WorldWideScience

Sample records for alfa 2b humano

  1. Interferon Alfa-2b Injection

    Science.gov (United States)

    Interferon alfa-2b injection is used to treat a number of conditions.Interferon alfa-2b injection is used alone or in ... Hodgkin's lymphoma (NHL; a slow-growing blood cancer). Interferon alfa-2b is in a class of medications ...

  2. Establecimiento y validación de un ensayo inmunoenzimático tipo ELISA, empleado en el control de calidad del Interferón alfa 2b humano recombinante

    Directory of Open Access Journals (Sweden)

    Susset Valderrama

    2009-04-01

    Full Text Available Se estableció y validó un ELISA para la cuantificación del Interferón alfa 2b humano recombinante en el Ingrediente Farmacéutico Activo, definiéndose los criterios de validez del ensayo y basado en el cumplimiento de las Buenas Prácticas de Laboratorio. Se evaluaron los parámetros de: linealidad, especificidad, exactitud, rango, precisión y robustez. El ensayo establecido resultó específico, con una exactitud entre 84,3% y 102,4%, se demostró un ajuste cuadrático y un rango de trabajo entre 1 y 10 ng/mL; la repetibilidad y la precisión intermedia mostraron coeficientes de variación inferiores al 10% y 20% respectivamente, y se comprobó la robustez del método con respecto al efecto borde y la estabilidad de las soluciones.

  3. Psychiatric side effects of pegylated interferon alfa-2b as compared to conventional interferon alfa-2b in patients with chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    Michael R Kraus; Arne Sch(a)fer; Herbert Csef; Michael Scheurlen

    2005-01-01

    AIM: To assess systematically the spectrum and extent of depressive symptoms comparing patient groups receiving peginterferon or conventional interferon.METHODS: Ninety-eight patients with chronic hepatitis C and interferon-based therapy (+ribavirin) were consecutively enrolled in a longitudinal study. Patients were treated with conventional interferon alfa-2b (48/98patients; 5 MIU interferon alfa-2b thrice weekly) or peginterferon alfa-2b (50/98 patients; 80-150 μgpeginterferon alfa-2b) in combination with weight-adapted ribavirin (800-1 200 mg/d). Repeated psychometric testing was performed before, three times during and once after antiviral therapy: Depression was evaluated by the Hospital Anxiety and Depression Scale (HADS), anger/hostility by the Symptom Checklist-90 Items Revised (SCL-90-R).RESULTS: Therapy with pegylated interferon alfa-2bproduces comparable scores for depression (ANOVA:P = 0.875) as compared to conventional interferon.Maximums of depression scores were even higher and cases of clinically relevant depression were frequent during therapy with peginterferon. Scores for anger/hostility were comparable for both therapy subgroups.CONCLUSION: Our findings suggest that the extent and frequency of depressive symptoms in total are not reduced by peginterferon. Monitoring and management of neuropsychiatric toxicity especially depression have to be considered as much as in antiviral therapy with unmodified interferon.

  4. The efficacy and safety of double (cepeginterferon alfa-2b and ribavirin and triple (simeprevir, cepeginterferon alfa 2b and ribavirin treatment regimens in chronic hepatitis C patients. The experience of everyday clinical practice

    Directory of Open Access Journals (Sweden)

    N. P. Blokhina

    2016-01-01

    Full Text Available The objective. To evaluate the efficacy, safety and tolerability of double (cepeginterferon alfa-2b and ribavirin and triple (simeprevir, cepeginterferon alfa 2b and ribavirin treatment regimens in chronic hepatitis C patients in everyday clinical practice of the Hepatology Center in Clinical Infectious Diseases Hospital in Moscow.Materials and methods. From 2013 to 2015 a total of 289 patients with chronic hepatitis C received antiviral therapy with cepeginterferon alfa 2b. 267 patients received combination of cepeginterferon alfa 2b and ribavirin. 22 patients received triple antiviral therapy with simeprevir, cepeginterferon alfa 2b and ribavirin. Treatment efficacy was assessed by the rate of sustained virologic response on 12/24 week after completion of antiviral therapy (SVR 12/24. In safety analysis all 289 patients were included. All cases of deterioration of the patient’s condition and laboratory abnormalities were registered throughout the treatment period and follow up.Results. 267 patients (74,5%, n=199, with 2/3 genotype, 25,5%, n = 68, with 1 genotype received cepeginterferon alfa 2b 1,5 µg/kg/week and ribavirin 800-1400 daily (weight based. 22 patients with genotype 1 (the majority of them had advanced fibrosis (F3-F4 underwent triple therapy with simeprevir 150 mg once daily in combination with cepeginterferon alfa 2b 1,5 µg/kg/week and ribavirin 800-1400 mg daily (weight based for 12 weeks, followed by cepeginterferon alfa 2b/ ribavirin therapy for 12-36 weeks. SVR was observed in 85,6% (n=113 of genotype 2/3 infected patients and in 64,6% (n=31 of genotype 1 infected patients. Among patients with mild or moderate fibrosis SVR rate was 90,7% in genotype 2/3 patients and 75% in genotype 1 patients. 21 patient completed the course of triple therapy. SVR was observed in 71,4% (n=15 of patients. Registered adverse reactions were common for interferon/ribavirin based therapy. In most cases adverse events were moderate and matched

  5. Interferón alfa-2b tópico como primera opción en las neoplasias intraepiteliales corneoconjuntivales Topical interferon alfa-2b for primary treatment of conjunctiva-cornea intraepithelial neoplasia

    Directory of Open Access Journals (Sweden)

    M. Pérez de Arcelus

    2012-04-01

    Full Text Available Se describen dos casos de neoplasia intraepitlelial corneo-conjuntival (CIN tratados con interferón alfa-2b (IFN alfa-2b tópico como primera elección. El tratamiento clásico de los CIN ha sido tradicionalmente la resección completa con márgenes de seguridad seguida de crioterapia en el lecho quirúrgico. No obstante, y puesto que la tasa de recidivas puede alcanzar el 50% han sido propuestos coadyuvantes como la mitomicina C y el 5 fluoracilo, con el consiguiente riesgo de toxicidad corneal y límbica. El IFN alfa-2b presenta una eficacia similar a la cirugía en la erradicación completa de la masa tumoral como primera opción, con escasos efectos secundarios y nulo potencial carcinogénico, incluso en casos de recurrencia a terapia con mitomicina C, lesiones quirúrgicas residuales y formas difusas.We describe two cases of conjunctival-cornea intraepithelial neoplasia (CIN, treated with topical IFN alfa 2b. The traditional treatment for CIN is surgical excision usually with adjunctive cryotherapy. However, residual tumour may remain, which can lead to recurrence rates of more than 50%. 5-Fluorouracil, mitomicyn C and interferon alfa 2b are new pharmacological agents that have proved their efficacy in the treatment of CIN. As side effects are common, we present IFN alfa 2b as a single therapeutic agent as an effective and optimal treatment for presumed recurrent corneal and conjunctival intraepithelial neoplasia. It offers the benefits of topical therapy and avoids the risks of surgical or other interventions - specifically, ocular surface toxicity, cicatricial conjunctival changes, and limbal stem cell deficiency.

