and deubiquitination, which are crucial for transcription. Our lab is investigating the SAGA-dependent deubiquitination of histone H2B. The deubiquitinating module (DUBm) of SAGA is comprised of a ubiquitin-specific protease, Ubp8, and three other proteins. It is known that Ubp8 cleaves ubiquitin from histone H2B, however, the specific way in which the enzyme binds to the substrate remains elusive. In order to unravel this mechanism, we attempted to determine the crystal structure of the substrate binding complex. We obtained this substrate by exploiting the techniques of intein chemistry to artificially ubiquitinate a histone H2B peptide, which we then co-crystallized with DUBm. Additionally, we synthesized Ub-K63R-linked chains and Ub-K48-linked chains and co-crystallized them with DUBm.

  7. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery......, service, configuration and customisation of the products in their company as well as to develop an apposite understanding of the key values and characteristics of the client organisation. Based on a design-ethnographical study of real sales practice in lift truck business the paper draws parallels between...

  8. Molecular design and downstream processing of turoctocog alfa (NovoEight), a B-domain truncated factor VIII molecule.

    Science.gov (United States)

    Ahmadian, Haleh; Hansen, Ernst B; Faber, Johan H; Sejergaard, Lars; Karlsson, Johan; Bolt, Gert; Hansen, Jens J; Thim, Lars

    2016-07-01

    Turoctocog alfa (NovoEight) is a third-generation recombinant factor VIII (rFVIII) with a truncated B-domain that is manufactured in Chinese hamster ovary cells. No human or animal-derived materials are used in the process. The aim of this study is to describe the molecular design and purification process for turoctocog alfa. A five-step purification process is applied to turoctocog alfa: protein capture on mixed-mode resin; immunoaffinity chromatography using a unique, recombinantly produced anti-FVIII mAb; anion exchange chromatography; nanofiltration and size exclusion chromatography. This process enabled reduction of impurities such as host cell proteins (HCPs) and high molecular weight proteins (HMWPs) to a very low level. The immunoaffinity step is very important for the removal of FVIII-related degradation products. Manufacturing scale data shown in this article confirmed the robustness of the purification process and a reliable and consistent reduction of the impurities. The contribution of each step to the final product purity is described and shown for three manufacturing batches. Turoctocog alfa, a third-generation B-domain truncated rFVIII product is manufactured in Chinese hamster ovary cells without the use of animal or human-derived proteins. The five-step purification process results in a homogenous, highly purified rFVIII product.

  9. alfa-Deuterium kinetic isotope effects in reactions of methyllithium. Is better aggregation the cause of lower reactivity?

    DEFF Research Database (Denmark)

    Holm, Torkil

    1996-01-01

    The value of kH/kD for alfa deuterium kinetic isotope effects for the reaction of methyllithium and methylmagnesium iodid with a series of substrates are consistently ca. 10-15 % higher for the lithium reagent. This may indicate a pre-equilibrium...

  10. Comprehensive safety analysis of concomitant drotrecogin alfa (activated) and prophylactic heparin use in patients with severe sepsis

    NARCIS (Netherlands)

    M. Levy; M. Levi; M.D. Williams; M. Antonelli; D. Wang; M.A. Mignini

    2009-01-01

    Purpose: The safety of using heparin concomitantly with drotrecogin alfa (activated) {DrotAA} was explored in the XPRESS study. No heparin effect on mortality was observed. Safety results from that study are explored in more detail. Methods: A randomized, double-blind trial of prophylactic heparin v

  11. Il trattamento di pazienti con sepsi grave mediante drotrecogin alfa: una valutazione economica con riferimento all’Italia

    Directory of Open Access Journals (Sweden)

    Carlo Lucioni

    2002-09-01

    Full Text Available Sepsis can be defined as a spectrum of clinical conditions caused by the immune response of a host to infection or trauma and characterized by systemic inflammation and coagulation. Particularly in elderly, immunocompromised and critically ill patients, sepsis is a major cause of morbidity and mortality in intensive care units (ICUs worldwide. In the US, sepsis is the leading cause of death in noncoronary ICU patients. Drotrecogin alfa, or recombinant human activated protein C, has antithrombotic, antiinflammatory, and profibrinolytic properties. Recently in a phase III trial (PROWESS, Drotrecogin alfa demonstrated significantly reduced mortality in severe sepsis patients at 28 days. In this trial important value factors for the assessment of costs and outcomes of severe sepsis were also considered. The purpose of the present study is to determine the economic burden of the treatment with Drotrecogin alfa, according to a cost-effectiveness analysis based on the data of the PROWESS trial. The study has been adapted to the italian health environment. As regards to the costs per surviving patient and costs per QALY (Quality Adjusted Life Year, the predicted cost-effectiveness ratio of drotrecogin alfa in severe sepsis patients is much lower than the standard values considered as acceptable in the international litterature.

  12. The Arecibo Legacy Fast ALFA Survey : X. The HI Mass Function and Omega_HI From the 40% ALFALFA Survey

    NARCIS (Netherlands)

    Martin, Ann M.; Papastergis, Emmanouil; Giovanelli, Riccardo; Haynes, Martha P.; Springob, Christopher M.; Stierwalt, Sabrina

    2010-01-01

    The Arecibo Legacy Fast ALFA (ALFALFA) survey has completed source extraction for 40% of its total sky area, resulting in the largest sample of HI-selected galaxies to date. We measure the HI mass function from a sample of 10,119 galaxies with 6.2

  13. Accurate Learning with Few Atlases (ALFA): an algorithm for MRI neonatal brain extraction and comparison with 11 publicly available methods

    Science.gov (United States)

    Serag, Ahmed; Blesa, Manuel; Moore, Emma J.; Pataky, Rozalia; Sparrow, Sarah A.; Wilkinson, A. G.; MacNaught, Gillian; Semple, Scott I.; Boardman, James P.

    2016-03-01

    Accurate whole-brain segmentation, or brain extraction, of magnetic resonance imaging (MRI) is a critical first step in most neuroimage analysis pipelines. The majority of brain extraction algorithms have been developed and evaluated for adult data and their validity for neonatal brain extraction, which presents age-specific challenges for this task, has not been established. We developed a novel method for brain extraction of multi-modal neonatal brain MR images, named ALFA (Accurate Learning with Few Atlases). The method uses a new sparsity-based atlas selection strategy that requires a very limited number of atlases ‘uniformly’ distributed in the low-dimensional data space, combined with a machine learning based label fusion technique. The performance of the method for brain extraction from multi-modal data of 50 newborns is evaluated and compared with results obtained using eleven publicly available brain extraction methods. ALFA outperformed the eleven compared methods providing robust and accurate brain extraction results across different modalities. As ALFA can learn from partially labelled datasets, it can be used to segment large-scale datasets efficiently. ALFA could also be applied to other imaging modalities and other stages across the life course.

  14. Randomized, controlled, open-label, non-inferiority study of the CONSORT algorithm for individualized dosing of follitropin alfa

    NARCIS (Netherlands)

    Olivennes, F.; Trew, G.; Borini, A.; Broekmans, F.; Arriagada, P.; Warne, D. W.; Howles, C. M.

    2015-01-01

    In this randomized, controlled, open-label, phase IV study, ovarian response after a follitropin alfa starting dose determined by the CONSORT calculator was compared with a standard dose (150 IU). Normo-ovulatory women (aged 18-34 years) eligible for assisted reproductive techniques were recruited (

  15. Validación de un ELISA para la cuantificación de las impurezas proteicas de la cepa hospedera en el principio activo de la vacuna recombinante cubana contra la hepatitis B

    OpenAIRE

    Eliana Pérez; Susset Valderrama; Alain Baxera; Yunaisy Jiménez; Gerardo García; Lourdes Costa; Marisel Quintana

    2014-01-01

    Se validó un inmunoensayo tipo sandwich de doble anticuerpo para cuantificar las impurezas proteicas de la cepa hospedera que pueden estar presentes en el principio activo de la vacuna cubana contra la hepatitis B. Se prepararon los reactivos biológicos empleados en el ELISA. Las proteínas de la cepa hospedera se obtuvieron bajo las mismas condiciones que el proceso de producción de la proteína recombinante hasta un paso de semipurificación o purificación primaria. Los antisueros dirigidos co...

  16. Vectores recombinantes basados en el virus modificado de Ankara (MVA), con deleción en el gen C6L, como vacunas contra el VIH/SIDA y otras enfermedades

    OpenAIRE

    García-Arriaza, J.; Gómez, Carmen E.; Esteban, Mariano

    2011-01-01

    La presente invención se engloba dentro de los campos de la biología molecular y de la biotecnología. Específicamente se refiere a virus recombinantes basados en el virus modificado de Ankara (MVA) que expresan los antígenos gp120 y Gag-Pol-Nef del virus de la inmunodeficiencia humana (VIH-1) de subtipo B (MVA-B), sobre los que se ha delecionado el gen de vaccinia C6L, y que han sido diseñados para utilizarse como vacunas contra el VIH/SIDA y otras enfermedades.

  17. Vectores recombinantes basados en el virus modificado de ankara (MVA), con deleción en el gen C6L, como vacunas contra el VIH/SIDA y otras enfermedades

    OpenAIRE

    García-Arriaza, J.; Gómez, Carmen E.; Esteban, Mariano

    2011-01-01

    [ES] La presente invención engloba dentro de los campos de la biología molecular y de la biotecnología. Especificamente se refiere a virus recombinantes basados en el virus modificado de Ankara (MVA) que expresan los antigenos gp120 y Gag-Pol-Nef del virus de la inmunodeficienciahumana (VIH-1) de subtipo B (MVA-B), sobre los que see ha delecionado el gen de vaccinia C6L, y que han sido diseñados para utilizarse como vacunas contra el VIH/SIDA y otras enfermedades.

  18. Efecto de la hormona de crecimiento recombinante humana en la regeneración de nervio periférico: Trabajo experimental en el nervio cubital de la rata

    OpenAIRE

    Saceda Gutiérrez, Javier Manuel

    2016-01-01

    Tesis doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Medicina, Departamento de Cirugía. Fecha de lectura: Junio - 2016 Cuando se producen lesiones en los nervios periféricos se pueden utilizar diferentes sustancias o productos para intentar mejorar su crecimiento y reparación. En el presente trabajo valoramos la efectividad de la hormona de crecimiento recombinante humana (Somatropina, GH) en la lesión del nervio periférico de la rata Wistar. Mediante técnic...

  19. Comparación de la antigenicidad de dos péptidos sintéticos y una proteína recombinante de la región de transmembrana (gp21 del HTLV-I

    Directory of Open Access Journals (Sweden)

    Milenen Hernández Marin

    2007-01-01

    Full Text Available El virus de la leucemia de las células T humanas tipo I (HTLV-I fue el primer retrovirus linfotrópico aislado de pacientes humanos, en 1980. El gen env codifica la síntesis de la proteína precursora, gp62, que es degradada por una proteasa del virus en dos proteínas: gp21 y gp46, las cuales son expresadas en la superficie de la célula. La proteína de la transmembrana gp21 resulta una de las proteínas más antigénicas del virus del HTLV. Esta proteína, obtenida por la tecnología del ADN recombinante o por síntesis química, es ampliamente usada como antígeno en el diagnóstico del HTLV-I. En el presente trabajo, se evaluó la antigenicidad de dos péptidos sintéticos gp21 (M-1 (377-400 y gp21 (13 (361-404 y una proteína recombinante de la región de la transmembrana (gp21 del HTLV-I, con 23 muestras positivas del Panel PRP-205 (Boston Biomedica Inc y cinco muestras de pacientes seropositivos cubanos al HTLV-I, todas las muestras utilizadas en el estudio fueron confirmadas por el ensayo de Western Blot. La especificidad de estos antígenos se evaluó con 30 muestras de sueros de donantes sanos de un banco de sangre. Se obtuvo 62 % y 92 % de reactividad para los péptidos sintéticos gp21 (M-1, gp21 (13 y un 85 % para la proteína recombinante, respectivamente. La especificidad de los antígenos fue de 100 %. Este estudio demostró la alta reactividad de los péptidos sintéticos comparado con la proteína recombinante.

  20. Customized E-Learning for B2B Companies

    Directory of Open Access Journals (Sweden)

    Tim Thomasma

    2014-06-01

    Full Text Available Business-to-Business (B2B companies have customers that are primarily other corporations. These companies have unique problems in workplace training. They must train their customers and their customers’ employees. A B2B company may operate with only a few dozen employees, but they may need to help thousands of customers learn how to make best use of their product or service. Discussions with industry executives suggest an ideal training solution might include a number of features that are reviewed in this paper.

  1. Dificuldades na identificação laboratorial da talassemia alfa Difficulty on laboratory identification of alpha thalassemia

    Directory of Open Access Journals (Sweden)

    Karlla Greick Batista Dias-Penna

    2010-04-01

    Full Text Available Introdução: Talassemia alfa é uma síndrome associada à redução da síntese de cadeias de globina do tipo alfa. A gravidade das manifestações clínicas está relacionada com a quantidade de globinas produzida e a estabilidade das cadeias beta presentes em excesso. A talassemia alfa mínima resulta da deleção de apenas um dos quatro genes a (-α/αα. Clinicamente apresenta anemia leve com microcitose ou ausência de anemia, sendo o diagnóstico realizado por meio de visualização da hemoglobina (Hb H por eletroforese alcalina em acetato de celulose ou por identificação de inclusões celulares de Hb H coradas pelo azul de crezil brilhante. Objetivo: Avaliar portadores de talassemia alfa e seus respectivos progenitores, correlacionando perfil hematológico e presença de Hb H, utilizando procedimentos laboratoriais clássicos em três diferentes amostragens. Discussão e conclusão: Os dados obtidos mostram que a presença de Hb H, indicativo de talassemia alfa, pode não ser confirmada em uma análise posterior. Entre os fatores que podem influenciar no não aparecimento de Hb H em pessoa comprovadamente com talassemia alfa está a deficiência de ferro. A talassemia alfa está associada a defeitos envolvendo os genes codificadores da cadeia alfa, mas também pode estar relacionada com desbalanciamento temporário na expressão dos genes globina, diminuição de alfa ou aumento de beta, o que poderia explicar o aparecimento de tetrâmeros de cadeia beta (Hb H, sugerindo diagnóstico de talassemia alfa mínima.Introduction: Alpha thalassemia is a syndrome with associated with the reduction of alpha globin chain synthesis. The severity of clinical manifestations is related to the amount of globins produced and the stability of beta chains that are present in excess. Alpha thalassemia minor is caused by the deletion of one of the four genes a (-α/αα. Clinically, it presents mild anemia with microcytosis or absence of anemia. The

  2. Supporting B2B Business Documents in XML Web Services

    Institute of Scientific and Technical Information of China (English)

    KIM Hyoungdo

    2004-01-01

    While XML web services become recognized as a solution to business-to-business transactions, there are many problems that should be solved. For example, it is not easy to manipulate business documents of existing standards such as RosettaNet and UN/EDIFACT EDI, traditionally regarded as an important resource for managing B2B relationships. As a starting point for the complete implementation of B2B web services, this paper deals with how to support B2B business documents in XML web services. In the first phase, basic requirements for driving XML web services by business documents are introduced. As a solution, this paper presents how to express B2B business documents in WSDL, a core standard for XML web services. This kind of approach facilitates the reuse of existing business documents and enhances interoperability between implemented web services. Furthermore, it suggests how to link with other conceptual modeling frameworks such as ebXML/UMM, built on a rich heritage of electronic business experience.

  3. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    2010-01-01

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The Net

  4. Optimización de una técnica de medida de disrupción endocrina por medio de Saccharomyces cerevisiae recombinantes

    Directory of Open Access Journals (Sweden)

    Karen Keel

    2011-05-01

    Full Text Available Los disruptores endocrinos son sustancias químicas, exógenas al organismo, capaces de alterar la homeostasis del sistema endocrino-reproductivo. Un grupo de ellos, los compuestos estrogénicos, pueden ocasionar efectos negativos sobre la capacidad reproductiva de algunos peces, disminución de la fertilidad, la aptitud sexual y la producción de esperma y feminización de los machos. En este trabajo se describe el desempeno analítico de un método para la cuantificación de estrogenicidad en aguas. Se utilizó la técnica Yeast Estrogen Screen (YES con Saccharomyces cerevisiae recombinante, una levadura modificada genéticamente que expresa el receptor de estrógenos humano y un plasmido de expresión con el gen reportero lacZ, bajo el control de elementos de respuesta a estrógenos. Dicho gen codifica para la ƒÀ-galactosidasa, que se secreta al medio y metaboliza un sustrato cromogénico, observandose un cambio de color que se mide a 420 nm. Se utilizaron estándares de 17 ƒÀ-estradiol para realizar una curva de calibración en el rango de concentraciones entre 1.75 ng/l y 7.5 ƒÊg/l. Las curvas sigmoides dosis.respuesta obtenidas se ajustaron mediante la función de Hill y los r2 fueron mayores a 0,95. El limite de detección fue de 55 ng/l. La estrogenicidad para las muestras ensayadas fue no detectable.

  5. Teste intradérmico com proteínas recombinantes de Mycobacterium bovis como antígenos em Cavia porcellus

    Directory of Open Access Journals (Sweden)

    Elaine S.P. Melo

    2014-10-01

    Full Text Available O teste intradérmico para o diagnóstico da tuberculose bovina utiliza derivados proteicos purificados (PPD de Mycobacterium bovis que são capazes de induzir reações de hipersensibilidade em animais infectados. No entanto, apresenta baixa especificidade devido à ocorrência de reações cruzadas com outras micobactérias. Neste sentido, o objetivo desse trabalho foi produzir proteínas recombinantes (ESAT-6, PE13, PE5 e ESX-1 de Mycobacterium bovis e avaliá-las como antígenos em teste intradérmico utilizando Cavia porcellus como modelo, e verificar se as condições empregadas na purificação (nativa ou desnaturante interferem no desempenho antigênico dessas proteínas. As proteínas foram testadas em Cavia porcellus previamente sensibilizados com cepa M. bovis AN5 inativada, individualmente (160 µg ou combinadas na forma de um coquetel (40 µg cada. O coquetel de proteínas induziu reações de hipersensibilidade nos animais sensibilizados significativamente superiores (p=0,002 as observadas nos animais não sensibilizados, possibilitando diferenciação. No entanto, as proteínas isoladamente não foram capazes de promover essa diferenciação. As condições de solubilização e purificação influenciaram o desempenho antigênico da proteína ESAT-6, pois, quando produzida em condição desnaturante desencadeou reações inespecíficas nos animais não sensibilizados, enquanto que aquela produzida em condições nativas e aplicada em concentrações de 6, 12, 24 e 48µg induziu reações significativas apenas nos animais sensibilizados, confirmando o seu potencial como antígeno.

  6. The ATLAS Forward Detectors - LUCID, ALFA and AFP: Past, Present and Future

    CERN Document Server

    Caforio, D; The ATLAS collaboration

    2013-01-01

    LUCID is a gas Cerenkov detector deployed near to the beam‐pipe at 17 m either side of the ATLAS Intersection point. The LUCID detector ‐ when calibrated via a Van der Meer scan – is now measuring absolute luminosity on a bunch‐by‐bunch basis. It is now measuring integrated luminosity up to high luminosity with a precision of around 3%. The technical challenges that had to faced to make this measurement as well as upgrade plans for LUCID will be presented. In addition to LUCID, we will discuss that ALFA detector (Absolute Luminosity for ATLAS) and its status as well as the progress on the ATLAS Forward Protons project (AFP) that plans to deploy detectors to tag and measure, with 3‐D silicon detectors, both protons in exclusive central diffractive processes.

  7. Analise dos alelos S e Z da alfa 1 antitripsina em uma amostra de pacientes fibrocisticos

    OpenAIRE

    2002-01-01

    A fibrose cística é uma alteração genética que cursa principalmente com manifestações pulmonares e pancreáticas. A correlação genótipo-fenótipo da fibrose cística é motivo de árduos estudos. Somente a correlação com a insuficiência pancreática foi encontrada. Percebeu-se, também, que o curso e a severidade da manifestação pulmonar não estão correlacionados com o genótipo CFTR. A alfaI antitripsina inibe as proteases que desencadeiam as reações inflamatórias do plasma. Seu papel inibitório mai...

  8. Arecibo Pulsar Survey Using ALFA. III. Probing Radio Pulsar Intermittency and Transients

    CERN Document Server

    Deneva, J S; McLaughlin, M A; Nice, D J; Lorimer, D R; Crawford, F; Bhat, N D R; Camilo, F; Champion, D J; Freire, P C C; Edel, S; Kondratiev, V I; Hessels, J W T; Jenet, F A; Kasian, L; Kaspi, V M; Krämer, M; Lazarus, P; Van Leeuwen, J; Ransom, S M; Stairs, I H; Stappers, B W; Brazier, A; Venkataraman, A; Zollweg, J A

    2008-01-01

    We present radio transient search algorithms, results, and statistics from the ongoing Arecibo Pulsar ALFA (PALFA) Survey of the Galactic plane. We have discovered seven objects by detecting isolated dispersed pulses and one of the new discoveries has a duty cycle of 0.01%, the smallest known. The impact of selection effects on the detectability and classification of intermittent sources is discussed, and the relative efficiencies of periodicity vs. single pulse searches are compared for various pulsar classes. We find that scintillation, off-axis detection and few rotation periods within an observation may misrepresent normal periodic pulsars as intermittent sources. Finally, we derive constraints on transient pulse rate and flux density from the PALFA survey parameters and results.

  9. GRIN2B predicts attention problems among disadvantaged children.

    Science.gov (United States)

    Riva, Valentina; Battaglia, Marco; Nobile, Maria; Cattaneo, Francesca; Lazazzera, Claudio; Mascheretti, Sara; Giorda, Roberto; Mérette, Chantal; Émond, Claudia; Maziade, Michel; Marino, Cecilia

    2015-07-01

    It is well established that adversities and GRIN2B (coding an N-methyl-D-aspartate receptor subunit) are independently associated with behavioral and cognitive impairments in childhood. However, a high proportion of children exposed to adversities have good, long-term outcomes. We hypothesized that among children exposed to adversities, GRIN2B variants would predict the worst cognitive and behavioral outcomes. 6 single nucleotide polymorphisms of GRIN2B were genotyped in 625 children aged 6-11 years from an Italian community-based sample. The interacting effect of GRIN2B variants with 4 measures of adversities [low socioeconomic status (SES), preterm delivery, maternal smoking during pregnancy, and absence of breastfeeding] was investigated upon blindly assessed cognitive abilities (vocabulary, block design, digit spans of Wechsler's Intelligence Scale, and Rey complex figure) and parents-rated behavioral problems (Child Behavior Checklist/6-18). Rs2268119 × SES interaction (Hotelling's Trace = 0.07; F(12,1154) = 3.53; p = 0.00004) influenced behavior, with more attention problems among children in the 'either A/T or T/T genotype and low SES' group, compared to all other groups. This interaction effect was not significant in an independent, replication sample of 475 subjects from an Italian community-based sample. GRIN2B variants predict children with the worst outcome in attention functioning among children exposed to low SES. Our findings, if replicated, could help in the identification of children with the highest risk and may prompt cost-effective preventive/treatment strategies.

  10. Mechanochemical synthesis and characterization of pure Co$_2$B nanocrystals

    Indian Academy of Sciences (India)

    MUSTAFA BARIS; TUNCAY SIMSEK; ADNAN AKKURT

    2016-08-01

    Cobalt boride (Co$_2$B) is a significant transition metal boride having a wide range of usage area due to its high oxidation, abrasion and corrosion resistance as well as its superior electrochemical, magnetic and anisotropicproperties. In this study, pure Co2B nanocrystals were synthesized with Co, B$_2$O$_3$ and Mg as starting materials via the mechanochemical synthesis (MCS) method by high-energy planetary ball mill in a hardened steel vial withhardened steel balls. All the experiments were conducted under Ar atmosphere at different rotational speeds and at 20:1–30:1–40:1 ball-to-powder ratios. Leaching of Co$_2$B $+$ MgO powder mixtures occurred after milling andpurified with acetic acid and pure Co$_2$B nanocrystals were obtained in solid form. The Co2Bs were characterized through X-ray diffraction, scanning electronmicroscopy, vibrating samplemagnetometer, Brunauer–Emmett–Tellerand specific density analyses, and effects of synthesis parameters on product properties were revealed. Surface areas of the powders synthesized at 40:1 ball-to-powder ratio at different rotational speeds were measured as 21.14,40.36 and 52.33 m$^2$ g$^{−1}$, respectively. Crystallite sizes of Co$_2$B nanocrystals were between 7.27 and 9.84 nm and their specific density varied between 7.61 and 7.78 g cm$^{−3}$. It was determined that all samples were saturated and exhibited hysteresis and ferromagnetic behaviours, and saturation magnetization was between 35 and 50 emu g$^{−1}$.

  11. Recombinant interferon alfa-2a, an active agent in advanced cutaneous T-cell lymphomas.

    Science.gov (United States)

    Bunn, P A; Ihde, D C; Foon, K A

    1987-01-01

    The cutaneous T-cell lymphomas including mycosis fungoides and the Sézary syndrome, are indolent lymphomas with early systemic dissemination. Like the indolent B-cell lymphomas, they cannot be cured by currently available systemic chemotherapy so new systemic therapies need to be developed. A study of very high-dose recombinant interferon alfa-2a was, therefore, initiated in 20 patients with advanced cutaneous T-cell lymphoma (5 in stage II, 2 in stage III and 13 in stage IV). All patients were refractory to at least 2 standard therapies, including topical nitrogen mustard (18 patients), psoralens and ultraviolet A light (12 patients), total skin electron irradiation (14 patients) and systemic chemotherapy (16 patients). Nine out of 20 patients (45%; 95% confidence interval 25-69%) had either objective partial or complete responses within 3 months of starting treatment. Maximal response, however, often did not occur for at least one year. The median duration of response was 5.5 months and all complete responses lasted more than 2 years. Response frequencies were equal at both cutaneous and extracutaneous sites and in patients with or without prior chemotherapy. Toxicity was exhibited primarily as a flu-like syndrome consisting of fever, malaise, fatigue, anorexia and weight loss which necessitated dose reductions in all patients. Transient elevations in liver function and decreases in renal function and granulocyte counts occurred in some patients. It is concluded that interferon alfa-2a is highly active against advanced cutaneous T-cell lymphomas and that it should be studied in its early stages. It should also be evaluated in combination with other biological agents and with chemotherapy.

  12. Properties of Cold HI Emission Clouds in the Inner-Galaxy ALFA Survey

    Science.gov (United States)

    Hughes, James Marcus; Gibson, Steven J.; Noriega-Crespo, Alberto; Newton, Jonathan; Koo, Bon-Chul; Douglas, Kevin A.; Peek, Joshua Eli Goldston; Park, Geumsook; Kang, Ji-hyun; Korpela, Eric J.; Heiles, Carl E.; Dame, Thomas M.

    2017-01-01

    Star formation, a critical process within galaxies, occurs in the coldest, densest interstellar clouds, whose gas and dust content are observed primarily at radio and infrared wavelengths. The formation of molecular hydrogen (H2) from neutral atomic hydrogen (HI) is an essential early step in the condensation of these clouds from the ambient interstellar medium, but it is not yet completely understood, e.g., what is the predominant trigger? Even more troubling, the abundance of H2 may be severely underestimated by standard tracers like CO, implying significant "dark" H2, and the quantity of HI may also be in error if opacity effects are neglected. We have developed an automated method to account for both HI and H2 in cold, diffuse clouds traced by narrow-line HI 21-cm emission in the Arecibo Inner-Galaxy ALFA (I-GALFA) survey. Our algorithm fits narrow (2-5 km/s), isolated HI line profiles to determine their spin temperature, optical depth, and true column density. We then estimate the "visible" H2 column in the same clouds with CfA and Planck CO data and the total gas column from dust emission measured by Planck, IRAS, and other surveys. Together, these provide constraints on the dark H2 abundance, which we examine in relation to other cloud properties and stages of development. Our aim is to build a database of H2-forming regions with significant dark gas to aid future analyses of coalescing interstellar clouds. We acknowledge support from NSF, NASA, Western Kentucky University, and Williams College. I-GALFA is a GALFA-HI survey observed with the 7-beam ALFA receiver on the 305-meter William E. Gordon Telescope. The Arecibo Observatory is a U.S. National Science Foundation facility operated under sequential cooperative agreements with Cornell University and SRI International, the latter in alliance with the Ana G. Mendez-Universidad Metropolitana and the Universities Space Research Association.

  13. Propiedades electrofisiológicas de las variantes normales de actividad alfa en el continuo vigilia-sueño

    Directory of Open Access Journals (Sweden)

    José Luis Cantero

    2001-01-01

    Full Text Available El estudio de los ritmos cerebrales puede ser abordado mediante el análisis de sus propiedades electrofisiológicas usando técnicas de EEG cuantitativo. En aquellos casos donde una misma actividad aparece espontáneamente en diferentes estados de activación cerebral, el estudio de estas propiedades ayudaría a establecer diferencias funcionales asociadas a cada uno de estos estados. El presente trabajo revisa aquellos estudios que han determinado las propiedades electrofisiológicas de las diferentes variantes normales de alfa que aparecen en el continuo vigilia-sueño, más concretamente en vigilia relajada, somnolencia y durante la fase REM del sueño. Los resultados indican que cada variante normal de alfa, aun mostrando una distribución topográfica similar en cada uno de los estados cerebrales, presenta características diferenciales atendiendo a su composición espectral, relaciones funcionales entre regiones corticales, y micro-estados cerebrales subyacentes. De acuerdo con estos hallazgos, cada variante de alfa desempeñaría diferentes funciones cerebrales. El ritmo alfa de vigilia parece ser el resultado de una máxima sincronización neuronal como consecuencia de la ausencia de procesamiento sensorial, mientras que la presencia de actividad alfa durante la somnolencia estaría más asociada al procesamiento de las imágenes hipnagógicas que ocurren al comienzo del sueño. Los brotes de alfa de REM, sin embargo, constituirían un punto de contacto entre el cerebro dormido y el ambiente externo. Esta caracterización electrofisiológica encuentra su campo de aplicación más directo en el diseño de algoritmos para clasificar el sueño de forma automática, así como en el diagnóstico y evaluación de determinadas patologías donde pudieran verse afectados los mecanismos cerebrales de generación de esta actividad a lo largo del continuo vigilia-sueño.

  14. Chemical Reactivity Perspective into the Group 2B Metals Halides.

    Science.gov (United States)

    Özen, Alimet Sema; Akdeniz, Zehra

    2016-06-30

    Chemical reactivity descriptors within the conceptual density functional theory can be used to understand the nature of the interactions between two monomers of the Group 2B metal halides. This information might be valuable in the development of adequate force law parameters for simulations in the liquid state. In this study, MX2 monomers and dimers, where M = Zn, Cd, Hg and X = F, Cl, Br, I, were investigated in terms of chemical reactivity descriptors. Relativistic effects were taken into account using the effective core potential (ECP) approach. Correlations were produced between global and local reactivity descriptors and dimerization energies. Results presented in this work represent the first systematic investigation of Group 2B metal halides in the literature from a combined point of view of both relativistic effects and chemical reactivity descriptors. Steric effects were found to be responsible for the deviation from the chemical reactivity principles. They were introduced into the chemical reactivity descriptors such as local softness.

  15. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...... and is independent of specific implementation technologies. In the next stage of the research the emerging reference model will be extended to create an assessment model for analysing the maturity level of a given company in a specific supply chain....

  16. Structured Crowdsourcing: A B2B Innovation Roadmap

    DEFF Research Database (Denmark)

    Edgeman, Rick; Engell, Toke; Jensen, Nik Grewy

    Crowdsourcing is an increasingly popular source of both ideas and funding. Crowdsourcing in a B2B context is less well understood and, as such, much of our discussion will highlight business-to-business crowdsourcing. More generally discussion will address crowdsourcing relative to innovation...... from crowd-sourcing efforts. The roadmap emphasizes on early stages in the overall innovation management activity that is related to development and specification of the task to be crowdsourced, the identification of the crowd, the creation of the environment to connect the crowdsourcer, the task...... and the crowd, motivation of the crowd, and actual activities in reaching the crowd. Managing the input from the crowd is regarded as a later stage in the overall innovation management but also as a focal point in the arguments for improving B2B crowdsourcing. In crowd selection processes this paper aims...

  17. B2B Models for DoD Acquisition

    Science.gov (United States)

    2008-01-15

    business (B2B) e- commerce refers to transactions between businesses conducted electronically over the Internet, intranets, extranets, or private...types of electronic marketplace participation: 1) Sell-side, 2) Buy- side, 3) Exchanges, and 4) Collaborative commerce . In sell-side commerce , there...types are collectively referred to as company-centric electronic commerce , because they address a single company buying or selling needs. Exchanges

  18. Inbound-markkinoinnin opas pienille B2B-asiantuntijayrityksille

    OpenAIRE

    Halonen, Tuija

    2016-01-01

    Digitalisaatio on muuttanut asiakkaiden ostokäyttäytymistä, minkä vuoksi myös markkinoinnin on muututtava. Asiakaslähtöinen inbound-markkinointi on vetovoimainen vaihtoehto perinteiselle yksisuuntaiselle markkinoinnille, jonka teho on laskussa. Tämän toiminnallisen opinnäytetyön tarkoituksena oli rakentaa opas, joka auttaa pieniä suomalaisia B2B-asiantuntijayrityksiä suunnittelemaan ja toteuttamaan toimivaa ja kustannustehokasta inbound-markkinointia. Teoreettisen viitekehyksen pohjal...

  19. CBERS-2B Monitored Forest Fires In Yunnan Province

    Institute of Scientific and Technical Information of China (English)

    Rain.L

    2008-01-01

    @@ Several forest fires hit Yunnan Province,in the southwest of China from April 6 to 9.Two disastrous fires happened near Shangri-La County,Yunnan Province.According to the requirement of the Land and Surveying Department of Yunnan Province,the China Center for Resources Satellite Data & Application (CRESDA) provided satellite monitoring images to detect the events.The processed CBERS-2B images were delivered to the related departments for decision making and disaster relief.

  20. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  1. A Randomized Study of Peginterferon Lambda-1a Compared to Peginterferon Alfa-2a in Combination with Ribavirin and Telaprevir in Patients with Genotype-1 Chronic Hepatitis C

    Science.gov (United States)

    Flisiak, Robert; Shiffman, Mitchell; Arenas, Juan; Cheinquer, Hugo; Nikitin, Igor; Dong, Yuping; Rana, Khurram; Srinivasan, Subasree

    2016-01-01

    Background A randomized, double-blind, multinational, phase 3 study was conducted comparing the efficacy and safety of peginterferon lambda-1a (Lambda)/ribavirin (RBV)/telaprevir (TVR) vs. peginterferon alfa-2a (Alfa)/RBV/TVR in patients with chronic hepatitis C virus (HCV) genotype-1 (GT-1) infection. Methods Patients (treatment-naïve or relapsers on prior Alfa/RBV treatment) were randomly assigned in a 2:1 ratio to receive Lambda/RBV/TVR or Alfa/RBV/TVR. Total duration of treatment was either 24 or 48 weeks (response-guided treatment), with TVR administered for the first 12 weeks. The primary endpoint was the proportion of patients who achieved a sustained virologic response at post treatment week 12 (SVR12), which was tested for noninferiority of Lambda/RBV/TVR. Results A total of 838 patients were enrolled, and 617 were treated; 411 and 206 patients received Lambda/RBV/TVR and Alfa/RBV/TVR, respectively. The majority of patients were treatment-naïve, with HCV GT-1b and a high baseline viral load (≥800,000 IU/mL). Less than 10% of patients had cirrhosis (Lambda, 7.5%; Alfa, 6.8%). Lambda/RBV/TVR did not meet the criterion for noninferiority (lower bound of the treatment difference interval was -12.3%); the SVR12 in all patients (modified intent-to-treat) was 76.2% in the Lambda arm and 82.0% in the Alfa arm. Overall, the frequency of adverse events in each arm was comparable (Lambda, 91.7%; Alfa, 97.1%). As expected based on the safety profile of the 2 interferons, there were more hepatobiliary events observed in the Lambda arm and more hematologic events in the Alfa arm. Conclusions In this comparison of Lambda/RBV/TVR and Alfa/RBV/TVR in patients who were treatment-naïve or had relapsed on prior Alfa/RBV treatment, Lambda failed to demonstrate noninferiority based on SVR12 results. Treatment with Lambda/RBV/TVR was associated with a higher incidence of relapse. More patients discontinued Lambda/RBV/TVR treatment during the first 4 weeks of study treatment

  2. 40 CFR Table 2b to Subpart E of... - Reactivity Factors for Aliphatic Hydrocarbon Solvent Mixtures

    Science.gov (United States)

    2010-07-01

    ... Hydrocarbon Solvent Mixtures 2B Table 2B to Subpart E of Part 59 Protection of Environment ENVIRONMENTAL... Hydrocarbon Solvent Mixtures Bin Averageboiling point * (degrees F) Criteria Reactivityfactor 1 80-205 Alkanes... + Dry Point) / 2 (b) Aromatic Hydrocarbon Solvents...

  3. Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy was underpowered

    Directory of Open Access Journals (Sweden)

    Ortiz A

    2015-11-01

    Full Text Available Alberto Ortiz,1,2 Maria Dolores Sanchez-Niño1,2 1Department of Nephrology, IIS-Fundacion Jimenez Diaz, School of Medicine, Universidad Autónoma de Madrid, 2Department of Nephrology, Instituto Reina Sofia de Investigación Nefrológica, Madrid, Spain We read with interest the report by Goláň et al on the “Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy in adults with Fabry disease”.1 Based on the reported results, the authors conclude that no efficacy or safety differences were found when the approved every-other-week (EOW dosage of agalsidase alfa was increased to weekly administration. However, the key question is whether the study, as designed and performed, could have had a different outcome. View original article by Goláň et al.

  4. Deficiência de alfa-1-antitripsina na doença pulmonar obstrutiva crónica

    OpenAIRE

    2009-01-01

    Introdução – A deficiência de alfa-1-antitripsina é uma das alterações genéticas graves encontradas por todo o mundo. Porém, permanece subdiagnosticada, apesar da forte predisposição à doença pulmonar obstrutiva crónica que condiciona. Objectivos – Os objectivos deste artigo de revisão incluem o estudo e avaliação das implicações da deficiência de alfa-1-antitripsina em indivíduos com doença pulmonar obstrutiva crónica, a apresentação dos esquemas de diagnóstico e terapêuticos mais utiliza...

  5. Fe3O4/Au magnetic nanoparticle amplification strategies for ultrasensitive electrochemical immunoassay of alfa-fetoprotein

    Directory of Open Access Journals (Sweden)

    Gan N

    2011-12-01

    Full Text Available Ning Gan1*, Haijuan Jin1*, Tianhua Li1, Lei Zheng21The State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Material Science and Chemical Engineering, Ningbo University, Ningbo, 2Department of Laboratory Medicine, Nanfang Hospital, Southern Medical University, Guangzhou, People's Republic of China *Both authors contributed equally to this workBackground: The purpose of this study was to devise a novel electrochemical immunosensor for ultrasensitive detection of alfa-fetoprotein based on Fe3O4/Au nanoparticles as a carrier using a multienzyme amplification strategy.Methods and results: Greatly enhanced sensitivity was achieved using bioconjugates containing horseradish peroxidase (HRP and a secondary antibody (Ab2 linked to Fe3O4/Au nanoparticles (Fe3O4/Au-HRP-Ab2 at a high HRP/Ab2 ratio. After a sandwich immunoreaction, the Fe3O4/Au-HRP-Ab2 captured on the electrode surface produced an amplified electrocatalytic response by reduction of enzymatically oxidized hydroquinone in the presence of hydrogen peroxide. The high content of HRP in the Fe3O4/Au-HRP-Ab2 could greatly amplify the electrochemical signal. Under optimal conditions, the reduction current increased with increasing alfa-fetoprotein concentration in the sample, and exhibited a dynamic range of 0.005–10 ng/mL with a detection limit of 3 pg/mL.Conclusion: The amplified immunoassay developed in this work shows good precision, acceptable stability, and reproducibility, and can be used for detection of alfa-fetoprotein in real samples, so provides a potential alternative tool for detection of protein in the laboratory. Furthermore, this immunosensor could be regenerated by simply using an external magnetic field.Keywords: Fe3O4/Au nanoparticles, alfa-fetoprotein, sandwich immunoassay, electrochemical immunosensor

  6. Detection of DNA-recombinant human epoetin-alfa as a pharmacological ergogenic aid.

    Science.gov (United States)

    Wilber, Randall L

    2002-01-01

    The use of DNA-recombinant human epoetin-alfa (rhEPO) as a pharmacological ergogenic aid for the enhancement of aerobic performance is estimated to be practised by at least 3 to 7% of elite endurance sport athletes. rhEPO is synthesised from Chinese hamster ovary cells, and is nearly identical biochemically and immunologically to endogenous epoetin-alfa (EPO). In a clinical setting, rhEPO is used to stimulate erythrocyte production in patients with end-stage renal disease and anaemia. A limited number of human studies have suggested that rhEPO provides a significant erythropoietic and ergogenic benefit in trained individuals as evidenced by increments in haemoglobin, haematocrit, maximal oxygen uptake (VO2max) and exercise endurance time. The purpose of this review is to summarise the various technologies and methodologies currently available for the detection of illicit use of rhEPO in athletes. The International Olympic Committee (IOC) banned the use of rhEPO as an ergogenic aid in 1990. Since then a number of methods have been proposed as potential techniques for detecting the illegal use of rhEPO. Most of these techniques use indirect markers to detect rhEPO in blood samples. These indirect markers include macrocytic hypochromatic erythrocytes and serum soluble transferrin receptor (sTfr) concentration. Another indirect technique uses a combination of 5 markers of enhanced erythropoiesis (haematocrit, reticulocyte haematocrit, percentage of macrocytic red blood cells, serum EPO, sTfr) to detect rhEPO. The electrophoretic mobility technique provides a direct measurement of urine and serum levels of rhEPO, and is based on the principle that the rhEPO molecule is less negatively charged versus the endogenous EPO molecule. Isoelectric patterning/focusing has emerged recently as a potential method for the direct analysis of rhEPO in urine. Among these various methodologies, the indirect technique that utilises multiple markers of enhanced erythropoiesis appears to

  7. Assessment of Lifespan Functioning Attainment (ALFA) scale: A quantitative interview for self-reported current and functional decline in schizophrenia.