  6. Interferón alfa-2b tópico como primera opción en las neoplasias intraepiteliales corneoconjuntivales Topical interferon alfa-2b for primary treatment of conjunctiva-cornea intraepithelial neoplasia

    OpenAIRE

    M. Pérez de Arcelus; Aranguren, M.; J. Andonegui

    2012-01-01

    Se describen dos casos de neoplasia intraepitlelial corneo-conjuntival (CIN) tratados con interferón alfa-2b (IFN alfa-2b) tópico como primera elección. El tratamiento clásico de los CIN ha sido tradicionalmente la resección completa con márgenes de seguridad seguida de crioterapia en el lecho quirúrgico. No obstante, y puesto que la tasa de recidivas puede alcanzar el 50% han sido propuestos coadyuvantes como la mitomicina C y el 5 fluoracilo, con el consiguiente riesgo de toxicidad corneal ...

  7. A randomized controlled clinical study of lower-dose peginterferon alfa-2b in combination with ribavirin in the treatment of chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    罗端德

    2006-01-01

    Objective To compare the efficacy and safety of lower-dose peginterferon alfa-2b plus ribavirin versus standard interferon alfa-2b plus ribavirin for treatment of chronic hepatitis C in China. Methods 192 patients with chronic hepatitis C were assigned peginterferon alfa-2b 0.5μg/kg each week plus ribavirin 750~1050 mg/d or standard interferon alfa-2b 3 MIU TIW plus ribavirin 750~1050 mg/d for 48-week treatment and 24-week fellow

  8. Benefit of adjuvant interferon alfa-2b (IFN-α) therapy in melanoma patients with high serum MMP-8 levels

    DEFF Research Database (Denmark)

    Vihinen, Pia; Tervahartiala, Taina; Sorsa, Timo;

    2015-01-01

    Matrix metalloproteinases (MMPs) are important enzymes in tissue turnover and various inflammatory processes. In this study, it was evaluated whether serum MMP-8 can predict the response to adjuvant interferon alfa-2b (IFN-α) therapy in patients with operated high-risk cutaneous melanoma. Pre...

  9. Peg-Interferon Alfa 2-b Related Cellulitis in a 40 Years Man

    Directory of Open Access Journals (Sweden)

    Shahnaaz Sali

    2016-01-01

    Full Text Available Background: Pegylated interferon and ribavirin are currently one of the accepted treatment for chronic Hepatitis C. Dermatologic complications of interferon have been reported, but to date a few cases of bacterial cellulitis; a rare and severe complication, have been published. Cellulitis is a common infectious process affecting the skin and subcutaneous tissues which results in significant morbidity and holds considerable healthcare costs.Cases Report: Herein, we report a case of chronic hepatitis C genotype 1a who was on medication since 8 weeks prior to developing leg cellulitis, an uncommon pegylated interferon injection site. Considering no other possible risk factors were found to be in favor of bacterial cellulitis, our case is unique in its kind. Some reports reveal necrotizing vasculitis as basis for cutaneous lesions, which could be due to the high concentrations of drug at the injection site, a toxic effect of the diluents, or an immunological reaction.Conclusion: According to the latter mechanism patients could develop bacterial cellulitis in their different organs. Conclusively, we propose the hypothesis of a possible association between cellulitis to occur at any site as the complication of pegylated interferon Alfa 2b and would highlight the role of a careful skin examination that could be an asset in preventing local skin infections.

  10. Long-term results of the randomized phase III trial EORTC 18991 of adjuvant therapy with pegylated interferon alfa-2b versus observation in resected stage III melanoma

    NARCIS (Netherlands)

    A.M.M. Eggermont (Alexander); S. Suciu (Stefan); A. Testori (Alessandro); M. Santinami (Mario); W.H.J. Kruit (Wim); J. Marsden; C.J.A. Punt (Cornelis); F. Salès (François); R. Dummer (Reinhard); C. Robert (Caroline); D. Schadendorf (Dirk); P. Patel (Poulam); G. de Schaetzen (Gaetan); A. Spatz (Alan); U. Keilholz (Ulrich)

    2012-01-01

    textabstractPurpose: Adjuvant pegylated interferon alfa-2b (PEG-IFN-α-2b) was approved for treatment of resected stage III melanoma in 2011. Here, we present long-term follow-up results of this pivotal trial. Patients and Methods: In all, 1,256 patients with resected stage III melanoma were randomly

  11. Systemic lupus erythematosus following virological response to peginterferon alfa-2b in a transplanted patient with chronic hepatitis C recurrence

    Institute of Scientific and Technical Information of China (English)

    Francesca Lodato; Giuseppe Mazzella; Maria Rosa Tamé; Antonio Colecchia; Chiara Racchini; Francesco Azzaroli; Antonia D'Errico; Silvia Casanova; Antonio Pinna; Enrico Roda

    2006-01-01

    Autoimmune manifestations are common both in patients chronically infected by hepatitis C virus, and in patients transplanted for non-autoimmune diseases. A correlation between interferon based treatment and autoimmune diseases or the development of autoantibodies is well established in non-transplanted patients, but few data are available about transplanted patients. It is unclear whether interferon may increase the incidence of acute cellular rejection and there are few reports on the development of atypical autoimmune manifestations during post-liver transplantation interferon or pegylated interferon treatment. We describe a case of systemic lupus erythematosus following treatment with pegylated interferon alfa-2b in a transplanted patient with recurrence of chronic hepatitis C. Our experience suggest that pegylated interferon may induce autoimmune diseases in the immunosuppressed host, different from acute cellular rejection and call for a great attention to possible autoimmune disorders development during interferon based treatments in liver transplanted patients.

  12. Pegylated interferon alfa-2b alone or in combination with lamivudine for HBeAg-positive chronic hepatitis B : a randomised trial

    NARCIS (Netherlands)

    Janssen, Harry L A; van Zonneveld, Monika; Senturk, Hakan; Zeuzem, Stefan; Akarca, Ulus S; Cakaloglu, Yilmaz; Simon, Christopher; So, Thomas M K; Gerken, Guido; de Man, Robert A; Niesters, Hubert G M; Zondervan, Pieter; Hansen, Bettina; Schalm, Solko W

    2005-01-01

    BACKGROUND: Treatment of HBeAg-positive patients with chronic hepatitis B is not effective in most. A combination of immunomodulatory pegylated interferon alfa-2b and antiviral lamivudine might improve the rate of sustained response. METHODS: 307 HBeAg-positive patients with chronic hepatitis B were

  13. Reduction of circulating regulatory T cells by intravenous high-dose interferon alfa-2b treatment in melanoma patients.