    Science.gov (United States)

    Joseph, Jamie; Kremen, William S; Glatt, Stephen J; Franz, Carol E; Chandler, Sharon D; Liu, Xiaohua; Johnson, Barbara K; Tsuang, Ming T; Twamley, Elizabeth W

    2015-06-01

    Schizophrenia has been characterized as a disorder with poor outcomes across various functional domains, especially social and occupational functioning. Although these outcomes have been investigated based on patients' current functioning, few studies have considered the assessment of functional outcomes across the lifespan in schizophrenia. We developed a novel and brief scale of adulthood lifespan functioning, the Assessment of Lifespan Functioning Attainment (ALFA). We assessed current functioning and percentage of pre- and post-psychosis onset engagement for five functional domains including paid employment, living independently, romantic partnerships, close friendships, and recreational engagement with others. Pre-to post-psychosis functional decline was observed for all domains, with paid employment having the greatest decline (d = 2.68) and living independently having the least decline (d = .59). Our exploratory factor analysis suggests that a single factor accounted for the most variance in Pre-Psychosis Functioning in ALFA domains. Two factors explain the majority of variance in Post-Psychosis Functioning and Pre-to-Post Psychosis Decline: a sociability factor (close friendships and recreational engagement with others) and an independence factor (paid employment, living independently, romantic relationships). To our knowledge, this is the first study to report on a self-reported quantitative assessment of adult lifespan functioning in schizophrenia. The ALFA scale may be a useful tool for future research on functional outcomes in schizophrenia.

  8. The oxidation of methionine-54 of epoetinum alfa does not affect molecular structure or stability, but does decrease biological activity.

    Science.gov (United States)

    Labrenz, Steven R; Calmann, Melissa A; Heavner, George A; Tolman, Glen

    2008-01-01

    Erythropoietin therapy is used to treat severe anemia in renal failure and chemotherapy patients. One of these therapies based on recombinant human erythropoietin is marketed under the trade name of EPREX and utilizes epoetinum alfa as the active pharmaceutical ingredient. The effect of oxidation of methionine-54 on the structure and stability of the erythropoietin molecule has not been directly tested. We have observed partial and full chemical oxidation of methionine-54 to methionine-54 sulfoxide, accomplished using tert-Butylhydroperoxide and hydrogen peroxide, respectively. A blue shift in the fluorescence center of spectral mass wavelength was observed as a linear response to the level of methionine sulfoxide in the epoetinum alfa molecule, presumably arising from a local change in the environment near tryptophan-51, as supported by potassium iodide quenching studies. Circular dichroism studies demonstrated no change in the folded structure of the molecule with methionine oxidation. The thermal unfolding profiles of partial and completely oxidized epoetinum alfa overlap, with a T(m) of 49.5 degrees C across all levels of methionine sulfoxide content. When the protein was tested for activity, a decrease in biological activity was observed, correlating with methionine sulfoxide levels. An allosteric effect between Met54, Trp51, and residues involved in receptor binding is proposed. These results indicate that methionine oxidation has no effect on the folded structure and global thermodynamic stability of the recombinant human erythropoietin molecule. Oxidation can affect potency, but only at levels significantly in excess of those seen in EPREX.

  9. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  10. Evaluación serológica de una proteína recombinante a partir de una cepa aislada del virus de la fiebre amarilla en el Perú: un estudio piloto

    Directory of Open Access Journals (Sweden)

    Carlos Yábar V

    2003-10-01

    Full Text Available Objetivo: Evaluar serológicamente una proteína recombinante de 66 kDa (Er66 de una cepa del virus de la fiebre amarilla aislada en el Perú usando anticuerpos inmunoreactivos. Material y métodos: La proteína Er66 fue expresada in vitro en la bacteria Escherichia coli y enfrentada a títulos de 1/100, 1/50 y 1/25 de anticuerpos monoclonales, y a sueros con anticuerpos IgM e IgG inmunoreactivos contra el virus de la fiebre amarilla mediante ensayos de Western blot (WB. Asimismo, se evaluaron proteínas totales de las cepas de referencia del virus dengue (DEN y fiebre amarilla como controles de antigenicidad. Resultados: La proteína recombinante Er66 presentó antigenicidad contra títulos de 1/50 y 1/25 de anticuerpo monoclonal (MAB8701; sin embargo, no se observó inmunoreactividad en sueros positivos para fiebre amarilla y dengue. Los ensayos con extractos crudos de la cepa de fiebre amarilla Asibi 17D (PTFA revelaron que la antigenicidad de las proteínas virales comprendidas entre 60 y 80 kDa fue afectada negativamente a temperaturas desnaturalizantes de 100°C. En cambio, tratamientos con ß-mercaptoetanol sin calor generó un aumento de la antigenicidad de dichas proteínas. Siguiendo este mismo principio, la proteína Er66 fue sometida a tratamientos desnaturalizantes con ß-mercaptoetanol sin incluir calor y fue enfrentada nuevamente a los sueros reactivos. El resultado final reveló que la proteína Er66 generó inmunoreactividad frente a sueros con altos títulos de anticuerpos IgM e IgG para fiebre amarilla mientras que en otras muestras se observó una débil señal. Conclusiones: Los datos obtenidos en este trabajo demuestran que la Er66 pudo ser reconocida por anticuerpos IgM e IgG específicos para fiebre amarilla presentes en sueros de pacientes infectados. Los datos presentados en este artículo sugieren el uso de proteínas recombinantes como posibles candidatas de valor diagnóstico para la FA.

  11. Produção de antissoro policlonal utilizando a proteína capsidial recombinante do Rupestris stem pitting-associated virus Production of polyclonal antiserum using recombinant coat protein of Rupestris stem pitting -associated virus

    Directory of Open Access Journals (Sweden)

    Marcos Fernando Basso

    2010-11-01

    Full Text Available O Rupestris stem pitting-associated virus (RSPaV é o agente causal das caneluras do lenho da videira. Este trabalho teve como objetivo produzir antissoro policlonal a partir da proteína capsidial (CP recombinante do RSPaV e avaliar a sua especificidade e sensibilidade. O gene da CP do RSPaV, com 780pb, foi previamente caracterizado. Esse gene foi subclonado no sítio de restrição EcoRI, no vetor de expressão pRSET-B e o plasmídeo recombinante foi utilizado para induzir a expressão da CP em Escherichia coli. A CP, ligada a uma cauda de seis histidinas, foi purificada por meio de cromatografia de afinidade em coluna de Ni-NTA a partir do extrato de proteínas totais extraídas de E. coli. A identidade da proteína purificada foi confirmada em SDS-PAGE e Western blot, utilizando-se anticorpos comerciais contra a cauda de seis histidinas. A CP recombinante expressada in vitro apresentou massa molecular de cerca de 31kDa. A proteína purificada foi quantificada e 2,55mg foram utilizados para a imunização de um coelho. O antissoro policlonal obtido reagiu com diferentes isolados deste vírus, extraídos de videiras em ELISA indireto.RSPaV is the causal agent of pitting in the grapevine woody cylinder. The aim of this research was to produce polyclonal antiserum against recombinant RSPaV coat protein (CP and evaluate its specificity and sensibility. The CP gene (780bp of RSPaV was previously characterized. This gene was subcloned into the EcoRI site of the pRSET-B expression vector and the recombinant plasmid was used to induce the expression of the CP in E. coli cells. The CP, fused to a 6-His-tag, was purified from E. coli total protein extract by affinity chromatography using Ni-NTA resin. Identity of the purified protein was confirmed by SDS-PAGE and Western blot, using antibodies against the histidine tail. The in vitro-expressed recombinant CP presented a MW of ca. 31kDa. The purified protein was quantified and 2.55mg used for the

  12. Uso de fator VII recombinante ativado para tratamento e profilaxia de grandes sangramentos Use of recombinant activated factor VII for treatment and prophylaxis of major bleeding

    Directory of Open Access Journals (Sweden)

    Flávio Augusto Henriques Vince

    2009-09-01

    Full Text Available INTRODUÇÃO: O fator VII recombinante ativado (rFVIIa é uma proteína produzida por engenharia genética, cuja estrutura é muito semelhante à do fator VII intrínseco ativado (FVII. Sua ação se baseia no conhecimento do mecanismo de coagulação in vivo agindo na ativação direta do fator X resultando em formação independente de trombina no local da lesão e contribuindo dessa forma para formação de coágulo estável de fibrina sem a ação dos fatores VIII e IX. MÉTODOS: Foi realizada ampla revisão da literatura com o objetivo de determinar os achados recentes relacionados ao uso de fator VII recombinante ativado em pacientes com sangramento severo. RESULTADOS: Constatou-se que o uso de rFVIIa foi iniciado na década de 80 para profilaxia e tratamento de sangramento em pacientes com antecedente de hemofilia A ou B com inibidores de fator VIII e IX, deficiência de fator VII e trombastenia de Glanzmann refratários à reposição plaquetária. Em 1999 seu uso foi ampliado para outras situações clínicas e dessa forma, começaram a ser publicados diversos trabalhos mostrando a eficácia do rFVIIa como agente pró-hemostático em paciente com outras coagulopatias ou pacientes previamente hígidos com história de sangramento agudo de grande monta. Trauma é a principal causa de mortalidade no mundo sendo sangramento incontrolado o principal desafio no atendimento a estes pacientes. É comum a associação de trauma com coagulopatia, necessitando em algumas situações de terapia específica para o tratamento da mesma. Neste momento a terapia adjuvante com rFVIIa deve ser considerada. Outras causas comuns de sangramento são as operações cardíacas e ginecológicas/ obstétricas e doenças envolvendo o fígado. A coagulopatia nesses casos ocorre por deficiência dos fatores dependentes de vitamina K, sendo o FVII o com menor meia-vida. CONCLUSÃO: O uso de rFVIIa tem sido sugerido como opção terapêutica promissora para esses

  13. Effect of wool and thermo-binder fibers on adhesion of alfa fibers in polyester composite

    Science.gov (United States)

    Omri, Med. Amin; Triki, A.; Guicha, M.; Hassen, Med. Ben; Arous, M.; Ahmed El Hamzaoui, H.; Bulou, A.

    2013-12-01

    Dielectric study was investigated in order to probe the interfacial region fibers/matrix of the polyester composite reinforced with alfa/wool/thermo-binder fibers. Dielectric spectra were measured in the frequency range from 10-1 Hz to 106 Hz, and temperature interval from 40 °C to 150 °C. This study revealed the presence of two dielectric relaxations in the composite. While the first one was attributed to the α mode relaxation associated with the glass transition of the matrix, the second was associated with the conductivity resulting from the carriers' charges diffusion noted for high temperature above glass transition and low frequencies. As this study did not show the presence of the interfacial polarization effect in the composite, it was accomplished with the vibrational study using the FT-IR and Raman techniques. A great compatibility between fibers and matrix was proven by a less hydrophilic character of the reinforcement giving rise to additional valence vibrations from wool fibers and hydrogen bonds.

  14. Arecibo Pulsar Survey Using ALFA. III. Precursor Survey and Population Synthesis

    CERN Document Server

    Swiggum, J K; McLaughlin, M A; Bates, S D; Champion, D J; Ransom, S M; Lazarus, P; Brazier, A; Hessels, J W T; Nice, D J; Ellis, J; Senty, T R; Allen, B; Bhat, N D R; Bogdanov, S; Camilo, F; Chatterjee, S; Cordes, J M; Crawford, F; Deneva, J S; Freire, P C C; Jenet, F A; Karako-Argaman, C; Kaspi, V M; Knispel, B; Lee, K J; Van Leeuwen, J; Lynch, R; Lyne, A G; Scholz, P; Siemens, X; Stairs, I H; Stappers, B W; Stovall, K; Venkataraman, A; Zhu, W W

    2014-01-01

    The Pulsar Arecibo L-band Feed Array (PALFA) Survey uses the ALFA 7-beam receiver to search both inner and outer Galactic sectors visible from Arecibo ($32^{\\circ}\\lesssim \\ell \\lesssim 77^{\\circ}$ and $168^{\\circ}\\lesssim \\ell \\lesssim 214^{\\circ}$) close to the Galactic plane ($|b|\\lesssim5^{\\circ}$) for pulsars. In this paper we detail a precursor survey of this region with PALFA, which observed a subset of the full region (slightly more restrictive in $\\ell$ and $|b|\\lesssim1^{\\circ}$) and detected 45 pulsars. For both Galactic millisecond and normal pulsar populations, we compare the survey's detections with simulations to model these populations and, in particular, to estimate the number of observable pulsars in the Galaxy. We place 95\\% confidence intervals of 82,000 to 143,000 on the number of detectable normal pulsars and 9,000 to 100,000 on the number of detectable millisecond pulsars in the Galactic disk. These are consistent with previous estimates. Given the most likely population size in each ca...

  15. Reversing anticoagulant effects of novel oral anticoagulants: role of ciraparantag, andexanet alfa, and idarucizumab

    Directory of Open Access Journals (Sweden)

    Hu TY

    2016-02-01

    Full Text Available Tiffany Y Hu,1 Vaibhav R Vaidya,2 Samuel J Asirvatham2,31Mayo Medical School, 2Division of Cardiovascular Diseases, Department of Internal Medicine, 3Department of Pediatrics and Adolescent Medicine, Mayo Clinic, Rochester, MN, USAAbstract: Novel oral anticoagulants (NOACs are increasingly used in clinical practice, but lack of commercially available reversal agents is a major barrier for mainstream use of these therapies. Specific antidotes to NOACs are under development. Idarucizumab (aDabi-Fab, BI 655075 is a novel humanized mouse monoclonal antibody that binds dabigatran and reverses its anticoagulant effect. In a recent Phase III study (Reversal Effects of Idarucizumab on Active Dabigatran, a 5 g intravenous infusion of idarucizumab resulted in the normalization of dilute thrombin time in 98% and 93% of the two groups studied, with normalization of ecarin-clotting time in 89% and 88% patients. Two other antidotes, andexanet alfa (PRT064445 and ciraparantag (PER977 are also under development for reversal of NOACs. In this review, we discuss commonly encountered management issues with NOACs such as periprocedural management, laboratory monitoring of anticoagulation, and management of bleeding. We review currently available data regarding specific antidotes to NOACs with respect to pharmacology and clinical trials.Keywords: novel oral anticoagulant, dabigatran, idarucizumab, reversal

  16. [PROWESS, ENHANCE and ADDRESS: clinical implications for the treatment with drotrecogin alfa (activated)].

    Science.gov (United States)

    Cobas Meyer, M; Langenfeld, H; Rossaint, R; Sablotzki, A

    2006-06-01

    Drotrecogin alfa (activated) (DrotAA) represents a therapeutic advance in the treatment of severe sepsis. In the pivotal PROWESS trial DrotAA had demonstrated a significant decrease in 28-day mortality, most evident in the subgroup of patients at higher risk of death. Thus, DrotAA was licensed throughout Europe for treatment of adult patients with severe sepsis with multiple organ failure when added to best standard care. The ADDRESS trial was mandated by the FDA to investigate prospectively the treatment effect of DrotAA in patients at low risk of death, e.g. single organ failure. The trial was prematurely stopped due to futility, because no reduction in mortality was observed in this non-indicated patient population. The ENHANCE open-label trial enrolled similar patients to the PROWESS trial and the observed 28-day mortality was consistent with the results seen in the PROWESS trial. Survival rates for patients receiving DrotAA early within 24 h from the first sepsis-induced organ dysfunction were significantly higher than in patients treated later. In this overview we will discuss the results of the ENHANCE and ADDRESS trials in the context of the PROWESS study and clinical implications for the treatment with DrotAA.

  17. The Arecibo Legacy Fast ALFA Survey: VI. Second HI Source Catalog of the Virgo Cluster Region

    CERN Document Server

    Kent, Brian R; Haynes, Martha P; Martin, Ann M; Saintonge, Amélie; Stierwalt, Sabrina; Balonek, Thomas J; Brosch, Noah; Koopmann, Rebecca A

    2008-01-01

    We present the third installment of HI sources extracted from the Arecibo Legacy Fast ALFA extragalactic survey. This dataset continues the work of the Virgo ALFALFA catalog. The catalogs and spectra published here consist of data obtained during the 2005 and 2006 observing sessions of the survey. The catalog consists of 578 HI detections within the range 11h 36m 6.5; (b) high velocity clouds in the Milky Way or its periphery; and (c) signals of lower S/N which coincide spatially with an optical object and known redshift. 75% of the sources are newly published HI detections. Of particular note is a complex of HI clouds projected between M87 and M49 that do not coincide with any optical counterparts. Candidate objects without optical counterparts are few. The median redshift for this sample is 6500 km/s and the cz distribution exhibits the local large scale structure consisting of Virgo and the background void and the A1367-Coma supercluster regime at cz_sun ~7000 km/s. Position corrections for telescope poin...

  18. LHC Report: special run with de-squeezed beams for ATLAS/ALFA and TOTEM

    CERN Multimedia

    Helmut Burkhardt for the LHC team

    2015-01-01

    The main high-luminosity proton-proton run of the LHC is complemented by one week per year of special proton-proton runs. The special runs are performed with larger beam sizes at the interaction points to allow the forward physics experiments, TOTEM and ATLAS/ALFA, the chance to make precise measurements of protons as they emerge from collisions at small angles.   In standard high-luminosity operation, the beams are squeezed to give small beam sizes at the interaction points to maximise the collision rates. The “squeeze” takes place at top energy and the beam size at the centre of ATLAS (IP1) and CMS (IP5) is reduced from 66 micrometres at the top of the ramp to 18 micrometres before colliding beams are established. Protons that avoid the fate of an inelastic collision but yet still interact – in elastic or diffractive events – are scattered and emerge in the forward direction. The reduction in beam size has a side effect of increasing the an...

  19. Pharmacokinetics of Novel Plant Cell-Expressed Taliglucerase Alfa in Adult and Pediatric Patients with Gaucher Disease.

    Directory of Open Access Journals (Sweden)

    Richat Abbas

    Full Text Available Taliglucerase alfa is a beta-glucocerebrosidase enzyme replacement therapy approved in the United States, Israel, and other countries for treatment of Type 1 Gaucher disease in adults, and is the first approved plant cell--expressed recombinant protein. In this report, taliglucerase alfa pharmacokinetics were assessed in adult and pediatric patients with Gaucher disease from separate multicenter trials of 30 Units/kg and 60 Units/kg doses infused every 2 weeks. Serial blood samples were obtained from adult patients following single-dose administration on day 1 (n = 26 and multiple doses at week 38 (n = 29, and from pediatric patients following administration of multiple doses of taliglucerase alfa for 10-27 months (n = 10. In both adult and pediatric patients, maximum plasma concentration (Cmax, area under the plasma concentration-time curve from time zero to last measureable concentration (AUC0-t, and from time zero to infinity (AUC0-∞ were higher after 60 Units/kg dose than 30 Units/kg dose. No tendency for accumulation or change in taliglucerase alfa pharmacokinetic parameters over time from day 1 to week 38 was observed with repeated doses of 30 or 60 Units/kg in adults. After multiple doses, mean (range dose-normalized pharmacokinetic parameters were similar for adult versus pediatric patients receiving 60 Units/kg: Cmax expressed in ng/mL/mg was 42.4 (14.5-95.4 in adults and 46.6 (34.4-68.4 in pediatric patients, AUC0 t expressed in ng • h/mL/mg was 63.4 (26.3-156 in adults and 63.9 (39.8-85.1 in pediatric patients, t1/2 expressed in minutes was 34.8 (11.3-104 in adults and 31.5 (18.0-42.9 in pediatric patients and total body clearance expressed in L/h was 19.9 (6.25-37.9 in adults and 17.0 (11.7-24.9 in pediatric patients. These pharmacokinetic data extend the findings of taliglucerase alfa in adult and pediatric patients.ClinicalTrials.gov. NCT00376168 (in adults; NCT01411228 (in children.

  20. 2b or Not 2b: Experimental Evolution of Functional Exogenous Sequences in a Plant RNA Virus

    Science.gov (United States)

    Zwart, Mark P.; Ambrós, Silvia; Carrasco, José L.; Elena, Santiago F.

    2017-01-01

    Horizontal gene transfer (HGT) is pervasive in viruses and thought to be a key mechanism in their evolution. On the other hand, strong selective constraints against increasing genome size are an impediment for HGT, rapidly purging horizontally transferred sequences and thereby potentially hindering evolutionary innovation. Here, we explore experimentally the evolutionary fate of viruses with simulated HGT events, using the plant RNA virus Tobacco etch virus (TEV), by separately introducing two functional, exogenous sequences to its genome. One of the events simulates the acquisition of a new function though HGT of a conserved AlkB domain, responsible for the repair of alkylation or methylation damage in many organisms. The other event simulates the acquisition of a sequence that duplicates an existing function, through HGT of the 2b RNA silencing suppressor from Cucumber mosaic virus. We then evolved these two viruses, tracked the maintenance of the horizontally transferred sequences over time, and for the final virus populations, sequenced their genome and measured viral fitness. We found that the AlkB domain was rapidly purged from the TEV genome, restoring fitness to wild-type levels. Conversely, the 2b gene was stably maintained and did not have a major impact on viral fitness. Moreover, we found that 2b is functional in TEV, as it provides a replicative advantage when the RNA silencing suppression domain of HC-Pro is mutated. These observations suggest a potentially interesting role for HGT of short functional sequences in ameliorating evolutionary constraints on viruses, through the duplication of functions. PMID:28137747

  1. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  2. Encephalomyocarditis virus viroporin 2B activates NLRP3 inflammasome.

    Directory of Open Access Journals (Sweden)

    Minako Ito

    Full Text Available Nod-like receptors (NLRs comprise a large family of intracellular pattern- recognition receptors. Members of the NLR family assemble into large multiprotein complexes, termed the inflammasomes. The NLR family, pyrin domain-containing 3 (NLRP3 is triggered by a diverse set of molecules and signals, and forms the NLRP3 inflammasome. Recent studies have indicated that both DNA and RNA viruses stimulate the NLRP3 inflammasome, leading to the secretion of interleukin 1 beta (IL-1β and IL-18 following the activation of caspase-1. We previously demonstrated that the proton-selective ion channel M2 protein of influenza virus activates the NLRP3 inflammasome. However, the precise mechanism by which NLRP3 recognizes viral infections remains to be defined. Here, we demonstrate that encephalomyocarditis virus (EMCV, a positive strand RNA virus of the family Picornaviridae, activates the NLRP3 inflammasome in mouse dendritic cells and macrophages. Although transfection with RNA from EMCV virions or EMCV-infected cells induced robust expression of type I interferons in macrophages, it failed to stimulate secretion of IL-1β. Instead, the EMCV viroporin 2B was sufficient to cause inflammasome activation in lipopolysaccharide-primed macrophages. While cells untransfected or transfected with the gene encoding the EMCV non-structural protein 2A or 2C expressed NLRP3 uniformly throughout the cytoplasm, NLRP3 was redistributed to the perinuclear space in cells transfected with the gene encoding the EMCV 2B or influenza virus M2 protein. 2B proteins of other picornaviruses, poliovirus and enterovirus 71, also caused the NLRP3 redistribution. Elevation of the intracellular Ca(2+ level, but not mitochondrial reactive oxygen species and lysosomal cathepsin B, was important in EMCV-induced NLRP3 inflammasome activation. Chelation of extracellular Ca(2+ did not reduce virus-induced IL-1β secretion. These results indicate that EMCV activates the NLRP3 inflammasome by

  3. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  4. Mania associated with interferon α2b treatment

    Directory of Open Access Journals (Sweden)

    Basanth K

    2006-01-01

    Full Text Available Neuropsychiatric side effects are common with Interferon α 2b. Psychosis and depression have been reported. Several cases of mania have been reported but only few have been associated with treatment for hepatitis B. We report a case of mania with psychotic symptoms in a 21-year-old female diagnosed to have hepatitis-B infection, who was receiving interferon. The report supports the view that dose reductions or pauses during interferon treatment can cause mania. Family history of mood disorder could be a risk factor. Atypical presentations are common in interferon-induced mania. Mania induced by interferon responds well to antimanic drugs. Since the use of interferon is increasing in developing countries, the need for awareness of side effects and management issues are important and these are highlighted.

  5. Vortex lattice transitions in YNi2B2C

    Indian Academy of Sciences (India)

    S J Levett; C D Dewhurst; D McK Paul

    2002-05-01

    We have performed extensive small-angle neutron scattering (SANS) diffraction studies of the vortex lattice in single crystal YNi2B2C for $B||c$. High-resolution SANS, combined with a field-oscillation vortex lattice preparation technique, allows us to separate Bragg scattered intensities from two orthogonal domains and accurately determine the unit cell angle, . The data suggest that upon increasing field there is a finite transition width where both low- and high-field distorted hexagonal vortex lattice phases, mutually rotated by 45°, coexist. The smooth variation of diffracted intensity from each phase through the transition corresponds to a redistribution of populations between the two types of domains.

  6. Semantic ETL into i2b2 with Eureka!

    Science.gov (United States)

    Post, Andrew R; Krc, Tahsin; Rathod, Himanshu; Agravat, Sanjay; Mansour, Michel; Torian, William; Saltz, Joel H

    2013-01-01

    Clinical phenotyping is an emerging research information systems capability. Research uses of electronic health record (EHR) data may require the ability to identify clinical co-morbidities and complications. Such phenotypes may not be represented directly as discrete data elements, but rather as frequency, sequential and temporal patterns in billing and clinical data. These patterns' complexity suggests the need for a robust yet flexible extract, transform and load (ETL) process that can compute them. This capability should be accessible to investigators with limited ability to engage an IT department in data management. We have developed such a system, Eureka! Clinical Analytics. It extracts data from an Excel spreadsheet, computes a broad set of phenotypes of common interest, and loads both raw and computed data into an i2b2 project. A web-based user interface allows executing and monitoring ETL processes. Eureka! is deployed at our institution and is available for deployment in the cloud.

  7. Structure of human nucleosome containing the testis-specific histone variant TSH2B

    Energy Technology Data Exchange (ETDEWEB)

    Urahama, Takashi; Horikoshi, Naoki; Osakabe, Akihisa; Tachiwana, Hiroaki; Kurumizaka, Hitoshi, E-mail: kurumizaka@waseda.jp [Waseda University, 2-2 Wakamatsu-cho, Shinjuku-ku, Tokyo 162-8480 (Japan)

    2014-03-25

    The crystal structure of human nucleosome containing the testis-specific TSH2B variant has been determined. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, and induces a local structural difference between TSH2B and H2B in nucleosomes. The human histone H2B variant TSH2B is highly expressed in testis and may function in the chromatin transition during spermatogenesis. In the present study, the crystal structure of the human testis-specific nucleosome containing TSH2B was determined at 2.8 Å resolution. A local structural difference between TSH2B and canonical H2B in nucleosomes was detected around the TSH2B-specific amino-acid residue Ser85. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, but in the canonical nucleosome the H2B Asn84 residue (corresponding to the TSH2B Ser85 residue) forms water-mediated hydrogen bonds with the H4 Arg78 residue. In contrast, the other TSH2B-specific amino-acid residues did not induce any significant local structural changes in the TSH2B nucleosome. These findings may provide important information for understanding how testis-specific histone variants form nucleosomes during spermatogenesis.

  8. Construcción y expresión de una proteína recombinante de la envoltura del virus linfotrópico humano tipo I (HTLV-I.

    Directory of Open Access Journals (Sweden)

    Paula Ordóñez

    2009-11-01

    Full Text Available El virus linfotrópico humano tipo I de las células T (HTLV-I es un oncorretrovirus asociado con la leucemia de células T adultas (ATL y la Paraparesia Espástica Tropical (PET. El gen env del virus codifica la glicoproteína precursora gp62, que mediante procesamiento produce la gp21 (transmembranal y la gp46 (superficie. Se ha demostrado la alta inmunorreactividad de la gp46 en sueros de individuos infectados. Con el propósito de obtener una proteína recombinante útil en diagnóstico y en una potencial vacuna, se clonó en el vector de expresión de Baculovirus “bácmido” pBlueBac4.5His el segmento de 144bp obtenido mediante reacción en cadena de la polimerasa (PCR con cebadores que amplifican la región 5622-5765 nt. El construido pBlueBacRENV fue transfectado en células del insecto Mamestrae brassicae (clon MB 8003 recuperándose la proteína recombinante. La proteína RENV reaccionó específicamente con suero de personas infectadas con HTLV-I. Los resultados obtenidos mostraron que la proteína RENV puede ser utilizada para el diagnóstico serológico de la infección por HTLV-I y en la evaluación de nuevas vacunas.

  9. Autoantibodies to alfa-fodrin in patients with Hashimoto thyroiditis and Sjögren's syndrome: possible markers for a common secretory disorder.

    Science.gov (United States)

    Szanto, Antonia; Csipo, Istvan; Horvath, Ildiko; Biro, Edit; Szodoray, Peter; Zeher, Margit

    2008-09-01

    Presence of autoantibodies to alfa-fodrin was investigated in patients with Sjögren's syndrome (n = 61), Hashimoto thyroiditis (n = 27), Sjögren's syndrome associated with Hashimoto thyroiditis (n = 31) and in healthy persons (n = 77). In each group, level of alfa-fodrin antibodies was higher than in the controls. There was no significant difference in their presence either between patients with Hashimoto thyroiditis with or without Sjögren's syndrome, or-in IgA isotype-between Sjögren's and Hashimoto thyroiditis patients. Correlation was found between the level of IgG alfa-fodrin and anti-thyroglobulin antibodies. Based on these findings, fodrin can be associated with both endocrine and exocrine glandular secretion. Antibodies to alfa-fodrin might have a role in the pathogenesis of Hashimoto thyroiditis concerning the "final common effectory pathway", secretion. Alfa-fodrin antibodies can be good markers of secretory disorders. Assessment of these autoantibodies might help the diagnosis and follow-up of patients with impaired secretory capability of not only autoimmune origin.

  10. Perfil hormonal sexual de mulheres em programa crônico de diálise em tratamento com eritropoetina humana recombinante Sex hormones in women on dialysis

    Directory of Open Access Journals (Sweden)

    Rosina Conceição Graçaplena Dal Maso

    2003-01-01

    Full Text Available A IRC (insuficiência renal crônica terminal é acompanhada por alterações sistêmicas, inclusive do eixo hipotálamo-hipofisário-gonadal. Após o aparecimento da EPO (eritropoetina humana recombinante, surgiram relatos de melhora da disfunção sexual em homens, havendo relativa escassez de dados sobre dosagens hormonais e função sexual das mulheres. No Brasil, há poucos dados sobre o perfil hormonal de mulheres em programa crônico de diálise. OBJETIVOS: Avaliação e comparação do perfil hormonal sexual, através das dosagens de FSH (hormônio folículo estimulante, LH (hormônio luteinizante, PRL (prolactina e E2 (estradiol de mulheres em programa crônico de diálise, sob terapêutica com EPO. MÉTODOS: Foram avaliadas 47 mulheres (uma em diálise peritoneal intermitente, quatro em diálise peritoneal ambulatorial contínua e 42 em hemodiálise, subdivididas em três grupos: (1 Grupo I, de mulheres com menos de 48 anos de idade e menstruando regularmente; (2 Grupo II, de mulheres com menos de 48 anos de idade e amenorreicas; (3 Grupo III, de mulheres com mais de 48 anos de idade e amenorreicas. Os grupos foram comparados entre si através do teste de Mann-Whitney para duas amostras independentes. RESULTADOS: Todos os grupos mostraram valores normais das dosagens séricas de FSH, LH e E2, e não houve diferença estatisticamente significante nos níveis desses hormônios entre as mulheres que menstruam e as amenorreicas com idade inferior a 48 anos. Os níveis de PRL encontravam-se acima da normalidade em todos os grupos, independentemente da idade e do padrão menstrual, não havendo diferenças estatísticas significantes entre os grupos. As pacientes do grupo III apresentaram perfis hormonais compatíveis com a menopausa, ou seja, níveis séricos de FSH e LH elevados e de E2 diminuídos.OBJECTIVE: The end stage renal disease has accompaniments in body systems, including hormonal changes. The present study was designed to

  11. Effects of alfa-hydroxy-isocaproic acid on body composition, DOMS and performance in athletes

    Directory of Open Access Journals (Sweden)

    Karila Tuomo AM

    2010-01-01

    Full Text Available Abstract Background Alfa-Hydroxy-isocaproic acid (HICA is an end product of leucine metabolism in human tissues such as muscle and connective tissue. According to the clinical and experimental studies, HICA can be considered as an anti-catabolic substance. The present study investigated the effects of HICA supplementation on body composition, delayed onset of muscle soreness (DOMS and physical performance of athletes during a training period. Methods Fifteen healthy male soccer players (age 22.1+/-3.9 yr volunteered for the 4-week double-blind study during an intensive training period. The subjects in the group HICA (n = 8 received 583 mg of sodium salt of HICA (corresponding 500 mg of HICA mixed with liquid three times a day for 4 weeks, and those in the group PLACEBO (n = 7 received 650 mg of maltodextrin mixed with liquid three times a day for the same period. According to a weekly training schedule, they practiced soccer 3 - 4 times a week, had strength training 1 - 2 times a week, and had one soccer game during the study. The subjects were required to keep diaries on training, nutrition, and symptoms of DOMS. Body composition was evaluated with a dual-energy X-ray absorptiometry (DXA before and after the 4-week period. Muscle strength and running velocity were measured with field tests. Results As compared to placebo, the HICA supplementation increased significantly body weight (p th week of the treatment (p Conclusion Already a 4-week HICA supplementation of 1.5 g a day leads to small increases in muscle mass during an intensive training period in soccer athletes.

  12. Análise comparativa do controle interno no contas a receber e a pagar nas empresas Beta Ltda e Alfa Ltda = A comparative internal control analysis of receivable and payable accounts in Beta and Alfa Ltd Companies

    Directory of Open Access Journals (Sweden)

    Cleyton de Oliveira Ritta

    2010-07-01

    Full Text Available A necessidade constante de um excelente desempenho empresarial leva à busca da qualidade e confiabilidade da informação para o auxílio na tomada de decisão. Neste contexto, a auditoria contábil tem um papel importante na análise das práticas administrativas adotadas pelas entidades. Desse modo, o objetivo deste artigo é comparar a estruturação dos controles internos no contas a receber e a pagar nas empresas Beta Ltda, a qual não contrata serviços de auditoria externa, e Alfa Ltda, que os contrata. Este estudo caracteriza-se como de caso comparativo de caráter descritivo por meio de questionário e entrevista. Os resultados apontam que a empresa Alfa Ltda tem melhores níveis de controle interno e, consequentemente, está menos exposta a erros e fraudes. Desse modo, entende-se que os seviços de auditoria atuam como um instrumento de auxílio para minimização dos riscos operacionais e servem de alerta aos gestores quanto à eficiência das transações. Contudo, percebe-se que a qualidade dos controles internos nas organizações depende diretamente da utilização de procedimentos de monitoramento.The constant need for excellent business performance triggers the quest for information quality and reliability to help in decision making. Considering this context, accounting auditing plays an important role in the analysis of administrative practices adopted by entities. Thus, the objective of this article is to compare the structure of the internal controls for receivable and payable accounts in Beta Ltd companies, which do not contract external auditing services, and Alfa Ltd, which does. This study is a descriptive comparative case study, carried out through questionnaire and interview. The results have showed that Alfa Ltd has better internal control levels and consequently is less exposed to errors and fraud. This way, auditing services are seen as auxiliary instruments to minimize operational risks and serve to alert

  13. Efficient cell culture system for hepatitis C virus genotype 2B

    DEFF Research Database (Denmark)

    2014-01-01

    The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from...... transfection experiments revealed that 2b/2a was genetically stable. Conclusion: The developed 2b/2a viruses provide a robust in vitro tool for research in HCV genotype 2b, including vaccine studies and functional analysis.......The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from 2...

  14. SH2B1 regulation of energy balance, body weight, and glucose metabolism

    Institute of Scientific and Technical Information of China (English)

    Liangyou; Rui

    2014-01-01

    The Src homology 2B(SH2B)family members(SH2B1,SH2B2 and SH2B3)are adaptor signaling proteins containing characteristic SH2 and PH domains.SH2B1(also called SH2-B and PSM)and SH2B2(also called APS)are able to form homo-or hetero-dimers via their N-terminal dimerization domains.Their C-terminal SH2 domains bind to tyrosyl phosphorylated proteins,including Janus kinase 2(JAK2),TrkA,insulin receptors,insulin-like growth factor-1 receptors,insulin receptor substrate-1(IRS1),and IRS2.SH2B1 enhances leptin signaling by both stimulating JAK2 activity and assembling a JAK2/IRS1/2 signaling complex.SH2B1 promotes insulin signaling by both enhancing insulin receptor catalytic activity and protecting against dephosphorylation of IRS proteins.Accordingly,genetic deletion of SH2B1 results in severe leptin resistance,insulin resistance,hyperphagia,obesity,and type 2 diabetes in mice.Neuronspecific overexpression of SH2B1βtransgenes protects against diet-induced obesity and insulin resistance.SH2B1 in pancreaticβcells promotesβcell expansion and insulin secretion to counteract insulin resistance in obesity.Moreover,numerous SH2B1 mutations are genetically linked to leptin resistance,insulin resistance,obesity,and type 2 diabetes in humans.Unlike SH2B1,SH2B2 and SH2B3 are not required for the maintenance of normal energy and glucose homeostasis.The metabolic function of the SH2B family is conserved from insects to humans.

  15. Expresión y purificación de las proteínas recombinantes estructurales VP5, VP6 y VP8 del rotavirus / Expression and purification of recombinant structural rotavirus proteins VP5, VP6 and VP8

    OpenAIRE

    Moreno Rueda, Luz Yurany

    2010-01-01

    La identificación de posibles receptores del rotavirus y su participación durante la unión y penetración del virus en células suceptibles a la infección han requerido la expresión y purificación de las proteínas virales. Por tanto, el objetivo general de este trabajo consistió en la expresión de las proteínas estructurales VP5 y VP8 del rotavirus en un sistema bacteriano y VP6 en células MA104 mediante la infección con el virus vaccinia recombinante. Las proteínas recombinantes fueron purific...

  16. Factor de necrosis tumoral alfa en pacientes con preeclampsia a término y pretérmino

    Directory of Open Access Journals (Sweden)

    Eduardo Reyna Villasmil

    2012-07-01

    Full Text Available El objetivo de la investigación fue identificar y comparar las concentraciones de factor de necrosis tumoral alfa en pacientes con preeclampsia a término y pre-término. Se seleccionó un total de 50 pacientes. Se incluyeron a 20 pacientes preeclámpticas pre-término (grupo A y 30 preeclámpticas a término (grupo B. Las muestras de sangre para la determinación de factor de necrosis tumoral alfa se recolectaron en todas las pacientes antes del parto e inmediatamente después del diagnóstico de preeclampsia. No se encontraron diferencias significativas con relación a la edad materna e Índice de masa corporal al momento de la toma de la muestra. Se observaron diferencias estadísticamente significativas entre los grupos con respecto a la edad gestacional (p < 0,0001. El valor promedio de la presión arterial sistólica en el grupo A fue de 149,4 ± 11,3 mmHg mientras que en las pacientes del grupo B fue de 148,1 ± 12,3 mmHg (p = 0,7071 y el valor promedio de presión arterial diastólica en el grupo A fue de 103,8 ± 8,6 mmHg y en el grupo B fue de 102,7 ± 7,9 mmHg (p = 0,6436. Las concentraciones de factor de necrosis tumoral alfa fueron similares en el grupo de preeclámpticas pre-término (98,2 ± 45,1 pg/mL comparado con el grupo de preeclámpticas a término (96,6 ± 48,7 pg/mL; p = 0,9072. Al realizar la correlación entre los valores de factor de necrosis tumoral alfa con los valores de presión arterial se observó que no existía correlación con la presión arterial sistólica (r = 0,129; p = 0,374 ni con la de presión arterial diastólica (r = 0,158, p = 0,273. Se concluye que las concentraciones sanguíneas del factor de necrosis tumoral alfa resultaron similares en las pacientes preeclámpticas con embarazo pretérmino y a término. La correlación de las concentraciones de factor de necrosis tumoral alfa con los valores de presión arterial sistólica y diastólica resultó no significativa. Palabras clave:Factor de

  17. Mucoproteína versus alfa-1-glicoproteína ácida: o que quantificar?

    Directory of Open Access Journals (Sweden)

    Picheth Geraldo

    2002-01-01

    Full Text Available A quantificação sérica da alfa-1-glicoproteína (GPA ácida é útil no diagnóstico e no acompanhamento dos processos agudos resultantes de múltiplas causas. Esta proteína também pode ser estimada pela quantificação da mucoproteína (Muco, ensaio que reflete as glicoproteínas com elevado teor de açúcar, entre as quais a GPA é majoritária. O objetivo deste trabalho é verificar a correlação e a performance analítica das determinações de mucoproteína (Muco e alfa-1-glicoproteína ácida (GPA, propondo uma equação de regressão linear. Amostras de soros de 540 pacientes, com idades entre 10 e 79 anos (média de 34,6, predominando mulheres (71,3%, foram analisadas simultaneamente para Muco (Winzler, manual com reagentes próprios e GPA (imunoturbidimetria automatizada, Roche; Cobas mira. A análise de regressão, fixando a Muco como variável dependente, apresentou Muco (mg/dl em tirosina = 0,031 x GPA (mg/dl + 0,8 (r = 0,91; e, fixando o intercepto em zero, Muco = 0,039 x GPA (r = 0,98. A imprecisão interensaio foi de 23,4% e 5,2% (coeficiente de variação, respectivamente, para Muco e GPA. Conclusão: a elevada variabilidade analítica da quantificação da mucoproteína pelo método de Winzler recomenda que este ensaio seja substituído pela dosagem da alfa-1-glicoproteína ácida. Quando necessário, recomendamos estimar a mucoproteína, quantificando a alfa-1-glicoproteína ácida com ensaios de mesmo desempenho que o do utilizado neste trabalho, e usar a equação de regressão AGP (mg/dl x 0,039 = Muco (mg/dl em tirosina.

  18. Tratamento de reposição na deficiência de alfa-1-antitripsina em doentes com enfisema pulmonar

    OpenAIRE

    2013-01-01

    A doença pulmonar obstrutiva crónica é uma das principais causas de incapacidade respiratória e a quarta causa de morte em todo o Mundo, sendo mais frequente no sexo masculino. A exposição ao fumo do tabaco é considerada o principal fator de risco ambiental, no entanto, existem outros fatores igualmente importantes como, por exemplo, a deficiência de alfa-1-antitripsina, a única desordem genética conhecida associada a esta patologia até aos dias de hoje. Esta enzima é maioritariamente produzi...

  19. Secondary bronchiolitis obliterans organizing pneumonia during treatment of chronic hepatitis C: role of pegylated interferon alfa-2a

    Directory of Open Access Journals (Sweden)

    Ronaldo Soares Martins

    2012-10-01

    Full Text Available The treatment of chronic hepatitis C has frequent side effects such as cytopenias and neuropsychiatric symptoms. However, pulmonary toxicity associated with interferon is rarely described. This paper describes the clinical case of a 67-year-old female patient with chronic hepatitis C who presented an acute onset of dry cough, dyspnoea, and fever 36 weeks after the use of pegylated interferon alfa-2a and ribavirin. The lung biopsy confirmed the diagnosis of a bronchiolitis obliterans organizing pneumonia (BOOP. Corticotherapy was initiated, with clinical and radiological improvement. This paper aims to advise physicians to this occasional, though severe, adverse event related to hepatitis C virus (HCV treatment.

  20. Comportamiento de glicinina, beta-conglicinina y alfa-amilasa en semillas de soja deterioradas y no deterioradas

    OpenAIRE

    2002-01-01

    El objetivo del trabajo fue estudiar el comportamiento de glicinina y beta-conglicinina y la actividad de alfa-amilasa en semillas deterioradas y no deterioradas de 10 cultivares de soja [Glycine max (L.) Merr.]. Las semillas se sometieron a dos tratamientos: deterioradas por envejecimiento acelerado y no deterioradas. Se determinó la presencia de las proteínas de reserva a partir de semillas con 0, 3 y 8 días de germinadas por electroforesis en geles de poliacrilamida (SDS-PAGE). La activida...

  1. Natural releases from contaminated groundwater, Example Reference Biosphere 2B

    Energy Technology Data Exchange (ETDEWEB)

    Simon, I. [CIEMAT/PIRA, Avda Complutense 22, 28040 Madrid (Spain)]. E-mail: isc@csn.es; Naito, M. [Nuclear Waste Management Organization of Japan (NUMO), 4-1-23 Shiba, Minato-ku, Tokyo, 108-0014 (Japan); Thorne, M.C. [Mike Thorne and Associates Limited, Abbotsleigh, Kebroyd Mount, Ripponden, Halifax, West Yorkshire HX6 3JA (United Kingdom); Walke, R. [Enviros QuantiSci, Building D5, Culham Science Centre, Culham, Oxfordshire OX14 3DB (United Kingdom)

    2005-07-01

    Safety assessment is a tool which, by means of an iterative procedure, allows the evaluation of the performance of a disposal system and its potential impact on human health and the environment. Radionuclides from a deep geological disposal facility may not reach the surface environment until many tens of thousands of years after closure of the facility. The BIOMASS Programme on BIOsphere Modelling and ASSessment developed Examples of 'Reference Biospheres' to illustrate the use of the methodology and to demonstrate how biosphere models can be developed and justified as being fit for purpose. The practical examples are also intended to be useful in their own right. The Example Reference Biosphere 2B presented here involves the consideration of alternative types of geosphere-biosphere interfaces and calculation of doses to members of hypothetical exposure groups arising from a wide range of exposure pathways within agricultural and semi-natural environments, but without allowing for evolution of the corresponding biosphere system. The example presented can be used as a generic analysis in some situations although it was developed around a relatively specific conceptual model. It should be a useful practical example, but the above numerical results are not intended to be understood as prescribed biosphere 'conversion factors'.

  2. Phonon linewidths in YNi2B2C

    Indian Academy of Sciences (India)

    L Pintschovius; F Weber; W Reichardt; A Kreyssig; R Heid; D Reznik; O Stockert; K Hradil

    2008-10-01

    Phonons in a metal interact with conduction electrons which give rise to a finite linewidth. In the normal state, this leads to a Lorentzian shape of the phonon line. Density functional theory is able to predict the phonon linewidths as a function of wave vector for each branch of the phonon dispersion. An experimental verification of such predictions is feasible only for compounds with very strong electron–phonon coupling. YN2B2C was chosen as a test example because it is a conventional superconductor with a fairly high c (15.2 K). Inelastic neutron scattering experiments did largely confirm the theoretical predictions. Moreover, they revealed a strong temperature dependence of the linewidths of some phonons with particularly strong electron–phonon coupling which can as yet only qualitatively be accounted for by theory. For such phonons, marked changes of the phonon frequencies and linewidths were observed from room temperature down to 15 K. Further changes were observed on entering into the superconducting state. These changes can, however, not be described simply by a change of the phonon linewidth.

  3. Analysis of exoplanet XO-2 b observed with HST NICMOS

    Science.gov (United States)

    Crouzet, Nicolas; McCullough, P. R.; Burke, C.; Long, D.

    2011-09-01

    We present the photometric and spectroscopic analysis of the transiting planet XO-2 b, from HST NICMOS. Three transits of the planet have been observed. The field of view contains not only the XO-2 star but also a second star of very similar properties, which we use as a comparison star. We first perform a white-light photometric analysis of the data. The high signal to noise ratio yields improved parameters for the planet and host star. We then build the spectrum of this system in the range 1.2-1.8 microns with a spectral resolution of R 35, taking into account systematic effects. To investigate the validity of the method and the reliability of NICMOS data, we also build a spectrum for the exoplanet XO-1 b. We find an overall shape close to Tinetti et al. (ApJL 2010), although differences appear for some particular features. In the context of a debate about planetary spectra obtained with NICMOS, this study suggests that NICMOS data, although clearly affected by systematics, contain enough information to derive planetary spectra at least at low resolution.

  4. Lithium decreased NR2B tyrosine phosphorylation and interactions of NR2B and PSD-95 with Src in rat hippocampus following cerebral ischemia

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Objective: To study the effects of chronic lithium on N-methyl-d-aspartate receptor subunit 2B (NR2B) tyrosine phosphorylation and the interactions of NR2B and PSD-95 with Src induced by cerebral ischemia/reperfusion (I/R). Methods: Transient (15 min) cerebral ischemia was induced by four-vessel occlusion procedure in SD rats. Immunoprecipitation (IP) and immunoblotting (IB)were performed to investigate the phosphorylation and interactions of proteins. The effects of lithium on tyrosine phosphorylation of NR2B and its interactions with PSD-95 and Src were examined. Results: Transient cerebral ischemia 15 min followed by reperfusion 6 h (I/R 6h) caused a significant increase in tyrosine phosphorylation of NR2B. Administration of LiCl for 7days before ischemia caused a profound decrease in tyrosine phosphorylation of NR2B. Similiarly, the interactions of NR2B and PSD-95 with Src were also enhanced by I/R 6 h.moreover, these interactions were also inhibited by chronic lithium. Conclusion: Pretreatment with lithium decrease tyrosine phosphorylation of NR2B and interactions of NR2B and PSD-95 with Src during cerebral I/R.

  5. GluN2B-containing NMDA receptors promote glutamate synapse development in hippocampal interneurons.

    Science.gov (United States)

    Kelsch, Wolfgang; Li, Zhijun; Wieland, Sebastian; Senkov, Oleg; Herb, Anne; Göngrich, Christina; Monyer, Hannah

    2014-11-26

    In postnatal development, GluN2B-containing NMDARs are critical for the functional maturation of glutamatergic synapses. GluN2B-containing NMDARs prevail until the second postnatal week when GluN2A subunits are progressively added, conferring mature properties to NMDARs. In cortical principal neurons, deletion of GluN2B results in an increase in functional AMPAR synapses, suggesting that GluN2B-containing NMDARs set a brake on glutamate synapse maturation. The function of GluN2B in the maturation of glutamatergic inputs to cortical interneurons is not known. To examine the function of GluN2B in interneurons, we generated mutant mice with conditional deletion of GluN2B in interneurons (GluN2B(ΔGAD67)). In GluN2B(ΔGAD67) mice interneurons distributed normally in cortical brain regions. After the second postnatal week, GluN2B(ΔGAD67) mice developed hippocampal seizures and died shortly thereafter. Before the onset of seizures, GluN2B-deficient hippocampal interneurons received fewer glutamatergic synaptic inputs than littermate controls, indicating that GluN2B-containing NMDARs positively regulate the maturation of glutamatergic input synapses in interneurons. These findings suggest that GluN2B-containing NMDARs keep the circuit activity under control by promoting the maturation of excitatory synapses in interneurons.

  6. Co-infection of SENV-D among chronic hepatitis C patients treated with combination therapy with high-dose interferon-alfa and ribavirin

    Institute of Scientific and Technical Information of China (English)

    Chia-Yen Dai; Liang-Yen Wang; Ming-Lung Yu; Wan-Long Chuang; Wen-Yu Chang; Shinn-Cherng Chen; Li-Po Lee; Ming-Yen Hsieh; Nei-Jen Hou; Zu-Yau Lin; Ming-Yuh Hsieh

    2005-01-01

    AIM: The clinical significance of co-infection of SENV-D among patients with chronic hepatitis C (CHC) and response of both viruses to combination therapy with high-dose interferon-alfa (IFN) plus ribavirin remain uncertain and are being investigated.METHODS: Total 164 (97 males and 67 females, the mean age 48.1±11.4 years, range: 20-73 years, 128histologically proved) naive CHC patients were enrolled in this study. SENV-D DNA was tested by PCR method.Detection of serum HCV RNA was performed using a standardized automated qualitative RT-PCR assay (COBAS AMPLICOR HCV Test, version 2.0). HCV genotypes 1a,1b, 2a, 2b, and 3a were determined by using genotypespecific primers. Pretreatment HCV RNA levels were determined by using the branched DNA assay (Quantiplex HCV RNA 3.0). There are 156 patients receiving combination therapy with IFN 6 MU plus ribavirin for 24 wk and the response to therapy is determined.RESULTS: Sixty-one (37.2%) patients were positive for SENV-D DNA and had higher mean age than those who were negative (50.7±10.6 years vs46.6±11.6 years,P = 0.026). The rate of sustained viral response (SVR)for HCV and SENV-D were 67.3% (105/156) and 56.3%(27/48), respectively. By univariate analysis, the higher rate of SVR was significantly related to HCV genotype non-1b (P<0.001), younger ages (P = 0.014), lower pretreatment levels of HCV RNA (P = 0.019) and higher histological activity index (HAI) score for intralobular regeneration and focal necrosis (P = 0.037). By multivariate analyses, HCV genotype non-1b, younger age and lower pretreatment HCV RNA levels were significantly associated with HCV SVR (odds ratio (OR)/95% confidence interval (CI): 12.098/0.02-0.19, 0.936/0.890-0.998, and 3.131/1.080-9.077, respectively). The SVR of SENV-D was higher among patients clearing SENV-D than those who had viremia at the end of therapy (P = 0.04).CONCLUSION: Coexistent SENV-D infection, apparently associated with higher ages, is found in more than onethird Taiwanese

  7. Validación y caracterización de un método inmuno-electroforético para la detección de eritropoyetina recombinante y análogos

    OpenAIRE

    Belalcazar Guerrero, Viviana

    2007-01-01

    El objetivo principal de esta tesis fue el de realizar una validación y caracterización de las posibles variables que pueden afectar la metodología empleada para identificar las isoformas presentes en algunas de las especies de EPO (uEPO, rEPO alfa, rEPO beta y el NESP) tras su identificación mediante la técnica de IEF e inmunodetección

  8. Informe sobre el Proyecto Alfa Biblioteca de Babel: ¿Un atajo para la administración de bibliotecas universitarias? Biblioteca de Babel Alfa Project Report: A shortcut for the academic libraries management?

    Directory of Open Access Journals (Sweden)

    Liliana Laura Rega

    2006-12-01

    Full Text Available El Proyecto Alfa Biblioteca de Babel que reúne bibliotecas universitarias de América Latina y Europa comenzó en marzo de 2005 y prevé su conclusión en marzo de 2007. El presente trabajo intenta describir los objetivos y los resultados esperados, e informa las actividades realizadas por la Red Biblioteca de Babel. Finalmente se analizan las propuestas del proyecto en cuanto al rol de las bibliotecas universitarias, y su relación con la innovación en las prácticas pedagógicas.Biblioteca de Babel Alfa Project that assembles academic libraries from Latin America and Europe was approved on March, 2005 and its conclusion is foreseen on March, 2007. This article attempts to describe the aims and the expected results, and reports the activities of the Biblioteca de Babel Network. Finally it analizes the proposals of the project about the role of academic libraries and their relationship with innovations in pedagogical practices.

  9. Data of evolutionary structure change: 1CLMA-2B1UA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2B1UA 1CLM 2B1U A A LTEEQIAEFKEAFALFD-KDGDGTITTKELGTVMRSLGQ...NPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA FALFD-KDGDG

  10. Data of evolutionary structure change: 1BHNF-2B8PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PB 1BHN 2B8P F B ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------ EVID>EVID> 0 1BHN F 1BHNF FMRAS-ED

  11. Uso de la tierra y diversidades alfa, beta y gamma de diplópodos en la cuenca del río Otún, Colombia

    OpenAIRE

    2010-01-01

    Objetivo: Determinar la relación entre los cambios promovidos por la intervención humana en ecosistemas y grosistemas y la diversidad alfa, beta y gamma de Diplopoda de la cuenca media del río Otún. Materiales y métodos: Se utilizó un diseño sistemático estratificado con la selección de siete ventanas y 16 puntos de muestreo. Se separaron los diplópodos en familias y morfotipos para calcular la diversidad alfa, beta y gamma relacionada con la heterogeneidad de usos del terreno. Resultados: Se...

  12. Associação entre deficiência de alfa-1-antitripsina e a gravidade da fibrose cística

    OpenAIRE

    2005-01-01

    OBJETIVO: Verificar a distribuição dos genótipos da alfa-1-antitripsina e correlacionar com a gravidade da doença pulmonar em pacientes fibrocísticos. MÉTODO: Estudo clínico-laboratorial de corte transversal, com 70 pacientes fibrocísticos do Hospital Universitário da UNICAMP. Os fibrocísticos tiveram diagnóstico confirmado clínica e laboratorialmente. A gravidade da fibrose cística foi avaliada pelo escore de Shwachman. Todos os pacientes foram analisados para os alelos S e Z de alfa-1-antit...

  13. Evidencia de la eficacia de los fármacos anti-TNF Alfa en el tratamiento de la espondilitis anquilosante

    OpenAIRE

    Montilla Salas, Juan Manuel

    2011-01-01

    OBJETIVO Establecer la evidencia de los estudios clínicos sobre la eficacia de las terapias anti-TNF alfa para el tratamiento de la espondilitis anquilosante (EA). MÉTODOS Se realizó una búsqueda con los diferentes fármacos anti-NTF alfa actualmente utilizados en terapia de la espondilitis anquilosante (Infiximab, Etanercept y Adalimumab). La revisión bibliográfica se realizó en Medline, Embase y la librería Cochrane para los estudios controlados y randomizados publicados hasta 1-enero-2005. ...

  14. Metastable Equilibria for the Quaternary System Li2B4O7+ Na2B4O7+K2B4O7+H2Oat15℃

    Institute of Scientific and Technical Information of China (English)

    SANG,Shi-Hua; YIN,Hui-An; NI,Shi-Jun; DENG,Miao

    2008-01-01

    Metastable equilibrium solubilities and such physico-chemical properties as densities, conductivity, pH, refractive index and viscosity of the solution for the quaternary system Li2B4O7+Na2B4O7+K2B4O7+H2O at 15℃ were determined experimentally. According to the experimental data, the metastable equilibrium phase diagram was plotted. In the metastable phase diagram, there are one invariant point, three univariant curves, and three fields of crystallization: Li2B2O4·16H2O, Na2B4O7·10H2O, and K2B4O7·4H2O. Potassium borate (K2B4O7·4H2O) has the smallest crystallization field and sodium borate (borax) has the biggest one. Also, the relationship diagram between the properties and the ion concentration of solution was constructed. It can be seen from the relationship diagram that the metastable equilibrium solution density values, viscosity values and refractive index values are increased apparently with the rise of lithium borate concentration, reaching the maximum values at invariant point F. Electrical conductivity values and pH values, however, fall down with the rise of ion concentration on the whole.

  15. Hanstholm phase 2B. Offshore wave energy test 1994 - 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The wave power converter consists of a float 2.5 meter in diameter, connected by a rope to a seabed-mounted piston pump, installed on 25 meter deep water 2,5 km offshore Hanstholm, Denmark. The converter is designed to absorb an average maximum power of 1 kW. Measured data in real sea conditions are compared to results based on computer simulations and previous tank testing. Losses caused by rope elasticity and hysteresis, friction in the pump and back flow through the valves are assessed. The economic perspectives of a large wave power plant are presented, based on a revised prototype incorporating the results and experience gained during the test period. The wave energy conversion test `Hanstholm phase 2B` has showed, that it it technically possible to exploit the offshore wave energy resource. This source of energy could become attractive for commercial enterprise. The wave power converter demonstrated a reliable performance over a period of nine months. It produced energy under all wave conditions and survived storm waves of 9,6 m. A 300 MW wave power plant in the Danish part of the North sea is estimated to produce electricity at a cost between 2,1 - 2,4 DKK/kWh. The electrical transmission to shore contribute to approximately 20% of the cost. New data predict a potential of 23 kW per meter wave front. The energy plan Energy 21 proposed by the Danish Department of Energy, includes a scenario incorporating wave energy in the energy system year 2030. A strategy for the development of wave energy, has been proposed as part of the project OWEC-1 supported by the European Joule R and D programme. A proposal for future Danish initiatives to develop second generation point absorber systems is outlined. (ARW) 29 refs.

  16. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  17. Diagnóstico molecular da talassemia alfa+ (deleção–a3.7) em indivíduos com microcitose e/ou hipocromia atendidos no Hemocentro Dalton Barbosa Cunha em Natal, Rio Grande do Norte

    OpenAIRE

    Bezerra, Christiane Medeiros

    2009-01-01

    A talassemia alfa, uma das doenças monogênicas mais comuns no mundo, resulta de um desequilíbrio na síntese das cadeias alfa da hemoglobina devido, principalmente, à deleção de um ou ambos os genes da globina alfa, sendo a deleção -α3.7 a mais freqüente. A talassemia alfa, juntamente com a deficiência de ferro e a talassemia beta, representa uma importante causa de microcitose e hipocromia. Com o objetivo de diagnosticar e verificar a prevalência da talassemia alfa (-α3.7) em indivíduos com m...

  18. Factor de necrosis tumoral alfa en una población infanto-juvenil con sobrepeso

    Directory of Open Access Journals (Sweden)

    Teresita del R. Carrizo

    2013-08-01

    Full Text Available El sobrepeso infantil está asociado a sobrepeso/obesidad en la edad adulta. El tejido adiposo en obesos produce una cantidad incrementada de citoquinas proinflamatorias como el factor de necrosis tumoral alfa (TNF-a, ejerciendo un efecto deletéreo sobre la función vascular. El objetivo de este trabajo fue evaluar niveles de TNF-a en una población infantojuvenil con sobrepeso y su relación con otras variables. Se estudiaron 30 niños con sobrepeso (12 varones de edades entre 8-13 años, se midió circunferencia de cintura (CC e índice de masa corporal (IMC y fueron comparados con 20 controles de edad y sexo semejantes. Se consideró criterio de inclusión un IMC = 85 < 95 percentilo para edad y sexo. En ambos grupos se determinó: glucemia en ayunas (método glucosa oxidasa, insulina plasmática (ECLIA, fibrinógeno (Fg, método de Clauss, proteína C reactiva ultrasensible (uPCR, método inmunoturbidimétrico, TNF-a (ELISA, perfil lipídico (métodos enzimáticos, eritrosedimentación y se calculó el índice HOMA. Los datos se expresaron como mediana y rango intercuartil y con el coeficiente de Spearman se investigaron las correlaciones entre variables, considerándose significativo un p < 0.05. Los niveles de TNF-a fueron mayores en los sujetos con sobrepeso [15.4 (13.2-24.0 vs. 12.7 (11.2-14.8 pg/ml; p = 0.028]. También resultaron más elevados los valores de Fg, insulina plasmática, índice HOMA, uPCR y triglicéridos. El TNF-a se correlacionó con la CC (r = 0.654; p = 0.021. Los niveles elevados de TNF-a, uPCR y Fg encontrados confirman un estado proinflamatorio asociado a obesidad abdominal en la población estudiada.

  19. Estimadores de consistencia interna en las investigaciones en salud: el uso del coeficiente alfa

    Directory of Open Access Journals (Sweden)

    Franciele Cascaes da Silva

    Full Text Available La producción académica ha aumentado en el área de la salud, exigiendo cada vez más calidad en las publicaciones de gran impacto. Una de las formas de considerar la calidad es por medio de procedimientos que aumentan la consistencia del análisis de los datos, como la confiabilidad, que dependiendo del tipo de datos, puede ser evaluada por diferentes coeficientes, en especial el coeficiente alfa. Basados en lo anterior, la presente revisión reúne sistemáticamente artículos científicos producidos en los últimos cinco años, que de manera metodológica hicieron uso psicométrico del coeficiente α como un estimador de consistencia interna y de confiabilidad en procesos de construcción, adaptación y validación de instrumentos. La identificación de los estudios fue realizada sistemáticamente en las bases de datos Biomed Central Journals, Google Scholar, Web of Science, Wiley Online Library, Medline via Pubmed, Scielo, Scopus, Journals@Ovid, BMJ y Springer por medio del Portal de Periódicos CAPES, utilizando criterios de inclusión y exclusión. El análisis de los datos fue realizado por medio de triangulación, análisis de contenido y análisis descriptivo. Se obtuvo que la mayoría de los estudios fueron realizados principalmente en Irán (f=3, España (f=2 y Brasil (f=2, estos estudios tuvieron como objetivo testar las propiedades psicométricas de instrumentos, siendo que ocho estudios utilizaron el coeficiente α para evaluar la confiabilidad y nueve para evaluar la consistencia interna. Todos los estudios fueron clasificados como investigaciones metodológicas al analizar sus objetivos. Adicionalmente, cuatro estudios también fueron clasificados como correlacionales y uno como descriptivo-correlacional. Se puede concluir que a pesar de que el coeficiente α es ampliamente utilizado como uno de los principales parámetros para la evaluación de consistencia interna de instrumentos de medición del tipo cuestionario en el

  20. Estimadores de consistencia interna en las investigaciones en salud: el uso del coeficiente alfa

    Directory of Open Access Journals (Sweden)

    Franciele Cascaes da Silva

    2015-03-01

    Full Text Available La producción académica ha aumentado en el área de la salud, exigiendo cada vez más calidad en las publicaciones de gran impacto. Una de las formas de considerar la calidad es por medio de procedimientos que aumentan la consistencia del análisis de los datos, como la confiabilidad, que dependiendo del tipo de datos, puede ser evaluada por diferentes coeficientes, en especial el coeficiente alfa. Basados en lo anterior, la presente revisión reúne sistemáticamente artículos científicos producidos en los últimos cinco años, que de manera metodológica hicieron uso psicométrico del coeficiente α como un estimador de consistencia interna y de confiabilidad en procesos de construcción, adaptación y validación de instrumentos. La identificación de los estudios fue realizada sistemáticamente en las bases de datos Biomed Central Journals, Google Scholar, Web of Science, Wiley Online Library, Medline via Pubmed, Scielo, Scopus, Journals@Ovid, BMJ y Springer por medio del Portal de Periódicos CAPES, utilizando criterios de inclusión y exclusión. El análisis de los datos fue realizado por medio de triangulación, análisis de contenido y análisis descriptivo. Se obtuvo que la mayoría de los estudios fueron realizados principalmente en Irán (f=3, España (f=2 y Brasil (f=2, estos estudios tuvieron como objetivo testar las propiedades psicométricas de instrumentos, siendo que ocho estudios utilizaron el coeficiente α para evaluar la confiabilidad y nueve para evaluar la consistencia interna. Todos los estudios fueron clasificados como investigaciones metodológicas al analizar sus objetivos. Adicionalmente, cuatro estudios también fueron clasificados como correlacionales y uno como descriptivo-correlacional. Se puede concluir que a pesar de que el coeficiente α es ampliamente utilizado como uno de los principales parámetros para la evaluación de consistencia interna de instrumentos de medición del tipo cuestionario en el

  1. Arecibo pulsar survey using ALFA. III. Precursor survey and population synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Swiggum, J. K.; Lorimer, D. R.; McLaughlin, M. A.; Bates, S. D.; Senty, T. R. [Department of Physics and Astronomy, West Virginia University, Morgantown, WV 26506 (United States); Champion, D. J.; Lazarus, P. [Max-Planck-Institut für Radioastronomie, D-53121 Bonn (Germany); Ransom, S. M. [NRAO, Charlottesville, VA 22903 (United States); Brazier, A.; Chatterjee, S.; Cordes, J. M. [Astronomy Department, Cornell University, Ithaca, NY 14853 (United States); Hessels, J. W. T. [ASTRON, Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Nice, D. J. [Department of Physics, Lafayette College, Easton, PA 18042 (United States); Ellis, J.; Allen, B. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee WI 53211 (United States); Bhat, N. D. R. [Center for Astrophysics and Supercomputing, Swinburne University, Hawthorn, Victoria 3122 (Australia); Bogdanov, S.; Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Crawford, F. [Department of Physics and Astronomy, Franklin and Marshall College, Lancaster, PA 17604-3003 (United States); Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); and others

    2014-06-01

    The Pulsar Arecibo L-band Feed Array (PALFA) Survey uses the ALFA 7-beam receiver to search both inner and outer Galactic sectors visible from Arecibo (32° ≲ ℓ ≲ 77° and 168° ≲ ℓ ≲ 214°) close to the Galactic plane (|b| ≲ 5°) for pulsars. The PALFA survey is sensitive to sources fainter and more distant than have previously been seen because of Arecibo's unrivaled sensitivity. In this paper we detail a precursor survey of this region with PALFA, which observed a subset of the full region (slightly more restrictive in ℓ and |b| ≲ 1°) and detected 45 pulsars. Detections included 1 known millisecond pulsar and 11 previously unknown, long-period pulsars. In the surveyed part of the sky that overlaps with the Parkes Multibeam Pulsar Survey (36° ≲ ℓ ≲ 50°), PALFA is probing deeper than the Parkes survey, with four discoveries in this region. For both Galactic millisecond and normal pulsar populations, we compare the survey's detections with simulations to model these populations and, in particular, to estimate the number of observable pulsars in the Galaxy. We place 95% confidence intervals of 82,000 to 143,000 on the number of detectable normal pulsars and 9000 to 100,000 on the number of detectable millisecond pulsars in the Galactic disk. These are consistent with previous estimates. Given the most likely population size in each case (107,000 and 15,000 for normal and millisecond pulsars, respectively), we extend survey detection simulations to predict that, when complete, the full PALFA survey should have detected 1000{sub −230}{sup +330} normal pulsars and 30{sub −20}{sup +200} millisecond pulsars. Identical estimation techniques predict that 490{sub −115}{sup +160} normal pulsars and 12{sub −5}{sup +70} millisecond pulsars would be detected by the beginning of 2014; at the time, the PALFA survey had detected 283 normal pulsars and 31 millisecond pulsars, respectively. We attribute the deficiency in normal pulsar

  2. TGF- induces Lysyl hydroxylase 2b in human synovial osteoarthritic fibroblasts through ALK5 signaling

    NARCIS (Netherlands)

    Remst, Dennis F. G.; Davidson, Esmeralda N. Blaney; Vitters, Elly L.; Bank, Ruud A.; van den Berg, Wim B.; van der Kraan, Peter M.

    2014-01-01

    Lysyl hydroxylase 2b (LH2b) is known to increase pyridinoline cross-links, making collagen less susceptible to enzymatic degradation. Previously, we observed a relationship between LH2b and osteoarthritis-related fibrosis in murine knee joint. For this study, we investigate if transforming growth fa

  3. File list: His.PSC.50.H2B.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H2B.AllCell mm9 Histone H2B Pluripotent stem cell SRX1034714,SRX1034721,...SRX1034715,SRX1034720 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.H2B.AllCell.bed ...

  4. Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology

    DEFF Research Database (Denmark)

    Clayton, Emma L.; Mizielinska, Sarah; Edgar, James R.;

    2015-01-01

    Mutations in the charged multivesicular body protein 2B (CHMP2B) cause frontotemporal dementia (FTD). We report that mice which express FTD-causative mutant CHMP2B at physiological levels develop a novel lysosomal storage pathology characterised by large neuronal autofluorescent aggregates. The a...

  5. Data of evolutionary structure change: 1BHNF-2B8PA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PA 1BHN 2B8P F A ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKE-----YFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------- EVID>EVID> 0 ... 1BHN F 1BHNF FMRAS-E...5856934 EVID> 1 2B8P

  6. Baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF)

    Science.gov (United States)

    McMurray, John J.V.; Anand, Inder S.; Diaz, Rafael; Maggioni, Aldo P.; O'Connor, Christopher; Pfeffer, Marc A.; Solomon, Scott D.; Tendera, Michal; van Veldhuisen, Dirk J.; Albizem, Moetaz; Cheng, Sunfa; Scarlata, Debra; Swedberg, Karl; Young, James B.; Amuchastegui, M.; Belziti, C.; Bluguermann, J.; Caccavo, M.; Cartasegna, L.; Colque, R.; Cuneo, C.; Fernandez, A.; Gabito, A.; Goicochea, R.; Gonzalez, M.; Gorosito, V.; Grinfeld, L.; Hominal, M.; Kevorkian, R.; Litvak Bruno, M.; Llanos, J.; Mackinnon, I.; Manuale, O.; Marzetti, E.; Nul, D.; Perna, E.; Riccitelli, M.; Sanchez, A.; Santos, D.; Schygiel, P.; Toblli, J.; Vogel, D.; Aggarwal, A.; Amerena, J.; De Looze, F.; Fletcher, P.; Hare, D.; Ireland, M.; Krum, H.; Lattimore, J.; Marwick, T.; Sindone, A.; Thompson, P.; Waites, J.; Altenberger, J.; Ebner, C.; Lenz, K.; Pacher, R.; Poelzl, G.; Charlier, F.; de Ceuninck, M.; De Keulenaer, G.; Dendale, P.; Maréchal, P.; Mullens, W.; Thoeng, J.; Vanderheyden, M.; Vanhaecke, J.; Weytjens, C.; Wollaert, B.; Albuquerque, D.; Almeida, D.; Aspe y Rosas, J.; Bocchi, E.; Bordignon, S.; Clausell, N.; Kaiser, S.; Leaes, P.; Martins Alves, S.; Montera, M.; Moura, L.; Pereira de Castro, R.; Rassi, S.; Reis, A.; Saraiva, J.; Simões, M.; Souza Neto, J.; Teixeira, M.; Benov, H.; Chompalova, B.; Donova, T.; Georgiev, P.; Gotchev, D.; Goudev, A.; Grigorov, M.; Guenova, D.; Hergeldjieva, V.; Ivanov, D.; Kostova, E.; Manolova, A.; Marchev, S.; Nikolov, F.; Popov, A.; Raev, D.; Tzekova, M.; Czarnecki, W.; Giannetti, N.; Haddad, H.; Heath, J.; Huynh, T.; Lepage, S.; Liu, P.; Lonn, E.; Ma, P.; Manyari, D.; Moe, G.; Parker, J.; Pesant, Y.; Rajda, M.; Ricci, J.; Roth, S.; Sestier, F.; Sluzar, V.; Sussex, B.; Vizel, S.; Antezana, G.; Bugueno, C.; Castro, P.; Conejeros, C.; Manriquez, L.; Martinez, D.; Potthoff, S.; Stockins, B.; Vukasovic, J.; Gregor, P.; Herold, M.; Jerabek, O.; Jirmar, R.; Kuchar, R.; Linhart, A.; Podzemska, B.; Soucek, M.; Spac, J.; Spacek, R.; Vodnansky, P.; Bronnum-Schou, J.; Clemmensen, K.; Egstrup, K.; Jensen, G.; Kjoller-Hansen, L.; Kober, L.; Markenvard, J.; Rokkedal, J.; Skagen, K.; Torp-Pedersen, C.; Tuxen, C.; Videbak, L.; Laks, T.; Vahula, V.; Harjola, V.; Kettunen, R.; Kotila, M.; Bauer, F.; Cohen Solal, A.; Coisne, D.; Davy, J.; De Groote, P.; Dos Santos, P.; Funck, F.; Galinier, M.; Gibelin, P.; Isnard, R.; Neuder, Y.; Roul, G.; Sabatier, R.; Trochu, J.; Anker, S.; Denny, S.; Dreykluft, T.; Flesch, M.; Genth-Zotz, S.; Hambrecht, R.; Hein, J.; Jeserich, M.; John, M.; Kreider-Stempfle, H.; Laufs, U.; Muellerleile, K.; Natour, M.; Sandri, M.; Schäufele, T.; von Hodenberg, E.; Weyland, K.; Winkelmann, B.; Tse, H.; Yan, B.; Barsi, B.; Csikasz, J.; Dezsi, C.; Edes, I.; Forster, T.; Karpati, P.; Kerekes, C.; Kis, E.; Kosa, I.; Lupkovics, G.; Nagy, A.; Preda, I.; Ronaszeki, A.; Tomcsanyi, J.; Zamolyi, K.; Agarwal, D.; Bahl, V.; Bordoloi, A.; Chockalingam, K.; Chopda, M.; Chopra, V.; Dugal, J.; Ghaisas, N.; Ghosh, S.; Grant, P.; Hiremath, S.; Iyengar, S.; Jagadeesa Subramania, B.; Jain, P.; Joshi, A.; Khan, A.; Mullasari, A.; Naik, S.; Oomman, A.; Pai, V.; Pareppally Gopal, R.; Parikh, K.; Patel, T.; Prakash, V.; Sastry, B.; Sathe, S.; Sinha, N.; Srikanthan, V.; Subburamakrishnan, P.; Thacker, H.; Wander, G.; Admon, D.; Katz, A.; Klainman, E.; Lewis, B.; Marmor, A.; Moriel, M.; Mosseri, M.; Shotan, A.; Weinstein, J.; Zimlichman, R.; Agostoni, P.; Albanese, M.; Alunni, G.; Bini, R.; Boccanelli, A.; Bolognese, L.; Campana, C.; Carbonieri, E.; Carpino, C.; Checco, L.; Cosmi, F.; D'Angelo, G.; De Cristofaro, M.; Floresta, A.; Fucili, A.; Galvani, M.; Ivleva, A.; Marra, S.; Musca, G.; Peccerillo, N.; Perrone Filardi, P.; Picchio, E.; Russo, T.; Scelsi, L.; Senni, M.; Tavazzi, L.; Erglis, A.; Jasinkevica, I.; Kakurina, N.; Veze, I.; Volans, E.; Bagdonas, A.; Berukstis, E.; Celutkiene, J.; Dambrauskaite, A.; Jarasuniene, D.; Luksiene, D.; Rudys, A.; Sakalyte, G.; Sliaziene, S.; Aguilar-Romero, R.; Cardona-Muñoz, E.; Castro-Jimenez, J.; Chavez-Herrera, J.; Chuquiure Valenzuela, E.; De la Pena, G.; Herrera, E.; Leiva-Pons, J.; Lopez Alvarado, A.; Mendez Machado, G.; Ramos-Lopez, G.; Basart, D.; Buijs, E.; Cornel, J.; de Leeuw, M.; Dijkgraaf, R.; Dunselman, P.; Freericks, M.; Hamraoui, K.; Lenderlink, T.; Linssen, G.; Lodewick, P.; Lodewijks, C.; Lok, D.; Nierop, P.; Ronner, E.; Somsen, A.; van Dantzig, J.; van der Burgh, P.; van Kempen, L.; van Vlies, B.; Voors, A.; Wardeh, A.; Willems, F.; Dickstein, K.; Gundersen, T.; Hole, T.; Thalamus, J.; Westheim, A.; Dabrowski, M.; Gorski, J.; Korewicki, J.; Kuc, K.; Miekus, P.; Musial, W.; Niegowska, J.; Piotrowski, W.; Podolec, P.; Polonski, L.; Ponikowski, P.; Rynkiewicz, A.; Szelemej, R.; Trusz-Gluza, M.; Ujda, M.; Wojciechowski, D; Wysokinski, A.; Camacho, A.; Fonseca, C.; Monteiro, P.; Apetrei, E.; Bruckner, I.; Carasca, E.; Coman, I.; Datcu, M.; Dragulescu, S.; Ionescu, P.; Iordachescu-Petica, D.; Manitiu, I.; Popa, V.; Pop-Moldovan, A.; Radoi, M.; Stamate, S.; Tomescu, M.; Vita, I.; Aroutiounov, G.; Ballyuzek, M.; Bart, B.; Churina, S.; Glezer, M.; Goloshchekin, B.; Ivleva, A.; Kobalava, Z.; Kostenko, V.; Lopatin, Y.; Martynov, A.; Orlov, V.; Semernin, E.; Shogenov, Z.; Sidorenko, B.; Skvortsov, A.; Storzhakov, G.; Sulimov, V.; Talibov, O.; Tereshenko, S.; Tsyrline, V.; Zadionchenko, V.; Zateyshchikov, D.; Dzupina, A.; Hranai, M.; Kmec, J.; Micko, K.; Murin, J.; Pella, D.; Sojka, G.; Spisak, V.; Vahala, P.; Vinanska, D.; Badat, A.; Bayat, J.; Dawood, S.; Delport, E.; Ellis, G.; Garda, R.; Klug, E.; Mabin, T.; Naidoo, D.; Pretorius, M.; Ranjith, N.; Van Zyl, L.; Weich, H.; Anguita, M.; Berrazueta, J.; Bruguera i Cortada, J.; de Teresa, E.; Gómez Sánchez, M.; González Juanatey, J.; Gonzalez-Maqueda, I.; Jordana, R.; Lupon, J.; Manzano, L.; Pascual Figal, D.; Pulpón, L.; Recio, J.; Ridocci Soriano, F.; Rodríguez Lambert, J.; Roig Minguell, E.; Roig Minguell, E.; Romero, J.; Valdovinos, P.; Klintberg, L.; Kronvall, T.; Lycksell, M.; Morner, S.; Rydberg, E.; Swedberg, K.; Timberg, I.; Wikstrom, G.; Moccetti, T.4; Ashok, J.; Banerjee, P.; Carr-White, G.; Cleland, J.; Connolly, E.; Francis, M.; Greenbaum, R.; Kadr, H.; Lindsay, S.; McMurray, J.; Megarry, S.; Memon, A.; Murdoch, D.; Senior, R.; Squire, I.; Tan, L.; Witte, K.; Adams, K.; Adamson, P.; Adler, A.; Altschul, L.; Altschuller, A.; Amirani, H.; Anand, I.; Andreou, C.; Ansari, M.; Antonishen, M.; Banchs, H.; Banerjee, S.; Banish, D.; Bank, A.; Barbagelata, A.; Barnard, D.; Bellinger, R.; Benn, A.; Berk, M.; Berry, B.; Bethala, V.; Bilazarian, S.; Bisognano, J.; Bleyer, F.; Blum, M.; Boehmer, J.; Bouchard, A.; Boyle, A.; Bozkurt, B.; Brown, C.; Burlew, B.; Burnham, K.; Butler, J.; Call, J.; Cambier, P.; Cappola, T.; Carlson, R.; Chandler, B.; Chandra, R.; Chandraratna, P.; Chernick, R.; Colan, D.; Colfer, H.; Colucci, W.; Connelly, T.; Costantini, O.; Dadkhah, S.; Dauber, I.; Davis, J.; Davis, S.; Denning, S.; Drazner, M.; Dunlap, S.; Egbujiobi, L.; Elkayam, U.; Elliott, J.; El-Shahawy, M.; Essandoh, L.; Ewald, G.; Fang, J.; Farhoud, H.; Felker, G.; Fernandez, J.; Festin, R.; Fishbein, G.; Florea, V.; Flores, E.; Floro, J.; Gabris, M.; Garg, M.; Gatewood, R.; Geller, M.; Ghali, J.; Ghumman, W.; Gibbs, G.; Gillespie, E.; Gilmore, R.; Gogia, H.; Goldberg, L.; Gradus-Pizlo, I.; Grainger, T.; Gudmundsson, G.; Gunawardena, D.; Gupta, D.; Hack, T.; Hall, S.; Hamroff, G.; Hankins, S.; Hanna, M.; Hargrove, J.; Haught, W.; Hauptman, P.; Hazelrigg, M.; Herzog, C.; Heywood, J.; Hill, T.; Hilton, T.; Hirsch, H.; Hunter, J.; Ibrahim, H.; Imburgia, M.; Iteld, B.; Jackson, B.; Jaffrani, N.; Jain, D.; Jain, A.; James, M.; Jimenez, J.; Johnson, E.; Kale, P.; Kaneshige, A.; Kapadia, S.; Karia, D.; Karlsberg, R.; Katholi, R.; Kerut, E.; Khoury, W.; Kipperman, R.; Klapholz, M.; Kosinski, E.; Kozinn, M.; Kraus, D.; Krueger, S.; Krum, H.; Kumar, S.; Lader, E.; Lee, C.; Levy, W.; Lewis, E.; Light-McGroary, K.; Loh, I.; Lombardi, W.; Machado, C.; Maislos, F.; Mancini, D.; Markus, T.; Mather, P.; McCants, K.; McGrew, F.; McLaurin, B.; McMillan, E.; McNamara, D.; Meyer, T.; Meymandi, S.; Miller, A.; Minami, E.; Modi, M.; Mody, F.; Mohanty, P.; Moscoso, R.; Moskowitz, R.; Moustafa, M.; Mullen, M.; Naz, T.; Noonan, T.; O'Brien, T.; Oellerich, W.; Oren, R.; Pamboukian, S.; Pereira, N.; Pitt, W.; Porter, C.; Prabhu, S.; Promisloff, S.; Ratkovec, R.; Richardson, R.; Ross, A.; Saleh, N.; Saltzberg, M.; Sarkar, S.; Schmedtje, J.; Schneider, R.; Schuyler, G.; Shanes, J.; Sharma, A.; Siegel, C.; Siegel, R.; Silber, D.; Singh, V.; Singh, N.; Singh, J.; Sklar, J.; Small, R.; Smith, A.; Smith, E.; Smith, E.; Smull, D.; Sotolongo, R.; Staniloae, C.; Stapleton, D.; Steele, P.; Stehlik, J.; Stein, M.; Tang, W.; Thadani, U.; Torre-Amoine, G.; Trichon, B.; Tsai, C.; Tummala, R.; Van Bakel, A.; Vicari, R.; Vijay, N.; Vijayaraghavan, K.; Vittorio, T.; Vossler, M.; Wagoner, L.; Wallis, D.; Ward, N.; Widmer, M.; Wight, J.; Wilkins, C.; Williams, C.; Williams, G.; Winchester, M.; Winkel, E.; Wittmer, B.; Wood, D.; Wormer, D.; Wright, R.; Xu, Z.; Yasin, M.; Zolty, R.