    Science.gov (United States)

    Mozzillo, Nicola; Ascierto, Paolo

    2012-10-01

    High-dose interferon alfa-2b (IFNα-2b) is the only approved adjuvant systemic therapy for resected, high risk melanoma in the United States (Fecher and Flaherty, in Natl Compr Cancer Netw 7:295-304, 2009). Recently, two important meta-analyses of randomized trials (Wheatley et al., in J Clin Oncol, 2007; Mocellin et al. in J Natl Cancer Inst, 2010) investigating IFNα-2b versus observation in high risk melanoma patients, showed that adjuvant IFNα-2b has an impact both on relapse-free survival (RFS) and overall survival (OS) independently by dosage, duration and route compared with observation in high risk melanoma patients. Despite of an absolute benefits of 3 % (Wheatley et al., in J Clin Oncol, 2007), this treatment is associated with significant toxicity, which impacts on patient quality of life. A better understanding of the mechanism of action may help to potentiate the clinical efficacy and reduce the toxicity of IFNα-2b/Peg-IFNα-2b. Numerous studies suggest that interferon's mechanism of action in melanoma is primarily immunomodulatory (Table 1) (de La Salmoniere, in Clin Cancer Res 6:4713-4718, 2000; Stuckert, in J Clin Oncol 25:8506, 2007; Gogas et al., in N Engl J Med 354:709-718, 2006; Moschos et al., in J Clin Oncol 24:3164-3171, 2006; Ascierto and Kirkwood, in J Transl Med 6:62, 2008) Recent efforts to elucidate the mechanism of action for interferon have focused upon signal transducers and activators of transcription (STAT) (Simons et al., in J Transl Med 9:52, 2011) signaling and immunoregulatory responses mediated by regulatory T cells (Tregs) (Wang et al., in Clin Cancer Res 13:1523-1531, 2007; Clin Cancer Res 14:8314-8320, 2008). Tregs are a suppressive CD4+ T cell population that is present, along with primed effector T cells, in tumor and tumor-draining lymph nodes (Hiura et al. in J Immunol 175:5058-5066, 2005). Tregs express high levels of surface antigens such as CD25, cytotoxic T lymphocyte associated antigen 4 (CTLA-4), and

  14. Peginterferon alpha-2a is associated with higher sustained virological response than peginterferon alfa-2b in chronic hepatitis C: systematic review of randomized trials

    DEFF Research Database (Denmark)

    Awad, Tahany; Thorlund, Kristian; Hauser, Goran;

    2010-01-01

    A combination of weekly pegylated interferon (peginterferon) alpha and daily ribavirin represents the standard of care for the treatment of chronic hepatitis C according to current guidelines. It is not established which of the two licensed products (peginterferon alpha-2a or peginterferon alfa-2b......) is most effective. We performed a systematic review of head-to-head randomized trials to assess the benefits and harms of the two treatments. We searched the Cochrane Central Register of Controlled Trials, MEDLINE, EMBASE, and LILACS through July 2009. Using standardized forms, two reviewers independently......-2a is associated with higher SVR than peginterferon alfa-2b. However, the paucity of evidence on adverse events curbs the decision to definitively recommend one peginterferon over the other, because any potential benefit must outweigh the risk of harm....

  15. Health-related quality of life in patients with high-risk melanoma randomised in the Nordic phase 3 trial with adjuvant intermediate-dose interferon alfa-2b

    DEFF Research Database (Denmark)

    Brandberg, Y; Aamdal, S; Bastholt, Lars;

    2012-01-01

    To compare health-related quality of life (HRQoL) and side-effects in patients with high-risk melanoma participating in a randomised phase III trial of adjuvant interferon alfa-2b (IFN).......To compare health-related quality of life (HRQoL) and side-effects in patients with high-risk melanoma participating in a randomised phase III trial of adjuvant interferon alfa-2b (IFN)....

  16. Intensive Farmaco- Surveillance of Interferon Alpha 2b Recombinant in Multiple Sclerosis. Farmacovigilancia intensiva al interferón alfa 2b recombinante en la esclerosis múltiple.

    Directory of Open Access Journals (Sweden)

    Hailen Bobillo López

    recombinant was safe in the treatment of the multiple sclerosis in these patients.

     

    Fundamento: El interferón alfa 2b recombinante, de producción nacional, se utiliza en el tratamiento de diferentes enfermedades, entre ellas la esclerosis múltiple. Para su comercialización se necesita conocer su margen de seguridad. Objetivo: Evaluar las reacciones adversas del interferón alfa 2b recombinante en el tratamiento de la esclerosis múltiple. Método: Durante el período comprendido entre 1996 y 2006, se revisaron las 70 historias clínicas y cuadernos de recogida de datos de los pacientes incluidos en el ensayo clínico nacional, fase IV aleatorizado, a doble ciegas, desarrollado en la Clínica de Esclerosis Múltiple del Hospital ¨Dr. Gustavo Aldereguía Lima¨ de Cienfuegos. Con respecto al total de reacciones adversas manifestadas, se analizó tipo, tiempo de duración, empleo de tratamiento o no para contrarrestarlas, grado de intensidad (leve, moderada, grave o mortal y de causalidad (definitiva, probable, posible, condicional o no relacionada. Resultados: Del total de pacientes, 53 presentaron 207 reacciones adversas al interferón. Las más frecuentes fueron: fiebre, cefalea, escalofríos, artralgia, astenia y mialgia, siendo la mayoría efectos colaterales moderados y de carácter definitivo. En 197 pacientes el desenlace fue favorable. Conclusiones: El uso del interferón alfa 2β recombinante fue seguro en el tratamiento de la esclerosis múltiple en estos pacientes.

  17. Two different durations of adjuvant therapy with intermediate-dose interferon alfa-2b in patients with high-risk melanoma (Nordic IFN trial): a randomised phase 3 trial

    DEFF Research Database (Denmark)

    Hansson, Johan; Aamdal, Steinar; Bastholt, Lars;

    2011-01-01

    Adjuvant high-dose interferon alfa-2b improves relapse-free survival (RFS) in patients with high-risk melanoma, although benefits in overall survival are uncertain. Because of the toxic effects of high-dose regimens, intermediate doses are being explored. We investigated whether adjuvant therapy ...

  18. Ectoine and hydroxyectoine inhibit thermal-induced aggregation and increase thermostability of recombinant human interferon Alfa2b.

    Science.gov (United States)

    Salmannejad, Faranak; Nafissi-Varcheh, Nastaran

    2017-01-15

    This study is to investigate whether ectoines (ectoine and hydroxyectoine) can reduce aggregation of rhIFNα2b in aqueous solutions on thermal stress. The effect of thermal stress condition on the stability was therefore investigated using size exclusion-high performance liquid chromatography (SE-HPLC), different spectroscopic measurements, dynamic light scattering (DLS), electrophoresis, and differential scanning calorimetry (DSC). All experiments were performed in a sodium phosphate buffer system (100mM, pH7). The protein samples (100μg/ml) were incubated at 50°C for 14days in the absence or presence (1, 10, 20, and 100mM) of ectoines. In summary, thermal-induced aggregation was reduced in the presence of ectoines, regardless of the ectoines concentration in different periods of incubation time by analyzing with SE-HPLC and turbidity measurement. The inhibitory effect of ectoines on the aggregation was shown by other techniques used. The optimal ectoines concentration was 10mM for aggregation reduction, so samples containing of 10mM of ectoines were selected for further evaluation. Secondary structural and conformational stability increased in presence of ectoines as measured by far-UV circular dichroism and fluorescence spectroscopy, respectively. DSC showed slight increase in Tm of interferon in the presence of ectoines. Hydroxyectoine had superior protein-stabilizing properties than ectoine. In conclusion, this study demonstrates that ectoine and hydroxyectoine are highly effective excipients which can significantly reduce the thermal-induced aggregation of rhIFNα2b at low concentration.