    2013-01-01

    Aims This report describes the baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) which is testing the hypothesis that anaemia correction with darbepoetin alfa will reduce the composite endpoint of death from any cause or hospital admission for worsening heart failure, and improve other outcomes. Methods and results Key demographic, clinical, and laboratory findings, along with baseline treatment, are reported and compared with those of patients in other recent clinical trials in heart failure. Compared with other recent trials, RED-HF enrolled more elderly [mean age 70 (SD 11.4) years], female (41%), and black (9%) patients. RED-HF patients more often had diabetes (46%) and renal impairment (72% had an estimated glomerular filtration rate <60 mL/min/1.73 m2). Patients in RED-HF had heart failure of longer duration [5.3 (5.4) years], worse NYHA class (35% II, 63% III, and 2% IV), and more signs of congestion. Mean EF was 30% (6.8%). RED-HF patients were well treated at randomization, and pharmacological therapy at baseline was broadly similar to that of other recent trials, taking account of study-specific inclusion/exclusion criteria. Median (interquartile range) haemoglobin at baseline was 112 (106–117) g/L. Conclusion The anaemic patients enrolled in RED-HF were older, moderately to markedly symptomatic, and had extensive co-morbidity. PMID:23329651

  7. Alfa247®: Un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking

    Directory of Open Access Journals (Sweden)

    Rodolfo Iván Martínez Lemos

    2010-03-01

    Full Text Available La técnica alfa y el método de los 7 pasos constituyen un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking (NW. NW consiste en caminar con bastones especialmente diseñados y utilizando una técnica precisa que moviliza una gran parte de la masa muscular total y tiene efectos beneficiosos probados sobre la salud. Alfa247® hace posible que cualquier persona, con independencia de su nivel de habilidad o condición física, pueda familiarizarse y aprender la técnica de caminar con bastones. Este nuevo concepto de movimiento saludable está todavía dando sus primeros pasos en España y es probable que en un futuro próximo pueda jugar un papel importante dentro del currículo de la Educación Física Escolar, como ya ha hecho en otros países del entorno.

  8. Vortex phase diagram studies in the weakly pinned single crystals of YNi2B2C and LuNi2B2C

    Indian Academy of Sciences (India)

    D Jaiswal-Nagar; D Pal; M R Eskildsen; P C Canfield; H Takeya; S Ramakrishnan; A K Grover

    2006-01-01

    We present a study of magnetization measurements performed on the single crystals of YNi2B2C and LuNi2B2C. For both the compounds, we find flux jumps in magnetisation values in the respective field regions, where the structural transitions in the flux line lattice symmetry have been reported in these systems via the small angle neutron scattering experiments. The magnetisation hysteresis loops and the AC susceptibility measurements show pronounced peak effect as well as second magnetisation peak anomaly for both YNi2B2C and LuNi2B2C. Based on these results, a vortex phase diagram has been constructed for YNi2B2C for $H \\Arrowvert c$ depicting different glassy phases of the vortex matter.

  9. ab initio calculation study on vibrational spectra of C2B10H12,NB11H12 and C2B10H11Cl

    Institute of Scientific and Technical Information of China (English)

    于微舟; 张明瑜; 孙家钟

    1996-01-01

    Geometrical optimization and theoretical calculation of the vibrational frequencies have been performed for C2B10H12, NB11H12 and C2B10Cl by using Gaussian 92 program at 6-31G basis set. The results obtained in this work are in agreement with experimental ones. The optimized geometry and vibrational spectra show that the icosahedral configuration remains unchanged upon converting from B12H122- to the title compounds. The vibrational spectrum of C2B10H11Cl features the absence of C-Cl stretching vibration. But the (C2B10H11)-Cl vibration mode in the low frequency region is as the case for two-atom molecules if the group (C2B10H11) is considered as a pseudoatom

  10. Functional role of human NK cell receptor 2B4 (CD244) isoforms.

    Science.gov (United States)

    Mathew, Stephen O; Rao, Krithi K; Kim, Jong R; Bambard, Nowland D; Mathew, Porunelloor A

    2009-06-01

    2B4 (CD244), a member of the signaling lymphocyte-activation molecule (SLAM/CD150), is expressed on all NK cells, a subpopulation of T cells, monocytes and basophils. Human NK cells express two isoforms of 2B4, h2B4-A and h2B4-B that differ in a small portion of the extracellular domain. In the present investigation, we have studied the functions of h2B4-A and h2B4-B. Our study demonstrated that these two isoforms differ in their binding affinity for CD48, which results in differential cytotoxic activity as well as intracellular calcium release by NK cells upon target cell recognition. Analysis of the predicted 3-D structure of the two isoforms showed conformational differences that could account for their differences in binding affinity to CD48. h2B4-A was able to mediate natural cytotoxicity against CD48-expressing K562 target cells and induce intracellular calcium release, whereas h2B4-B showed no effects. NK-92MI, U937, THP-1, KU812, primary monocytes, basophils and NK cells showed expression of both h2B4-A and h2B4-B whereas YT and IL-2-activated NK cells did not show any h2B4-B expression. Stimulation of NK cells through 2B4 resulted in decreased mRNA levels of both h2B4-A and h2B4-B indicating that down-regulation of 2B4 isoforms may be an important factor in controlling NK cell activation during immune responses.

  11. Role of adenosine A2b receptor overexpression in tumor progression.

    Science.gov (United States)

    Sepúlveda, Cesar; Palomo, Iván; Fuentes, Eduardo

    2016-12-01

    The adenosine A2b receptor is a G-protein coupled receptor. Its activation occurs with high extracellular adenosine concentration, for example in inflammation or hypoxia. These conditions are generated in the tumor environment. Studies show that A2b receptor is overexpressed in various tumor lines and biopsies from patients with different cancers. This suggests that A2b receptor can be used by tumor cells to promote progression. Thus A2b participates in different events, such as angiogenesis and metastasis, besides exerting immunomodulatory effects that protect tumor cells. Therefore, adenosine A2b receptor appears as an interesting therapeutic target for cancer treatment.

  12. Immunogenicity and antigenicity of the recombinant EMA-1 protein of Theileria equi expressed in the yeast Pichia pastoris Imunogenicidade e antigenicidade da proteína recombinante EMA-1 de Theileria equi expressa em Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Leandro Q. Nizoli

    2009-06-01

    Full Text Available The equine piroplasmosis caused by Theileria equi is one of the most important parasitic diseases of the equine, causing damage to animal health and economic losses. In T. equi, 2 merozoite surface proteins, equi merozoite antigen EMA-1 and EMA-2, have been identified as the most immunodominant antigens. This suggests that these antigens might be used as immunobiological tools. The EMA-1 of Theileria equi was cloned and expressed in the yeast Pichia pastoris. The transformed yeast was grown at high cell density, expressing up to 389 mg.L-1 of recombinant protein. The protein was concentrated and detected in Dot blot. The recombinant product was antigenically similar to the native protein as determined using monoclonal antibodies, and polyclonal antibodies obtained from equines naturally infected with T. equi. The immunogenicity of rEMA-1 protein was demonstrated by IFAT using sera from recombinant-protein-immunized mice using aluminum hydroxide as adjuvant. All animals vaccinated with rEMA-1 developed a high specific antibody response. This results suggest that rEMA-1expressed in P. pastoris might be a strong candidate to be used as an antigen for immune diagnostics as well as a vaccine antigen.A piroplasmose equina causada por Theileria equi é uma das mais importantes doenças parasitárias de equídeos, causando danos a saúde animal e perdas econômicas. Em T. equi, 2 proteínas de superfície de merozoítos, equi merozoite antigen EMA-1 e EMA-2, têm sido identificadas como antígenos imunodominantes. Sugerindo que estes antígenos possam ser usados como produtos imunobiológicos. O gene EMA-1 de T. equi foi clonado e expressado na levedura Pichia pastoris. As leveduras transformadas foram cultivadas a altas densidades celulares expressando 389 mg.L-1 de proteína recombinante. A proteína foi concentrada e detectada em Dot blot. O produto recombinante foi antigenicamente similar à proteína nativa quando determinado usando anticorpo

  13. Copy Number Variation of UGT 2B Genes in Indian Families Using Whole Genome Scans

    Directory of Open Access Journals (Sweden)

    Avinash M. Veerappa

    2016-01-01

    Full Text Available Background and Objectives. Uridine diphospho-glucuronosyltransferase 2B (UGT2B is a family of genes involved in metabolizing steroid hormones and several other xenobiotics. These UGT2B genes are highly polymorphic in nature and have distinct polymorphisms associated with specific regions around the globe. Copy number variations (CNVs status of UGT2B17 in Indian population is not known and their disease associations have been inconclusive. It was therefore of interest to investigate the CNV profile of UGT2B genes. Methods. We investigated the presence of CNVs in UGT2B genes in 31 members from eight Indian families using Affymetrix Genome-Wide Human SNP Array 6.0 chip. Results. Our data revealed >50% of the study members carried CNVs in UGT2B genes, of which 76% showed deletion polymorphism. CNVs were observed more in UGT2B17 (76.4% than in UGT2B15 (17.6%. Molecular network and pathway analysis found enrichment related to steroid metabolic process, carboxylesterase activity, and sequence specific DNA binding. Interpretation and Conclusion. We report the presence of UGT2B gene deletion and duplication polymorphisms in Indian families. Network analysis indicates the substitutive role of other possible genes in the UGT activity. The CNVs of UGT2B genes are very common in individuals indicating that the effect is neutral in causing any suspected diseases.

  14. Impaired ventilatory and thermoregulatory responses to hypoxic stress in newborn Phox2b heterozygous knockout mice

    Directory of Open Access Journals (Sweden)

    Nelina eRamanantsoa

    2011-09-01

    Full Text Available The Phox2b gene is necessary for the development of the autonomic nervous system, and especially, of respiratory neuronal circuits. In the present study, we examined the role of Phox2b in ventilatory and thermoregulatory responses to hypoxic stress, which are closely related in the postnatal period. Hypoxic stress was generated by strong thermal stimulus, combined or not with reduced inspired O2. To this end, we exposed 6-day-old Phox2b+/- pups and their wild-type littermates (Phox2b+/+ to hypoxia (10% O2 or hypercapnia (8% CO2 under thermoneutral (33°C or cold (26°C conditions. We found that Phox2b+/- pups showed less normoxic ventilation (VE in the cold than Phox2b+/+ pups. Phox2b+/- pups also showed lower oxygen consumption (VO2 in the cold, reflecting reduced thermogenesis and a lower body temperature. Furthermore, while the cold depressed ventilatory responses to hypoxia and hypercapnia in both genotype groups, this effect was less pronounced in Phox2b+/- pups. Finally, because serotonin (5-HT neurons are pivotal to respiratory and thermoregulatory circuits and depend on Phox2b for their differentiation, we studied 5-HT metabolism using high-pressure liquid chromatography, and found that it was altered in Phox2b+/- pups. We conclude that Phox2b haploinsufficiency alters the ability of newborns to cope with metabolic challenges, possibly due to 5-HT signaling impairments.

  15. Functional characterization of cytochromes P450 2B from the desert woodrat Neotoma lepida

    Energy Technology Data Exchange (ETDEWEB)

    Wilderman, P. Ross, E-mail: pwilderman@ucsd.edu [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Jang, Hyun-Hee [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Malenke, Jael R. [Department of Biology, University of Utah, Salt Lake City, UT (United States); Salib, Mariam; Angermeier, Elisabeth; Lamime, Sonia [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Dearing, M. Denise [Department of Biology, University of Utah, Salt Lake City, UT (United States); Halpert, James R. [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States)

    2014-02-01

    Mammalian detoxification processes have been the focus of intense research, but little is known about how wild herbivores process plant secondary compounds, many of which have medicinal value or are drugs. cDNA sequences that code for three enzymes of the cytochrome P450 (CYP) 2B subfamily, here termed 2B35, 2B36, and 2B37 have been recently identified from a wild rodent, the desert woodrat (Malenke et al., 2012). Two variant clones of each enzyme were engineered to increase protein solubility and to facilitate purification, as reported for CYP2B enzymes from multiple species. When expressed in Escherichia coli each of the woodrat proteins gave the characteristic maximum at 450 nm in a reduced carbon monoxide difference spectrum but generally expressed at lower levels than rat CYP2B1. Two enzymes, 2B36 and 2B37, showed dealkylation activity with the model substrates 7-ethoxy-4-(trifluoromethyl)coumarin and 7-benzyloxyresorufin, whereas 2B35 was inactive. Binding of the monoterpene (+)-α-pinene produced a Type I shift in the absorbance spectrum of each enzyme. Mutation of 2B37 at residues 114, 262, or 480, key residues governing ligand interactions with other CYP2B enzymes, did not significantly change expression levels or produce the expected functional changes. In summary, two catalytic and one ligand-binding assay are sufficient to distinguish among CYP2B35, 2B36, and 2B37. Differences in functional profiles between 2B36 and 2B37 are partially explained by changes in substrate recognition site residue 114, but not 480. The results advance our understanding of the mechanisms of detoxification in wild mammalian herbivores and highlight the complexity of this system. - Highlights: • Three CYP2B enzymes from Neotoma lepida were cloned, engineered, and expressed. • A mix of catalytic and binding assays yields unique results for each enzyme. • Mutational analysis indicates CYP{sub 2}B substrate recognition remains to be clarified. • Reported N. lepida gene

  16. The brain-specific neural zinc finger transcription factor 2b (NZF-2b/7ZFMyt1 suppresses cocaine self-administration in rats

    Directory of Open Access Journals (Sweden)

    Vijay Chandrasekar

    2010-04-01

    Full Text Available Brain-specific neural-zinc-finger transcription factor-2b (NZF2b/7ZFMyt1 is induced in the mesolimbic dopaminergic region after chronic cocaine exposure and lentiviral-mediated expression of NZF2b/7ZFMyt1 in the nucleus accumbens results in decreased locomotor activity (Chandrasekar and Dreyer, 2009. In this study the role of NZF2b/7ZFMyt1 in active cocaine seeking and of its interaction with histone deacetylase on the altered behavior has been observed. Localized expression of NZF2b/7ZFMyt1 in the nucleus accumbens resulted in attenuated cocaine self-administration, whereas silencing this transcription factor with lentiviruses expressing siRNAs increased the animal′s motivation to self-infuse cocaine. Low doses of sodium butyrate, a potent inhibitor of histone deacetylase, were sufficient to reverse the NZF2b/7ZFMyt1-mediated decrease in cocaine self-administration. NZF2b/7ZFMyt1 expression resulted in strong induction of transcription factors REST1 and NAC1 and of the dopamine D2 receptor, with concomitant inhibition of BDNF and its receptor TrkB. We show that NZF2b/7ZFMyt1 colocalizes with histone deacetylase-2 (HDAC2, probably overcoming the suppression of transcriptional activity caused by Lingo1. These findings show that molecular adaptations mediated by NZF2b/7ZFMyt1 expression possibly lead to decreased responsiveness to the reinforcing properties of cocaine and play a prominent role in affecting the behavioral changes induced by the drug.

  17. Desenvolvimento e padronização do Dot-ELISA usando peptídeos recombinantes para o diagnóstico sorológico de Neospora caninum

    Directory of Open Access Journals (Sweden)

    Rafael D. Blanco

    2014-08-01

    Full Text Available A neosporose é reconhecida como uma das maiores causas de aborto e perdas neonatais em bovinos de leite e corte em todo o mundo. Nos últimos anos esta doença tem atraído o interesse de pesquisadores com foco na epidemiologia e métodos eficazes de diagnóstico desta doença. No presente estudo objetivou-se desenvolver e padronizar um teste Dot-ELISA para o diagnóstico sorológico de Neospora caninum com um peptídeo recombinate como antígeno, visando o desenvolvimento de um kit para diagnóstico a campo. O peptídeo recombinante (rNcGRA1 foi desenhado com base na metodologia de genética reversa de epítopos antigênicos originados de uma proteína de grânulos densos de N. caninum, e sintetizado pela GenScript (USA. Produzido mediante o processo fermentativo em leveduras Pichia pastoris KM71. Para a padronização do Dot-ELISA, membranas de nitrocelulose de 0.22µm foram sensibilizadas com 1µL do antígeno e posteriormente os soros foram diluídos em solução de lavagem e incubados durante 1 hora. A revelação foi feita mediante a adição de Proteína G marcada com peroxidase por 30 minutos, seguido da solução reveladora a base de 3,3’-Diaminobenzidine (DAB. Logo após a padronização foram testados 44 soros bovinos diagnosticados por imunofluorescência indireta (RIFI, obtendo-se uma concordância nos resultados do teste de 95,5% e uma sensibilidade e especificidade de 100% e 92% respectivamente. Quanto ao Kit para diagnóstico a campo na Plataforma Tecnológica RapidFlow-Through Miriad®, o peptídeo rNcGRA1 apresentou marcações visíveis ao reagir com os soros positivos, e não apresentou marcações usando os soros negativos. Este estudo é o primeiro a utilizar peptídeos recombinantes e mostrar-se eficiente para o diagnóstico sorológico de bovinos naturalmente infetados por N. caninum.

  18. Hemoglobinas AS/alfa talassemia: importância diagnóstica Hemoglobins AS/alpha thalassemia: diagnostic importance

    Directory of Open Access Journals (Sweden)

    Renata Tomé-Alves

    2000-12-01

    Full Text Available Portadores de traço falciforme (hemoglobina AS associados a talassemia alfa apresentam alterações na morfologia dos eritrócitos, normalmente ausentes nos heterozigotos para esta variante de hemoglobina. A interação entre hemoglobina S e talassemia alfa tem sido descrita como um dos fatores responsáveis pela melhora no quadro clínico de portadores homozigotos de hemoglobina S (anemia falciforme, diminuindo os episódios de crises de falcização. Os mecanismos genéticos desta influência são avaliados em análises moleculares dos genes da globina humana. Com o objetivo de verificar a presença de talassemia alfa em portadores de hemoglobina S em heterozigose, com presença de anemia, encaminhados ao Laboratório de Hemoglobinas do Departamento de Biologia da UNESP, de São José do Rio Preto, analisamos 1.002 amostras de sangue com traço falciforme, no período de 1990 a 1998. As amostras foram colhidas com EDTA como anticoagulante, após prévia autorização dos portadores. Para o diagnóstico laboratorial as amostras de sangue foram submetidas a procedimentos eletroforéticos em pH alcalino e ácido e pesquisa citológica de hemoglobina H. Os procedimentos eletroforéticos confirmaram a presença de hemoglobina AS. A pesquisa citológica evidenciou a presença de talassemia alfa. Deste total analisado, 16 (1,59 % amostras de sangue apresentaram a associação entre hemoglobina AS e alfa talassemia, sendo que duas eram de indivíduos de uma mesma família. Os resultados obtidos nos direcionaram a sugerir aos laboratórios de rotina que realizem a pesquisa de alfa talassemia entre os portadores de hemoglobina AS, com presença de anemia, para verificar a interação com talassemia alfa, fornecendo assim aos portadores informação importante sobre seu perfil hematológico.Sickle Cell disease is a generic term for a group of genetic disorders characterized by the predominance of hemoglobin S. These disorders include Sickle Cell anemia

  19. Alfa Laval to meet the ballast water challenge%阿法拉伐应对压载水的挑战

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Alfa Laval, the market leader in separation, heat transfer and freshwater generation, is widening its offering of solutions for environmental protection. The company hereby announces that a potent technology for dealing with unwanted organisms in ballast water will be commercially available as early as 2006.

  20. Stability is maintained in adults with Gaucher disease type 1 switched from velaglucerase alfa to eliglustat or imiglucerase: A sub-analysis of the eliglustat ENCORE trial.

    Science.gov (United States)

    Pleat, Rebecca; Cox, Timothy M; Burrow, T Andrew; Giraldo, Pilar; Goker-Alpan, Ozlem; Rosenbloom, Barry E; Croal, Laura R; Underhill, Lisa H; Gaemers, Sebastiaan J M; Peterschmitt, M Judith

    2016-12-01

    Gaucher disease type 1 is an autosomal recessive disorder caused by deficient activity of the lysosomal enzyme acid β-glucosidase resulting in accumulation of glucosylceramide and clinical manifestations of anemia, thrombocytopenia, hepatosplenomegaly, and skeletal disease. The historic standard of care is intravenous recombinant enzyme therapy with imiglucerase. Eliglustat, an oral substrate reduction therapy, is a first-line treatment for adults with Gaucher disease type 1 who have a compatible CYP2D6-metabolizer phenotype (≈ 95% of patients). The 12-month ENCORE trial (NCT00943111) found eliglustat non-inferior to imiglucerase in maintaining stability in adult Gaucher patients previously stabilized after ≥ 3 years of enzyme therapy (imiglucerase or velaglucerase alfa). This post-hoc analysis examined safety and efficacy in the 30 ENCORE patients who were receiving velaglucerase alfa at study entry and were randomized to eliglustat (n = 22) or imiglucerase (n = 8). Efficacy and safety in velaglucerase alfa-transitioned patients were consistent with the full ENCORE trial population; 90% of patients switched to eliglustat and 88% of patients switched to imiglucerase met the composite endpoint (stable hemoglobin concentration, platelet count, spleen volume, and liver volume). Clinical stability was maintained for 12 months in Gaucher disease type 1 patients in the ENCORE trial who switched from velaglucerase alfa to either eliglustat or imiglucerase.

  1. Effectiveness of interferon alfa on incidence of hepatocellular carcinoma and decompensation in cirrhosis type C. European Concerted Action on Viral Hepatitis (EUROHEP)

    DEFF Research Database (Denmark)

    Fattovich, G; Giustina, G; Degos, F

    1997-01-01

    The role of interferon alfa treatment in improving morbidity endpoints in patients with chronic hepatitis C infection is currently under debate. The aim of this study was to evaluate the effectiveness of interferon in preventing hepatocellular carcinoma and decompensation in cirrhosis type C....

  2. O uso da drotrecogina alfa ativada na prática clínica e as atuais evidências Drotrecogin alfa activated in clinical practice and the current evidences

    Directory of Open Access Journals (Sweden)

    Márcio Soares

    2008-06-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O debate sobre a segurança e eficácia da drotrecogina alfa (DrotAA encontra-se na ordem do dia, principalmente, em função dos resultados negativos observados em ensaios clínicos subseqüentes ao PROWESS e do impacto econômico no sistema de saúde relacionado ao custo elevado do fármaco. O objetivo deste estudo foi rever os principais estudos sobre a utilização da DrotAA em pacientes com sepse grave, com ênfase nas questões ligadas a sua eficácia e segurança. CONTEÚDO: Foram selecionados artigos sobre a utilização da DrotAA em pacientes com sepse publicados nos últimos dez anos no MedLine. Os seguintes unitermos foram utilizados: activated protein C; drotrecogin alfa; sepsis; septic shock; Xigris®. Estudos referenciados nos artigos selecionados na busca também foram utilizados. CONCLUSÕES: As taxas de letalidades e as complicações hemorrágicas associadas com o uso do fármaco foram maiores em grandes estudos observacionais do que aquelas descritas previamente nos ensaios clínicos. A luz dos resultados atualmente disponíveis, o uso da DrotAA deve ser reconsiderado até que novos ensaios clínicos possam subsidiar com informações adicionais sobre eficácia, segurança e na identificação dos subgrupos de pacientes com sepse grave que porventura possam ter benefício com o uso deste medicamento. A DrotAA deve servir de exemplo para que haja maior cautela com a rápida transposição de evidências ainda em construção para recomendações e diretrizes de tratamento de pacientes com sepse grave.BACKGROUND AND OBJECTIVES: The debate on efficacy and patient safety related to the use of drotrecogin alfa (DrotAA is timely, principally due to the negative results observed in clinical studies performed after the PROWESS study, and the economic cost-related impact of the drug on the healthcare system. The aim of this study was to review the main studies on the use of DrotAA in patients with severe

  3. Overexpression of SULT2B1b Promotes Angiogenesis in Human Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Wen Chen

    2016-03-01

    Full Text Available Background/Aims: Overexpression of cytosolic sulfotransferase 2B1b (SULT2B1b has been commonly found in colorectal and hepatocellular carcinoma, suggesting that SULT2B1b might act as a potential oncogenic protein. However, its clinical significance and biological role in gastric cancer progression remain largely unknown. Methods: Expressions of SULT2B1b in clinical gastric cancer (GC samples were examined using qRT-PCR and Western blot. Results: SULT2B1b was markedly overexpressed in human GC samples, and positively correlated with vessel density and associated with poor clinical features. We also demonstrated that overexpression of SULT2B1b resulted in increased tumor angiogenesis and tumor growth in mouse GC models. In addition, ablation of SULT2B1b in human GC cells lines BGC823 and MKN45 decreased the capability of the cells to recruit endothelial cells. Moreover, depletion of SULT2B1b in GC cells reduced VEGF-A expression by downregulating SP1 and AP2. Conclusion: Our results suggested that the SULT2B1b-mediated angiogenic pathway could serve as biomarkers for GC diagnosis and prognosis, and suppressing SULT2B1b-mediated angiogenic signaling might be a promising strategy for developing novel GC treatment.

  4. X-ray powder diffraction studies and thermal behaviour of NaK 2B 9O 15, Na(Na .17K .83) 2B 9O 15, and (Na .80K .20)K 2B 9O 15

    Science.gov (United States)

    Bubnova, R.; Albert, B.; Georgievskaya, M.; Krzhizhanovskaya, M.; Hofmann, K.; Filatov, S.

    2006-09-01

    The crystal structures of NaK 2B 9O 15 ( a=9.1158(1) Å, b=6.6246(1) Å, c=20.6812(3) Å, β=94.080(1)°, R=0.047, R=0.059, R=0.026), Na(Na .17K .83) 2B 9O 15 ( a=9.0559(1) Å, b=6.6170(1) Å, c=20.5833(3) Å, β=94.228(2)°, R=0.053, R=0.068, R=0.026), and (Na .80K .20)K 2B 9O 15 ( a=9.1534(1) Å, b=6.6296(1) Å, c=20.7422(3) Å, β=94.071(1)°, Z=4, R=0.041, R=0.052, R=0.023) were refined in the monoclinic space groups P2 1/ c(Z=4) using X-ray powder diffraction data and the Rietveld method. These nonaborates are isostructural to K 3B 9O 15. Their crystal structure consists of a three-dimensional open framework built up from three crystallographically independent triborate groups. The alkali metal cations are located on three different sites in the voids of the framework. High-temperature X-ray diffraction studies show that NaK 2B 9O 15 decomposes at about 700 °C in accordance with the peritectic reaction NaK 2B 9O 15↔K 5B 19O 31+liquid. The thermal expansion of NaK 2B 9O 15 and Na(Na .17K .83) 2B 9O 15 is highly anisotropic. A similarity of the thermal and compositional (Na-K substitution) deformations of NaK 2B 9O 15 is revealed: heating of NaK 2B 9O 15 by 1 °C leads to the same deformations of the crystal structure as increasing the amount of K atoms in (Na 1-xK x) 3B 9O 15 by 0.04 at% K.

  5. Evaluation of NR2B peptide as subunit vaccines against experimental neuropathic pain

    Institute of Scientific and Technical Information of China (English)

    WANG Gong-ming; TIAN Yu-ke; CHEN Jian-ping; TIAN Xu-bi; GAO Feng; YANG Hui; AN Ke; MA Guo-ping

    2007-01-01

    Background NR2B containing N-methyl-D-aspartate (NMDA) receptor plays an important role in the facilitation and maintenance of neuropathic pain. The discrete distribution of NR2B subunit in the central nervous system (CNS) may support reduced side effects of agents that act selectively at this site. Therefore, we investigated the hypothesis that a humoral autoimmune response targeting the NR2B subunit of NMDA receptor relieves pain like behaviours produced by peripheral injury.Methods Rats were immunized subcutaneously with NR2B-Keyhole Limpet Hemocyanin (NR2B-KLH) three times at two-week intervals. NR2B specific IgG titres in sera and cerebrospinal fluid were determined by indirect ELISA. Seven days after the third immunization, 2 of the 3 terminal branches of the sciatic nerve (tibial and common peroneal nerves) were tightly ligated. Behavioural testing was carried out on every other day after surgery, until 7 days after surgery. The lumbar spinal cord (L4-6) was removed on day 7 after ligation. The expression of NR2B protein in the lumbar spinal cord was determined using Western blotting.Results After the second vaccination, NR2B specific IgG in sera was detected to be >0.5 μg/ml in six of nine rats. After the third vaccination, all the immunized rats had >2.2 μg/ml. Titres of NR2B specific IgG in sera peaked 42 days post initial immunization and persisted for over 70 days. No NR2B specific IgG was detected in sera from PBS or KLH group.The behavioural thresholds in NR2B group were significantly higher than those in PBS and KLH groups on day 7 after ligation. NR2B specific IgG in CSF in NR2B group could not be detected on day 1 before spinal dissection; but could be detected on day 7 after surgery. The expression of NR2B protein in group NR2B was significantly lower than in PBS and KLH groups on day 7 after surgery.Conclusion The NR2B peptide could be used as a vaccine against neuropathic pain, which could be associated with reduction of NR2B protein in

  6. Genetic loss of SH2B3 in acute lymphoblastic leukemia

    Science.gov (United States)

    Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Hadler, Michael; Rigo, Isaura; LeDuc, Charles A.; Kelly, Kara; Jalas, Chaim; Paietta, Elisabeth; Racevskis, Janis; Rowe, Jacob M.; Tallman, Martin S.; Paganin, Maddalena; Basso, Giuseppe; Tong, Wei; Chung, Wendy K.

    2013-01-01

    The SH2B adaptor protein 3 (SH2B3) gene encodes a negative regulator of cytokine signaling with a critical role in the homeostasis of hematopoietic stem cells and lymphoid progenitors. Here, we report the identification of germline homozygous SH2B3 mutations in 2 siblings affected with developmental delay and autoimmunity, one in whom B-precursor acute lymphoblastic leukemia (ALL) developed. Mechanistically, loss of SH2B3 increases Janus kinase-signal transducer and activator of transcription signaling, promotes lymphoid cell proliferation, and accelerates leukemia development in a mouse model of NOTCH1-induced ALL. Moreover, extended mutation analysis showed homozygous somatic mutations in SH2B3 in 2 of 167 ALLs analyzed. Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of ALL and highlight a possible link between genetic predisposition factors in the pathogenesis of autoimmunity and leukemogenesis. PMID:23908464

  7. Estudios sobre alfa-amilasa en saliva como marcador de estrés en la especie humana y otras especies animales= Studies on salivary alpha-amylase as a maker of stress in human and different animal species

    OpenAIRE

    Fuentes Rubio, María

    2014-01-01

    OBJETIVOS 1. Evaluar el uso de la alfa amilasa salivar como marcador de estrés usando técnicas tradicionales (ensayos enzimáticos) en humana, usando como modelo experimental a estudiantes de veterinaria que tenían que realizar una presentación oral de un trabajo en lengua extranjera. 2. Evaluar el uso de la alfa amilasa salivar como marcador de estrés usando técnicas tradicionales (ensayos enzimáticos) en cerdos. 3. Implementar nuevos enfoques para la medición de la alfa-amilasa e...

  8. Recombinant human erythropoietin, and myocardial and cerebral acute ischemia: implications for clinical use. Eritropoyetina humana recombinante e isquemia aguda miocárdica y cerebral: sus implicaciones para el uso clínico

    Directory of Open Access Journals (Sweden)

    Maritza Cabrera Zamora

    2010-07-01

    Full Text Available Recombinant human erythropoietin has been used for more than two decades in clinical practice with promising results in the treatment of anemia associated with chronic renal insufficiency and in patients with cancer. Recent evidence has uncovered new nonhematopoietic functions of this protein and have brought new hope in the treatment of diseases with ischemic component. In the present review is rife with detail about these new features in the light of new discoveries and explores the therapeutic opportunities offered by these new scientific evidence.La eritropoyetina humana recombinante se ha empleado por más de dos décadas en la práctica clínica con resultados alentadores en el tratamiento de la anemia asociada a la insuficiencia renal crónica y en los pacientes con cáncer. Recientes evidencias han puesto al descubierto nuevas funciones no hematopoyéticas de esta proteína y han abierto nuevas esperanzas en la terapéutica de las enfermedades con componente isquémico. En la presente revisión se abunda con detalle sobre estas nuevas funciones, a la luz de los nuevos descubrimientos y se profundiza en las oportunidades terapéuticas que ofrecen estas nuevas evidencias científicas.

  9. Validación de un ELISA para la cuantificación de las impurezas proteicas de la cepa hospedera en el principio activo de la vacuna recombinante cubana contra la hepatitis B

    Directory of Open Access Journals (Sweden)

    Eliana Pérez

    2014-04-01

    Full Text Available Se validó un inmunoensayo tipo sandwich de doble anticuerpo para cuantificar las impurezas proteicas de la cepa hospedera que pueden estar presentes en el principio activo de la vacuna cubana contra la hepatitis B. Se prepararon los reactivos biológicos empleados en el ELISA. Las proteínas de la cepa hospedera se obtuvieron bajo las mismas condiciones que el proceso de producción de la proteína recombinante hasta un paso de semipurificación o purificación primaria. Los antisueros dirigidos contra las proteínas de la cepa hospedera se generaron en conejos por un proceso de inmunización en cascada. Para la validación se analizaron los siguientes parámetros: linealidad, límite de detección y cuantificación, exactitud, rango y precisión. El ensayo establecido resultó específico, con una exactitud entre 89% y 109% para todos los tampones estudiados; se demostró un ajuste parabólico y un rango de trabajo entre 0,63 y 1,25 ng/mL, la repetibilidad y la precisión intermedia mostraron coeficientes de variación inferiores al 10 y 20% respectivamente.

  10. Infecção experimental de bezerros com recombinantes do herpesvírus bovino tipo 5 defectivos na glicoproteína E (gE, timidina quinase (TK e ambos, gE/TK

    Directory of Open Access Journals (Sweden)

    C.M.B. Santos

    2011-04-01

    Full Text Available Este artigo descreve uma investigação da virulência/atenuação de recombinantes do herpesvírus bovino tipo 5 (BoHV-5 com deleções nos genes da glicoproteína E (BoHV-5gEΔ, timidina quinase (BoHV-5TKΔ, e ambos gE e TK (BoHV-5gEΔTKΔ. Bezerros soronegativos (80-90 dias de idade inoculados com o vírus parental SV-507/99 (n=5 excretaram o vírus em secreções nasais por até 15 dias (média de 10,8 dias. Nos animais inoculados com os recombinantes, a duração da excreção viral foi de 11 dias (BoHV-5gEΔ, 9,6 dias (BoHV-5TKΔ e 6,2 dias (BoHV-5gEΔTKΔ. Os maiores títulos foram observados entre os dias 1 e 6 pós-inoculação (pi, sendo de 10(6,8TCID50/mL para o SV-507/99, 10(5,1TCID50/mL (BoHV-5gEΔ, 10(5,9TCID50/mL (BoHV-5TKΔ e 10(4,7TCIΔ50/mL (BoHV-5gEΔTKΔ. Os bezerros inoculados com o vírus parental apresentaram anorexia e apatia; três deles mostraram apatia profunda e perda da condição corporal. Dois bezerros foram eutanasiados in extremis nos dias 10 e 11 pi, respectivamente e o vírus foi isolado de várias regiões do encéfalo. Já os bezerros inoculados com os recombinantes permaneceram saudáveis; alguns apresentaram uma secreção nasal serosa transitória. Administração de dexametasona (Dx no dia 42 pi resultou em excreção viral por todos os bezerros inoculados com o vírus parental (duração média de 3,7 dias, por 2 de 5 bezerros dos grupos BoHV-5TKΔ (dois dias e BoHV-5gEΔ (um dia. Os bezerros inoculados com o duplo mutante BoHV-5gEΔTKΔ não excretaram o vírus após o tratamento com Dx. Pesquisa de DNA viral por PCR no dia 30 pós-Dx revelou uma ampla distribuição do DNA do vírus parental no encéfalo; poucas seções (3/30 foram positivas no encéfalo dos animais do grupo BoHV-5gEΔ, e não detectou-se DNA latente no encéfalo dos animais dos grupos BoHV-5TKΔ e BoHV-5gEΔTKΔ. Esses resultados demonstram que os mutantes simples (gE and tk-deletados são atenuados para bezerros e estabelecem e

  11. Allele and genotype frequencies of CYP2B6 in a Turkish population.

    Science.gov (United States)

    Yuce-Artun, Nazan; Kose, Gulcin; Suzen, H Sinan

    2014-06-01

    Increasing interest in cytochrome P450 2B6 (CYP2B6) genetic polymorphism was stimulated by revelations of a specific CYP2B6 genotype significantly affecting the metabolism of various drugs in common clinical use in terms of increasing drug efficacy and avoiding adverse drug reactions. The present study aimed to determine the frequencies of CYP2B6*4 CYP2B6*5, CYP2B6*6, CYP2B6*7 and CYP2B6*9 alleles in healthy Turkish individuals (n = 172). Frequencies of three single nucleotide polymorphisms were 516G>T (28%), 785A>G (33%), and 1459C>T (12%). The frequencies of CYP2B6*1, *4, *5, *6, *7, and *9 alleles were 54.3 (95% CI 49.04-59.56), 6.4% (95% CI 3.81-8.99), 11% (95% CI 7.69-14.31), 25.3% (95% CI 20.71-29.89), 0.87% (95% CI -0.11-1.85) and 2.0% (95% CI 0.52-3.48), respectively. Allele *6 was more frequent (25.3%) than the other variant alleles in Turkish subjects. The frequencies of CYP2B6*4, *5, *6, *7, and *9 alleles were similar to European populations but significantly different from that reported for Asian populations. This is the first study to document the frequencies of the CYP2B6*4, *5, *6, *7, *9 alleles in the healthy Turkish individuals and our results could provide clinically useful information on drug metabolism by CYP2B6 in Turkish population.

  12. Do self-service technologies affect interfirm relationships? A B2B perspective

    OpenAIRE

    Raechel Johns

    2014-01-01

    While considerable literature examines business-to business (B2B) relationships, the impact of technology on these relationships has lacked attention. IT has impacted the way businesses operate in a B2B context as well as influencing services by altering the way services are delivered. To understand the way in which Internet technology has impacted these B2B services, it is essential to examine its impact not only on business processes but on business relationships too. One technology, enable...

  13. B2B marketingová komunikace společnosti John Deere

    OpenAIRE

    2013-01-01

    The aim of this master's thesis is to evaluate the implementation of the B2B marketing strategy of John Deere on a specific example. The theoretical part of the thesis focuses on defining the basics of modern marketing communications. Next it deals with defining the concept of B2B marketing and related strategies. The practical part focuses on the characterisation of the agricultural machinery industry and the slovak agricultural sector. Further it includes the introduction of other B2B marke...

  14. Deficiência de alfa-1 antitripsina: diagnóstico e tratamento Alpha-1 antitrypsin deficiency: diagnosis and treatment

    Directory of Open Access Journals (Sweden)

    Aquiles A Camelier

    2008-07-01

    Full Text Available A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que determina polimerização e acúmulo dentro dos hepatócitos. O acúmulo e a conseqüente redução dos níveis séricos de alfa-1 antitripsina determinam, respectivamente, doença hepática e pulmonar, sendo que esta se manifesta principalmente sob a forma de enfisema de aparecimento precoce, habitualmente com predomínio basal. O diagnóstico envolve a detecção de níveis séricos reduzidos de alfa-1 antitripsina e a confirmação fenotípica. Além do tratamento usual para doença pulmonar obstrutiva crônica, existe atualmente uma terapia específica com infusão de concentrados de alfa-1 antitripsina. Essa terapia de reposição, aparentemente segura, ainda não teve a eficácia clínica definitivamente comprovada, e o custo-efetividade também é um tema controverso e ainda pouco abordado. Apesar da sua importância, não existem dados epidemiológicos brasileiros a respeito da prevalência da doença ou da freqüência de ocorrência dos alelos deficientes. O subdiagnóstico também tem sido uma importante limitação tanto para o estudo da doença quanto para o tratamento adequado dos pacientes. Espera-se que a criação do Registro Internacional de Alfa-1 venha a resolver essas e outras importantes questões.Alpha-1 antitrypsin deficiency is a recently identified genetic disease that occurs almost as frequently as cystic fibrosis. It is caused by various mutations in the SERPINA1 gene, and has numerous clinical

  15. 77 FR 28764 - Temporary Non-agricultural Employment of H-2B Aliens in the United States

    Science.gov (United States)

    2012-05-16

    ... H-2B Aliens in the United States AGENCY: Employment and Training Administration, Labor. ] ACTION... Aliens in the United States, published February 21, 2012 (the 2012 H-2B Final Rule). The 2012 H-2B...