  19. Methotrexate, Doxorubicin, and Cisplatin (MAP) Plus Maintenance Pegylated Interferon Alfa-2b Versus MAP Alone in Patients With Resectable High-Grade Osteosarcoma and Good Histologic Response to Preoperative MAP: First Results of the EURAMOS-1 Good Response Randomized Controlled Trial

    NARCIS (Netherlands)

    Bielack, S.S.; Smeland, S.; Whelan, J.S.; Marina, N.; Jovic, G.; Hook, J.M.; Krailo, M.D.; Gebhardt, M.; Papai, Z.; Meyer, J.; Nadel, H.; Randall, R.L.; Deffenbaugh, C.; Nagarajan, R.; Brennan, B.; Letson, G.D.; Teot, L.A.; Goorin, A.; Baumhoer, D.; Kager, L.; Werner, M.; Lau, C.C.; Hall, K.; Gelderblom, H.; Meyers, P.; Gorlick, R.; Windhager, R.; Helmke, K.; Eriksson, M.; Hoogerbrugge, P.M.; Schomberg, P.; Tunn, P.U.; Kuhne, T.; Jurgens, H.; Berg, H. van den; Bohling, T.; Picton, S.; Renard, M.; Reichardt, P.; Gerss, J.; Butterfass-Bahloul, T.; Morris, C.; Hogendoorn, P.C.; Seddon, B.; Calaminus, G.; Michelagnoli, M.; Dhooge, C.; Sydes, M.R.; Bernstein, M.

    2015-01-01

    PURPOSE: EURAMOS-1, an international randomized controlled trial, investigated maintenance therapy with pegylated interferon alfa-2b (IFN-alpha-2b) in patients whose osteosarcoma showed good histologic response (good response) to induction chemotherapy. PATIENTS AND METHODS: At diagnosis, patients a

  20. Polineuropatia desmielinizante inflamatória crônica pós-tratamento com interferon peguilado alfa 2b em um paciente co-infectado HIV/HCV: relato de caso Chronic inflammatory demyelinating polyneuropathy after treatment with pegylated interferon alpha 2b in a patient with HIV/HCV coinfection: case report

    Directory of Open Access Journals (Sweden)

    Bil Randerson Bassetti

    2010-02-01

    Full Text Available A polineuropatia desmielinizante inflamatória cônica possui forte associação com a infecção pelo HIV e HCV. Uma rara associação entre PDIC e o tratamento da hepatite C com interferon peguilado alfa foi descrita recentemente. Nós descrevemos o primeiro caso de polineuropatia desmielinizante inflamatória crônica em um paciente branco, sexo masculino infectado por HIV e HCV associado a interferon peguilado alfa 2b. O paciente recuperou-se completamente após o uso de imunoglobulina hiperimune endovenosa. Infectologistas e hapatologistas devem estar atentos à esta rara e grave associação, que exige imediata descontinuação da droga e tratamento precoce.Chronic inflammatory demyelinating polyneuropathy has a strong association with HIV and HCV infection. A rare association between chronic inflammatory demyelinating polyneuropathy and hepatitis C treatment with pegylated interferon alpha was described recently. We described the first case of chronic inflammatory demyelinating polyneuropathy associated with pegylated interferon alpha 2b in a white man infected with HIV and HCV. The patient recovered completely with the use of intravenous hyperimmune immunoglobulin. Infectologists and hepatologists should be alert regarding this rare and serious association, which requires immediately drug discontinuation and early treatment.

  1. Thalidomide with peginterferon alfa-2b and ribavirin in the treatment of non-responders genotype 1 chronic hepatitis C patients: proof of concept Talidomida, peginterferón alfa-2b y ribavirina en el tratamiento de pacientes no respondedores con hepatitis crónica C genotipo 1: estudio piloto

    Directory of Open Access Journals (Sweden)

    Benjamín Pardo-Yules

    2011-12-01

    Full Text Available Background: fewer than half of patients infected with hepatitis C virus (HCV achieve sustained viral clearance after peginterferon alfa/ribavirin (Peg-IFN/RBV therapy. Aims: thalidomide posses anti-inflammatory and immunomodulatory properties through inhibition of tumor necrosis factor and costimulatory effect on human CD8+ T cells. Methods: we started a prospective, open label trial of retreatment of very-difficult-to-treat genotype 1 chronic hepatitis C patients (CHC patients, who had failed to respond to the (Peg-IFN/RBV, with a triple therapy consisting in these same antivirals plus thalidomide 200 mg/day (the TRITAL study. Results: none of the eleven patients fulfilling the inclusion criteria and included in the trial reached complete early virological response or sustained virological response. Viral load decline after 12 weeks of triple therapy thalidomide-based retreatment did not differ from viral dynamics during the first course. The triple therapy was well tolerated and only one patient developed mild bilateral neuropathy. Conclusions: thalidomide addition to standard therapy is tolerated and did not increase the SVR rate in very-difficult-to-treat genotype 1 CHC patients. Different schedules are warranted to improve attempting retreatment of non responder CHC patients.Antecedentes: menos de la mitad de los pacientes con hepatitis C logra eliminar el virus de manera sostenida después de la terapia con peginterferón alfa y ribavirina (Peg-IFN/RBV. Objetivos: la talidomida posee propiedades antiinflamatorias e inmunomoduladoras a través de la inhibición del TNF-α y al efecto estimulador sobre las células T CD8+. Métodos: se inició un estudio prospectivo y abierto de re-tratamiento de pacientes con hepatitis crónica C genotipo 1, no respondedores al tratamiento con Peg-IFN/RBV, mediante triple terapia añadiendo a los mismos antivirales 200 mg/día de talidomida. Resultados: ninguno de los once pacientes que fueron incluidos en

  2. Peginterferon Alfa-2b Injection (Sylatron)

    Science.gov (United States)

    ... the arms, hands, legs, or feet cough rash hair loss Some side effects can be serious. If ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...

  3. Peginterferon Alfa-2b (PEG-Intron)

    Science.gov (United States)

    ... diarrhea constipation heartburn weight loss headache dizziness confusion hair loss or thinning itching difficulty concentrating feeling cold ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...

  4. The ALFA Trigger Simulator

    CERN Document Server

    Dziedzic B

    2015-01-01

    The paper presents basic information about ALFA detectors used in the ATLAS experiment, and the structure of currently developed device used to test a new ALFA trigger interface. It discusses the block diagram of the device, principle of its operation, implementation details and future plans for developing the Simulator.