  16. Insights into CYP2B6-mediated drug–drug interactions

    Directory of Open Access Journals (Sweden)

    William D. Hedrich

    2016-09-01

    Full Text Available Mounting evidence demonstrates that CYP2B6 plays a much larger role in human drug metabolism than was previously believed. The discovery of multiple important substrates of CYP2B6 as well as polymorphic differences has sparked increasing interest in the genetic and xenobiotic factors contributing to the expression and function of the enzyme. The expression of CYP2B6 is regulated primarily by the xenobiotic receptors constitutive androstane receptor (CAR and pregnane X receptor (PXR in the liver. In addition to CYP2B6, these receptors also mediate the inductive expression of CYP3A4, and a number of important phase II enzymes and drug transporters. CYP2B6 has been demonstrated to play a role in the metabolism of 2%–10% of clinically used drugs including widely used antineoplastic agents cyclophosphamide and ifosfamide, anesthetics propofol and ketamine, synthetic opioids pethidine and methadone, and the antiretrovirals nevirapine and efavirenz, among others. Significant inter-individual variability in the expression and function of the human CYP2B6 gene exists and can result in altered clinical outcomes in patients receiving treatment with CYP2B6-substrate drugs. These variances arise from a number of sources including genetic polymorphism, and xenobiotic intervention. In this review, we will provide an overview of the key players in CYP2B6 expression and function and highlight recent advances made in assessing clinical ramifications of important CYP2B6-mediated drug–drug interactions.

  17. Reversal of pathology in CHMP2B-mediated frontotemporal dementia patient cells using RNA interference

    DEFF Research Database (Denmark)

    Nielsen, Troels Tolstrup; Mizielinska, Sarah; Hasholt, Lis;

    2012-01-01

    BACKGROUND: Frontotemporal dementia is the second most common form of young-onset dementia after Alzheimer's disease, and several genetic forms of frontotemporal dementia are known. A rare genetic variant is caused by a point mutation in the CHMP2B gene. CHMP2B is a component of the ESCRT...... role in the pathogenesis of the disease. METHODS: In the present study, we used lentiviral vectors to efficiently knockdown CHMP2B by delivering microRNA embedded small hairpin RNAs. RESULTS: We show that CHMP2B can be efficiently knocked down in patient fibroblasts using an RNA interference approach...

  18. Daclatasvir vs telaprevir plus peginterferon alfa/ribavirin for hepatitis C virus genotype 1

    Science.gov (United States)

    Jacobson, Ira; Zeuzem, Stefan; Flisiak, Robert; Knysz, Brygida; Lueth, Stefan; Zarebska-Michaluk, Dorota; Janczewska, Ewa; Ferenci, Peter; Diago, Moises; Zignego, Anna Linda; Safadi, Rifaat; Baruch, Yaacov; Abdurakhmanov, Dzhamal; Shafran, Stephen; Thabut, Dominique; Bruck, Rafael; Gadano, Adrian; Thompson, Alexander James; Kopit, Justin; McPhee, Fiona; Michener, Tracy; Hughes, Eric A; Yin, Philip D; Noviello, Stephanie

    2016-01-01

    AIM: To evaluate daclatasvir vs telaprevir, each combined with peginterferon alfa-2a/ribavirin (pegIFN/RBV), in treatment-naive hepatitis C virus (HCV) genotype (GT) 1-infected patients. METHODS: In this phase 3, randomized, open-label, noninferiority study, 602 patients were randomly assigned (2:1) to daclatasvir vs telaprevir, stratified by IL28B rs12979860 host genotype (CC vs non-CC), cirrhosis status (compensated cirrhosis vs no cirrhosis), and HCV GT1 subtype (GT1a vs GT1b). Patients were selected by study inclusion criteria from a total of 793 enrolled patients. Patients received daclatasvir 60 mg once daily or telaprevir 750 mg 3 times daily plus pegIFN/RBV. Daclatasvir recipients received 24 wk of daclatasvir plus pegIFN/RBV; those without an extended rapid virologic response (eRVR; undetectable HCV-RNA at weeks 4 and 12) received an additional 24 wk of pegIFN/RBV. Telaprevir-treated patients received 12 wk of telaprevir plus pegIFN/RBV followed by 12 (with eRVR) or 36 (no eRVR) wk of pegIFN/RBV. The primary objective was to compare for noninferiority of sustained virologic response rates at posttreatment week 12 (SVR12) in GT1b-infected patients. Key secondary objectives were to demonstrate that the rates of anemia (hemoglobin < 10 g/dL) and rash-related events, through week 12, were lower with daclatasvir + pegIFN/RBV than with telaprevir + pegIFN/RBV among GT1b-infected patients. Resistance testing was performed using population-based sequencing of the NS5A region for all patients at baseline, and for patients with virologic failure or relapse and HCV-RNA ≥ 1000 IU/mL, to investigate any link between NS5A polymorphisms associated with daclatasvir resistance and virologic outcome. RESULTS: Patient demographics and disease characteristics were generally balanced across treatment arms; however, there was a higher proportion of black/African Americans in the daclatasvir groups (6.0% and 8.2% in the GT1b and GT1a groups, respectively) than in the

  19. Regulation of PI-2b Pilus Expression in Hypervirulent Streptococcus agalactiae ST-17 BM110

    Science.gov (United States)

    du Merle, Laurence; Rosinski-Chupin, Isabelle; Gominet, Myriam; Bellais, Samuel; Poyart, Claire; Trieu-Cuot, Patrick

    2017-01-01

    The widely spread Streptococcus agalactiae (also known as Group B Streptococcus, GBS) “hypervirulent” ST17 clone is strongly associated with neonatal meningitis. The PI-2b locus is mainly found in ST17 strains but is also present in a few non ST17 human isolates such as the ST-7 prototype strain A909. Here, we analysed the expression of the PI-2b pilus in the ST17 strain BM110 as compared to the non ST17 A909. Comparative genome analyses revealed the presence of a 43-base pair (bp) hairpin-like structure in the upstream region of PI-2b operon in all 26 ST17 genomes, which was absent in the 8 non-ST17 strains carrying the PI-2b locus. Deletion of this 43-bp sequence in strain BM110 resulted in a 3- to 5-fold increased transcription of PI-2b. Characterization of PI-2b promoter region in A909 and BM110 strains was carried out by RNAseq, primer extension, qRT-PCR and transcriptional fusions with gfp as reporter gene. Our results indicate the presence of a single promoter (Ppi2b) with a transcriptional start site (TSS) mapped 37 bases upstream of the start codon of the first PI-2b gene. The large operon of 16 genes located upstream of PI-2b codes for the group B carbohydrate (also known as antigen B), a major constituent of the bacterial cell wall. We showed that the hairpin sequence located between antigen B and PI-2b operons is a transcriptional terminator. In A909, increased expression of PI-2b probably results from read-through transcription from antigen B operon. In addition, we showed that an extended 5’ promoter region is required for maximal transcription of gfp as a reporter gene in S. agalactiae from Ppi2b promoter. Gene reporter assays performed in Lactococcus lactis strain NZ9000, a related non-pathogenic Gram-positive species, revealed that GBS-specific regulatory factors are required to drive PI-2b transcription. PI-2b expression is up-regulated in the BM110ΔcovR mutant as compared to the parental BM110 strain, but this effect is probably indirect

  20. Data of evolutionary structure change: 1BEDA-2B6MA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BEDA-2B6MA 1BED 2B6M A A AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTF---...HHHHHHHHHH EEEE EEEEE HHHHHHHHHHHHHH - 0 1BED... A 1BEDA HCNTF---E...e> ALA CA 306 SER CA 272 1BED... A 1BEDA HTLRKPPKDEQ

  1. The SH2B1 obesity locus and abnormal glucose homeostasis

    DEFF Research Database (Denmark)

    Prudente, S; Copetti, M; Morini, E

    2013-01-01

    affecting risk of obesity and insulin resistance might also modulate risk of T2D. Recently, 32 loci have been associated with body mass index (BMI) by genome-wide studies, including one locus on chromosome 16p11 containing the SH2B1 gene. Animal studies have suggested that SH2B1 is a physiological enhancer...

  2. Preparation and application of hydroxyapatite(HA) nanoparticles/NR2B-siRNA complex

    Institute of Scientific and Technical Information of China (English)

    YANG Hui; HUANG Dong; ZHU Shai-hong; YAN Xue-bin; GU Yong-hong; YAN Hui; WU Li-xiang

    2008-01-01

    Hydroxyapatite(HA) nanoparticles were prepared by coprecipitation-hydrothermal synthesis and their exosyndrome was estimated via transmission electron microscopy. Agarose gel electrophoresis and ultraviolet spectrophotometry were used to evaluate the ability of HA to bind NR2B-siRNA at different pH values and at different HA-NR2B-siRNA ratios. And the stability of the complex in saline was also evaluated. The effect of HA/NR2B-siRNA complex on chronic inflammatory pain was evaluated in vivo in mice. Transmission electron microscopy(TEM) reveals that HA nanoparticles are thin strips or short rod in shape and the one-dimensional particle size of HA nanoparticles is 40-50 nm. Under the acid or neutral condition, the Zeta potential of HA is positive; nanoparticles can completely bind NR2B-siRNA when the HA:NR2B-siRNA ratio is at or larger than 35-1; while under the alkaline condition, the affinity of HA to NR2B-siRNA is rather weak. HA/NR2B-siRNA complex is not dissociated when being resuspended in saline. The nociception of the tonic phase induced by formalin is significantly reduced in the HA/NR2B-siRNA treated mice as compared with the controls. Therefore, HA may be a new siRNA nano-vector material.

  3. SRC Inhibition Reduces NR2B Surface Expression and Synaptic Plasticity in the Amygdala

    Science.gov (United States)

    Sinai, Laleh; Duffy, Steven; Roder, John C.

    2010-01-01

    The Src protein tyrosine kinase plays a central role in the regulation of N-methyl-d-aspartate receptor (NMDAR) activity by regulating NMDAR subunit 2B (NR2B) surface expression. In the amygdala, NMDA-dependent synaptic plasticity resulting from convergent somatosensory and auditory inputs contributes to emotional memory; however, the role of Src…

  4. Smoking, alcoholism and genetic polymorphisms alter CYP2B6 levels in human brain.

    Science.gov (United States)

    Miksys, Sharon; Lerman, Caryn; Shields, Peter G; Mash, Deborah C; Tyndale, Rachel F

    2003-07-01

    CYP2B6 metabolizes drugs such as nicotine and bupropion, and many toxins and carcinogens. Nicotine induces CYP2B1 in rat brain and in humans polymorphic variation in CYP2B6 affects smoking cessation rates. The aim of this study was to compare CYP2B6 expression in brains of human smokers and non-smokers and alcoholics and non-alcoholics (n=26). CYP2B6 expression was brain region-specific, and was observed in both neurons and astrocytes. CYP2B6 levels were higher in brains of smokers and alcoholics, particularly in cerebellar Purkinje cells and hippocampal pyramidal neurons, cells known to be damaged in alcoholics. Significantly more (penzyme levels, stability and activity. Preliminary genotyping of this small sample (n=24) suggested that individuals with the CC genotype had higher brain CYP2B6 than those with the CT or TT genotype. Higher brain CYP2B6 activity in smokers and alcoholics may cause altered sensitivity to centrally acting drugs, increased susceptibility to neurotoxins and carcinogenic xenobiotics and contribute to central tolerance to nicotine.

  5. Noncanonical sortase-mediated assembly of pilus type 2b in group B Streptococcus.

    Science.gov (United States)

    Lazzarin, Maddalena; Cozzi, Roberta; Malito, Enrico; Martinelli, Manuele; D'Onofrio, Mariapina; Maione, Domenico; Margarit, Immaculada; Rinaudo, C Daniela

    2015-11-01

    Group B Streptococcus (GBS) expresses 3 structurally distinct pilus types (1, 2a, and 2b) identified as important virulence factors and vaccine targets. These pili are heterotrimeric polymers, covalently assembled on the cell wall by sortase (Srt) enzymes. We investigated the pilus-2b biogenesis mechanism by using a multidisciplinary approach integrating genetic, biochemical, and structural studies to dissect the role of the 2 pilus-2b-associated Srts. We show that only 1 sortase (SrtC1-2b) is responsible for pilus protein polymerization, whereas the second one (Srt2-2b) does not act as a pilin polymerase, but similarly to the housekeeping class A Srt (SrtA), it is involved in cell-wall pilus anchoring by targeting the minor ancillary subunit. Based on its function and sequence features, Srt2-2b does not belong to class C Srts (SrtCs), nor is it a canonical member of any other known family of Srts. We also report the crystal structure of SrtC1-2b at 1.9 Å resolution. The overall fold resembles the typical structure of SrtCs except for the N-terminal lid region that appears in an open conformation displaced from the active site. Our findings reveal that GBS pilus type 2b biogenesis differs significantly from the current model of pilus assembly in gram-positive pathogens.

  6. Genetics Home Reference: RRM2B-related mitochondrial DNA depletion syndrome, encephalomyopathic form with renal ...

    Science.gov (United States)

    ... Munnich A, Rötig A. Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion. Nat Genet. 2007 Jun;39(6):776-80. Epub 2007 May 7. Citation on PubMed GeneReview: RRM2B-Related Mitochondrial Disease Pontarin G, Ferraro P, Bee L, Reichard P, ...

  7. First identification of Porcine Circovirus Type 2b mutant in pigs from Uruguay.

    Science.gov (United States)

    Ramos, Natalia; Mirazo, Santiago; Castro, Gustavo; Arbiza, Juan

    2015-07-01

    Porcine Circovirus Type 2 (PCV2) is a worldwide distributed virus and is considered an important emerging pathogen related to several distinct disease syndromes in pigs. PCV2 strains are classified into three genotypes: PCV2a, with five subtypes (2A-2E), PCV2b with three subtypes (1A-1C) and PCV2c, only found in Denmark. Recently, several reports suggested the circulation of newly emerging PCV2b mutants (mPCV2b) isolated from pigs with PCVAD in cases of suspected vaccine failure. In this work, we report for the first time the identification of mPCV2b in pigs from Uruguay, providing an additional evidence of a global circulation. Complete genome characterization and phylogenetic analysis reveal that Uruguayan strains, as well as mPCV2b previously reported are closely related to other sequences already classified as PCV2b-1C. Furthermore, results showed that mPCV2b presented different genetic markers in the capsid protein compared with classical PCV2a/b strains. Further investigation about antigenic shift of the mPCV2b strains including the Uruguayan isolates is needed.

  8. Data of evolutionary structure change: 1ANTI-2B4XL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-2B4XL 1ANT 2B4X I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE...Chain> 1ANT I 1ANTI AASTA----VVIA...14> 1ANT I 1ANTI...ntryChain> 1ANT I 1ANTI

  9. Fabrication Report for the AFC-2A and AFC-2B Capsule Irradiations in the ATR

    Energy Technology Data Exchange (ETDEWEB)

    Timothy A. Hyde

    2007-10-01

    This document provides a general narrative description of the AFC-2A and 2B fuel fabrication processes for the AFC 2A and AFC 2B fuel irradiation experiments fabricated at the Idaho National Laboratory’s Materials and Fuels Complex (MFC) for irradiation in the Advanced Test Reactor (ATR).

  10. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2010 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  11. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2011

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2011 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  12. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2012

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2012 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  13. A Decompositional Approach to Executing Quality Data Model Algorithms on the i2b2 Platform

    Science.gov (United States)

    Mo, Huan; Jiang, Guoqian; Pacheco, Jennifer A.; Kiefer, Richard; Rasmussen, Luke V.; Pathak, Jyotishman; Denny, Joshua C.; Thompson, William K.

    2016-01-01

    The Quality Data Model (QDM) is an established standard for representing electronic clinical quality measures on electronic health record (EHR) repositories. The Informatics for Integrated Biology and the Bedside (i2b2) is a widely used platform for implementing clinical data repositories. However, translation from QDM to i2b2 is challenging, since QDM allows for complex queries beyond the capability of single i2b2 messages. We have developed an approach to decompose complex QDM algorithms into workflows of single i2b2 messages, and execute them on the KNIME data analytics platform. Each workflow operation module is composed of parameter lists, a template for the i2b2 message, an mechanism to create parameter updates, and a web service call to i2b2. The communication between workflow modules relies on passing keys ofi2b2 result sets. As a demonstration of validity, we describe the implementation and execution of a type 2 diabetes mellitus phenotype algorithm against an i2b2 data repository. PMID:27570665

  14. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2009

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2009 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  15. Doc2b synchronizes secretion from chromaffin cells by stimulating fast and inhibiting sustained release

    DEFF Research Database (Denmark)

    da Silva Pinheiro, Paulo César; de Wit, Heidi; Walter, Alexander M;

    2013-01-01

    is still high. We conclude that Doc2b acts to inhibit vesicle priming during prolonged calcium elevations, thus protecting unprimed vesicles from fusing prematurely, and redirecting them to refill the readily releasable pool after relaxation of the calcium signal. In sum, Doc2b favors fast, synchronized...

  16. XO-2b: a Prograde Planet with a Negligible Eccentricity, and an Additional Radial Velocity Variation

    CERN Document Server

    Narita, Norio; Sato, Bun'ei; Harakawa, Hiroki; Fukui, Akihiko; Aoki, Wako; Tamura, Motohide

    2011-01-01

    We present precise radial velocities of XO-2 taken with the Subaru HDS, covering two transits of XO-2b with an interval of nearly two years. The data suggest that the orbital eccentricity of XO-2b is consistent with zero within 2$\\sigma$ ($e=0.045\\pm0.024$) and the orbit of XO-2b is prograde (the sky-projected spin-orbit alignment angle $\\lambda=10^{\\circ}\\pm72^{\\circ}$). The poor constraint of $\\lambda$ is due to a small impact parameter (the orbital inclination of XO-2b is almost 90$^{\\circ}$). The data also provide an improved estimate of the mass of XO-2b as $0.62\\pm0.02$ $M_{\\rm Jup}$. We also find a long-term radial velocity variation in this system. Further radial velocity measurements are necessary to specify the cause of this additional variation.

  17. Global view of transcriptome in the brains of aged NR2B transgenic mice*****

    Institute of Scientific and Technical Information of China (English)

    Chunxia Li; Men Su; Huimin Wang; Yinghe Hu

    2013-01-01

    NR2B subunits are involved in regulating aging, in particular, age-related learning and memory deficits. We examined 19-month-old NR2B transgenic mice and their littermate controls. First, we detected expression of the NR2B subunit gene, Grin2b, in the neocortex of transgenic mice using real-time PCR. Next, we used microarrays to examine differences in neocortical gene expression. Pathway and signal-net analyses identified multiple pathways altered in the transgenic mice, in-cluding the P53, Jak-STAT, Wnt, and Notch pathways, as wel as regulation of the actin cytoskeleton and neuroactive ligand-receptor interactions. Further signal-net analysis highlighted the P53 and insulin-like growth factor pathways as key regulatory pathways. Our results provide new insight into understanding the molecular mechanisms of NR2B regulated age-related memory storage, normal organismal aging and age-related disease.

  18. Isolation of recombinant strains with enhanced pectinase production by protoplast fusion between Penicillium expansum and Penicillium griseoroseum Isolamento de linhagens recombinantes com maior produção de pectinases por meio de fusão de protoplastos entre Penicillium expansum e Penicillium griseoroseum

    Directory of Open Access Journals (Sweden)

    Maurilio Antonio Varavallo

    2007-03-01

    Full Text Available Protoplast fusion between complementary auxotrophic and morphological mutant strains of Penicillium griseoroseum and P. expansum was induced by polyethylene glycol and calcium ions (Ca2+. Fusant strains were obtained in minimal medium and a prototrophic strain, possibly diploid, was chosen for haplodization with the fungicide benomyl. Different recombinant strains were isolated and characterized for occurrence of auxotrophic mutations and pectinolytic enzyme production. The fusant prototrophic did not present higher pectinase production than the parental strains, but among 29 recombinants analyzed, four presented enhanced enzyme activities. The recombinant RGE27, which possesses the same auxotrophic and morphologic mutations as the P. griseoroseum parental strain, presented a considerable increase in polygalacturonase (3-fold and pectin lyase production (1.2-fold.Fusões de protoplastos entre linhagens mutantes auxotróficas e morfológicas complementares de Penicillium griseoroseum e P. expansum foram induzidas por polietilenoglicol e íons cálcio (Ca2+. Fusionantes foram obtidos em meio mínimo e uma linhagem prototrófica, possivelmente diplóide, foi selecionada para a haploidização com o fungicida benomil. Diferentes linhagens recombinantes foram isoladas e caracterizadas quanto à presença de mutações auxotróficas e a produção de enzimas pectinolíticas. O fusionante prototrófico não apresentou maior atividade de pectinases em relação às linhagens parentais, entretanto, entre 29 recombinantes analisados, quatro apresentaram maiores atividades enzimáticas. O recombinante RGE27, o qual possui as mesmas mutações auxotróficas e morfológicas que a linhagem parental de P. griseoroseum, apresentou um aumento considerável na produção de poligalacturonase (3 vezes e de pectina liase (1,2 vezes.

  19. RET(MEN 2B) is active in the endoplasmic reticulum before reaching the cell surface.

    Science.gov (United States)

    Runeberg-Roos, P; Virtanen, H; Saarma, M

    2007-12-13

    MEN 2B (multiple endocrine neoplasia type 2B) is an autosomal dominant cancer syndrome caused by an oncogenic form of the receptor tyrosine kinase REarranged during transfection (RET). The MEN 2B syndrome is associated with an abnormal autophosphorylation of the mutated receptor even without ligand-stimulation. Here, we characterize the activation of a RET(MEN 2B) variant carrying the point mutation Met918Thr, and show that the 150 kDa precursor of RET(MEN 2B) becomes phosphorylated already during synthesis in the endoplasmic reticulum (ER). At least three different tyrosine residues (Tyr905, Tyr1062, Tyr1096) of the RET(MEN 2B) precursor are phosphorylated before the oncogenic receptor reaches the cell surface. We also demonstrate that the precursor of RET(MEN 2B) interacts with both growth factor receptor-bound protein and Src homology 2 domain-containing already in the ER, and that this interaction is dependent on the kinase activity of RET. With the aid of two RET mutants (RET(MEN 2B/S32L) and RET(MEN 2B/F393L)), which accumulate in the ER, we show that the oncogenic precursor of the receptor has the capacity to activate AKT, extracellular signal-regulated kinase and signal transducer and activator of transcription 3 from the ER. Taken together, our data demonstrate that the oncogenic precursor of RET(MEN 2B) is phosphorylated, interacts with adapter proteins and induces downstream signalling from the ER.

  20. Interferon-alpha-2b induces autophagy in hepatocellular carcinoma cells through Beclin1 pathway

    Institute of Scientific and Technical Information of China (English)

    Jun Zhao; Ming-Li Wang; Zeng Li; Dong-Mei Gao; Yu Cai; Jun Chang; Shi-Ping Wang

    2014-01-01

    Objective:To determine whether Interferon-alpha-2b (IFN-α2b) can modulate the autophagic response in hepatocellular carcinoma cells. Methods:Hepatocellular carcinoma cells were treated with IFN-α2b. Autophagy was assessed by acridine orange staining, GFP-LC3 dotted assay, transmission electron microscopy and immunoblotting. Results:Acridine orange staining showed that IFN-α2b triggered the accumulation of acidic vesicular and autolysosomes in HepG2 cells. hTe acridine orange HepG2 cell ratios were (4.3±1.0)%, (6.9±1.4)%, and (13.1±2.3)%, respectively, atfer treatment with 100, 1,000, and 10,000 IU/mL IFN-α2b for 48 h. A markedly punctate pattern was observed in HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h, but only diffuse and weakly lfuorescent GFP-LC3 puncta was observed in control cells. HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h developed autophagosome-like characteristics, including single-or double-membrane vacuoles containing intact and degraded cellular debris. The Beclin1 and LC3-II protein expression was up-regulated by IFN-α2b treatment. Conclusion:Autophagy can be induced in a dose-dependent manner by treatment with IFN-α2b in HepG2 cells, and the Beclin1 signaling pathway was stimulated by IFN-α2b.

  1. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida.

    Directory of Open Access Journals (Sweden)

    Jael R Malenke

    Full Text Available Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida, we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B. We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma or creosote bush (Larrea tridentata, plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a

  2. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida).

    Science.gov (United States)

    Malenke, Jael R; Magnanou, Elodie; Thomas, Kirk; Dearing, M Denise

    2012-01-01

    Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida), we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B). We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma) or creosote bush (Larrea tridentata), plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a wild mammalian

  3. Elementos regulatórios responsáveis pelo controle da estabilidade do mRNA de alfa tubulina de Trypanosoma cruzi

    OpenAIRE

    Patricia Rosa de Araujo

    2007-01-01

    Um mecanismo de auto-regulação dos mRNAs de alfa e beta tubulina em Trypanosoma cruzi afeta a meia vida desses transcritos ao longo do ciclo de vida do parasita. Enquanto epimastigotas apresentam altos níveis dos mRNAs de tubulina, um excesso da proteína não polimerizada em amastigotas está relacionada com o decréscimo dos níveis dos seus mRNAs. Esta diminuição não é resultado de mudanças na transcrição e sim devido a redução da meia vida dos mRNAs de alfa e beta tubulina. Através do tratamen...

  4. Assessment of the Results of the Multicenter Randomized Acute Leukemia French Association (ALFA) 9803 Trial%法国急性白血病协会(ALFA)9803多中心随机临床试验结果的评价

    Institute of Scientific and Technical Information of China (English)

    江滨; 凌伟

    2009-01-01

    @@ 1文献来源 Gardin C, Turlure P, Fagot T, et al. Postremission treatment of elderly patients with acute myeloid leukemia in first complete remission after intensive induction chemotherapy: Results of the multicenter randomized Acute Leukemia French Association (ALFA) 9803 trial [J]. Blood, 2007, 109(12) : 5129-5135.

  5. Characterization of the A2B adenosine receptor from mouse, rabbit, and dog.

    Science.gov (United States)

    Auchampach, John A; Kreckler, Laura M; Wan, Tina C; Maas, Jason E; van der Hoeven, Dharini; Gizewski, Elizabeth; Narayanan, Jayashree; Maas, Garren E

    2009-04-01

    We have cloned and pharmacologically characterized the A(2B) adenosine receptor (AR) from the dog, rabbit, and mouse. The full coding regions of the dog and mouse A(2B)AR were obtained by reverse transcriptase-polymerase chain reaction, and the rabbit A(2B)AR cDNA was obtained by screening a rabbit brain cDNA library. It is noteworthy that an additional clone was isolated by library screening that was identical in sequence to the full-length rabbit A(2B)AR, with the exception of a 27-base pair deletion in the region encoding amino acids 103 to 111 (A(2B)AR(103-111)). This 9 amino acid deletion is located in the second intracellular loop at the only known splice junction of the A(2B)AR and seems to result from the use of an additional 5' donor site found in the rabbit and dog but not in the human, rat, or mouse sequences. [(3)H]3-Isobutyl-8-pyrrolidinoxanthine and 8-[4-[((4-cyano-[2,6-(3)H]-phenyl)carbamoylmethyl)oxy]phenyl]-1,3-di(n-propyl)xanthine ([(3)H]MRS 1754) bound with high affinity to membranes prepared from human embryonic kidney (HEK) 293 cells expressing mouse, rabbit, and dog A(2B)ARs. Competition binding studies performed with a panel of agonist (adenosine and 2-amino-3,5-dicyano-4-phenylpyridine analogs) and antagonist ligands identified similar potency orders for the A(2B)AR orthologs, although most xanthine antagonists displayed lower binding affinity for the dog A(2B)AR compared with A(2B)ARs from rabbit and mouse. No specific binding could be detected with membranes prepared from HEK 293 cells expressing the rabbit A(2B)AR(103-111) variant. Furthermore, the variant failed to stimulate adenylyl cyclase or calcium mobilization. We conclude that significant differences in antagonist pharmacology of the A(2B)AR exist between species and that some species express nonfunctional variants of the A(2B)AR due to "leaky" splicing.

  6. Impact of elosulfase alfa in patients with morquio A syndrome who have limited ambulation: An open-label, phase 2 study.

    Science.gov (United States)

    Harmatz, Paul R; Mengel, Eugen; Geberhiwot, Tarekegn; Muschol, Nicole; Hendriksz, Christian J; Burton, Barbara K; Jameson, Elisabeth; Berger, Kenneth I; Jester, Andrea; Treadwell, Marsha; Sisic, Zlatko; Decker, Celeste

    2017-02-01

    Efficacy and safety of elosulfase alfa enzyme replacement therapy (ERT) were assessed in an open-label, phase 2, multi-national study in Morquio A patients aged ≥5 years unable to walk ≥30 meters in the 6-min walk test. Patients received elosulfase alfa 2.0 mg/kg/week intravenously for 48 weeks. Efficacy measures were functional dexterity, pinch/grip strength, mobility in a modified timed 25-foot walk, pain, quality of life, respiratory function, and urine keratan sulfate (KS). Safety/tolerability was also assessed. Fifteen patients received elosulfase alfa, three patients discontinued ERT due to adverse events (two were grade 3 drug-related adverse events, the other was not drug-related), and two patients missed >20% of planned infusions; 10 completed treatment through 48 weeks and received ≥80% of planned infusions (Modified Per Protocol [MPP] population). The study population had more advanced disease than that enrolled in other trials. From baseline to week 48, MPP data showed biochemical efficacy (urine KS decreased 52.4%). The remaining efficacy results were highly variable due to challenges in test execution because of severe skeletal and joint abnormalities, small sample sizes, and clinical heterogeneity among patients. Eight patients showed improvements in one or more outcome measures; several patients indicated improvements not captured by the study assessments (e.g., increased energy, functional ability). The nature of adverse events was similar to other elosulfase alfa studies. This study illustrates the considerable challenges in objectively measuring impact of ERT in very disabled Morquio A patients and highlights the need to examine results on an individual basis. © 2016 The Authors. American Journal of Medical Genetics Part A Published by Wiley Periodicals, Inc.

  7. A cost-effectiveness evaluation comparing originator follitropin alfa to the biosimilar for the treatment of infertility

    Directory of Open Access Journals (Sweden)

    Gizzo S

    2016-12-01

    Full Text Available Salvatore Gizzo,1 Juan A Garcia-Velasco,2 Franca Heiman,3 Claudio Ripellino,3 Klaus Bühler4 1Department of Woman and Child Health, University of Padua, Padua, Italy; 2Department of Obstetrics and Gynecology, Rey Juan Carlos University Madrid, Madrid, Spain; 3IMS Health Information Solutions Italy Srl, Milan, Italy; 4Centre for Gynaecology, Endocrinology, and Reproductive Medicine, Ulm and Stuttgart, Germany Objectives: To perform a cost-effectiveness evaluation comparing the originator follitropin alfa (Gonal-f® to the biosimilar (Bemfola® in the Italian and Spanish contexts, with an assessment of the German and UK backgrounds. Methods: Starting from the study by Rettenbacher et al, a cost-effectiveness model was developed in the Italian and Spanish contexts. Clinical data on subjects, doses of gonadotropin, pregnancies, live-born children, and ovarian hyperstimulation syndrome were used to feed the model. Costs related to drugs, hospitalizations, specialist visits, and examinations were retrieved from Italian and Spanish tariffs. Gonadotropin acquisition costs for Germany and the UK were also taken into account to expand the economical assessment to the other countries. The evaluation was done based on the National Health Service perspective. Sensitivity analyses, both univariate and probabilistic, as long as scenario analyses, tested the robustness of the model. Results: Originator follicle-stimulating hormone (FSH costs were €3,663 and €6,387 in Italy and Spain, respectively, whereas biosimilar FSH costs were €3,483 and €6,342. The efficacy was found to be 0.52 for the originator and 0.47 for the biosimilar. The average cost per live birth was estimated to be €7,044 and €12,283 for the originator FSH and €7,411 and €13,494 for the biosimilar for Italy and Spain, respectively. Furthermore, the originator FSH generated an incremental cost-effectiveness ratio of €3,600 for Italy and €900 for Spain compared to the

  8. The influence of VO2(B nanobelts on thermal decomposition of ammonium perchlorate

    Directory of Open Access Journals (Sweden)

    Zhang Yifu

    2015-09-01

    Full Text Available The influence of vanadium dioxide VO2(B on thermal decomposition of ammonium perchlorate (AP has not been reported before. In this contribution, the effect of VO2(B nanobelts on the thermal decomposition of AP was investigated by the Thermo- Gravimetric Analysis and Differential Thermal Analysis (TG/DTA. VO2(B nanobelts were hydrothermally prepared using peroxovanadium (V complexes, ethanol and water as starting materials. The thermal decomposition temperatures of AP in the presence of I wt.%, 3 wt.% and 6 wt.% of as-obtained VO2<B nanobelts were reduced by 39 °C. 62 °C and 74 °C, respectively. The results indicated that VO2(B nanobelts had a great influence on the thermal decomposition temperature of AP Furthermore, the influence of the corresponding V2Os, which was obtained by thermal treatment of VO2(B nanobelts, on the thermal decomposition of AP was also investigated. The resufs showed that VO2(B nanobelts had a greater influence on the thermal decomposition temperature of AP than that of V2Os.

  9. Differential role of SH2-B and APS in regulating energy and glucose homeostasis.

    Science.gov (United States)

    Li, Minghua; Ren, Decheng; Iseki, Masanori; Takaki, Satoshi; Rui, Liangyou

    2006-05-01

    SH2-B and APS, two members of a pleckstrin homology and SH2 domain-containing adaptor family, promote both insulin and leptin signaling in a similar fashion in cultured cells. In addition, APS mediates insulin-stimulated activation of the c-Cbl/CAP/TC10 pathway in cultured adipocytes. Here we characterized genetically modified mice lacking SH2-B, APS, or both to determine the physiological roles of these two proteins in animals. Disruption of the SH2-B gene resulted in obesity, hyperglycemia, hyperinsulinemia, and glucose intolerance. Conversely, deletion of the APS gene did not alter adiposity, energy balance, and glucose metabolism. Energy intake, energy expenditure, fat content, body weight, and plasma insulin, leptin, glucose, and lipid levels were similar between APS(-/-) and WT littermates fed either normal chow or a high-fat diet. Moreover, deletion of APS failed to alter insulin and glucose tolerance. APS(-/-)/SH2-B(-/-) double knockout mice also developed energy imbalance, obesity, hyperleptinemia, hyperinsulinemia, hyperglycemia, and glucose intolerance; however, plasma leptin and insulin levels were significantly lower in APS(-/-)/SH2-B(-/-) than in SH2-B(-/-) mice. These results suggest that SH2-B, but not APS, is a key positive regulator of energy and glucose metabolism in mice.

  10. Structural characterization and antiviral effect of a novel polysaccharide PSP-2B from Prunellae Spica.

    Science.gov (United States)

    Ma, Feng-Wei; Kong, Si-Yuan; Tan, Hong-Sheng; Wu, Rong; Xia, Bing; Zhou, Yan; Xu, Hong-Xi

    2016-11-05

    In the present study, a novel polysaccharide, PSP-2B, was isolated from aqueous extracts of Prunellae Spica by direct ultrafiltration membrane separation and gel chromatography purification. PSP-2B is a partially sulphated polysaccharide with a molecular weight of approximately 32kDa. Its sulfate content is 10.59% by elemental analysis. The major sugars comprising PSP-2B are arabinose, galactose and mannose, in addition to small amounts of glucose and uronic acids. The framework of PSP-2B is speculated to be a branched arabinogalactomannan, and the side chains are terminated primarily by the Araf residues. PSP-2B also contains 2.98% protein. PSP-2B exhibits activity against herpes simplex virus (HSV), with a half maximal inhibitory concentration (IC50) of approximately 69μg/mL for HSV-1 and 49μg/mL for HSV-2. However, PSP-2B demonstrated no cytotoxicity even when its concentration was increased to 1600μg/mL, suggesting that it has potential as an anti-HSV drug candidate.

  11. The A2B adenosine receptor modulates pulmonary hypertension associated with interstitial lung disease.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Zhong, Hongyan; Acero, Luis; Weng, Tingting; Melicoff, Ernestina; West, James D; Hemnes, Anna; Grenz, Almut; Eltzschig, Holger K; Blackwell, Timothy S; Xia, Yang; Johnston, Richard A; Zeng, Dewan; Belardinelli, Luiz; Blackburn, Michael R

    2012-06-01

    Development of pulmonary hypertension is a common and deadly complication of interstitial lung disease. Little is known regarding the cellular and molecular mechanisms that lead to pulmonary hypertension in patients with interstitial lung disease, and effective treatment options are lacking. The purpose of this study was to examine the adenosine 2B receptor (A(2B)R) as a regulator of vascular remodeling and pulmonary hypertension secondary to pulmonary fibrosis. To accomplish this, cellular and molecular changes in vascular remodeling were monitored in mice exposed to bleomycin in conjunction with genetic removal of the A(2B)R or treatment with the A(2B)R antagonist GS-6201. Results demonstrated that GS-6201 treatment or genetic removal of the A(2B)R attenuated vascular remodeling and hypertension in our model. Furthermore, direct A(2B)R activation on vascular cells promoted interleukin-6 and endothelin-1 release. These studies identify a novel mechanism of disease progression to pulmonary hypertension and support the development of A(2B)R antagonists for the treatment of pulmonary hypertension secondary to interstitial lung disease.

  12. Neutron diffraction studies of magnetic ordering in superconducting ErNi2B2C and TmNi2B2C in an applied magnetic field

    DEFF Research Database (Denmark)

    Toft, Katrine Nørgaard

    along [110], the magnetic structure rotates a small angle of 0.5 degrees away from the symmetrydirection. TmNi2B2C: A magnetic field applied in the [100] direction suppresses the zero field magnetic structure QF = (0.094,0.094,0) (TN = 1.6 K), in favor of the Fermi surface nesting structure QN = (0......The field-induced magnetic structures of ErNi2B2C and TmNi2B2C in are especially interesting because the field suppresses the superconducting order parameter and therefore the magnetic properties can be studied while varying the strength ofsuperconductivity. ErNi2B2C: For magnetic fields along all...... three symmetry directions, the observed magnetic structures have a period corresponding to the Fermi surface nesting structure. The phase diagrams present all the observed magnetic structures.Two results remain unresolved: 1. When applying the magnetic field along [010], the minority domain (QNB = (0,Q...

  13. Results of thrombolytic treatment with recombinant streptokinase in elderly and non elderly patients. Resultados del tratamiento trombolítico con estreptoquinasa recombinante en pacientes ancianos y no ancianos.

    Directory of Open Access Journals (Sweden)

    Marcos D. Iraola Ferrer

    resultados del tratamiento con estreptoquinasa recombinante, en ancianos y no ancianos con infarto agudo del miocadio. Métodos: Estudio prospectivo observacional de 325 pacientes ingresados con infarto agudo del miocardio en el Hospital Provincial Universitario ¨Dr. Gustavo Aldereguìa Lima¨, de Cienfuegos, que recibieron terapéutica trombolítica con estreptoquinasa recombinante ( Heberquinasa a la dosis de 1 500 000 unidades, y tratamiento conjunto con 325 mg de ácido acetilsalicìlico. Resultados: La presencia de infarto fue más frecuente en el sexo masculino (68,31 %; asociado en mayor porcentaje al tabaquismo, la hipertensión arterial, la hipercolesteronemia en los pacientes menores de 74 años ; la hipertensión arterial y la diabetes en los mayores de 75 años; la cara anterior (44,6 %, fue la más afectada y la terapia trombolítica se realizó con una media de 211, 76 minutos. Los fallecidos aumentaron con la edad. El hecho de estar clasificado hemodinámicamente en un Killip-Kimball (K-K grado III –IV, haber tenido arritmias graves y rotura cardiaca fueron la variables que se asociaron de forma significativa con la mortalidad.

  14. Influence of wool and thermo-binder fibers relative fractions on the adhesion of non-woven Alfa fibers reinforced unsaturated polyester hybrid composites

    Science.gov (United States)

    Amin Omri, Med; Triki, A.; Ben Hassen, Med; Arous, M.; Bulou, A.

    2016-10-01

    Alfa/wool/thermo-binder fibers hybrid composites were investigated in order to analyze adhesion state. Bearing in mind the chemical structure of wool and thermo-binder fibers, this study revealed a good compatibility between the reinforcement and the matrix. Dielectric measurements revealed the presence of two dielectric relaxations in the composite. The first relaxation was attributed to the α mode relaxation and the second one was associated with the conductivity noted for high temperature. This study allowed the analysis of the interfacial polarization effect using the Havrilliak-Negami model in the electric modulus formalism. The lowness of this relaxation intensity revealed a good adhesion of the fibers in the matrix. Differential Scanning Calorimetry (DSC) showed a slow decrease of the Tg glass transition temperature compared to the matrix, which could be explained by the existence of interactions between the fibers and the matrix. Vibrational analysis, based on FTIR measurements, showed a less hydrophilic character of Alfa fibers owing to a basic dissociation that occurs between the wool fibers and the water molecules associated with Alfa fibers. Furthermore, adhesion mechanism in the composite material was established by covalent and hydrogen bonds. Tensile testing performed on this composite confirmed that such adhesion was improved by increasing the thermo-binder fibers relative fraction.

  15. Caracterização de linhagens endogâmicas recombinantes e mapeamento de locos de características quantitativas associados a ciclo e produtividade do feijoeiro-comum

    Directory of Open Access Journals (Sweden)

    Faleiro Fábio Gelape

    2003-01-01

    Full Text Available O objetivo deste trabalho foi caracterizar 154 linhagens endogâmicas recombinantes por meio da avaliação de características quantitativas, morfológicas, moleculares e de resistência a doenças e mapear locos de características quantitativas associados a ciclo e produtividade do feijoeiro-comum. Adotando o valor do limite de detecção (LOD de 4,0 e uma freqüência máxima de recombinação de 0,40, foram mapeados 43 marcadores em nove grupos de ligação cobrindo uma distância de recombinação total de 247,8 cM. A distância entre marcadores adjacentes variou entre 0 e 28 cM, com média de 7,3 cM. Os grupos de ligação variaram em tamanho de 2,3 a 61,2 cM. Os genes de resistência à ferrugem e à antracnose ficaram localizados no mesmo grupo de ligação. Foram mapeados locos associados às oito características quantitativas estudadas, e a explicação da variância fenotípica pelos marcadores variou de 14,03% a 40,14%. Os resultados encontrados lançam bases para o desenvolvimento de mapas específicos saturados e de utilidade em programas de melhoramento do feijoeiro-comum.