  5. ALFA Detector Control System

    CERN Document Server

    Oleiro Seabra, Luis Filipe; The ATLAS collaboration

    2015-01-01

    ALFA (Absolute Luminosity For ATLAS) is one of the sub-detectors of ATLAS (A Toroidal LHC Apparatus). The ALFA system is composed by four stations installed in the LHC tunnel 240 m away from the ATLAS interaction point. Each station has a vacuum and ventilation system, movement control and all the required electronics for signal processing. The Detector Control System (DCS) provides control and monitoring of several components and ensures the safe operation of the detector contributing to good Data Quality. This paper describes the ALFA DCS system including a detector overview, operation aspects and hardware control through a SCADA system, WinCC OA.

  6. ALFA Detector Control System

    CERN Document Server

    Oleiro Seabra, Luis Filipe; The ATLAS collaboration

    2015-01-01

    ALFA (Absolute Luminosity For ATLAS) is one of the sub-detectors of ATLAS/LHC. The ALFA system is composed by two stations installed in the LHC tunnel 240 m away from each side of the ATLAS interaction point. Each station has a vacuum and ventilation system, movement control and all the required electronic for signal processing. The Detector Control System (DCS) provides control and monitoring of several components and ensures the safe operation of the detector contributing to good Data Quality. This paper describes the ALFA DCS system including a detector overview, operation aspects and hardware control through a SCADA system, WinCC OA.

  7. Epoetin Alfa Injection

    Science.gov (United States)

    ... a medication used to treat human immunodeficiency virus (HIV). Epoetin alfa injection is also used before and ... record book.If you are being treated with dialysis (treatment to remove waste from the blood when ...

  8. Recombinant Interferon Alfa-2b in Treating Patients With Melanoma

    Science.gov (United States)

    2016-05-17

    Stage IA Skin Melanoma; Stage IB Skin Melanoma; Stage IIA Skin Melanoma; Stage IIB Skin Melanoma; Stage IIC Skin Melanoma; Stage IIIA Skin Melanoma; Stage IIIB Skin Melanoma; Stage IIIC Skin Melanoma; Stage IV Skin Melanoma

  9. Southwest Oncology Group S0008: A Phase III Trial of High-Dose Interferon Alfa-2b Versus Cisplatin, Vinblastine, and Dacarbazine, Plus Interleukin-2 and Interferon in Patients With High-Risk Melanoma—An Intergroup Study of Cancer and Leukemia Group B, Children's Oncology Group, Eastern Cooperative Oncology Group, and Southwest Oncology Group

    Science.gov (United States)

    Flaherty, Lawrence E.; Othus, Megan; Atkins, Michael B.; Tuthill, Ralph J.; Thompson, John A.; Vetto, John T.; Haluska, Frank G.; Pappo, Alberto S.; Sosman, Jeffrey A.; Redman, Bruce G.; Moon, James; Ribas, Antoni; Kirkwood, John M.; Sondak, Vernon K.

    2014-01-01

    Purpose High-dose interferon (IFN) for 1 year (HDI) is the US Food and Drug Administration–approved adjuvant therapy for patients with high-risk melanoma. Efforts to modify IFN dose and schedule have not improved efficacy. We sought to determine whether a shorter course of biochemotherapy would be more effective. Patients and Methods S0008 (S0008: Chemotherapy Plus Biological Therapy in Treating Patients With Melanoma) was an Intergroup phase III trial that enrolled high-risk patients (stage IIIA-N2a through IIIC-N3), randomly assigning them to receive either HDI or biochemotherapy consisting of dacarbazine, cisplatin, vinblastine, interleukin-2, IFN alfa-2b (IFN-α-2b) and granulocyte colony-stimulating factor given every 21 days for three cycles. Coprimary end points were relapse-free survival (RFS) and overall survival (OS). Results In all, 432 patients were enrolled. Grade 3 and 4 adverse events occurred in 57% and 7% of HDI patients and 36% and 40% of biochemotherapy patients, respectively. At a median follow-up of 7.2 years, biochemotherapy improved RFS (hazard ratio [HR], 0.75; 95% CI, 0.58 to 0.97; P = .015), with a median RFS of 4.0 years (95% CI, 1.9 years to not reached [NR]) versus 1.9 years for HDI (95% CI, 1.2 to 2.8 years) and a 5-year RFS of 48% versus 39%. Median OS was not different (HR, 0.98; 95% CI, 0.74 to 1.31; P = .55), with a median OS of 9.9 years (95% CI, 4.62 years to NR) for biochemotherapy versus 6.7 years (95% CI, 4.5 years to NR) for HDI and a 5-year OS of 56% for both arms. Conclusion Biochemotherapy is a shorter, alternative adjuvant treatment for patients with high-risk melanoma that provides statistically significant improvement in RFS but no difference in OS and more toxicity compared with HDI. PMID:25332243

  10. Elosulfase alfa: first global approval.

    Science.gov (United States)

    Sanford, Mark; Lo, Jin Han

    2014-04-01

    Elosulfase alfa (Vimizim™) is a recombinant form of N-acetylgalactosamine-6-sulfatase (GALNS) that was developed by BioMarin Pharmaceutical Inc. as an enzyme replacement therapy for patients with mucopolysaccharidosis type IVA (MPS IVA), also known as Morquio A syndrome. Patients with MPS IVA have a GALNS deficiency, which results in serious musculoskeletal, cardiorespiratory and other system disturbances. Elosulfase alfa was approved by the US FDA on 14 February 2014 for the treatment of MPS IVA. The European Medicines Agency Committee for Medicinal Products for Human Use (CHMP) has recently recommended that elosulfase alfa be approved for use in the EU in the same indication. Within the last year, the manufacturer has also filed applications for approval for the use of elosulfase alfa in MPS IVA in Brazil, Australia, Canada and Mexico. This article summarizes the milestones in the development of elosulfase alfa leading to its first global approval in MPS IVA.

  11. ALFA beam halo

    CERN Document Server

    Komarek, Tomas

    2014-01-01

    This note serves as a final report about CERN Summer Student Programme 2014 project. The beam halo is an undesired phenomenon for physics analyses on particle accelerators. It surrounds the beam core and constitutes an important part of background for signal measurements on some detectors, eg. in the forward region. In this study, the data from the ALFA detector were used, specifically from the run 191373 ($\\beta^*=90\\unit{m}$) and the run 213268 ($\\beta^*=1\\unit{km}$). Using the ROOT framework, a software for beam halo events selection was created and beam halo properties were examined. In the run 213268, excessive beam halo is suspected to be the reason for multiple beam scrapings that occurred. A kinematic reconstruction of beam halo particles is attempted in order to understand beam halo properties in the interaction point. Some further simulations are employed to find constraints for beam halo particles in order to survive in the accelerator for a longer time/many revolutions. This work represents a st...

  12. ALFA detector upgrade before LHC Run 2

    CERN Document Server

    Vorobel, Vit; The ATLAS collaboration

    2016-01-01

    The operation experience with ATLAS ALFA detectors in the LHC environment during the Run1 period has shown significant beam-induced heating. Subsequent comprehensive studies revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosities in the LHC Run2. During the first LHC long shutdown (LS1) all ALFA detectors have been removed from the LHC tunnel and their covers - Roman Pots - underwent a geometry upgrade to minimize the impedance losses. It will be shown that this modification together with a system improving the internal heat transfer and an air cooling system, significantly shifted the temperatures of ALFA detectors away from the critical limits throughout the LHC Run2. Also ALFA trigger system was considerably upgraded to keep measured data safely inside the Run2 ATLAS latency budget and to minimize dead time. The needed hardware changes of the trigger system will be presented in the second part of the talk.

  13. "Alfa" i "Võmpel" bez maski / Andrei Sharov

    Index Scriptorium Estoniae

    Sharov, Andrei

    2004-01-01

    Venemaa FSB keskuse, mille koosseisu kuuluvad ka eriüksused Alfa ja Võmpel, töötajad osalevad terroristide neutraliseerimise ja pantvangide vabastamise erioperatsioonides. Intervjuu keskuse staabi uue juhiga

  14. ALFA detector before LHC Run 2

    CERN Document Server

    Vorobel, Vit; The ATLAS collaboration

    2016-01-01

    The operation experience with ATLAS ALFA detectors in the LHC environment during the Run1 period has shown significant beam-induced heating. Subsequent comprehensive studies revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosities in the LHC Run2. During the first LHC long shutdown (LS1) all ALFA detectors have been removed from the LHC tunnel and their covers - Roman Pots - underwent a geometry upgrade to minimize the impedance losses. It will be shown that this modification together with a system improving the internal heat transfer and an air cooling system, significantly shifted the temperatures of ALFA detectors away from the critical limits throughout the LHC Run2. Also ALFA trigger system was considerably upgraded to keep measured data safely inside the Run2 ATLAS latency budget and to minimize dead time. The needed hardware changes of the trigger system are also described

  15. B2B marketing

    OpenAIRE

    Pospíšilová, Lucie

    2010-01-01

    The main goal of this bachelor thesis is to apply theoretical knowledge in B2B marketing to the example of marketing processes in a particular company, to evaluate the current situation of its activities with regard to B2B principles and to suggest relevant recommendations. The theoretical part focuses on specific characteristics of B2B marketing, describes its differences from marketing on consumer markets, deals with buying behaviour of organizations and specifies particular features of mar...

  16. Administration of follitropin alfa and lutropin alfa combined in a single injection: a feasibility assessment

    Directory of Open Access Journals (Sweden)

    Agostinetto Rita

    2009-05-01

    Full Text Available Abstract Background Gonadotrophins are routinely administered in assisted reproductive technology (ART treatment protocols. Recombinant human follicle-stimulating hormone (r-hFSH; follitropin alfa and recombinant human luteinizing hormone (r-hLH; lutropin alfa can be administered individually or in a fixed combination. The ability to vary the FSH to LH dose ratio in a single injection without compromising the bioactivity of either gonadotrophin or generating losses of active principle is important for physicians and patients alike. Methods This study investigated whether follitropin alfa (GONAL-f (R, as lyophilized powder for reconstitution or solution from the GONAL-f (R (filled-by-mass [FbM] Prefilled Pen, could be used to reconstitute Pergoveris TM (follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder. In Ratio Groups 1 and 2, the r-hFSH:r-hLH ratio was 3:1; in Ratio Groups 3 and 4, the ratios of r-hFSH:r-hLH were 5:1 and 8:1, respectively. The protein content and bioactivity of each mixed solution were evaluated. The r-hFSH and r-hLH content was determined using reverse-phase high performance liquid chromatography. The biological activity of r-hFSH and r-hLH was assessed using the Steelman-Pohley and Van Hell in vivo bioassays in rats, respectively. Results Follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder could be successfully mixed with follitropin alfa 75 IU FbM solution that was either reconstituted from lyophilized powder or injected directly from the prefilled pen to create solutions with ratios of r-hFSH and r-hLH from 3:1 to 8:1. The measured content of r-hFSH and r-hLH corresponded favourably with the target protein content in Ratio Groups 1–4. The in vivo target and measured bioactivity of r-hFSH and r-hLH were also closely matched in all Ratio Groups. Conclusion Follitropin alfa lyophilized powder or solution can be accurately mixed with follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder to

  17. Interferon alfa with or without ribavirin for chronic hepatitis C

    DEFF Research Database (Denmark)

    Kjaergard, L L; Krogsgaard, K; Gluud, C

    2001-01-01

    To assess the efficacy and safety of interferon alfa with or without ribavirin for treatment of chronic hepatitis C.......To assess the efficacy and safety of interferon alfa with or without ribavirin for treatment of chronic hepatitis C....

  18. Interferon-alfa treatment of facial infantile haemangiomas

    DEFF Research Database (Denmark)

    Fledelius, Hans C.; Illum, N.; Jensen, H.;

    2001-01-01

    ophthalmology, haemangiomas of the face, infancy, Interferon alfa, eye at risk, amblyopia, induced refractive change, ultrasound imaging......ophthalmology, haemangiomas of the face, infancy, Interferon alfa, eye at risk, amblyopia, induced refractive change, ultrasound imaging...

  19. ALFA: an automated line fitting algorithm

    CERN Document Server

    Wesson, Roger

    2015-01-01

    I present the Automated Line Fitting Algorithm, ALFA, a new code which can fit emission line spectra of arbitrary wavelength coverage and resolution, fully automatically. In contrast to traditional emission line fitting methods which require the identification of spectral features suspected to be emission lines, ALFA instead uses a list of lines which are expected to be present to construct a synthetic spectrum. The parameters used to construct the synthetic spectrum are optimised by means of a genetic algorithm. Uncertainties are estimated using the noise structure of the residuals. An emission line spectrum containing several hundred lines can be fitted in a few seconds using a single processor of a typical contemporary desktop or laptop PC. I show that the results are in excellent agreement with those measured manually for a number of spectra. Where discrepancies exist, the manually measured fluxes are found to be less accurate than those returned by ALFA. Together with the code NEAT (Wesson et al. 2012), ...

  20. Fit 2-B FATHERS.

    Science.gov (United States)

    Maiorano, Joseph J.

    2001-01-01

    Fit 2-B FATHERS is a parenting-skills education program for incarcerated adult males. The goals of this program are for participants to have reduced recidivism rates and a reduced risk of their children acquiring criminal records. These goals are accomplished by helping participants become physically, practically, and socially fit for the demands…

  1. Asfotase alfa therapy for children with hypophosphatasia

    Science.gov (United States)

    Madson, Katherine L.; Phillips, Dawn; Reeves, Amy L.; McAlister, William H.; Yakimoski, Amy; Mack, Karen E.; Hamilton, Kim; Kagan, Kori; Fujita, Kenji P.; Thompson, David D.; Moseley, Scott; Odrljin, Tatjana; Rockman-Greenberg, Cheryl