  16. Riesgo de exposición a Fasciola hepática en ganado vacuno en extensivo de Uruguay y Portugal determinado mediante ELISA y un antígeno recombinante

    Directory of Open Access Journals (Sweden)

    J Sanchís

    2015-01-01

    Full Text Available Para evaluar el riesgo de exposición a Fasciola hepatica del ganado vacuno en extensivo se tomaron muestras de sangre de dos zonas climáticas diferentes, Uruguay (clima subtropical húmedo, 1.192 muestras y Portugal (clima mediterráneo, 473 muestras, que se analizaron con un ELISA y un antígeno recombinante de superficie de F. hepatica (FhrAPS. Los datos obtenidos se analizaron de acuerdo con la raza, edad sexo y aptitud. La seroprevalencia global en Uruguay resultó del 56% (Intervalo de Confianza, IC 95%: 53-59 mediante FhrAPS-ELISA, con porcentajes significativamente más altos en vacas lecheras Holstein de 2-4 años. En Portugal, el porcentaje de sensibilización fue del 47% (IC 95%: 43-52 con los valores más elevados en bovinos resultado de cruces de distintas razas, destinados a la obtención de carne y con edad también comprendida entre 2 y 4 años. Se concluyó que el riesgo de exposición a F. hepatica del ganado vacuno en extensivo es mayor en las zonas con clima subtropical húmedo que en las de clima mediterráneo. Los terneros presentan un alto riesgo de exposición al trematodo hepático con independencia de las condiciones climáticas. Los resultados ponen de manifiesto la necesidad de adoptar medidas frente a las formas del parásito que se encuentran en el medio y combinarlas con programas de desparasitación eficaces.

  17. I2B is a small cytosolic protein that participates in vacuole fusion

    OpenAIRE

    1997-01-01

    Saccharomyces cerevisiae vacuole inheritance requires two low molecular weight activities, LMA1 and LMA2. LMA1 is a heterodimer of thioredoxin and protease B inhibitor 2 (I2B). Here we show that the second low molecular weight activity (LMA2) is monomeric I2B. Though LMA2/I2B was initially identified as a protease B inhibitor, this protease inhibitor activity is not related to its ability to promote vacuole fusion: (i) Low Mr protease B inhibitors cannot substitute for LMA1 or LMA 2, (ii) LMA...

  18. Sustained major molecular response on interferon alpha-2b in two patients with polycythemia vera

    DEFF Research Database (Denmark)

    Larsen, Thomas Stauffer; Bjerrum, O W; Pallisgaard, N

    2008-01-01

    chromosome negative chronic myeloproliferative disorders. Reductions in the JAK2 V617F allele burden in patients treated with pegylated interferon alpha-2a (Peg-IFN-2a) have been demonstrated, although follow-up was relatively short. We report here the first profound and sustained molecular responses...... with a JAK2 V617F allele burden below 1.0% in two patients with polycythemia vera treated with interferon alpha-2b (IFN-2b). Discontinuation of IFN-2b in one of the patients was followed by a sustained long-lasting (12 months of follow-up) major molecular response....

  19. Using service design methods for B2b service brand concept development: Case company

    OpenAIRE

    Molina Escalante, Hugo

    2014-01-01

    A short time before this study was initiated, a small B2b service company had just began op-erating its business without a brand of it’s own. The company owners were looking to design an innovative brand for their business. The purpose of this thesis was to develop the brand for this service Company in the B2b context, using practical service design and Strategic design research methods. This thesis report represents a framework for developing a B2b service brand using research methods c...

  20. An Empirical Examination of Reverse Auction Appropriateness in B2B Source Selection

    Science.gov (United States)

    2006-01-01

    Measures of Marketing Constructs," Journal of Marketing Research, Vol. 16, No.2, pp. 64 - 73. Cohn, L. (2000), " B2B : The Hottest Net Bet Yet...AND SUBTITLE 5. FUNDING NUMBERS AN EMPIRICAL EXAMINATION OF REVERSE AUCTION APPROPRIATENESS IN B2B SOURCE SELECTION. 6. AUTHOR(S) MAJ HAWKINS TIMOTHY...Examination of Reverse Auction Appropriateness in B2B Source Selection D :7;TZU IUT•ITM STATER,;77TIT A Approved for Puhtic P-•-!,ase Distribution

  1. Vaccination of dogs with canine parvovirus type 2b (CPV-2b) induces neutralising antibody responses to CPV-2a and CPV-2c.

    Science.gov (United States)

    Wilson, Stephen; Illambas, Joanna; Siedek, Elisabeth; Stirling, Catrina; Thomas, Anne; Plevová, Edita; Sture, Gordon; Salt, Jeremy

    2014-09-22

    Since the identification of canine parvovirus type 2, three variants have subsequently been observed differing from the historical CPV-2 and each other by 1-2 amino acids only. As a result there has been considerable research into differential diagnostics, with some researchers indicating there is a need for new vaccines containing different strains of CPV-2. In this study we investigated whether vaccination with a CPV-2b containing vaccine would induce cross-reactive antibody responses to the other CPV-2 variants. Two studies where dogs were vaccinated with a multivalent vaccine, subsequently challenged with CPV-2b and sera samples analysed are presented. Six week old pups with defined serological status were vaccinated twice, three weeks apart and challenged either 5 weeks (MDA override study) or one year after vaccination (duration of immunity study). Sera samples were collected before each vaccination and at periods throughout each study. In each study the antibody profiles were very similar; serological responses against CPV-2a, CPV-2b and CPV-2c were higher than those for CPV-2. Nevertheless, responses against CPV-2 were well above levels considered clinically protective. In each study dogs also showed a rapid increase in antibody titres following vaccination, reached a plateau following second vaccination with a slight decline to challenge after which rapid anamnestic responses were seen. Evaluation of the serological responses suggests vaccination with CPV-2b would cross-protect against CPV-2a and CPV-2c, as well as against CPV-2 which is now extinct in the field. In conclusion we have demonstrated that vaccination of minimum aged dogs with a multivalent vaccine containing the CPV-2b variant strain will induce serological responses which are cross-reactive against all currently circulating field strains, CPV-2a and CPV-2c, and the now extinct field strain CPV-2.

  2. Comparing effects of Beractant and Poractant alfa in decreasing mortality rate due to respiratory distress syndrome in premature infants

    Directory of Open Access Journals (Sweden)

    Saeidi R

    2011-02-01

    Full Text Available "nBackground: Exogenous natural and synthetic surfactants is a rescue treatment for respiratory distress syndrome (RDS. The goals of the study were to compare the clinical response and side-effects of two frequently used surfactants, poractant alfa (Curosurf and beractant (Survanta, for the treatment of respiratory distress syndrome in preterm infants."n "nMethods: This clinical trial study was performed during a two-year period in the Neonatal Intensive Care Unit of Ghaem Hospital in Mashhad, Iran. Sample size calculated by a 95% confidence and power of 80, included 104 premature neonates, 74 in survanta and 30 in curosurf groups. The level of statistical significance was considered to be < 0.05."n "nResults: There were no statistically significant differences between the infants treated by survanta or cursurf groups regarding their mean gestational age (30.58 Vs. 29.00 weeks and birth weight (1388 Vs. 1330 g, (p=0.3 There were also no significant differences between the two groups regarding incidences of broncho- pulmonary dysplasia (BPD (40.5% Vs. 40%, intraventricular hemorrhage (IVH grades III/IV (13.5% Vs. 13.3%, pneumothorax (both 20%, patent ductus arteriosus (PDA (28/3% Vs. 20% or death (28% Vs. 26.6% on the 28th day postpartum."n "nConclusion: This study showed that survanta and curosurf had similar therapeutic effects in the treatment of neonatal respiratory distress syndrome.

  3. Diferencias entre coeficientes alfa de Cronbach, con muestras y partes pequeñas: un programa VB

    Directory of Open Access Journals (Sweden)

    César Merino-Soto

    Full Text Available Se presenta un programa informático escrito en VB 6.0, para calcular la diferencia entre coeficientes de consistencia interna (alfa de Cronbach, obtenidos en muestras pequeñas independientes y/o con instrumentos que poseen un número también pequeño de partes o ítems. La comparación de coeficientes de fiabilidad permite identificar posibles diferencias en el tamaño del error de medición en los instrumentos comparados; esta metodología usa el enfoque de prueba de hipótesis, probando la hipótesis nula de igualdad de los coeficientes. Esta condición tiende a ser frecuente en la práctica clínica entre psicólogos y profesiones aliadas, e inclusive en las fases de construcción de instrumentos de medición, por ejemplo en muestras piloto. La técnica aplicada proviene del trabajo de Feldt y Kim (2006, y ofrece una viable e interesante propuesta metodológica que expande el análisis de la fiabilidad de instrumentos de medición psicológicos y educativos. Se presenta las características de su uso, y se discuten las condiciones apropiadas de aplicación.

  4. THE INFLUENCE OF ASOCIATED SUPPLEMENT OF ALFA AMYLASE AND XYLANASE ON THE RHEOLOGY OF DOUGH CONCEARNING ITS CONSTITOGRAPHICAL PARAMETERS

    Directory of Open Access Journals (Sweden)

    RODICA CHEREJI

    2013-07-01

    Full Text Available In this paper we determined the influence of associated supplement of alfa amylase and xylanase on the rheology of dough concearning its constitographical parameters : maximum pressure (Pr max, (mb and the absorbed water (Wa, %. The analysis on the consistograph were conducted for constant hydration at the consistency of 500 UF. Determinations were made on 4 types of flour and optimal dosages were found for each enzyme, after which we prepared the optimal dosage of the enzymes in the compund for flour F1 and F2 : P1-840000 U. SKB/100 kg flour +8100 U. FXU /100 kg flour, P2-840000 U. SKB/100 kg flour+16200 U. FXU, /100 kg flour , P3-840000 U. SKB/100 kg flour+24300 U. FXU/100 kg flour , and for F3 and F4 thus: P1-280000 U. SKB/100 kg flour +8100 U. FXU /100 kg flour, P2- 280000 U. SKB/100 kg flour+16200 U. FXU/100 kg flour, P3-280000 U. SKB/100 kg flour+24300 U. FXU/100 kg flour. Fungous α-amylase and xylanase were used in these concentrations to establish which one is more apropriate to be added in flour to obtain superior quality of bread: finer texture of the crumb, prolongation of the freashness of the bread, improvind the colour and flavour, emproving the slicing ability.

  5. AlphaCI: un programa de cálculo de intervalos de confianza para el coeficiente alfa de Cronbach

    Directory of Open Access Journals (Sweden)

    Rubén Ledesma

    Full Text Available El coeficiente alfa de Cronbach es el modo más habitual de estimar la fiabilidad de pruebas basadas en Teoría Clásica de los Test. En dicha estimación, los investigadores usualmente omiten informar intervalos de confianza para el coeficiente, un aspecto no solo recomendado por los especialistas, sino también requerido explícitamente en las normas editoriales de algunas revistas especializadas. Esta situación puede atribuirse a que los métodos de estimación de intervalos de confianza son poco conocidos, además de no estar disponibles al usuario en los programas estadísticos más populares. Así, en este trabajo se presenta un programa desarrollado dentro del sistema estadístico ViSta que permite calcular intervalos de confianza basados en el enfoque clásico y mediante la técnica bootstrap. Se espera promover la inclusión de intervalos de confianza para medidas de fiabilidad, facilitando el acceso a las herramientas necesarias para su aplicación. El programa es gratuito y puede obtenerse enviando un mail de solicitud al autor del trabajo.

  6. Data of evolutionary structure change: 1AW2B-2VENA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW2B-2VENA 1AW2 2VEN B A --RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDV...RQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEK-SEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAE...ine> 2VEN A 2VENA1 2VEN A 2VENA... A 2VENA YEPVW-----KVATP

  7. High performance of solvothermally prepared VO2(B as anode for aqueous rechargeable lithium batteries

    Directory of Open Access Journals (Sweden)

    Milošević Sanja

    2015-01-01

    Full Text Available The VO2 (B was synthesized via a simple solvothermal route at 160oC in ethanol. The initial discharge capacity of VO2 (B anode, in saturated aqueous solution of LiNO3, was 177 mAh g-1 at a current rate of 50 mA g-1. After 50 cycles capacity fade was 4%, but from 20th-50th cycle no capacity drop was observed. The VO2 (B has shown very good cyclability at current rate of even 1000 mA g-1 with initial discharge capacity of 92 mAh g-1. The excellent electrochemical performance of VO2 (B was attributed to the stability of micro-nano structures to repeated intercalation /deintercalation process, very good electronic conductivity as well as the very low charge transfer resistance in the aqueous electrolyte. [Projekat Ministarstva nauke Republike Srbije, br. III45014

  8. Project Description Advanced Fuel Cycle Initiative AFC-2A and AFC-2B Experiments

    Energy Technology Data Exchange (ETDEWEB)

    AFCI AFC-2A and AFC-2B Experiments Project Executi

    2007-03-01

    The proposed AFC-2A and AFC-2B irradiation experiments are a continuation of the AFC-1 fuel test series currently in progress in the ATR. This document discusses the experiments and the planned activities that will take place.

  9. Thermoluminescence characteristics of gamma irradiated Li2B4O7:Cu nanophosphor

    Science.gov (United States)

    Chopra, Vibha; Singh, Lakhwant; Lochab, S. P.

    2013-07-01

    Nanocrystals of the Li2B4O7:Cu were synthesized by the combustion method using different concentrations of Cu. X-ray diffraction (XRD) spectra and transmission electron microscopy (TEM) image confirm the nanometric size of synthesized material. The thermal stability of phosphor was obtained by thermogravimetric analysis (TGA). TL characteristics of the synthesized Li2B4O7:Cu material doped with Cu of concentrations 1000 ppm and 2500 ppm were studied. It is observed that Li2B4O7:Cu doped with Cu (both 1000 ppm and 2500 ppm) exhibit a linear response in the range 1×100-5×103 Gy of gamma radiations. Finally the trapping parameters associated with the glow peaks were calculated using the glow curve deconvolution (GCD) glow fit method. Fading and reproducibility of phosphors were also studied and it was found that the Li2B4O7:Cu is quite suitable for radiation dosimetry.

  10. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2014

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Crane Creek are described in this report. Water-Data Report 2013 413721083124001 Pool 2B at Ottawa NWR...

  11. Managing Innovation Through Social Media in B2B SME-Context

    DEFF Research Database (Denmark)

    Lutz, Salla; Madsen, Svend Ole; Brink, Tove

    2015-01-01

    This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business model...... innovation. However, social media application is hindered due to lack of specific local knowledge, lack of knowledge on social media technicalities and bewilderedness on leadership approaches within the social media application. A contribution is hereby made to the B2B SME field, to the academic...... understanding an insight on social media application and open business model innovation....

  12. Data of evolutionary structure change: 1DJ2B-1ADIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DJ2B-1ADIA 1DJ2 1ADI B A IGSLSQVSGVLGCQWGDEGKGKLVDILAQHFDIVARCQG...LLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADI...5 PHE CA 263 LYS CA 227 TYR CA 251 1ADI... A 1ADIA 1 1ADI A 1ADI

  13. Data of evolutionary structure change: 3EK2B-3FNFB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 6833343506 EVID> 3 3FNF EVID> 4 3FNF B 3FNF...EVID>EVID> 5 3FNF...3EK2B-3FNFB 3EK2 3FNF B B MGFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTY...VGDRFKDRITEFAAEFGSE-LVFPCDVADDAQIDALFASLKTHWD---SLDGLVHSIGFAPREAIAG-DFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLL

  14. Viroporin Activity of the Foot-and-Mouth Disease Virus Non-Structural 2B Protein.

    Directory of Open Access Journals (Sweden)

    Da Ao

    Full Text Available Viroporins are a family of low-molecular-weight hydrophobic transmembrane proteins that are encoded by various animal viruses. Viroporins form transmembrane pores in host cells via oligomerization, thereby destroying cellular homeostasis and inducing cytopathy for virus replication and virion release. Among the Picornaviridae family of viruses, the 2B protein encoded by enteroviruses is well understood, whereas the viroporin activity of the 2B protein encoded by the foot-and-mouth disease virus (FMDV has not yet been described. An analysis of the FMDV 2B protein domains by computer-aided programs conducted in this study revealed that this protein may contain two transmembrane regions. Further biochemical, biophysical and functional studies revealed that the protein possesses a number of features typical of a viroporin when it is overexpressed in bacterial and mammalian cells as well as in FMDV-infected cells. The protein was found to be mainly localized in the endoplasmic reticulum (ER, with both the N- and C-terminal domains stretched into the cytosol. It exhibited cytotoxicity in Escherichia coli, which attenuated 2B protein expression. The release of virions from cells infected with FMDV was inhibited by amantadine, a viroporin inhibitor. The 2B protein monomers interacted with each other to form both intracellular and extracellular oligomers. The Ca(2+ concentration in the cells increased, and the integrity of the cytoplasmic membrane was disrupted in cells that expressed the 2B protein. Moreover, the 2B protein induced intense autophagy in host cells. All of the results of this study demonstrate that the FMDV 2B protein has properties that are also found in other viroporins and may be involved in the infection mechanism of FMDV.

  15. An analysis of Common Missile and TOW 2B using the Janus combat simulation

    OpenAIRE

    2002-01-01

    Approved for public release; distribution is unlimited. The US Army is currently developing a new close combat missile system, Common Missile, to replace the aging Tubelaunched, Optically-tracked, Wire-guided (TOW 2B) and HELLFIRE missile systems. The Common Missile will have a greater range and improved target acquisition capability over the current missile systems. The purpose of this thesis is to compare the performance of the Common Missile and the TOW 2B missile in a simulated ground ...

  16. Drivers of relationships affecting B2B firms in an e-commerce environment

    Directory of Open Access Journals (Sweden)

    Irene Samanta

    2014-09-01

    Full Text Available The advent of the internet has created numerous opportunities for B2B marketing professionals to enhance current marketing practices, including electronic relationships. However, the investigation of e-relationships and the factors that influence e-relationships in an internet environment is scant. Further, there appears to be no investigation of this phenomenon within the context of Greek B2B Medium-sized firms (MSF. Τhe research problem investigated in this research is: “Which drivers in B2B e-commerce use affect inter-firm relationships in medium-sized B2B firms?”. A framework for B2B e-commerce relationships in a changing and globalized environment was synthesised and integrated with the literature about relationship marketing to arrive at the following research issues: “How do relationship marketing drivers affect the management of B2B e-relationships?”. An explanatory quantitative research approach was used and quantitative data was collected from B2B firms in Greece, which represents a case of e-commerce progress during the last six years. Regarding social exchange, some important differences emerge where cooperation between B2B e-commerce firms is concerned. Suppliers engaged in electronic commerce are more committed and oriented to a long-term relationship than buyers, based on both previous and current experience with them. Confidence in the relationships, consistency and honesty with their obligations and the exchange of reliable, trustworthy information and advisory services between firms are important factors in the development and establishment of their e-relationships. The main contribution of this research is the development of a theoretical framework for e-relationships in medium-sized Β2Β firms. That framework is the first rigorously researched step towards understanding the importance of these powerful streams of relationship drivers in total, and the business activity of e-marketing and electronic relationships.

  17. Framing agenda for business model innovation research from the B2B context

    OpenAIRE

    Neupane, Ganesh Prasad; Haugland, Sven A.

    2016-01-01

    This paper reviews the literature on business models in the business-to-business (B2B) context and proposes a research agenda that can be explored by future studies using various management and organizational theories. We outline four research themes and seven research topics for research on business model innovations in the B2B context. Further studies on these topics can make significant contributions to the business model literature.

  18. Itga2b regulation at the onset of definitive hematopoiesis and commitment to differentiation.

    Directory of Open Access Journals (Sweden)

    Stephanie Dumon

    Full Text Available Product of the Itga2b gene, CD41 contributes to hematopoietic stem cell (HSC and megakaryocyte/platelet functions. CD41 expression marks the onset of definitive hematopoiesis in the embryo where it participates in regulating the numbers of multipotential progenitors. Key to platelet aggregation, CD41 expression also characterises their precursor, the megakaryocyte, and is specifically up regulated during megakaryopoiesis. Though phenotypically unique, megakaryocytes and HSC share numerous features, including key transcription factors, which could indicate common sub-regulatory networks. In these respects, Itga2b can serve as a paradigm to study features of both developmental-stage and HSC- versus megakaryocyte-specific regulations. By comparing different cellular contexts, we highlight a mechanism by which internal promoters participate in Itga2b regulation. A developmental process connects epigenetic regulation and promoter switching leading to CD41 expression in HSC. Interestingly, a similar process can be observed at the Mpl locus, which codes for another receptor that defines both HSC and megakaryocyte identities. Our study shows that Itga2b expression is controlled by lineage-specific networks and associates with H4K8ac in megakaryocyte or H3K27me3 in the multipotential hematopoietic cell line HPC7. Correlating with the decrease in H3K27me3 at the Itga2b Iocus, we find that following commitment to megakaryocyte differentiation, the H3K27 demethylase Jmjd3 up-regulation influences both Itga2b and Mpl expression.

  19. Sperm nuclear histone H2B: correlation with sperm DNA denaturation and DNA stainability

    Institute of Scientific and Technical Information of China (English)

    Armand Zini; Xiaoyang Zhang; Maria San Gabriel

    2008-01-01

    Aim: To examine the relationship between sperm DNA damage and sperm nuclear histone (H2B) staining. Methods:We evaluated sperm samples from 14 consecutive asthenoteratozoospermic infertile men and six consecutive fertile controls. Sperm nuclear histone (H2B) staining and sperm chromatin integrity (assessed by sperm chromatin structure assay and expressed using the percentage of (I) DNA fragmentation index [%DFI] and (ii) high DNA stainability [%HDS)]) were evaluated. Results: Histone H2B immunocytochemistry demonstrated two nuclear staining patterns: (I) focal punctate staining; and (ii) diffuse staining. Infertile men had a higher mean percentage of spermatozoa exhibiting diffuse H2B staining than did fertile men (7.7% ± 4.6% vs. 1.6% ± 1.2%, respectively, P < 0.01). We observed significant relationships between the proportion of spermatozoa with diffuse nuclear histone staining and both sperm %DFI (r= 0.63, P < 0.01) and sperm %HDS (r= 0.63, P < 0.01). Conclusion: The data demonstrate that infertile men have a higher proportion of spermatozoa with diffuse histone H2B than do fertile men and suggest that sperm DNA damage might, at least in part, be due to abnormally high histone H2B levels.

  20. [Prooxidant and cytotoxic action of N-acetylcysteine and glutathione combined with vitamin Bl2b].

    Science.gov (United States)

    Solov'eva, M E; Solov'ev, V V; Faskhutdinova, A A; Kudriavtsev, A A; Akatov, V S

    2007-01-01

    We studied the prooxidant and cytotoxic action of thiols N-acetylcystein (NAC) and glutathione (GSH) combined with vitamin Bl2b. The synergism of action of the thiols and Bl2b resulted in human carcinoma cell damage was found. It was shown that GSH and NAC in physiological doses combined with Bl2b caused the initiation of apoptosis. It was established that prooxidant action of the thiols combined with vitamin Bl2b, i. e. generation and accumulation of hydrogen peroxide in culture medium, led to intracellular oxidative stress and injury of cell redox system. These effects were completely abolished by nonthiol antioxidants catalase and pyruvate. The chelators of iron phenanthroline and deferoxamine did not suppress the H2O2 accumulation in culture medium but significantly inhibited the cell death induced by the thiols combined with Bl2b. Therefore, the thiols GSH and NAC widely used as antioxidants, in combination with vitamin Bl2b show prooxidant characteristics and induce, with the participation of intracellular iron, apoptotic HEp-2 cell death.

  1. Deletion of ADORA2B from myeloid cells dampens lung fibrosis and pulmonary hypertension.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Philip, Kemly; Acero, Luis F; Chen, Ning-Yuan; Weng, Tingting; Molina, Jose G; Luo, Fayong; Davies, Jonathan; Le, Ngoc-Bao; Bunge, Isabelle; Volcik, Kelly A; Le, Thanh-Thuy T; Johnston, Richard A; Xia, Yang; Eltzschig, Holger K; Blackburn, Michael R

    2015-01-01

    Idiopathic pulmonary fibrosis (IPF) is a lethal, fibroproliferative disease. Pulmonary hypertension (PH) can develop secondary to IPF and increase mortality. Alternatively, activated macrophages (AAMs) contribute to the pathogenesis of both IPF and PH. Here we hypothesized that adenosine signaling through the ADORA2B on AAMs impacts the progression of these disorders and that conditional deletion of ADORA2B on myeloid cells would have a beneficial effect in a model of these diseases. Conditional knockout mice lacking ADORA2B on myeloid cells (Adora2B(f/f)-LysM(Cre)) were exposed to the fibrotic agent bleomycin (BLM; 0.035 U/g body weight, i.p.). At 14, 17, 21, 25, or 33 d after exposure, SpO2, bronchoalveolar lavage fluid (BALF), and histologic analyses were performed. On day 33, lung function and cardiovascular analyses were determined. Markers for AAM and mediators of fibrosis and PH were assessed. Adora2B(f/f)-LysM(Cre) mice presented with attenuated fibrosis, improved lung function, and no evidence of PH compared with control mice exposed to BLM. These findings were accompanied by reduced expression of CD206 and arginase-1, markers for AAMs. A 10-fold reduction in IL-6 and a 5-fold decrease in hyaluronan, both linked to lung fibrosis and PH, were also observed. These data suggest that activation of the ADORA2B on macrophages plays an active role in the pathogenesis of lung fibrosis and PH.

  2. Magnetic properties of ball-milled TbFe2 and TbFe2B

    Indian Academy of Sciences (India)

    J Arout Chelvane; S Kasiviswanathan; M V Rao; G Markandeyulu

    2004-04-01

    The magnetic properties of ball-milled TbFe2 and TbFe2B were studied by magnetization measurements. X-ray diffraction studies on TbFe2B showed that boron occupied interstitial position in the crystal structure, just as hydrogen did. The value of the saturation magnetization of TbFe2B was found to be smaller than that of TbFe2. This is explained on the basis of a charge transfer between the boron atoms and the 3d band of Fe. The anisotropy of TbFe2B was found to be large compared to that of TbFe2. X-ray diffractograms for the ball milled samples showed that after 80 h of milling, a predominantly amorphous phase was obtained. TbFe2B was found to undergo easy amorphization compared to TbFe2. Magnetization of TbFe2 was found to decrease rapidly with initial milling hours and was found to be constant with further hours of milling. TbFe2B exhibited an anomalous behaviour with an increase in moment with milling hours and this may be due to the segregation of -Fe.

  3. A thymidine kinase-deleted bovine herpesvirus 5 establishes latent infection but reactivates poorly in a sheep model Recombinante do herpesvírus bovino tipo 5 com deleção na timidina quinase estabelece infecção latente porém reativa ineficientemente em ovinos

    Directory of Open Access Journals (Sweden)

    Gustavo C. Cadore

    2013-03-01

    Full Text Available The ability of thymidine kinase (tk-deleted recombinant bovine herpesvirus 5 (BoHV-5tkΔ to establish and reactivate latent infection was investigated in lambs. During acute infection, the recombinant virus replicated moderately in the nasal mucosa, yet to lower titers than the parental strain. At day 40 post-infection (pi, latent viral DNA was detected in trigeminal ganglia (TG of all lambs in both groups. However, the amount of recombinant viral DNA in TGs was lower (9.7-fold less than that of the parental virus as determined by quantitative real time PCR. Thus, tk deletion had no apparent effect on the frequency of latent infection but reduced colonization of TG. Upon dexamethasone (Dx administration at day 40 pi, lambs inoculated with parental virus shed infectious virus in nasal secretions, contrasting with lack of infectivity in secretions of lambs inoculated with the recombinant virus. Nevertheless, some nasal swabs from the recombinant virus group were positive for viral DNA by PCR, indicating low levels of reactivation. Thus, BoHV-5 TK activity is not required for establishment of latency, but seems critical for efficient virus reactivation upon Dx treatment.A capacidade de um recombinante do herpesvírus bovino tipo 5 com deleção no gene da timidina quinase (BoHV-5tk∆ em estabelecer e reativar infecção latente foi investigada em cordeiros. Durante a infecção aguda, o vírus recombinante replicou na mucosa nasal em títulos moderados, porém menores do que os da cepa parental. Aos 40 dias pós-infecção (pi DNA viral latente foi detectado no gânglio trigêmeo (TG de todos os cordeiros em ambos os grupos. No entanto, a quantidade de DNA do vírus recombinante nos TGs foi 9,7 vezes menor do que do vírus parental, segundo determinação por PCR em tempo real. Assim, a deleção do gene tk (timidina quinase não produziu efeito aparente sobre a frequência da infecção latente, porém reduziu a colonização do TG. Após a

  4. Heat and charge transport in YNi{sub 2}B{sub 2}C and HoNi{sub 2}B{sub 2}C single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, M; Gladun, A; Kreyssig, A [Institut fuer Festkoerperphysik, Technische Universitaet Dresden, D-01062 Dresden (Germany); Wosnitza, J [Hochfeld-Magnetlabor Dresden (HLD), Forschungszentrum Dresden-Rossendorf, D-01314 Dresden (Germany); Petzold, V; Rosner, H [Max-Planck-Institut fuer Chemische Physik fester Stoffe, D-01187 Dresden (Germany); Behr, G; Souptel, D; Mueller, K-H; Drechsler, S-L; Fuchs, G [Leibniz-Institut fuer Festkoerper- und Werkstoffforschung Dresden (IFW), D-01171 Dresden (Germany)], E-mail: M.Schneider@ifw-dresden.de, E-mail: G.Fuchs@ifw-dresden.de

    2008-04-30

    For a systematic investigation of the heat- and charge-transport properties of YNi{sub 2}B{sub 2}C and HoNi{sub 2}B{sub 2}C, single-crystal measurements of the electrical resistivity, the thermal conductivity, and the thermoelectric power were performed on the same samples. For HoNi{sub 2}B{sub 2}C, a local maximum of the Lorenz number at 20 K is evidently connected with the occurrence of magnetic fluctuations well above the ordering temperature. For the in-plane thermal conductivity, a kink near the superconducting transition was observed, consistent with an anisotropic gap or a multiband description. For both investigated borocarbides, the electrical resistance is isotropic. In contrast, the thermal conductivity shows a pronounced anisotropy. The thermoelectric power exhibits a minor anisotropy and can be well described by electron-diffusion and phonon-drag contributions over a wide temperature range. Based on an analysis of full-potential local-orbital calculations, a strong influence of the boron z position on the thermoelectric power has been revealed.

  5. Competency-orientated brand cooperations of power supply companies in the B2B sector; Kompetenzorientierte Markenkooperationen von Energieversorgungsunternehmen im B2B-Kundenbereich

    Energy Technology Data Exchange (ETDEWEB)

    Peuser, M.M.

    2008-07-01

    On the basis of an extensive empirical study with B2B electricity users, the author of the book under consideration examines brand co-operations of power supply companies with companies not working in the area of energy production. Based on the view of various co-operation alternatives, impact relations and success-determining factors of influence in the area of B2B customers are identified. The term of the authority of an energy brand is discussed. Beside this, profiles of concrete brands of current power supply companies from the view of B2B customers are pointed out, and recommendations for the organization of brand co-operation and the structure of mark authority in practice are shown. This contribution is written for lecturers and students of the management economics with the emphasis of marketing and management as well as high-level personnel in the energy industry, who wants to develop strong mark authority by brand co-operation.

  6. Unidades fototérmicas e temperatura-base inferior de frutos de Mangueira Alfa, na Baixada Cuiabana Photothermal units and lower base temperature for alfa mango fruit on the Baixada Cuiabana

    Directory of Open Access Journals (Sweden)

    Marcelo Paes de Barros

    2010-06-01

    Full Text Available O objetivo deste trabalho foi determinar a temperatura-base inferior (Tb a partir da unidade fototérmica (UF para o cultivo experimental de manga Alfa sob condições de cerrado. Foram utilizados dados diários da temperatura do ar disponibilizados pela Estação Agrometeorológica Padre Ricardo Remetter, localizada em Santo Antônio do Leverger-MT (15,8° S e 56,1° W, 140 m, e avaliação sensorial do estádio de maturação dos frutos de manga. A Tb foi determinada pelo método da menor variabilidade das unidades fototérmicas (UF acumuladas do período da floração à colheita dos frutos, variabilidade avaliada pelo coeficiente de variação (cv simulado para diferentes valores da Tb. De julho a novembro de 2007, em três plantas de um pomar demonstrativo irrigado, foram identificados 82 frutos para o acompanhamento do crescimento e maturação. Entre esses frutos, em meados de dezembro de 2007, foi possível identificar 13 frutos que atingiram a maturidade fisiológica, após um período médio de observação de 112 dias. Para exigência fototérmica de 1.878.166,1 UF, encontrou-se Tb de 10 °C, valor consistente com os apresentados na literatura para a cultivar de manga, o que comprova a eficiência do método que combina a ação da temperatura e do fotoperíodo sobre a maturação dos frutos e que confere um caráter mais racional que o método tradicional da soma térmica.In this study was to determine the lower base temperature (Tb for Alfa mango fruit, using the photothermal units (PTU method in cerrado conditions. The meteorological data for the study were acquired from "Padre Ricardo Remetter" meteorological station located at Santo Antonio do Leverger, MT, Brazil (15,8° S and 56,1° W, 140 m, and the fruit data was acquired by sensorial evaluation of mango fruit maturation state. The Tb was determined by less variability of the coefficient of variation (cv method applied to the PTU sum, from flowering to harvest, simulated for

  7. e-Relationships for e-Readiness:culture and corruption in international e-B2B

    OpenAIRE

    Berthon, Pierre; Pitt, Leyland; Berthon, Jean-Paul; Campbell, Colin; Thwaites, Des

    2008-01-01

    The role of electronic networks in B2B relationships has been growing exponentially. From massive internet B2B exchanges to tiny RFID chips, B2B is increasingly becoming e-B2B. Whilst e-B2B has been explored intra-nationally, its international counterpart is less well documented; as has been the role that culture might play in the development of international e-B2B relationships. In this paper we address this important issue of international e-business relationships. Specifically we explore t...

  8. Research on Game Theory of C2B Platform for Recycling%C2B 平台竞价回收博弈研究

    Institute of Scientific and Technical Information of China (English)

    李春发; 刘一非; 王帅

    2016-01-01

    C2B 网络回收平台的竞价回收机制决定了众多回收商之间存在着激烈的竞争,每个网络回收商的回收量不仅取决于自己的回收价格,还取决于其他网络回收商的回收价格。期望利润最大化是每个网络回收商的竞争目标。运用最优化理论与非合作博弈理论证明 C2B 平台竞价回收博弈存在唯一的 Nash 均衡。在完全竞争与串谋合作的不同情况中发现,完全竞争情况下 Nash 均衡的网络回收价格高于串谋合作下的网络回收价格,并通过数值仿真进行验证。%Many recyclers recycle waste products or used fine products and remanufacture for profit in C2B network plat-form.Since the auction collection mechanism of C2B network platform determines there is a fierce competition among the many recyclers,the recycling number of waste products depends on the cost of recycling itself,but also the price of compet-itors.Expected profit maximization is the objective of each network recycler.Firstly the paper studied the operation of the C2B network platform,and proved the bidding games fit the supermodel game by using the theory of optimum and non -co-operative game theory,and the existence of Nash equilibrium.In perfect competition and collusion cooperation cases,we found the recycling price is higher than the conspiracy cooperation network cost under Nash equilibrium,which is verified by using the method of numerical simulation.

  9. LIM kinase/cofilin dysregulation promotes macrothrombocytopenia in severe von Willebrand disease-type 2B

    Science.gov (United States)

    Poirault-Chassac, Sonia; Adam, Frédéric; Muczynski, Vincent; Aymé, Gabriel; Casari, Caterina; Bordet, Jean-Claude; Soukaseum, Christelle; Rothschild, Chantal; Proulle, Valérie; Pietrzyk-Nivau, Audrey; Berrou, Eliane; Christophe, Olivier D.; Rosa, Jean-Philippe; Lenting, Peter J.; Bryckaert, Marijke; Baruch, Dominique

    2016-01-01

    von Willebrand disease type 2B (VWD-type 2B) is characterized by gain-of-function mutations of von Willebrand factor (vWF) that enhance its binding to platelet glycoprotein Ibα and alter the protein’s multimeric structure. Patients with VWD-type 2B display variable extents of bleeding associated with macrothrombocytopenia and sometimes with thrombopathy. Here, we addressed the molecular mechanism underlying the severe macrothrombocytopenia both in a knockin murine model for VWD-type 2B by introducing the p.V1316M mutation in the murine Vwf gene and in a patient bearing this mutation. We provide evidence of a profound defect in megakaryocyte (MK) function since: (a) the extent of proplatelet formation was drastically decreased in 2B MKs, with thick proplatelet extensions and large swellings; and (b) 2B MKs presented actin disorganization that was controlled by upregulation of the RhoA/LIM kinase (LIMK)/cofilin pathway. In vitro and in vivo inhibition of the LIMK/cofilin signaling pathway rescued actin turnover and restored normal proplatelet formation, platelet count, and platelet size. These data indicate, to our knowledge for the first time, that the severe macrothrombocytopenia in VWD-type 2B p.V1316M is due to an MK dysfunction that originates from a constitutive activation of the RhoA/LIMK/cofilin pathway and actin disorganization. This suggests a potentially new function of vWF during platelet formation that involves regulation of actin dynamics. PMID:27734030

  10. Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome.

    Science.gov (United States)

    Wilson, Gabrielle R; Sunley, Jasmine; Smith, Katherine R; Pope, Kate; Bromhead, Catherine J; Fitzpatrick, Elizabeth; Di Rocco, Maja; van Steensel, Maurice; Coman, David J; Leventer, Richard J; Delatycki, Martin B; Amor, David J; Bahlo, Melanie; Lockhart, Paul J

    2014-06-01

    Borrone Dermato-Cardio-Skeletal (BDCS) syndrome is a severe progressive autosomal recessive disorder characterized by coarse facies, thick skin, acne conglobata, dysmorphic facies, vertebral abnormalities and mitral valve prolapse. We identified a consanguineous kindred with a child clinically diagnosed with BDCS. Linkage analysis of this family (BDCS1) identified five regions homozygous by descent with a maximum LOD score of 1.75. Linkage analysis of the family that originally defined BDCS (BDCS3) identified an overlapping linkage peak at chromosome 5q35.1. Sequence analysis identified two different homozygous mutations in BDCS1 and BDCS3, affecting the gene encoding the protein SH3 and PX domains 2B (SH3PXD2B), which localizes to 5q35.1. Western blot analysis of patient fibroblasts derived from affected individuals in both families demonstrated complete loss of SH3PXD2B. Homozygosity mapping and sequence analysis in a second published BDCS family (BDCS2) excluded SH3PXD2B. SH3PXD2B is required for the formation of functional podosomes, and loss-of-function mutations in SH3PXD2B have recently been shown to underlie 7 of 13 families with Frank-Ter Haar syndrome (FTHS). FTHS and BDCS share some overlapping clinical features; therefore, our results demonstrate that a proportion of BDCS and FTHS cases are allelic. Mutations in other gene(s) functioning in podosome formation and regulation are likely to underlie the SH3PXD2B-mutation-negative BDSC/FTHS patients.

  11. Thermal behaviour analysis on ITER component cooling water system loop 2B

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Bin, E-mail: guobin@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Fu, Peng [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Dell’Orco, Giovanni; Liliana, Teodoros; Tao, Jun [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Yang, Lei [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)

    2015-11-15

    Highlights: • Thermal hydraulic analysis model has been developed to perform thermal analysis on the component cooling water system loop 2B. • The cooling water temperature profile at client inlet and outlet during one cycle of the most demanding plasma operation scenario was obtained. • Operation behaviour of the main heat exchanger for CCWS-2B has been depicted. - Abstract: ITER cooling water system is composed by several cooling loops, the primary heat transfer loops that form the Tokamak Cooling Water System (TCWS), the secondary heat transfer loops that form the Component Cooling Water System (CCWS) and the Chilled Water System (CHWS) and a tertiary heat transfer loop which is the Heat Rejection System (HRS). The CCWS is further divided into CCWS-1, CCWS-2A, CCWS-2B, CCWS-2C, CCWS-2D depending on the water chemistry needs of clients and wetted area material. The component cooling water system loop 2B (CCWS-2B) has the function to remove heat load from coil power supply component, Neutral Beam Injectors (NBIs) system component and diagnostic system which are located in different buildings. As the total number of the client connections for the loop is a few hundreds, simplified thermal hydraulic analysis model has been developed to perform thermal analysis on the component cooling water system loop 2B. The curve of the cooling water temperature at client inlet and outlet during one cycle of the most demanding plasma operation scenario was obtained and the cooling water flow rate can meet the thermal removal requirement of client was also confirmed from this analysis. In addition, operation behaviour of the main heat exchanger for CCWS-2B in this thermal analysis was depicted for main heat exchanger selection purposes. This study has been carried out with the AFT Fathom code.

  12. 聚乙二醇干扰素α-2b联合利巴韦林治疗慢性丙型肝炎疗效观察%Efficacy of peginterferonα-2b plus ribavirin for treating chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    孙振江; 过建春; 石伟珍; 荀运浩

    2015-01-01

    Objective To investigate the efficacy of long-acting interferon (peginterferon alfa-2b, PEG-IFNα-2b) plus ribavirin for treating chronic hepatitis C(CHC) in comparison with that of conventional interferon alfa-2b (IFNα-2b) plus ribavirin. Methods A total of 96 consecutive, treatment-naive, HCV RNA-positive patients with chronic hepatitis were randomly assigned to once weekly PEG-IFNα-2b(Observational group, n=48) or every other day IFNα-2b(Control group, n=48) plus ribavirin for 48 weeks. The rates of early-, end of treatment-, and sustained- virological response (VR) to-gether with the safety and adverse-event profiles between the two groups were compared. Results More patients in obser-vational group than control group achieved an early VR (χ2=6.27,P0.05). Conclu-sions PEG-IFNα-2b plus ribavirin is more effective than IFNα-2b plus ribavirin for treating CHC, but its sustained VR rate needs further improvement.%目的:以普通干扰素(IFN)α-2b联合利巴韦林为对照,观察聚乙二醇干扰素(PEG-IFN)α-2b联合利巴韦林治疗慢性丙型肝炎(CHC)的临床疗效。方法成人CHC患者96例随机分为两组,每组48例,观察组给予PEG-IFNα-2b,对照组给予IFNα-2b,均联合利巴韦林口服,疗程48周。观察两组早期病毒学应答(EVR)、治疗结束时病毒学应答(ETVR)、持久病毒学应答(SVR)和安全性等方面的差异。结果观察组EVR率、ETVR 率、SVR率均高于对照组(χ2分别=6.27、4.17、4.44,P均<0.05)。两组不良反应发生率差异无统计学意义(χ2=0.12,P>0.05)。结论PEG-IFNα-2b联合利巴韦林治疗CHC疗效优于普通干扰素联合利巴韦林,但SVR率需要进一步提高。

  13. Involvement of CYP2B6 in the biotransformation of propofol by human liver microsomes

    Institute of Scientific and Technical Information of China (English)

    TANG Bing; WANG Jun-ke; FENG Wan-yu

    2008-01-01

    Objective To determine whether the cytochrome P4502B6 (CYP2B6) is involved in the oxidation of propofol by human liver microsomes. Methods The change of propofol concentration in an incubation mixture with human liver microsomes was monitored by the high performance liquid chromatography (HPLC), in order to calculate the rate constants of metabolism of propofol. The correlation between the rate constants and the rate of metabolism of CYP2B6 selective substrate bupropion, and the effect of two different CYP2B6 specific inhibitors on the propofol metabolism were examined. Results The mean rate constant of propofol metabolism by liver microsomes obtained from twelve individuals was 3.9 (95 % confidence intervals 3.3, 4.5) nmol·min-1·mg-1 protein. The rate constants of propofol metabolism by liver microsomes were significantly correlated with bupropion hydroxylation (r=0.888, P<0.001). Both selective chemical inhibitors of CYP2B6, orphenadrine and N, N′, N″-triethylenethiophosphoramide (thioTEPA), reduced the rate constants of propofol metabolism by 37.596 (P<0.001) and 42.796 (P<0.001)in liver microsomes, respectively. Conclusions CYP2B6 is predominantly involved in the oxidation of propofol by human liver microsomes.