    2016-01-01

    Background. Hypophosphatasia (HPP) is caused by loss-of-function mutation(s) of the gene that encodes the tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). Consequently, cell-surface deficiency of TNSALP phosphohydrolase activity leads to extracellular accumulation of inorganic pyrophosphate, a natural substrate of TNSALP and inhibitor of mineralization. Children with HPP can manifest rickets, skeletal pain, deformity, fracture, muscle weakness, and premature deciduous tooth loss. Asfotase alfa is a recombinant, bone-targeted, human TNSALP injected s.c. to treat HPP. In 2012, we detailed the 1-year efficacy of asfotase alfa therapy for the life-threatening perinatal and infantile forms of HPP. Methods. Here, we evaluated the efficacy and safety of asfotase alfa treatment administered to children 6–12 years of age at baseline who were substantially impaired by HPP. Two radiographic scales quantitated HPP skeletal disease, including comparisons to serial radiographs from similarly affected historical control patients. Results. Twelve children receiving treatment were studied for 5 years. The 6-month primary endpoint was met, showing significant radiographic improvement. Additional significant improvements included patient growth, strength, motor function, agility, and quality of life, which for most patients meant achieving normal values for age- and sex-matched peers that were sustained at 5 years of treatment. For most, pain and disability resolved. Mild to moderate injection-site reactions were common and were sometimes associated with lipohypertrophy. Low anti–asfotase alfa antibody titers were noted in all patients. No evidence emerged for clinically important ectopic calcification or treatment resistance. Conclusions. Asfotase alfa enzyme replacement therapy has substantial and sustained efficacy with a good safety profile for children suffering from HPP. Trial Registration. ClinicalTrials.gov NCT00952484 (https://clinicaltrials.gov/ct2/show

  2. Asfotase alfa therapy for children with hypophosphatasia.

    Science.gov (United States)

    Whyte, Michael P; Madson, Katherine L; Phillips, Dawn; Reeves, Amy L; McAlister, William H; Yakimoski, Amy; Mack, Karen E; Hamilton, Kim; Kagan, Kori; Fujita, Kenji P; Thompson, David D; Moseley, Scott; Odrljin, Tatjana; Rockman-Greenberg, Cheryl

    2016-06-16

    Background. Hypophosphatasia (HPP) is caused by loss-of-function mutation(s) of the gene that encodes the tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). Consequently, cell-surface deficiency of TNSALP phosphohydrolase activity leads to extracellular accumulation of inorganic pyrophosphate, a natural substrate of TNSALP and inhibitor of mineralization. Children with HPP can manifest rickets, skeletal pain, deformity, fracture, muscle weakness, and premature deciduous tooth loss. Asfotase alfa is a recombinant, bone-targeted, human TNSALP injected s.c. to treat HPP. In 2012, we detailed the 1-year efficacy of asfotase alfa therapy for the life-threatening perinatal and infantile forms of HPP. Methods. Here, we evaluated the efficacy and safety of asfotase alfa treatment administered to children 6-12 years of age at baseline who were substantially impaired by HPP. Two radiographic scales quantitated HPP skeletal disease, including comparisons to serial radiographs from similarly affected historical control patients. Results. Twelve children receiving treatment were studied for 5 years. The 6-month primary endpoint was met, showing significant radiographic improvement. Additional significant improvements included patient growth, strength, motor function, agility, and quality of life, which for most patients meant achieving normal values for age- and sex-matched peers that were sustained at 5 years of treatment. For most, pain and disability resolved. Mild to moderate injection-site reactions were common and were sometimes associated with lipohypertrophy. Low anti-asfotase alfa antibody titers were noted in all patients. No evidence emerged for clinically important ectopic calcification or treatment resistance. Conclusions. Asfotase alfa enzyme replacement therapy has substantial and sustained efficacy with a good safety profile for children suffering from HPP. Trial Registration. ClinicalTrials.gov NCT00952484 (https://clinicaltrials.gov/ct2/show

  3. los Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Luciano Barp Fontana

    2005-01-01

    Full Text Available Una declaración universal de los derechos humanos es incompleta si se reduce a un conjunto de recomendaciones para que cada persona y cada organismo de la sociedad se esfuerce para promover, mediante la enseñanza y la educación, el respeto a una serie de valores y de derechos ligados a la dignidad humana. Así se va depauperando la expresión “derechos humanos”, que actualmente tiende a confundirse con unas instancias en las que pueden frustrarse frecuentemente las esperanzas de quien busca justicia. Para que una declaración sea completa es necesario fundamentarla en la constitución universal humana. Solamente así quedará asegurada y garantizada su inviolabilidad. En efecto, la primera violación a los derechos humanos consiste en descuidar el deber urgente de aclarar la respuesta a la pregunta “¿qué es el ser humano?” De hecho, el tema de los derechos humanos debe ser fundamentalmente ontológico-antropológico. De la postura antropológica derivará el tema axiológico de la dignidad del ser humano. De la postura axiológica brotará el tema deontológico del deber ser del ser humano. Finalmente, de la postura deontológica derivará el tema jurídico de los derechos humanos de todos los humanos. Brevemente. El punto de partida es necesariamente el ser. El segundo paso es el ser humano. El tercer paso es el valor (dignidad del ser humano. El cuarto paso será el deber ser del ser humano. La fundamentación de los derechos humanos que proponemos en este artículo consiste en un proceso dinámico-histórico de una humanización concebida y realizada como una liberación de cada hombre y de todos los hombres, sin concesiones a posturas totalitarias que devalúan el valor del individuo, o bien a posturas liberales que no respetan la igualdad de todos los grupos humanos. En realidad, cada persona goza de los mismos derechos humanos, no por un beneficio concedido por una cierta clase social o por el Estado, sino precisamente por la

  4. Arecibo Pulsar and Transient Surveys Using ALFA

    Science.gov (United States)

    Cordes, J. M.

    2008-02-01

    A large scale survey for pulsars and transients is being conducted at the Arecibo Observatory using the Arecibo L-band Feed Array (ALFA). Data acquisition so far has been with correlation spectrometers that analyze a 0.1 GHz bandwidth at 1.4 GHz. The 256 frequency channels limit dispersion smearing to 1.2 ms at DMmax = 103 pc cm-3 while the sampling interval of 64 μs equals the dispersion smearing at DM~54 pc cm-3, providing high sensitivity to millisecond pulsars with standard periods out to implied distances of several kpc at low Galactic latitudes. In early 2008, we will use a new set of polyphase filter bank systems that provide the same time and frequency resolutions but over ALFA's full 0.3 GHz bandwidth. Currently the survey covers sky positions within 5° of the Galactic plane that are reachable with Arecibo. Preliminary results are given for some of the discoveries made so far, which include millisecond pulsars, a relativistic binary pulsar, a likely counterpart of a Compton GRO/EGRET gamma-ray source, and transient pulsars (including `RRATs''). We discuss the methodology of the survey, which includes archival of raw survey data at the Cornell Center for Advanced Computing and processing at distributed sites. The survey and follow up observations, which include timing observations, multiwavelength searches for orbital companions in the case of binary pulsars, etc. are organized through the Pulsar-ALFA (PALFA) Consortium. We expect the Galactic plane survey to continue until at least 2010, most likely involving multiple passes on each sky position to optimize detection of variable sources. The ALFA system will also be used to survey intermediate Galactic latitudes for millisecond pulsars, relativistic binaries with large systemic velocities, and runaway pulsars that will escape the Galaxy.