  14. Structure and sequence based functional annotation of Zika virus NS2b protein: Computational insights.

    Science.gov (United States)

    Aguilera-Pesantes, Daniel; Méndez, Miguel A

    2017-02-08

    While Zika virus (ZIKV) outbreaks are a growing concern for global health, a deep understanding about the virus is lacking. Here we report a contribution to the basic science on the virus- a detailed computational analysis of the non structural protein NS2b. This protein acts as a cofactor for the NS3 protease (NS3Pro) domain that is important on the viral life cycle, and is an interesting target for drug development. We found that ZIKV NS2b cofactor is highly similar to other virus within the Flavivirus genus, especially to West Nile Virus, suggesting that it is completely necessary for the protease complex activity. Furthermore, the ZIKV NS2b has an important role to the function and stability of the ZIKV NS3 protease domain even when presents a low conservation score. In addition, ZIKV NS2b is mostly rigid, which could imply a non dynamic nature in substrate recognition. Finally, by performing a computational alanine scanning mutagenesis, we found that residues Gly 52 and Asp 83 in the NS2b could be important in substrate recognition.

  15. Presymptomatic generalized brain atrophy in frontotemporal dementia caused by CHMP2B mutation

    DEFF Research Database (Denmark)

    Rohrer, Jonathan D; Ahsan, R Laila; Isaacs, Adrian M;

    2009-01-01

    BACKGROUND/AIMS: CHMP2B mutations are a rare cause of familial frontotemporal dementia (FTD). The clinical syndrome is dominated by personality change and behavioural symptoms, but language, memory, calculation and praxis impairments are also seen early in the course of the disease. There are no ......BACKGROUND/AIMS: CHMP2B mutations are a rare cause of familial frontotemporal dementia (FTD). The clinical syndrome is dominated by personality change and behavioural symptoms, but language, memory, calculation and praxis impairments are also seen early in the course of the disease....... There are no detailed studies of brain imaging in CHMP2B mutation-associated FTD. This study aimed to investigate whether there were early or presymptomatic changes in this group of patients. METHODS: Subjects comprised 16 members of a Danish family with CHMP2B mutation-associated FTD. Nine subjects were presymptomatic...... mutation carriers with a control group of 7 mutation-negative family members. Volumetric MRI brain scans were performed on all subjects at two time points, and rates of volume change were compared between the two groups. RESULTS: We demonstrate that generalized atrophy occurs presymptomatically in CHMP2B...

  16. Inhibitory Effects of Garcinia cambogia Extract on CYP2B6 Enzyme Activity.

    Science.gov (United States)

    Yu, Jun Sang; Choi, Min Sun; Park, Jong Suk; Rehman, Shaheed Ur; Nakamura, Katsunori; Yoo, Hye Hyun

    2017-03-13

    This study assessed the inhibitory effects of Garcinia cambogia extract on the cytochrome P450 enzymes in vitro. G. cambogia extract was incubated with cytochrome P450 isozyme-specific substrates in human liver microsomes and recombinant CYP2B6 isozyme, and the formation of the marker metabolites was measured to investigate the inhibitory potential on cytochrome P450 enzyme activities. The results showed that G. cambogia extract has significant inhibitory effects on CYP2B6 activity in a concentration-dependent manner. Furthermore, the inhibition was potentiated following preincubation with NADPH, indicating that G. cambogia extract is a time-dependent inhibitor of CYP2B6. Meanwhile, hydroxycitric acid, the major bioactive ingredient of G. cambogia extract, did not exhibit significant inhibition effects on cytochrome P450 enzyme activities. G. cambogia extract could modulate the pharmacokinetics of CYP2B6 substrate drugs and lead to interactions with those drugs. Therefore, caution may be required with respect to concomitant intake of dietary supplements containing G. cambogia extract with CYP2B6 substrates.

  17. Supporting the Health Quality Measures Format in i2b2.

    Science.gov (United States)

    Klann, Jeffrey G; Murphy, Shawn N

    2013-01-01

    The Health Quality Measures Format (HQMF) is an HL7 standard for expressing computable queries of clinical data. It is becoming increasingly consequential for both quality measurement and population health research. A variety of national leadership is involved in its development and deployment, including the Meaningful Use incentive program, the Query Health initiative, the Joint Commission, the National Quality Forum (NQF), and the Food and Drug Administration. Here we analyze the structure of HQMF and apply this to computation of HQMF on Informatics for Integrating Biology and the Bedside (i2b2). i2b2 is a widely used, modular, open-source clinical research data repository. We implement a translator to convert between HQMF and i2b2-XML format that covers the subset of HQMF supported in i2b2-XML, which will be expanded in the next release of i2b2. This translator is part of the freely-available reference implementation of the QueryHealth initiative.

  18. Molecular level interaction of inositol hexaphosphate with the C2B domain of human synaptotagmin I.

    Science.gov (United States)

    Joung, Meng-Je; Mohan, Sepuru K; Yu, Chin

    2012-05-01

    Synaptotagmin I is a synaptic vesicle membrane protein that serves as a multifunctional regulator during the exocytosis of neurotransmitter release. It contains C2A and C2B domains. The binding of Ca(2+) to the C2A domain activates the exocytosis of secretory vesicles, while the binding of inositol polyphosphates (IP4-IP6) to the C2B domain inhibits this process. To understand the IP6-induced inhibition of exocytosis of secretory vesicles, we determined the three-dimensional structure of the C2B-IP6 complex by nuclear magnetic resonance (NMR). In this study, we have determined the binding constant by isothermal titration calorimetry. The circular dichroism measurements demonstrated that IP6 can stabilize the C2B molecule. We identified the binding site using (1)H-(15)N heteronuclear single-quantum coherence spectroscopy titration data and determined the structure of the C2B-IP6 complex using multidimensional NMR studies. This information will aid in the design of better pharmacological treatments for neurological disorders.

  19. Serotonin 2B receptor: upregulated with age and hearing loss in mouse auditory system.

    Science.gov (United States)

    Tadros, Sherif F; D'Souza, Mary; Zettel, Martha L; Zhu, XiaoXia; Lynch-Erhardt, Martha; Frisina, Robert D

    2007-07-01

    Serotonin (5-HT) is a monoamine neurotransmitter. Serotonin may modulate afferent fiber discharges in the cochlea, inferior colliculus (IC) and auditory cortex. Specific functions of serotonin are exerted upon its interaction with specific receptors; one of those receptors is the serotonin 2B receptor. The aim of this study was to investigate the differences in gene expression of serotonin 2B receptors with age in cochlea and IC, and the possible correlation between gene expression and functional hearing measurements in CBA/CaJ mice. Immunohistochemical examinations of protein expression of IC in mice of different age groups were also performed. Gene expression results showed that serotonin 2B receptor gene was upregulated with age in both cochlea and IC. A significant correlation between gene expression and functional hearing results was established. Immunohistochemical protein expression studies of IC showed more serotonin 2B receptor cells in old mice relative to young adult mice, particularly in the external nucleus. We conclude that serotonin 2B receptors may play a role in the pathogenesis of age-related hearing loss.

  20. Clinical Experience of Interferon Alfa-2a Treatment for Refractory Uveitis in Behçet's Disease.

    Science.gov (United States)

    Park, Ji-Youn; Chung, Yoo-Ri; Lee, Kihwang; Song, Ji Hun; Lee, Eun-So

    2015-07-01

    Behçet's disease (BD) involves multisystem vasculitis of unknown origin. Ocular manifestations of BD mostly include bilateral panuveitis and retinal vasculitis, which are very challenging to treat. Interferon alfa-2a (IFN) has been recently introduced for treating refractory Behçet uveitis, mainly in Germany and Turkey. Nonetheless, there is so far no consensus about the ideal treatment regimen of IFN for Behçet uveitis. We report our experience of IFN treatment in five Korean BD patients with refractory uveitis. All patients complained of oral ulcers; one patient had a positive pathergy test and 2 showed the presence of HLA-B51. Immunosuppressive agents used prior to IFN treatment included cyclosporine and methotrexate. The IFN treatment was commenced with a dose of 6-9 MIU/day for 7 days, adjusted according to individual ocular manifestations, tapered down to 3 MIU three times in a week, and then discontinued. All patients showed positive response to IFN treatment; 50% of them showed complete response without additional major ocular inflammation during the follow-up period. Other BD symptoms also improved after IFN treatment in most cases. After treatment, the relapse rate and the required dose of oral corticosteroid were decreased in most cases, showing a significant steroid-sparing effect. However, the visual acuity was not improved in most cases due to irreversible macular sequelae. Despite the small sample size of this study, we suggest that, in Korean patients, IFN is an effective treatment modality for BD uveitis as was observed in German and Turkish patients.

  1. Co-treatment with pegylated interferon alfa-2a and entecavir for hepatitis D: a randomized trial

    Institute of Scientific and Technical Information of China (English)

    Zaigham; Abbas; Mohammad; Sadik; Memon; Muhammad; Amir; Umer; Minaam; Abbas; Lubna; Shazi

    2016-01-01

    AIM: To investigate the efficacy of pegylated interferon alfa(PEG-IFNα) therapy with and without entecavir in patients with chronic hepatitis D. METHODS: Forty hepatitis D virus(HDV) RNA positive patients were randomized to receive either PEG-IFNα-2a 180 μg weekly in combination with entecavir 0.5 mg daily(n = 21) or PEG-IFNα alone(n =19). Patients who failed to show 2 log reduction in HDV RNA level at 24 wk of treatment, or had detectable HDV RNA at 48 wk of therapy were considered as treatment failure. Treatment was continued for 72 wk in the rest of the patients. All the patients were followed for 24 wk post treatment. Intention to treat analysis was performed.RESULTS: The mean age of the patients was 26.7 ± 6.8 years, 31 were male. Two log reduction in HDV RNA levels at 24 wk of therapy was achieved in 9(43%) patients receiving combination therapy and 12(63%) patients receiving PEG-IFNα alone(P = 0.199). Decline in hepatitis B surface antigen(HBs Ag) levels was insignificant. At the end of treatment, HDV RNA was negative in 8 patients(38%) receiving combination therapy and 10 patients(53%) receiving PEG-IFNα-2a alone. Virological response persisted in 7(33%) and 8(42%) patients, respectively at the end of the 24 wk follow-up period. One responder patient in the combination arm lost HBs Ag and became hepatitis B surface antibody positive. Six out of 14 baseline hepatitis B e antigen reactive patients seroconverted and four of these seroconverted patients had persistent HDV RNA clearance.CONCLUSION: Administration of PEG-IFNα-2a with or without entecavir, resulted in persistent HDV RNA clearance in 37% of patients. The addition of entecavir did not improve the overall response.

  2. Management of anaemia in oncohaematological patients treated with biosimilar epoetin alfa: results of an Italian observational, retrospective study

    Science.gov (United States)

    Rosti, Giovanni; Petrini, Mario; Bosi, Alberto; Galieni, Piero; Bernardi, Daniele; Giglio, Gianfranco; Dorotea, Laura; Falini, Brunangelo; Scelzi, Elvira; Veltri, Enzo; Castelli, Roberto; Longagnani, Chiara; Raggi, Tommaso; Simonetti, Federico

    2016-01-01

    Background: Many patients with solid tumours or nonmyeloid haematopoietic tumours develop symptomatic anaemia, which has a major impact on quality of life (QoL). The efficacy of erythropoiesis-stimulating agents (ESAs) in improving QoL and reducing blood transfusions has been widely demonstrated. Binocrit® (biosimilar epoetin alfa) is an ESA indicated in the European Union for treating chemotherapy-induced anaemia. The aim of this study was to investigate the effect of Binocrit® on haemoglobin (Hb) levels in anaemic cancer patients in Italian clinical practice. Methods: The ANEMONE study was a national, longitudinal, retrospective, multicentre observational study. Patients had to be 18 years or older, with a solid tumour or non-Hodgkin’s lymphoma, Hodgkin’s disease or multiple myeloma, receiving chemotherapy, and treated with Binocrit® to manage chemotherapy-induced anaemia. The primary outcomes were the proportion of patients with a Hb increase ⩾1 g/dl during the first 4 weeks and with a Hb increase ⩾2 g/dl during the first 12 weeks. Results: A total of 245 patients were enrolled and 215 patients were evaluable for statistical analysis. In the first 4 weeks, 49.3% of patients showed an increase in Hb of ⩾1 g/dl: 45.5% in patients with solid tumours and 52.1% in patients with haematological malignancies. In the first 12 weeks, 51.6% of patients showed an increase in Hb of ⩾2 g/dl (48.4% solid tumours, 54.2% haematological diseases). Treatment with Binocrit® was well tolerated. Conclusions: These results confirm the effectiveness and safety of Binocrit® for chemotherapy-induced anaemia in routine practice in patients with solid tumours, lymphoma and myeloma. PMID:28203295

  3. Therapeutic and routine prophylactic properties of rFactor VIII Fc (efraloctocog alfa, Eloctate®) in hemophilia A

    Science.gov (United States)

    Chowdary, Pratima; Fosbury, Emma; Riddell, Anne; Mathias, Mary

    2016-01-01

    rFVIIIFc (efraloctocog alfa, Eloctate®) is an extended half-life (EHL) factor VIII licensed for use in patients with hemophilia A for prophylaxis and treatment of bleeding and surgical episodes. Pharmacokinetic studies in adults have shown a mean 1.5-fold increase in half-life compared to full-length factor VIII. When compared to adults, the half-life is decreased by 8% in adolescents between 12 and 17 years, by 18% in children 6 to <12 years, and by 33% in children between the ages of 2 and <6 years. There is a considerable interindividual variation in the prolongation of the half-life particularly in children and across the age groups, the range extending from no increase to a 2.5-fold increase. In addition to age, von willebrand factor (VWF) antigen level has demonstrated a significant impact on rFVIIIFc half-life, with higher VWF levels associated with greater prolongation of half-life. The pivotal and pediatric clinical trials have demonstrated the efficacy and safety of rFVIIIFc for use in regular prophylaxis and in management of bleeds and surgery. In these studies, just under half the participants showed a zero annualized bleed rate (ABR), and the median ABR (1.6 in the pivotal study for the individualized prophylaxis arm) showed a further decrease in the extension study. On average, the patients required fewer infusions (reduced by at least a third), and the mean weekly consumption seems to be in keeping with standard recombinant factor VIII. EHL rFVIIIFc has made decreased infusion frequency a possibility. However, the interindividual variability in dose and infusion frequency highlights the need for a personalized approach based on individual patient’s half-life and/or response to treatment. PMID:27695377

  4. 77 FR 24225 - Information Collection Approval; Temporary Non-Agricultural Employment of H-2B Aliens in the...

    Science.gov (United States)

    2012-04-23

    ... of H-2B Aliens in the United States AGENCY: Employment and Training Administration, Department of... Employment of H-2B Aliens in the United States; Final Rule. See 77 FR 10038, Feb. 21, 2012. DATES: On April...

  5. Serum zinc and hormonal profile in male dialysis patients receiving human recombinant erythropoietin Zinco sérico e perfil hormonal de pacientes do sexo masculino submetidos à hemodiálise em uso de eritropoetina humana recombinante

    Directory of Open Access Journals (Sweden)

    Maria Mouranilda Schleicher

    2005-08-01

    Full Text Available INTRODUCTION: Treatment with recombinant human erythropoietin (rHuEpo is associated with an improvement in well-being and quality of life in patients submitted to maintenance hemodialysis (HD. OBJECTIVES: The goal of this work was to evaluate the levels of sex hormones, hematocrit, albumin and zinc in HD patients with rHuEpo therapy and compare them with those observed in patients without rHuEpo treatment. MATERIAL AND METHODS: Two groups of twelve male HD patients each were selected for a transversal study; one did not receive rHuEpo (group 1 whereas the other one did (group 2. Levels of hematocrit, albumin, zinc, luteinizing hormone (LH, follicle-stimulating hormone (FSH, prolactin, and testosterone were determined. RESULTS: Group 2 patients showed significantly higher medians (p INTRODUÇÃO: Em pacientes submetidos à hemodiálise crônica (HD, o tratamento com eritropoetina humana recombinante (rHuEpo está associado a melhora no bem-estar geral e na qualidade de vida. OBJETIVOS: O objetivo do presente trabalho foi avaliar os níveis dos hormônios sexuais e do zinco em pacientes sob HD e em uso de rHuEpo em comparação com pacientes sem tratamento com essa droga. MATERIAL E MÉTODOS: Dois grupos de doze pacientes do sexo masculino cada um, submetidos à HD, sendo um deles sem uso de rHuEpo (grupo 1 e o outro utilizando a droga (grupo 2, foram selecionados para um estudo transversal, comparando-se os níveis séricos do zinco, da albumina, dos hormônios FSH, LH, prolactina, testosterona e do hematócrito. RESULTADOS: No grupo 2, os valores de testosterona (4,65 vs. 3,5ng/ml, hematócrito (30,5 vs. 22%, albumina (3,9 vs. 3,7g/dl e zinco (62,5 vs. 50,5microg/dl foram significativamente maiores do que no grupo 1 (p < 0,05. DISCUSSÃO: Sugere-se que, em pacientes recipientes da rHuEpo, os níveis mais altos de hematócrito, zinco, albumina e testosterona possam ser fatores que contribuam para melhorar a disfunção sexual e a qualidade de

  6. Dinâmica folicular em cabras da raça Toggenburg em lactação tratadas ou não com somatotropina bovina recombinante Follicular dynamics of lactating Toggenburg does treated with recombinant bovine somatotropin

    Directory of Open Access Journals (Sweden)

    E.A.M. Amorim

    2007-12-01

    Full Text Available Avaliou-se o efeito da injeção de somatotropina bovina recombinante (r-bST sobre o ciclo estral de cabras. Foram utilizadas 24 fêmeas da raça Toggenburg, distribuídas em dois tratamentos: T1 (n=12, cabras tratadas com r-bST; e T2 (n=12, cabras tratadas com solução salina (controle. A partir da primeira injeção do tratamento, acompanhou-se o ciclo dos animais em estro até o estro subseqüente. O comprimento médio do ciclo estral e o período interovulatório não diferiram (P>0,05 entre os tratamentos. Foram verificados ciclos estrais de duas, três e quatro ondas de crescimento folicular. Não houve diferença (P>0,05 entre os tratamentos quanto ao número de ondas do ciclo estral. O número de folículos detectados com diâmetro >3mm nas cabras do T1 foi maior (P0,05. A r-bST não alterou a dinâmica folicular de cabras lactantes da raça Toggenburg, mas promoveu o aumento do número de folículos recrutados ³3mm durante o ciclo estral.The effect of the r-bST injection was evaluated on the goats estrous cycles. Twenty-four Toggenburg does were used in two treatments: T1 (n=12 treated with r-bST; and T2 (n=12 treated with saline solution (control. After the first r-bST injection, the estrous cycles were checked between two estrus. The estrous cycle length and interovulatory period of the goats did not differ between treatments (P>0.05. Estrous cycles with two, three and four waves of follicular growth were observed. The number of waves during the estrous cycle were not affected by the r-bST treatment (P>0.05. The number of 3mm follicles was different between T1 and T2 (P0.05 between treatments. The r-bST did not affect the ovarian response during the estrous cycle. The r-bST not affected the follicular dynamic of Toggenburg lactating does, but increased the number of emerging follicles >3mm during the estrous cycle.

  7. Laboratory Study of O2(b1Σ g+, υ = 1) Collisional Removal at Thermospheric Temperatures

    Science.gov (United States)

    Wouters, E. R.; Pejaković, D. A.; Phillips, K. E.; Kalogerakis, K. S.

    2003-12-01

    In the Earth's thermosphere, energy transfer from O(1D) to O2 generates oxygen molecules in the υ = 0 and 1 levels of the O2(b1Σg+) state. The emissions in the O2(b1Σ g+ - X3Σ g-) system (Atmospheric Band) present a major component of the Earth's airglow. Interpretation of the measured intensities of O2 Atmospheric Band emissions can yield altitude profiles of oxygen atom density and local temperature in the lower thermosphere. To achieve this goal accurate laboratory measurements of the collisional removal rate coefficients of O2(b, υ = 1) and their temperature dependence are essential. Atmospheric observations suggest that the relevant colliders for the removal of O2(b, υ = 1) in the lower thermosphere are O2 and O(3P). We report measurements of the rate coefficients for the collisional removal of O2(b, υ = 1) by O2, N2, and CO2, at temperatures in the range 300--1000 K. A state-specific two-laser technique is used, in which the visible output of the first laser directly excites O2 to O2(b, υ = 1), and the ultraviolet output of the second laser probes the O2(b, υ = 1) population by resonantly enhanced multiphoton ionization via the υ= 4 level of the d1Π g Rydberg state. The temporal evolution of the O2(b, υ = 1) population is monitored by varying the time delay between the two laser pulses. The rate coefficient of the collisional removal of O2(b, υ = 1) by O2 increases monotonically with temperature from about 1.5 x 10-11 cm3 s-1 to about 6*E-11 cm3 s-1 in the range 300--1000 K. Experiments with colliders N2 and CO2 determine the upper limits for the removal rate coefficients of O2(b, υ = 1) by N2 and CO2 to be 2 orders of magnitude smaller. This work extends previous studies of O2(b, υ = 1) at room and low temperatures.1,2 We are currently planning experiments to investigate the collisional removal of O2(b, υ = 1) by O atoms. This study was supported by the NSF's Grant ATM-0209229. The participation of K. Phillips in this project was funded by

  8. Reciprocal interactions of Fgf10/Fgfr2b modulate the mouse tongue epithelial differentiation.

    Science.gov (United States)

    Sohn, Wern-Joo; Jung, Hye-In; Choi, Min-A; Han, Jin-Hyun; Gwon, Gi-Jeong; Yamamoto, Hitoshi; Lee, Sanggyu; Ryoo, Zae Young; Park, Eui-Kyun; Shin, Hong-In; Jung, Han-Sung; Kim, Jae-Young

    2011-08-01

    The molecular mechanisms for epithelial differentiation have been studied by observing skin development in embryogenesis, but the early signaling modulations involved in tongue epithelial differentiation are not completely understood. Based on the gene expression patterns of the Fgf signaling molecules and previous results from Fgf10 and Fgfr2b knockout mice, it was hypothesized that there would be fundamental signaling interactions through the epithelial Fgfr2b and its mesenchymal ligand Fgf10 to regulate tongue epithelium differentiation. To elucidate these reciprocal interactions in tongue epithelial differentiation, this study employed an in vitro tongue organ culture system with antisense-oligodeoxynucleotides (AS-ODNs) and recombinant protein-soaked bead implantation for the loss-of-function and gain-of-function studies. Functional analysis of Fgf signaling revealed precise reciprocal interactions, which showed that mesenchymal Fgf10 rather than Fgf7 modulates tongue epithelial differentiation via Fgfr2b in a temporal- and spatial-specific manner.

  9. Sustained major molecular response on interferon alpha-2b in two patients with polycythemia vera

    DEFF Research Database (Denmark)

    Larsen, T.S.; Pallisgaard, N.; Andersen, M.T.;

    2008-01-01

    Quantitative assessment of the JAK2 V617F allele burden during disease evolution and ongoing myelosuppressive treatment is likely to be implemented in the future clinical setting. Interferon alpha has demonstrated efficacy in treatment of both chronic myeloid leukemia and the Philadelphia...... chromosome negative chronic myeloproliferative disorders. Reductions in the JAK2 V617F allele burden in patients treated with pegylated interferon alpha-2a (Peg-IFN-2a) have been demonstrated, although follow-up was relatively short. We report here the first profound and sustained molecular responses...... with a JAK2 V617F allele burden below 1.0% in two patients with polycythemia vera treated with interferon alpha-2b (IFN-2b). Discontinuation of IFN-2b in one of the patients was followed by a sustained long-lasting (12 months of follow-up) major molecular response Udgivelsesdato: 2008/10...

  10. Contributions of PHOX2B in the pathogenesis of Hirschsprung disease.

    Directory of Open Access Journals (Sweden)

    Raquel María Fernández

    Full Text Available Hirschsprung disease (HSCR is a congenital malformation of the hindgut resulting from a disruption of neural crest cell migration during embryonic development. It has a complex genetic aetiology with several genes involved in its pathogenesis. PHOX2B plays a key function in the development of neural crest derivatives, and heterozygous mutations cause a complex dysautonomia associating HSCR, Congenital Central Hypoventilation Syndrome (CCHS and neuroblastoma (NB in various combinations. In order to determine the role of PHOX2B in isolated HSCR, we performed a mutational screening in a cohort of 207 Spanish HSCR patients. Our most relevant finding has been the identification of a de novo and novel deletion (c.393_410del18 in a patient with HSCR. Results of in silico and functional assays support its pathogenic effect related to HSCR. Therefore our results support that PHOX2B loss-of-function is a rare cause of HSCR phenotype.

  11. Magnetic properties of Y1- xGdxCo2B2C series of borocarbides

    Science.gov (United States)

    Bud'ko, S. L.; Giordanengo, B.; Sulpice, A.; Fontes, M. B.; Baggio-Saitovitch, E. M.

    1995-04-01

    Magnetic properties of Y1- xGdxCo2B2C series of compounds were studied. Two magnetically ordered phases were observed for 0.7 ≤ x ≤ 1. Change of the magnetic ordering temperatures T 1 and T 2 with the Gd concentration is argued to be related to the dilution of magnetic Gd by nonmagnetic Y and to the reduction of the distance between ( Y1- xGdx) C planes. However, significant contribution to the changes in T 1 between pure GdNi2B2C and GdCo2B2C samples is suggested to be due to the different 3 d band filling in these compounds.

  12. Neuropsychiatric complications associated with interferon - alpha -2b treatment of malignant melanoma.

    LENUS (Irish Health Repository)

    Enudi, W

    2012-02-01

    Several adverse effects have been associated with interferon alpha 2b treatment and neuropsychiatric effects have also been commonly reported. Psychosis and mood disorders have been described in the literature. This case report is of a 30 year old man with malignant melanoma stage 3a who was receiving adjuvant alpha 2b interferon and developed a manic episode two weeks post switching after one month of treatment on a high dose to a low dose. There was no previous psychiatric illness and no known family history of mental illness. This is in keeping with previous reports that mania has been observed in patients undergoing interferon treatment especially after significant dose-reduction or treatment breaks. Mania induced by interferon responds well to antimanic drugs .Since interferon alpha 2b is now commonly used in the treatment of malignant melanoma and other conditions, the need to be aware of its neuropsychiatric complications is essential.

  13. Neuropsychiatric complications associated with interferon - alpha -2b treatment of malignant melanoma.

    LENUS (Irish Health Repository)

    Enudi, W

    2009-08-01

    Several adverse effects have been associated with interferon alpha 2b treatment and neuropsychiatric effects have also been commonly reported. Psychosis and mood disorders have been described in the literature. This case report is of a 30 year old man with malignant melanoma stage 3a who was receiving adjuvant alpha 2b interferon and developed a manic episode two weeks post switching after one month of treatment on a high dose to a low dose. There was no previous psychiatric illness and no known family history of mental illness. This is in keeping with previous reports that mania has been observed in patients undergoing interferon treatment especially after significant dose-reduction or treatment breaks. Mania induced by interferon responds well to antimanic drugs .Since interferon alpha 2b is now commonly used in the treatment of malignant melanoma and other conditions, the need to be aware of its neuropsychiatric complications is essential.

  14. Possible coexistence of superconductivity and magnetic order in NdPt2B2C

    Indian Academy of Sciences (India)

    S K Dhar; A D Chinchure; E Alleno; C Godart; L C Gupta; R Nagarajan

    2002-05-01

    Coexistence of superconductivity and magnetic order has been one of the exciting aspects of the quaternary borocarbide superconductors. So far, RNi2B2C (R=Tm, Er, Ho and Dy) are the only known magnetic superconductors in this family. Here, we present our resistivity, magnetization and heat capacity studies on NdPt2B2C (nominal composition, NdPt1.5Au0.6B2C and NdPt2.1B2.4C1.2). We find superconductivity in both samples with c,onset∼ 3 K. Bulk magnetic order is found to occur below 1.7 K. We suggest that NdPt2B2C is a possible magnetic superconductor.

  15. A new natural naphtho[1,2-b]furan from the leaves of Cassia fistula.

    Science.gov (United States)

    Wang, Li-Qin; Tang, Zheng-Rong; Mu, Wei-Hua; Kou, Jun-Feng; He, Dong-Yang

    2013-11-01

    A new naphtho[1,2-b]furan, 2,9-dihydroxy-7-methoxy-4-methylnaphtha[1,2-b]furan-3(2H)-one (1), along with 10 known compounds vanillic acid (2), naringenin (3), glyceryl-1-tetracosanoate (4), moracin J (5), 1,3,8-trihydroxyanthraquinone (6), esculetin (7), mauritianin (8), kaempferol 3-neohesperidoside (9), β-sitosterol (10), and β-daucosterol (11), was isolated from the leaves of Cassia fistula. The structure of the new compound was determined by NMR and X-ray analysis. Compounds 1, 3, 5-9 were isolated from this plant for the first time. The naphtha[1,2-b]furan was firstly isolated from the natural resources.

  16. Uso de una conantokina y anticuerpos policlonales para identificar la subunidad NR2B del receptor

    OpenAIRE

    2010-01-01

    Objetivo. Proponer una metodología de identificación de la subunidad NR2B, mediante el uso de conantokina G, así como una adecuada extracción de la subunidad NR2B. Materiales y métodos. Se ensayaron dos metodologías para la extracción de la subunidad NR2B de cerebro de rata adulta, la primera buscó la extracción de la subunidad a partir de la membrana mediante la utilización del detergente deoxicolato de sodio y la segunda, garantizó primero la solubilización y eliminación de proteínas citopl...

  17. The Importance of Brand on B2B Markets: Expert Interviews with Hilti AG Managers

    Directory of Open Access Journals (Sweden)

    Martin Konečný

    2013-12-01

    Full Text Available This paper investigates the importance of brand building in the business-to-business world. Not only B2C companies must take branding into account and put it among their top priorities in order to survive and succeed on the market. The first part of the article deals with the theoretical background of brand importance and market specifics of B2B markets and results in the setting of two hypotheses. The following research has to find out how the managers of a pure business-to-business company perceive the importance of a brand; moreover, it has to evaluate the importance of eight specific brand building factors. Fourteen expert interviews document the growing of brands in the B2B market and their main aspects. At the end of the article, we will focus on future implications for B2B management.

  18. Properties of a New Nonlinear Optical Crystal CdZn2B2O6

    Institute of Scientific and Technical Information of China (English)

    ZHANG Fan; SHEN De-Zhong; SHEN Guang-Qiu; WANG Xiao-Qing

    2008-01-01

    @@ Cadmium dizinc diborate (CdZn2B2O6) single crystals have been grown for the first time. The crystal structure of CdZn2B2O6 is the same as that of the Cd3Zn3B4O12. The x-ray diffraction, infrated and Raman spectra,differential scanning calorimetry analysis and density indicate that the physical and chemical properties of both crystals are very similar. Especially, the nonlinear optical coefficients of CdZn2B2O6 and Cd3ZnaB4O12 crystals are 2.6 and 2.4 times as large as that of KH2PO4 crystal respectively. Chemical etching experiments indicated that these crystals are very stable in neutral solution and not hygroscopic in air at room temperature.

  19. Genes for resistance to stripe rust on chromosome 2B and their application in wheat breeding

    Institute of Scientific and Technical Information of China (English)

    Peigao Luo; Xueyun Hu; Huaiyu Zhang; Zhenglong Ren

    2009-01-01

    Stripe rust,caused by Puccinia striiformis f.sp.tritici,is one of the most damaging diseases of wheat worldwide.Growing resistant cultivars is the most economic and environmental friendly way to control the disease.There are many resistance genes to stripe rust located on wheat chromosome 2B.Here,we propose a strategy to construct the recombinant wheat chromosome 2B with multiple resistances to stripe rust by making crosses between wheat lines or cultivars carrying Yr genes and using marker-assisted selection,based on the reported information about resistance spectrum,chromosomal location,and linked markers of the genes.Pyramiding the resistance genes on 2B would afford a valuable strategy to control the disease by cultivating varieties with durable resistance.The possibility,efficiency,and prospect of the suggested strategy are reviewed in the paper.

  20. Oral application of freeze-dried yeast particles expressing the PCV2b Cap protein on their surface induce protection to subsequent PCV2b challenge in vivo.

    Science.gov (United States)

    Patterson, Robert; Eley, Thomas; Browne, Christopher; Martineau, Henny M; Werling, Dirk

    2015-11-17

    Porcine circovirus type 2 (PCV2) is now endemic in every major pig producing country, causing PCV-associated disease (PCVAD), linked with large scale economic losses. Current vaccination strategies are based on the capsid protein of the virus and are reasonably successful in preventing PCVAD but fail to induce sterile immunity. Additionally, vaccinating whole herds is expensive and time consuming. In the present study a "proof of concept" vaccine trial was employed to test the effectiveness of powdered freeze-dried recombinant Saccharomyces cerevisiae yeast stably expressing the capsid protein of PCV2b on its surface as an orally applied vaccine. PCV2-free pigs were given 3 doses of vaccine or left un-vaccinated before challenge with a defined PCV2b strain. Rectal temperatures were measured and serum and faeces samples were collected weekly. At the end of the study, pigs were euthanized, tissue samples taken and tested for PCV2b load by qPCR and immunohistochemistry. The peak of viraemia in sera and faeces of unvaccinated pigs was higher than that of vaccinated pigs. Additionally more sIgA was found in faeces of vaccinated pigs than unvaccinated. Vaccination was associated with lower serum concentrations of TNFα and IL-1β but higher concentrations of IFNα and IFNγ in comparison to the unvaccinated animals. At the end of the trial, a higher viral load was found in several lymphatic tissues and the ileum of unvaccinated pigs in comparison to vaccinated pigs. The difference between groups was especially apparent in the ileum. The results presented here demonstrate a possible use for recombinant S. cerevisiae expressing viral proteins as an oral vaccine against PCV2. A powdered freeze-dried recombinant S. cerevisiae used as an oral vaccine could be mixed with feed and may offer a cheap and less labour intensive alternative to inoculation with the additional advantage that no cooling chain would be required for vaccine transport and storage.

  1. Structural Basis for Host Membrane Remodeling Induced by Protein 2B of Hepatitis A Virus

    Science.gov (United States)

    Vives-Adrián, Laia; Garriga, Damià; Buxaderas, Mònica; Fraga, Joana; Pereira, Pedro José Barbosa

    2015-01-01

    ABSTRACT The complexity of viral RNA synthesis and the numerous participating factors require a mechanism to topologically coordinate and concentrate these multiple viral and cellular components, ensuring a concerted function. Similarly to all other positive-strand RNA viruses, picornaviruses induce rearrangements of host intracellular membranes to create structures that act as functional scaffolds for genome replication. The membrane-targeting proteins 2B and 2C, their precursor 2BC, and protein 3A appear to be primarily involved in membrane remodeling. Little is known about the structure of these proteins and the mechanisms by which they induce massive membrane remodeling. Here we report the crystal structure of the soluble region of hepatitis A virus (HAV) protein 2B, consisting of two domains: a C-terminal helical bundle preceded by an N-terminally curved five-stranded antiparallel β-sheet that displays striking structural similarity to the β-barrel domain of enteroviral 2A proteins. Moreover, the helicoidal arrangement of the protein molecules in the crystal provides a model for 2B-induced host membrane remodeling during HAV infection. IMPORTANCE No structural information is currently available for the 2B protein of any picornavirus despite it being involved in a critical process in viral factory formation: the rearrangement of host intracellular membranes. Here we present the structure of the soluble domain of the 2B protein of hepatitis A virus (HAV). Its arrangement, both in crystals and in solution under physiological conditions, can help to understand its function and sheds some light on the membrane rearrangement process, a putative target of future antiviral drugs. Moreover, this first structure of a picornaviral 2B protein also unveils a closer evolutionary relationship between the hepatovirus and enterovirus genera within the Picornaviridae family. PMID:25589659

  2. UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men

    Science.gov (United States)

    Yatsenko, Alexander N.; Georgiadis, Andrew P.; Murthy, Lata J.; Lamb, Dolores J.; Matzuk, Martin M.

    2013-01-01

    Oligozoospermia (low sperm count) is a common semen deficiency. However, to date, few genetic defects have been identified to cause this condition. Moreover, even fewer molecular genetic diagnostic tests are available for patients with oligozoospermia in the andrology clinic. Based on animal and gene expression studies of oligozoospermia, several molecular pathways may be disrupted in post-meiotic spermatozoa. One of the disrupted pathways is protein ubiquitination and cell apoptosis. A critical protein involved in this pathway is the ubiquitin-conjugating enzyme 2B, UBE2B. Absence of Ube2b in male mice causes spermatogenic meiotic disruption with increased apoptosis, leading to infertility. To examine the association between messenger RNA defects in UBE2B and severe oligozoospermia (0.1–10 × 106 cells/ml), sequencing of sperm cDNA in 326 oligozoospermic patients and 421 normozoospermic men was performed. mRNA alterations in UBE2B were identified in sperm in 4.6% (15 out of 326) of the oligozoospermic patients, but not found in control men, suggesting strong association between mRNA defects and oligozoospermia (χ2 = 19, P = 0.0001). Identified UBE2B alterations include nine splicing, four missense and two nonsense alterations. The follow-up screen of corresponding DNA regions did not reveal causative DNA mutations, suggesting a post-transcriptional nature of identified defects. None of these variants were reported in the dbSNP database, although other splicing abnormalities with low level of expression were present in 11 out of 421 (2.6%) controls. Our findings suggest that two distinct molecular mechanisms, mRNA editing and splicing processing, are disrupted in oligozoospermia. We speculate that the contribution of post-transcriptional mRNA defects to oligozoospermia could be greater than previously anticipated. PMID:23378580

  3. 26 CFR 301.6103(p)(2)(B)-1 - Disclosure of returns and return information by other agencies.

    Science.gov (United States)

    2010-04-01

    ... other agencies. 301.6103(p)(2)(B)-1 Section 301.6103(p)(2)(B)-1 Internal Revenue INTERNAL REVENUE... Information and Returns Returns and Records § 301.6103(p)(2)(B)-1 Disclosure of returns and return information... regulations thereunder, including, if applicable, safeguards imposed by section 6103(p)(4). (d) Records...

  4. Early microgliosis precedes neuronal loss and behavioural impairment in mice with a frontotemporal dementia-causing CHMP2B mutation

    DEFF Research Database (Denmark)

    Clayton, Emma L; Mancuso, Renzo; Nielsen, Troels Tolstrup

    2017-01-01

    Frontotemporal dementia (FTD)-causing mutations in the CHMP2B gene lead to the generation of mutant C-terminally truncated CHMP2B. We report that transgenic mice expressing endogenous levels of mutant CHMP2B developed late-onset brain volume loss associated with frank neuronal loss and FTD...

  5. Medullær thyroideacancer hos et ti måneder gammelt barn med multipel endokrin neoplasi 2B

    DEFF Research Database (Denmark)

    Mathiesen, Jes Sloth; Døssing, Helle; Bender, Lars;

    2014-01-01

    In infants at risk of multiple endocrine neoplasia type 2B (MEN2B) the American Thyroid Association recommends genetic testing as soon as possible after birth and that thyroidectomy should be performed in MEN2B RET-mutation positive individuals as soon as possible and if possible within the first...

  6. Molecular and functional characterization of the first tick CAP2b (periviscerokinin) receptor from Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    The cDNA of the receptor for CAP2b/periviscerokinin (PVK) neuropeptides, designated Rhimi-CAP2b-R, was cloned from synganglia of tick Rhipicephalus (Boophilus) microplus. This receptor is the ortholog of the insect CAP2b/PVK receptor, as concluded from analyses of the predicted protein sequence, ph...

  7. Association Study of N-Methyl-D-Aspartate Receptor Subunit 2B (GRIN2B Polymorphisms and Schizophrenia Symptoms in the Han Chinese Population.

    Directory of Open Access Journals (Sweden)

    Yongfeng Yang

    Full Text Available Schizophrenia (SZ is a common and complex psychiatric disorder that has a significant genetic component. The glutamatergic system is the major excitatory neurotransmitter system in the central nervous system, and is mediated by N-methyl-D-aspartate (NMDA receptors. Disturbances in this system have been hypothesized to play a major role in SZ pathogenesis. Several studies have revealed that the NMDA receptor subunit 2B (GRIN2B potentially associates with SZ and its psychiatric symptoms. In this study, we performed a case-control study to identify polymorphisms of the GRIN2B gene that may confer susceptibility to SZ in the Han Chinese population. Thirty-four single nucleotide polymorphisms (SNPs were genotyped in 528 paranoid SZ patients and 528 control subjects. A significant association was observed in allele and genotype between SZ and controls at rs2098469 (χ2 = 8.425 and 4.994; p = 0.025 and 0.014, respectively. Significant associations were found in the allele at rs12319804 (χ2 = 4.436; p = 0.035, as well as in the genotype at rs12820037 and rs7298664 between SZ and controls (χ2 = 11.162 and 38.204; p = 0.003 and 4.27×10(-8, respectively. After applying the Bonferroni correction, rs7298664 still had significant genotype associations with SZ (p = 1.71×10(-7. In addition, rs2098469 genotype and allele frequencies, and 12820037 allele frequencies were nominally associated with SZ. Three haplotypes, CGA (rs10845849-rs12319804-rs10845851, CC (rs12582848-rs7952915, and AAGAC (rs2041986-rs11055665-rs7314376-rs7297101-rs2098469, had significant differences between SZ and controls (χ2 = 4.324, 4.582, and 4.492; p = 0.037, 0.032, and 0.034, respectively. In addition, three SNPs, rs2098469, rs12820037, and rs7298664, were significantly associated with cognition factors PANSS subscores in SZ (F = 16.799, 7.112, and 13.357; p = 0.000, 0.017, and 0.000, respectively. In conclusion, our study provides novel evidence for an association between GRIN2B

  8. Association Study of N-Methyl-D-Aspartate Receptor Subunit 2B (GRIN2B) Polymorphisms and Schizophrenia Symptoms in the Han Chinese Population

    Science.gov (United States)

    Zhang, Hongxing; Yang, Ge; Wang, Xiujuan; Ding, Minli; Jiang, Tianzi; Lv, Luxian

    2015-01-01

    Schizophrenia (SZ) is a common and complex psychiatric disorder that has a significant genetic component. The glutamatergic system is the major excitatory neurotransmitter system in the central nervous system, and is mediated by N-methyl-D-aspartate (NMDA) receptors. Disturbances in this system have been hypothesized to play a major role in SZ pathogenesis. Several studies have revealed that the NMDA receptor subunit 2B (GRIN2B) potentially associates with SZ and its psychiatric symptoms. In this study, we performed a case–control study to identify polymorphisms of the GRIN2B gene that may confer susceptibility to SZ in the Han Chinese population. Thirty-four single nucleotide polymorphisms (SNPs) were genotyped in 528 paranoid SZ patients and 528 control subjects. A significant association was observed in allele and genotype between SZ and controls at rs2098469 (χ2 = 8.425 and 4.994; p = 0.025 and 0.014, respectively). Significant associations were found in the allele at rs12319804 (χ2 = 4.436; p = 0.035), as well as in the genotype at rs12820037 and rs7298664 between SZ and controls (χ2 = 11.162 and 38.204; p = 0.003 and 4.27×10-8, respectively). After applying the Bonferroni correction, rs7298664 still had significant genotype associations with SZ (p = 1.71×10-7). In addition, rs2098469 genotype and allele frequencies, and 12820037 allele frequencies were nominally associated with SZ. Three haplotypes, CGA (rs10845849—rs12319804—rs10845851), CC (rs12582848—rs7952915), and AAGAC (rs2041986—rs11055665—rs7314376—rs7297101—rs2098469), had significant differences between SZ and controls (χ2 = 4.324, 4.582, and 4.492; p = 0.037, 0.032, and 0.034, respectively). In addition, three SNPs, rs2098469, rs12820037, and rs7298664, were significantly associated with cognition factors PANSS subscores in SZ (F = 16.799, 7.112, and 13.357; p = 0.000, 0.017, and 0.000, respectively). In conclusion, our study provides novel evidence for an association between

  9. An Alpha spectrometer for measuring radon daughter individual activity concentration; Spettrometro Alfa per la misura delle concentrazioni individuali in attivita' della progenie del radon

    Energy Technology Data Exchange (ETDEWEB)

    Berico, M.; Formignani, M. [ENEA, Div. Protezione dell' Uomo e degli Ecosistemi, Centro Ricerche E. Clementel, Bologna (Italy); Mariotti, F. [Bologna Univ., Bologna (Italy). Dipt. di Fisica

    2001-07-01

    In the frame of the program of the Institute for Radiation Protection of ENEA, related to the evaluation of dose from radon and thoron progeny, an alpha spectrometer for the continuous air monitoring (CAM type) of radon and thoron has been realized. The constructive characteristics of the device are here presented together with energy and efficiency calibration. The device allows, by means of a screen type diffusion battery and a filter, to determinate the single radioactivity of each radionuclide of the progeny selecting them in relation to their diffusive behaviour (dichotomous particle size selection). The three-count filter method has been employed to measure the concentrations of {sup 218}Po, {sup 214}Pb and {sup 214}Bi in air. Radon and thoron effective doses using a dosimetric, instead of an epidemiologic approach, will be then evaluated. [Italian] Presso l'Istituto per la Radioprotezione, nell'ambito del programma di valutazione di dose da radon e' stato progettato e realizzato uno spettrometro alfa per il monitoraggio continuo in aria (CAM) della progenie del radon e del toron. Le caratteristiche costruttive dello strumento permettono, tramite l'utilizzo di batterie a diffusione a reti, di determinare l'attivita' individuale della progenie per diverse dimensioni granulometriche in particolare per la frazione attaccata e non al particolato amosferico con un taglio granulometrico di qualche nanometro. E' stato inoltre applicato un metodo spettrometrico a tre conteggi per il calcolo delle concentrazioni individuali della progenie del radon, {sup 218}Po, {sup 214}Pb and {sup 214}Bi, effettuando un conteggio alfa di {sup 218}Po e due conteggi alfa di {sup 214}Po. Tale informazione consentira' una valutazione della dose di radon utilizzando il modello dosimetrico in alternativa a quello epidemiologico.

  10. Peginterferon alfa-2a is associated with elevations in alanine aminotransferase at the end of treatment in chronic hepatitis C patients with sustained virologic response.

    Directory of Open Access Journals (Sweden)

    Chih-Wei Tseng

    Full Text Available The purpose of this study was to investigate the incidence and demographic/clinical factors of alanine aminotransferase (ALT abnormalities at the end of treatment (EOT in chronic hepatitis C (CHC patients with sustained virologic response (SVR.Seven hundred naïve CHC patients who underwent combination treatment between January 2003 and December 2010 were included in the study. The patients with SVR and serum ALT>upper limit of normal (ULN at the EOT were further analyzed. The effects of clinical characteristics, treatment regimen, and virologic variables were evaluated by logistic regression. Of the 700 included patients, 488 (69.7% achieved an SVR after treatment, and 235 (33.6% had serum ALT levels>ULN at the EOT. Of those 488 patients, 137 (28.1% had abnormal ALT values at the EOT. A multivariate analysis showed that the occurrence of ALT abnormalities at the EOT was significantly associated with pegylated interferon (PEG-IFN alfa-2a (odds ratio [OR], 2.24; 95% confidence interval [CI], 1.45-3.45; P<0.001, baseline fatty liver (OR, 1.76; 95% CI, 1.16-2.76; P = 0.007, and baseline liver cirrhosis (OR, 2.35; 95% CI, 1.35-4.09; P = 0.002.Use of PEG-IFN-alfa-2a, fatty liver, and cirrhosis are important factors associated with EOT-ALT abnormality in CHC patients receiving combination therapy that achieve an SVR. PEG-IFN-alfa-2a-related EOT-ALT elevation will become normal at the end of follow-up, but fatty liver and cirrhosis-related ALT elevation will not be resolved.

  11. How to successfully present a solution in a B2B sales meeting

    OpenAIRE

    Klemola, Mari

    2013-01-01

    This thesis contains research on presenting a solution in a B2B (business-to-business) sales meeting. This thesis is planned to complement the existing course material in the solution selling course at HAAGA-HELIA University of Applied Sciences’ Degree Programme in Sales. The objective of this thesis was to create a handbook to students about how to successfully present a solution in a B2B sales meeting. This is the main research question. The secondary research questions are: (1) how to ...

  12. Progressive dysphagia in limb-girdle muscular dystrophy type 2B.

    LENUS (Irish Health Repository)

    Walsh, Richard

    2012-02-01

    Dysphagia has not been reported in genetically confirmed limb-girdle muscular dystrophy type 2B (LGMD2B). A 40-year-old woman reported exercise-induced calf pain at age 34, followed by progressive lower and upper limb weakness. At age 38, progressive dysphagia for solids, and subsequently liquids, ensued. Endoscopic and videofluoroscopic-radiological findings indicated a myopathic swallowing disorder. Molecular genetic analysis confirmed two dysferlin gene mutations consistent with a compound heterozygote state. Progressive dysphagia should be considered as part of the expanding dysferlinopathy phenotype.

  13. Anisotropic Multiband Many-Body Interactions in LuNi2B2C

    Energy Technology Data Exchange (ETDEWEB)

    Bergk, B.; Petzold, V.; Rosner, H.; Drechsler, S.-L.; Bartkowiak, M.; Ignatchik, O.; Bianchi, A. D.; Sheikin, I.; Canfield, P. C.; Wosnitza, J.

    2008-06-27

    We present a comprehensive de Haas-van Alphen study on the nonmagnetic borocarbide superconductor LuNi{sub 2}B{sub 2}C. The analysis of the angular-dependent effective masses for different bands in combination with full-potential density functional calculations allowed us to determine the mass-enhancement factors, {lambda}, for the different electronic bands and their wave-vector dependences. Our data clearly show the anisotropic multiband character of the superconductivity in LuNi{sub 2}B{sub 2}C.

  14. Examination of dioxin degradation conditions for geobacillus midousuji SH2B-J2

    Energy Technology Data Exchange (ETDEWEB)

    Hoshina, S. [Jikei Univ., School of Medicine, Tokyo (Japan); Ohtsuka, Y. [Forestry and Forest Products Research Instiute; Goda, H. [Towa Kagaku Co., Ltd.

    2004-09-15

    Cellular membrane degradation capability of SH2B-J2 strains for dioxin mixtures that are greater than tetra-chlorinated have been examined. Optimal temperature, reaction time, optimal pH, and heavy metal resistance of cellular membrane enzyme were investigated, to examine dioxin degradation characteristics of SH2B-J2 strains. For chlorinated dioxins, a mixture (PCDD/PCDF mix) containing 7 species of dibenzo-p-dioxins greater than tetra-chlorinated, as well as 10 isomers of dibenzofurans, was used. Using GC/MS, decrease of 17 species of dioxin isomer/congener was measured.

  15. The role of transcriptional coactivator ADA2b in Arabidopsis abiotic stress responses.

    Science.gov (United States)

    Vlachonasios, Konstantinos E; Kaldis, Athanasios; Nikoloudi, Adriana; Tsementzi, Despoina

    2011-10-01

    Plant growth and crop production can be greatly affected by common environmental stresses such as drought, high salinity and low temperatures. Gene expression is affected by several abiotic stresses. Stress-inducible genes are regulated by transcription factors and epigenetic mechanisms such as histone modifications. In this Mini-Review, we have explored the role of transcriptional adaptor ADA2b in Arabidopsis responses to abiotic stress. ADA2b is required for the expression of genes involved in abiotic stress either by controlling H3 and H4 acetylation in the case of salt stress or affecting nucleosome occupancy in low temperatures response.

  16. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  17. A New Evolution Mechanism Model for B2B E-Commerce Network

    OpenAIRE

    Zhihong Tian; Zhenji Zhang; Xiaolan Guan

    2013-01-01

    To study the structure and evolution mechanism of B2B e-commerce network, the authors propose a network with several layers description of B2B e-commerce market. The empirical analysis from Alibaba.com shows that degree distribution of the network structure follows power-law. Based on modified BA (Barabasi-Albert) model, a new model is proposed, adding layers, fitness parameters, and more reasonable growth mechanism. The model reveals that, the structure of the network is stable, and the aver...

  18. Jusbetonin, the first indolo[3,2-b]quinoline alkaloid glycoside, from Justicia betonica.

    Science.gov (United States)

    Subbaraju, Gottumukkala V; Kavitha, Jakka; Rajasekhar, Dodda; Jimenez, Jorge I

    2004-03-01

    A new indolo[3,2-b]quinoline alkaloid glycoside, jusbetonin (1), and three known alkaloids, namely, 10H-quindoline (2), 6H-quinindoline (3), and 5H,6H-quinindolin-11-one (4), have been isolated from the leaves of Justicia betonica. The structure of 1 was established on the basis of 1D and 2D NMR ((1)H-(1)H COSY, HMQC, and HMBC) and HRFABMS data. Compound 1 is the first example of a glycosylated indolo[3,2-b]quinoline alkaloid, while compound 4 was isolated for the first time from a natural source.

  19. TiO2(B) nanoparticle-functionalized WO3 nanorods with enhanced gas sensing properties.

    Science.gov (United States)

    Zhang, Hongxin; Wang, Shurong; Wang, Yanshuang; Yang, Jiedi; Gao, Xueling; Wang, Liwei

    2014-06-14

    In this work, TiO2(B) nanoparticle (NP)-functionalized WO3 nanorods (NRs) were synthesized by a two-step solution strategy, with a hydrothermal process for WO3 NRs and hydrolyzation of Ti(OBu)4 for the functionalization of TiO2(B) NPs. Various techniques, including scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), and X-ray photoelectron spectroscopy (XPS), were employed to investigate the morphology, microstructure, crystalline nature and chemical composition of the prepared TiO2(B) NP-functionalized WO3 NRs. SEM and TEM results revealed that the TiO2(B)-WO3 composite showed a rod-like nanostructure with a diameter in the range from 93 to 154 nm and a rough surface, which could increase the accessible surface area and the amount of surface active sites, thus improving the properties or performance of the as-prepared composite NRs. XRD and XPS analysis clearly verified that monoclinic TiO2(B) NPs, a metastable polymorph of TiO2, were successfully supported on the WO3 NRs. Gas sensing measurement results for several common reductive organic gases such as acetone, ethanol, ether, methanol and formaldehyde demonstrated that the sensor based on the as-obtained TiO2(B) NP-functionalized WO3 NRs exhibited obviously enhanced responses compared with a pure WO3 NR based sensor, as well as fast response-recovery speeds, good reproducibility and good stability, indicating their promising application in gas sensors. The excellent gas sensing performance could be attributed to the unique 1D rod-like nanostructure with a rough surface, the existence of TiO2-WO3 heterojunctions and the catalytic effect of the TiO2(B) NPs. The as-prepared TiO2(B) NP-functionalized WO3 NRs will also have very good prospects in electrochromic devices and catalysis applications.

  20. H2B ubiquitination regulates meiotic recombination by promoting chromatin relaxation

    OpenAIRE

    Xu, Zhiliang; Song,Zhenhua; Li, Guoping; Tu, Huayu; Liu, Weixiao; Liu, Yujiao; Wang, Pan; Wang, Yuanting; Cui, Xiuhong; Liu, Chao; Shang, Yongliang; de Rooij, Dirk G.; Gao, Fei; Li, Wei

    2016-01-01

    Meiotic recombination is essential for fertility in most sexually reproducing species, but the molecular mechanisms underlying this process remain poorly understood in mammals. Here, we show that RNF20-mediated H2B ubiquitination is required for meiotic recombination. A germ cell-specific knockout of the H2B ubiquitination E3 ligase RNF20 results in complete male infertility. The Stra8-Rnf20−/− spermatocytes arrest at the pachytene stage because of impaired programmed double-strand break (DSB...

  1. Competence Neworks: Effects on Corporate Branding in B2B SMEs

    OpenAIRE

    2015-01-01

    The purpose of this thesis is to investigate the effects of competence networks on corporate branding in B2B SMEs and to develop a conceptual model of these effects. After reviewing the relevant literature that explores the field, eight components of corporate branding in an effective growth stage of an SME have been identified. Founders Alliance is a competence network in Sweden that was chosen as a case for our study. Representatives of five B2B SMEs within Founders Alliance were interviewe...

  2. Refined Sellmeier and thermo-optic dispersion formulas for Li2B4O7

    Science.gov (United States)

    Umemura, Nobuhiro; Watanabe, Jun; Matsuda, Daisuke; Kamimura, Tomosumi

    2017-03-01

    We report the high-accuracy Sellmeier and thermo-optic dispersion formulas for Li2B4O7, which provide an excellent reproduction of the temperature-dependent phase-matching conditions for second-harmonic generation (SHG) and sum-frequency generation (SFG) in the 0.2093–1.5352 µm range. In addition, Li2B4O7 was found to be nearly 90° phase-matchable for fifth-harmonic generation (5HG) of an Yb-doped fiber laser at 1.031 µm.

  3. 5-HT2B Receptor Antagonists Inhibit Fibrosis and Protect from RV Heart Failure

    OpenAIRE

    Wiebke Janssen; Yves Schymura; Tatyana Novoyatleva; Baktybek Kojonazarov; Mario Boehm; Astrid Wietelmann; Himal Luitel; Kirsten Murmann; Damian Richard Krompiec; Aleksandra Tretyn; Soni Savai Pullamsetti; Norbert Weissmann; Werner Seeger; Hossein Ardeschir Ghofrani; Ralph Theo Schermuly

    2015-01-01

    Objective. The serotonin (5-HT) pathway was shown to play a role in pulmonary hypertension (PH), but its functions in right ventricular failure (RVF) remain poorly understood. The aim of the current study was to investigate the effects of Terguride (5-HT2A and 2B receptor antagonist) or SB204741 (5-HT2B receptor antagonist) on right heart function and structure upon pulmonary artery banding (PAB) in mice. Methods. Seven days after PAB, mice were treated for 14 days with Terguride (0.2 mg/kg b...

  4. An Inter-enterprise Workflow Model for Supply Chain and B2B E-commerce

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The goals of B2B electronic commerce and supply chain management system are to implement interoperability of independent enterprises, to smooth the information flow between them and to deploy business processes over multiple enterprises. The inherent characteristics of workflow system make it suitable to implement the cross organization management. This paper, firstly, proposes an inter-enterprises workflow model based on the agreement to support the construction of supply chain management system and B2B electronic commerce. This model has extended the standard workflow model. After that, an architecture which supports the model has been introduced, especially it details the structure and implementation of interfaces between enterprises.

  5. The Importance of Brand on B2B Markets: Case Study of Hilti

    OpenAIRE

    Konečný, Martin

    2012-01-01

    The brand is mostly associated with business-to-customer markets and environment. People would first think of such a brand, because we see marketing and advertising of those brands every day. But business-to-business brands are for companies also very important. The overall goal of my thesis would be to find out how the managers of a pure B2B company perceive the importance of brand in the B2B environment where the company operates. Theoretical part will, in the first chapter, characterize B2...

  6. Efficient 266 nm Ultraviolet Beam Generation in K2Al2B2O7 Crystal

    Institute of Scientific and Technical Information of China (English)

    吕军华; 王桂玲; 许祖彦; 陈创天; 王继扬; 张承乾; 刘耀岗

    2002-01-01

    The ultraviolet beam at 266 nm was obtained by fourth harmonic generation of 1064 nm Nd:YAG laser radiation through a nonlinear crystal K2Al2 B2O7 (KABO). The fundamental frequency of a Hash-lamp pumped Nd: YAG laser was doubled in a β-Ba2B2O4 crystal to generate a second harmonic output at the wavelength of 532 nm,and then doubled again in the KABO crystal to generate the fourth harmonic output at 266 nm. The optical conversion efficiency from 532 to 266 nm was investigated for the first time, and 13% was achieved.

  7. Conocimiento del déficit Alfa1-antitripsina y de la discinesia ciliar primaria por estudiantes de medicina y profesionales sanitarios

    OpenAIRE

    Requena Fernández, MªÁngeles

    2015-01-01

    El déficit de alfa-1-antitripsina (DAAT) y la discinesia ciliar primaria (DCP), se engloban dentro de las enfermedades raras, siendo sin embargo trastornos genéticos y hereditarios con una prevalencia nada desdeñable. En ellas, el infradiagnóstico y el retraso diagnóstico son una constante y característica común. Dado que una de las posibles causas de este problema puede ser el bajo grado de conocimiento de ambas enfermedades por parte de los profesionales que atienden a este tipo de pac...

  8. Long-term outcome of hepatitis B e antigen-positive patients with compensated cirrhosis treated with interferon alfa. European Concerted Action on Viral Hepatitis (EUROHEP)

    DEFF Research Database (Denmark)

    Fattovich, G; Giustina, G; Realdi, G;

    1997-01-01

    The aim of this study was to evaluate whether interferon alfa (IFN-alpha) treatment-associated virological and biochemical remission improves survival in a cohort of 90 white patients with compensated cirrhosis caused by hepatitis B (Child A) followed for a mean period of 7 years. Inclusion...... criteria were biopsy-proven cirrhosis, hepatitis B e antigen (HBeAg) positivity, abnormal serum aminotransferase levels, exclusion of hepatitis delta virus, and absence of complications of cirrhosis. Of the 40 IFN-treated patients, 27 (67%) showed sustained HBeAg loss with alanine aminotransferase (ALT...

  9. Estudio de la utilidad clínica del perfil de estrés oxidativo en pacientes con déficit de alfa-1 antitripsina

    OpenAIRE

    Castillo Corullón, Silvia

    2016-01-01

    Introducción: Investigaciones recientes en modelos animales sugieren la participación del estrés oxidativo y el daño de oxidativo en la patogénesis del déficit de alfa 1 antitripsina (DAAT). Sin embargo, no hay datos disponibles sobre el estado de estrés oxidativo y la actividad de los enzimas antioxidantes en estos pacientes. Se sabe que el estrés oxidativo está implicado en la patogénesis de enfermedades en otros organismos (aterosclesosis, enfermedades neurodegenerativas, diabetes mel...

  10. Recommendations for the clinical practice: Standards, options and recommendations 2003 for the use of recombinant erythropoietin (alpha and beta epoetine, alpha darbepoetine, EPO) in the taking charge of anemia in oncology for the patients treated by radiotherapy, update; Recommandations pour la pratique clinique: Standards, Options et Recommandations 2003 pour l'utilisation de l'erythropoietine recombinante (epoetine alfa et beta, darbepoetine alfa, EPO) dans la prise en charge de l'anemie en cancerologie pour les patients traites par radiotherapie, mise a jour

    Energy Technology Data Exchange (ETDEWEB)

    Marchal, Ch. [Centre Alexis-Vautrin, oncologue-radiotherapeute, 54 - Nancy (France); Spaeth, C. [Centre Alexis-Vautrin, oncologue medical, 54 - Nancy (France); Casadevall, N. [Hopital Hotel-Dieu, hematologue, 75 - Paris (France); Daouphars, M. [Hopital Notre-Dame-de-Bon-Secours, pharmacien, 57 - Metz (France); Marec-Berard, P. [Centre Leon-Berard, oncologue-pediatre, 69 - Lyon (France); Fabre, N. [FNCLCC, methodologiste, 75 - Paris (France); Haugh, M. [FNCLCC, methodologiste, 75 - Paris (France)

    2004-06-01

    Standards, Options and Recommendations for the use of recombinant erythropoietin (epoietin alpha and beta darbepoietin alpha, EPO) in the management of anaemia in oncology for patient undergoing radiotherapy - UPDATE 2003. Context. - 'The Standards, Options and Recommendations' (SOR) project, started in 1993, is a collaboration between the Federation of French Cancer Centres (FNCLCC), the twenty French cancer centres, and specialists from French public universities, general hospitals and private clinics. The main objective is the development of clinical practice guidelines to improve the quality of health care and the outcome of cancer patients. The methodology is based on a literature review and critical appraisal by a multidisciplinary group of experts, with feedback from specialists in cancer care delivery. Objectives. - To update the Standards, Options and Recommendations clinical practice guidelines for the use of recombinant erythropoietin (epoietin alpha and beta darbepoietin-alpha, EPO) in the management of anaemia in oncology for patient undergoing radiotherapy. Methods. - The working group identified the questions requiring up-dating from the previous guideline. Medline and Embase were searched using specific search strategies from January 1999 to October 2002. Literature monitoring was performed to identify randomized clinical trials published between October 2002 to November 2003. In addition several Internet sites were searched in October 2002. Results. - There is no standard attitude for use of rHuEPO in patients undergoing radiotherapy. There is no evidence to support use of rHuEPO in patients with ENT cancer receiving radiotherapy alone. In patients undergoing curative radiotherapy, it is recommended to correct anaemia under 10 g/dL using transfusion rather than rHuEPO. When the haemoglobin concentration is between 12 g/dL and 14 g/dL initial use of rHuEPO can be an option under certain conditions for radio-chemotherapy if the risk of anaemia is high with the chemotherapy regimen used. Anemic patients should be included in clinical trials to clarify the impact of rHuEPO in terms of local control of the tumour and survival. (authors)

  11. Li4Ge2B as a new derivative of the Mo2B5 and Li5Sn2 structure types.

    Science.gov (United States)

    Pavlyuk, Volodymyr; Ciesielski, Wojciech; Rozdzynska-Kielbik, Beata; Dmytriv, Grygoriy; Ehrenberg, Helmut

    2016-07-01

    Binary and multicomponent intermetallic compounds based on lithium and p-elements of Groups III-V of the Periodic Table are useful as modern electrode materials in lithium-ion batteries. However, the interactions between the components in the Li-Ge-B ternary system have not been reported. The structure of tetralithium digermanium boride, Li4Ge2B, exhibits a new structure type, in the noncentrosymmetric space group R3m, in which all the Li, Ge and B atoms occupy sites with 3m symmetry. The title structure is closely related to the Mo2B5 and Li5Sn2 structure types, which crystallize in the centrosymmetric space group R-3m. All the atoms in the title structure are coordinated by rhombic dodecahedra (coordination number = 14), similar to the atoms in related structures. According to electronic structure calculations using the tight-binding-linear muffin-tin orbital-atomic spheres approximation (TB-LMTO-ASA) method, strong covalent Ge-Ge and Ge-B interactions were established.

  12. AlphaCI: un programa de cálculo de intervalos de confianza para el coeficiente alfa de Cronbach AlphaCI: a computer program for computing confidence intervals around Cronbach's alfa coefficient

    Directory of Open Access Journals (Sweden)

    Rubén Ledesma

    2004-06-01

    Full Text Available El coeficiente alfa de Cronbach es el modo más habitual de estimar la fiabilidad de pruebas basadas en Teoría Clásica de los Test. En dicha estimación, los investigadores usualmente omiten informar intervalos de confianza para el coeficiente, un aspecto no solo recomendado por los especialistas, sino también requerido explícitamente en las normas editoriales de algunas revistas especializadas. Esta situación puede atribuirse a que los métodos de estimación de intervalos de confianza son poco conocidos, además de no estar disponibles al usuario en los programas estadísticos más populares. Así, en este trabajo se presenta un programa desarrollado dentro del sistema estadístico ViSta que permite calcular intervalos de confianza basados en el enfoque clásico y mediante la técnica bootstrap. Se espera promover la inclusión de intervalos de confianza para medidas de fiabilidad, facilitando el acceso a las herramientas necesarias para su aplicación. El programa es gratuito y puede obtenerse enviando un mail de solicitud al autor del trabajo.Cronbach's alpha coefficient is the most popular way of estimating reliability in measurement scales based on Classic Test Theory. When estimating it, researchers usually omit to report confidence intervals of this coefficient, as it is not only recommended by experts, but also required by some journal's guidelines. This situation is because the different methods of estimating confidence intervals are not well-known by researchers, as well as they are not being available among the most popular statistical packages. Therefore, this paper describes a computer program integrated into the ViSta statistical system, which allows computing confidence intervals based on the classical approach and using bootstrap technique. It is hoped that this work promotes the inclusion of confidence intervals of reliability measures, by increasing the availability of the required computer tools. The program is free and

  13. CYP2B6*6 and CYP2B6*18 Predict Long-Term Efavirenz Exposure Measured in Hair Samples in HIV-Positive South African Women.

    Science.gov (United States)

    Röhrich, Carola R; Drögemöller, Britt I; Ikediobi, Ogechi; van der Merwe, Lize; Grobbelaar, Nelis; Wright, Galen E B; McGregor, Nathaniel; Warnich, Louise

    2016-06-01

    Long-term exposure to efavirenz (EFV) measured in hair samples may predict response to antiretroviral treatment (ART). Polymorphisms in CYP2B6 are known to alter EFV levels. The aim of this study was to assess the relationship between CYP2B6 genotype, EFV levels measured in hair, and virological outcomes on ART in a real-world setting. We measured EFV levels in hair from HIV-positive South African females who had been receiving EFV-based treatment for at least 3 months from the South African Black (SAB) (n = 81) and Cape Mixed Ancestry (CMA) (n = 53) populations. Common genetic variation in CYP2B6 was determined in 15 individuals from each population using bidirectional Sanger sequencing. Prioritized variants (n = 16) were subsequently genotyped in the entire patient cohort (n = 134). The predictive value of EFV levels in hair and selected variants in CYP2B6 on virological treatment outcomes was assessed. Previously described alleles (CYP2B6*2, CYP2B6*5, CYP2B6*6, CYP2B6*17, and CYP2B6*18), as well as two novel alleles (CYP2B6*31 and CYP2B6*32), were detected in this study. Compared to noncarriers, individuals homozygous for CYP2B6*6 had ∼109% increased EFV levels in hair (p = .016) and CYP2B6*18 heterozygotes demonstrated 82% higher EFV hair levels (p = .0006). This study confirmed that alleles affecting CYP2B6 metabolism and subsequent EFV exposure are present at significant frequencies in both the SAB and CMA populations. Furthermore, this study demonstrated that the use of hair samples for testing EFV concentrations may be a useful tool in determining long-term drug exposure in resource-limited countries.

  14. Late results of catheter-directed recombinant tissue plasminogen activator fibrinolytic therapy of iliofemoral deep venous thrombosis Resultados de longo prazo do tratamento fibrinolítico da trombose venosa iliacofemoral por infusão seletiva do ativador de plasminogênio tissular recombinante em baixas doses

    Directory of Open Access Journals (Sweden)

    Ivan Benaduce Casella

    2007-02-01

    Full Text Available PURPOSE: To evaluate the efficacy of catheter-directed low-dose recombinant tissue-type plasminogen activator infusion in the treatment of iliofemoral deep venous thrombosis and prevention of post-thrombotic syndrome. METHOD: Eighteen patients (out of 260 evaluated with acute iliofemoral deep venous thrombosis and no previous evidence of venous insufficiency were prospectively selected for thrombolytic therapy. Catheter-directed low-dose recombinant tissue-type plasminogen activator (1 mg/h was infused into the thrombotic segments. RESULTS: Effective fibrinolysis was achieved in 14 of 18 cases, with correlation between effective fibrinolysis and major/complete resolution of acute signs and symptoms (P OBJETIVOS: Avaliar a eficácia da infusão seletiva por cateter do ativador de plasminogênio tecidual recombinante em baixas doses no tratamento da trombose venosa iliacofemoral e na prevenção da síndrome pós-trombótica. MÉTODO: Dezoito pacientes (de 260 avaliados portadores de trombose venosa profunda iliacofemoral sem evidência prévia de insuficiência venosa foram selecionados para terapia fibrinolítica e submetidos a infusão seletiva por cateter do ativador de plasminogênio tecidual recombinante na dose de 1mg/dl nos segmentos venosos trombóticos. RESULTADOS: Quatorze pacientes apresentaram fibrinólise efetiva; observamos correlação entre o grau de melhora clínica observado e a redução percentual do volume trombótico (P<.01. Não houve episódios de complicações graves. Quatro pacientes apresentaram retrombose precoce (1 a 8 semanas. Os pacientes foram seguidos por um período de até 131 semanas (média 85.2. A incidência de sinais e sintomas clínicos de insuficiência venosa e os achados ecográficos de refluxo valvular foram significativamente menores nos pacientes em que a terapia fibrinolítica foi efetiva e a perviedade mantida ao longo do período de seguimento, na comparação com os casos de falha aguda ou de

  15. Burn wound angiogenesis is increased by exogenously administered recombinant leptin in rats A administração exógena de leptina recombinante induz à angiogênese em queimaduras cutâneas provocadas em ratos

    Directory of Open Access Journals (Sweden)

    Ioannis Liapakis

    2008-04-01

    differences in microvessel density between the seventh and the ninth postoperative day among different groups treated with leptin. All wounds from the control group, as well as those from animal groups treated with the combined injection of leptin and antileptin did not develop any new vessels. CONCLUSION: Exogenous administration of recombinant leptin increases early tissue angiogenesis in the burn wound level of an experimental animal model.INTRODUÇÃO: A leptina é um potente fator angiogênico que estimula a migração e a ativação de células endoteliais in vitro e a angiogênese in vivo. Além disso, a leptina tem sido considerada importante na angiogênese pois ela promove a formação de novos vasos sanguíneos. OBJETIVO: Investigar o efeito da leptina administrada por via exógena no processo de cicatrização em um modelo experimental de queimadura. MÉTODOS: Foram utilizados sessenta e três ratos Sprague-Dawley, machos. A lesão de espessura total da queimadura foi realizada por eletrocautério. O dano tecidual foi de 0.3 cm numa extensão de 2 cm tendo sido empregada o módulo de "corte"do eletrocautéio. Os ratos foram distribuídos em sete grupos de nove animais. As lesões por queimadura receberam leptina recombinante. Os animais foram sacrificados 3, 7 e 9 dias após o ato operatório. Obteve-se três animais de cada grupo nos três períodos estipulados. Três diferentes dosagens de leptina: 250 pg/ml, 500 pg/ml e 1000 pg/ml foram aplicados nos três diferentes grupos (A, B e C. Para cada uma das três dosagens de leptina, outro grupo de animais foi avaliado pelo uso de injeção combinada de leptina e antileptina (A1, B1 e C1 no sentido de investigar o efeito inibitório do fator leptina. Nove ratos serviram de controles. Estes foram submetidos à injeção de 0.3 ml de água e sacrificados nos mesmos intervalos de tempo. Após o sacrifício dos animais, o tegumento foi avaliado por sua aparência, cor e textura. Fragmentos das feridas queimadas foram

  16. Johnston Atoll Site 2B-P 6/30/2000 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 7 and 8 meters along a permanent transect.

  17. Johnston Atoll Site 2B-P 6/30/2000 24-25M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 24 and 25 meters along a permanent transect.

  18. Johnston Atoll Site 2B-P 6/30/2000 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 37 and 38 meters along a permanent transect.

  19. Johnston Atoll Site 2B-P 6/30/2000 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 38 and 39 meters along a permanent transect.

  20. MOLECULAR CLONING AND HETEROLOGOUS EXPRESSION OF HUMAN INTERFERON ALPHA2b GENE

    Directory of Open Access Journals (Sweden)

    I. Made Artika

    2013-01-01

    Full Text Available Human alpha Interferons (hIFNα have been shown to have antiviral, antiproliferative and immunomodulatory activities. The human interferon alpha2b (hIFNα2b, is one of the human interferon alpha2 sub variants, naturally synthesized as a polypeptide of 188 amino acid residues, the first 23 residues of which represents a signal peptide. In the present study, the hIFNα2b gene was expressed after being fused with Glutathione S-Transferase (GST gene. The hIFNα2b gene was amplified from human genomic DNA by using a pair of specific primers, cloned into an Escherichia coli expression vector and expressed in E. coli cells under the direction of the tac promoter. The expressed protein was purified using a one-step affinity chromatography column containing immobilized gluthatione-bound resin. The purified protein was shown to react specifically with anti-human-interferon-alpha antibody, confirming that the protein was the human interferon alpha molecule. This strategy has the potential to be used as an alternative mean for production of pure human interferon α proteins for therapeutic purposes and for further studies on their molecular characterization and mechanism of action.

  1. Johnston Atoll Site 2B-P 6/30/2000 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 10 and 11 meters along a permanent transect.

  2. Disruption of endocytic trafficking in frontotemporal dementia with CHMP2B mutations

    DEFF Research Database (Denmark)

    Urwin, Hazel; Authier, Astrid; Nielsen, Jørgen Erik

    2010-01-01

    ), an endosomal structure that fuses with the lysosome to degrade endocytosed proteins. We report a novel endosomal pathology in CHMP2B mutation-positive patient brains and also identify and characterize abnormal endosomes in patient fibroblasts. Functional studies demonstrate a specific disruption of endosome...

  3. An expedient and new synthesis of pyrrolo[1,2-b]pyridazine derivatives

    Directory of Open Access Journals (Sweden)

    Rajeshwar Reddy Sagyam

    2009-11-01

    Full Text Available The reaction of 2-[2-(4-fluorophenyl-2-oxo-1-phenylethyl]-4-methyl-3-oxo-pentanoic acid phenylamide with tertiary butyl carbazate and subsequent condensation of the resulting carbamate derivative with a chalcone provided a facile new approach to pyrrolo[1,2-b]pyridazine derivatives.

  4. New High-Pressure Gallium Borate Ga2B3O7(OH) with Photocatalytic Activity.

    Science.gov (United States)

    Vitzthum, Daniela; Schauperl, Michael; Strabler, Christof M; Brüggeller, Peter; Liedl, Klaus R; Griesser, Ulrich J; Huppertz, Hubert

    2016-01-19

    The new high-pressure gallium borate Ga2B3O7(OH) was synthesized in a Walker-type multianvil apparatus under high-pressure/high-temperature conditions of 10.5 GPa and 700 °C. For the system Ga-B-O-H, it is only the second known compound next to Ga9B18O33(OH)15·H3B3O6·H3BO3. The crystal structure of Ga2B3O7(OH) was determined by single-crystal X-ray diffraction data collected at room temperature. Ga2B3O7(OH) crystallizes in the orthorhombic space group Cmce (Z = 8) with the lattice parameters a = 1050.7(2) pm, b = 743.6(2) pm, c = 1077.3(2) pm, and V = 0.8417(3) nm(3). Vibrational spectroscopic methods (Raman and IR) were performed to confirm the presence of the hydroxyl group. Furthermore, the band gap of Ga2B3O7(OH) was estimated via quantum-mechanical density functional theory calculations. These results led to the assumption that our gallium borate could be a suitable substance to split water photocatalytically, which was tested experimentally.

  5. 14 CFR Special Federal Aviation... - Mitsubishi MU-2B Series Special Training, Experience, and Operating Requirements

    Science.gov (United States)

    2010-01-01

    .... You may inspect a copy at U.S. Department of Transportation, Docket Management Facility, Room W 12-140... checklists, procedures, and techniques found within this training program. The FAA's Mitsubishi MU-2B SFAR... classroom environment with the aid of a qualified instructor who meets the requirements of this SFAR....

  6. Designing the marketing-sales interface in B2B firms

    NARCIS (Netherlands)

    Biemans, W.G.; Makovec Brencic, M.

    2007-01-01

    Purpose - This paper explores the marketing-sales interface in Dutch and Slovenian B2B firms. Design/methodology/approach - The study included 11 Dutch firms and ten Slovenian firms, with both samples as closely matched as possible. The firms were all manufacturers of physical products that operate

  7. 76 FR 3451 - Wage Methodology for the Temporary Non-agricultural Employment H-2B Program

    Science.gov (United States)

    2011-01-19

    ... H- 2B program and the optional use of SCA and DBA wages. Comit de Apoyo a los Trabajadores Agricolas... business advocates, business associations, law firms, government agencies, including the Chief Counsel for the Office of Advocacy of the Small Business Association (Chief Counsel for Advocacy, SBA),\\3\\...

  8. genetic overexpression of NR2B subunit enhances social recognition memory for different strains and species.

    Directory of Open Access Journals (Sweden)

    Stephanie A Jacobs

    Full Text Available The ability to learn and remember conspecifics is essential for the establishment and maintenance of social groups. Many animals, including humans, primates and rodents, depend on stable social relationships for survival. Social learning and social recognition have become emerging areas of interest for neuroscientists but are still not well understood. It has been established that several hormones play a role in the modulation of social recognition including estrogen, oxytocin and arginine vasopression. Relatively few studies have investigated how social recognition might be improved or enhanced. In this study, we investigate the role of the NMDA receptor in social recognition memory, specifically the consequences of altering the ratio of the NR2B:NR2A subunits in the forebrain regions in social behavior. We produced transgenic mice in which the NR2B subunit of the NMDA receptor was overexpressed postnatally in the excitatory neurons of the forebrain areas including the cortex, amygdala and hippocampus. We investigated the ability of both our transgenic animals and their wild-type littermate to learn and remember juvenile conspecifics using both 1-hr and 24-hr memory tests. Our experiments show that the wild-type animals and NR2B transgenic mice preformed similarly in the 1-hr test. However, transgenic mice showed better performances in 24-hr tests of recognizing animals of a different strain or animals of a different species. We conclude that NR2B overexpression in the forebrain enhances social recognition memory for different strains and animal species.

  9. Hysteresis in the field-induced magnetic structure in TmNi2B2C

    DEFF Research Database (Denmark)

    Eskildsen, M.R.; Harada, K.; Gammel, P.L:

    1999-01-01

    Using small-angle neutron scattering we have studied the flux line lattice and the magnetic structure in TmNi2B2C. With an applied field parallel to the crystalline c-axis several magnetic and flux line lattice symmetry transitions have been reported. The subject of this paper is the held-induced...

  10. Johnston Atoll Site 2B-P 6/30/2000 4-5M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 4 and 5 meters along a permanent transect.

  11. Johnston Atoll Site 2B-P 6/30/2000 14-15M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 14 and 15 meters along a permanent transect.

  12. Johnston Atoll Site 2B-P 6/30/2000 8-9M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 8 and 9 meters along a permanent transect.

  13. Johnston Atoll Site 2B-P 6/30/2000 6-7M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 6 and 7 meters along a permanent transect.

  14. Johnston Atoll Site 2B-P 6/30/2000 13-14M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 13 and 14 meters along a permanent transect.

  15. Johnston Atoll Site 2B-P 6/30/2000 27-28M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 27 and 28 meters along a permanent transect.

  16. Johnston Atoll Site 2B-P 6/30/2000 29-30M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 29 and 30 meters along a permanent transect.

  17. Johnston Atoll Site 2B-P 6/30/2000 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 2 and 3 meters along a permanent transect.

  18. Johnston Atoll Site 2B-P 6/30/2000 33-34M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 33 and 34 meters along a permanent transect.

  19. Johnston Atoll Site 2B-P 6/30/2000 26-27M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 26 and 27 meters along a permanent transect.

  20. Johnston Atoll Site 2B-P 6/30/2000 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 11 and 12 meters along a permanent transect.