  5. Measurement of elastic scattering with ALFA

    CERN Document Server

    Jakobsen, S; The ATLAS collaboration

    2012-01-01

    The principal of ALFA is presented and then a detailed description of the detector, installation, triggering and beam based alignment. All this was needed in 2011 before the special optics runs with beta* = 90 m which was used for measuring elastic scattering. The first analysis steps of seeing tack patterns, making a global alignment of the detectors and finding correlations are presented. The plans for upcoming runs in 2012 are briefly discussed.

  6. Microbioma oral humano

    OpenAIRE

    Silva, Joana Pinto Oliveira e

    2016-01-01

    O microbioma oral humano é constituído por um vasto conjunto de microrganismos presentes na cavidade oral. Analisando a cavidade oral podemos verificar que nela existem mais de 700 espécies de bactérias responsáveis pelo domínio de parte do microbioma humano, tornando-a um importante local de estudo. É um dos habitats com maior diversidade no corpo humano onde esses microrganismos se apresentam de forma organizada e estruturada. Estes habitats estão intimamente relacionados ...

  7. Analysis of the trigger system of the ALFA detectors

    CERN Document Server

    Guerrero Llorente, Alonso

    2015-01-01

    During the CERN Summer Student Programme 2015 two different projects were carried out. Both related with the ALFA subdetector in ATLAS and its trigger system. The frst, and main, project aimed to do an study of the trigger effciency of the ALFA detector at $\\sqrt{s}=8 TeV$ and $\\beta^* = 90m$. The results can be found fully explained in the ATLAS note: "Trigger effciency for the ALFA detector at $\\sqrt{s}=8 TeV$ and $\\beta^* = 90m$". A secondary task consisted on systematical tests of new chips for an update of the ALFA trigger system.

  8. The ALFA ZOA Deep Survey: First Results

    Science.gov (United States)

    McIntyre, T. P.; Henning, P. A.; Minchin, R. F.; Momjian, E.; Butcher, Z.

    2015-07-01

    The Arecibo L-band Feed Array Zone of Avoidance (ALFA ZOA) Deep Survey is the deepest and most sensitive blind H i survey undertaken in the ZOA. ALFA ZOA Deep will cover about 300 square degrees of sky behind the Galactic Plane in both the inner (30^\\circ ≤slant l≤slant 75^\\circ ;b≤slant | 2^\\circ | ) and outer (175^\\circ ≤slant l≤slant 207^\\circ ;-2^\\circ ≤slant b≤slant +1^\\circ ) Galaxy, using the Arecibo Radio Telescope. First results from the survey have found 61 galaxies within a 15 square degree area centered on l=192^\\circ and b = -2°. The survey reached its expected sensitivity of rms = 1 mJy at 9 km s-1 channel resolution, and is shown to be complete above integrated flux, FHi = 0.5 Jy km s-1. The positional accuracy of the survey is 28″ and detections are found out to a recessional velocity of nearly 19,000 km s-1. The survey confirms the extent of the Orion and Abell 539 clusters behind the plane of the Milky Way and discovers expansive voids, at 10,000 and 18,000 km s-1. Twenty-six detections (43%) have a counterpart in the literature, but only two of these have known redshifts. Counterparts are 20% less common beyond vhel = 10,000 km s-1 and 33% less common at extinctions higher than AB = 3.5 mag. The ALFA ZOA Deep survey is able to probe large scale structure beyond redshifts that even the most modern wide-angle surveys have been able to detect in the ZOA at any wavelength.

  9. Stock footage ATLAS-ALFA experiment September 2016

    CERN Multimedia

    2016-01-01

    Stock footage of the ATLAS- ALFA subdetector in the LHC tunnel at IP1 taken during the LHC technical shut-down in September 2016. The ATLAS/ALFA experiment and studies the elastic scattering of protons, which are not observable in normal operation runs. In the elastic scattering process, the two protons survive their encounter intact and only change directions by exchanging momentum.

  10. The ALFA ZOA Deep Survey: First Results

    CERN Document Server

    McIntyre, Travis P; Minchin, Robert F; Momjian, Emmanuel; Butcher, Zhon

    2015-01-01

    The Arecibo L-Band Feed Array Zone of Avoidance (ALFA ZOA) Deep Survey is the deepest and most sensitive blind Hi survey undertaken in the ZOA. ALFA ZOA Deep will cover about 300 square degrees of sky behind the Galactic plane in both the inner (30 deg < l < 75 deg; b < |2 deg|) and outer (175 deg < l < 207 deg; -2 deg < b < +1 deg) Galaxy, using the Arecibo Radio Telescope. First results from the survey have found 61 galaxies within a 15 square degree area centered on l = 192 deg and b = -2 deg. The survey reached its expected sensitivity of rms = 1 mJy at 9 km/s channel resolution, and is shown to be complete above integrated flux, F_HI = 0.5 Jy km/s. The positional accuracy of the survey is 28 arcsec and detections are found out to a recessional velocity of nearly 19,000 km/s. The survey confirms the extent of the Orion and Abell 539 clusters behind the plane of the Milky Way and discovers expansive voids, at 10,000 km/s and 18,000 km/s. 26 detections (43%) have a counterpart in the li...

  11. Sequential combination of glucocorticosteroids and alfa interferon versus alfa interferon alone for HBeAg-positive chronic hepatitis B

    DEFF Research Database (Denmark)

    Mellerup, M T; Krogsgaard, K; Mathurin, P;

    2002-01-01

    Chronic hepatitis B has serious effects on morbidity and mortality. Alfa interferon has been shown to increase the rates of HBeAg-clearance as well as seroconversion to anti-HBe, but response rates are unsatisfactory. Glucocorticosteroid pretreatment may increase the response to alfa interferon....

  12. Sequential combination of glucocorticosteroids and alfa interferon versus alfa interferon alone chronic hepatitis B. Protocol for a Cochrane Review

    DEFF Research Database (Denmark)

    Mellerup, M T; Krogsgaard, K; Mathurin, P;

    2000-01-01

    Chronic hepatitis B has serious effects on morbidity and mortality. Alfa interferon has been shown to increase the rates of HBeAg-clearance as well as seroconversion to anti-HBe, but response rates are unsatisfactory. Glucocorticosteroid pretreatment may increase the response to alfa interferon....

  13. Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Liliana Galdámez Zelada

    2006-01-01

    Full Text Available La prohibición internacional de la tortura y los tratos o penas crueles inhumanos o degradantes plantea diversas dificultades desde el punto de vista de la definición y alcance de la prohibición. El trabajo jurisprudencial de los tribunales internacionales de derechos humanos ha contribuido a delimitar las nociones de tortura y los otros tratos y ha fortalecido el carácter absoluto de la prohibición, ha jugado en ello un rol fundamental el carácter progresivo del Derecho Internacional de los derechos humanos. El presente trabajo analiza los criterios jurisprudenciales aplicados por la Corte Interamericana de Derechos Humanos entre 1989 y 2006 para delimitar el alcance de la prohibición de la tortura y los otros tratos.

  14. Historia del genoma humano

    OpenAIRE

    Castaño Valencia, Óscar

    2006-01-01

    En 1990 el Doctor Charles de Lisi presentó el proyecto del GENOMA HUMANO en asocio del Instituto de Salud Americano, el Instituto Whithead de Cambridge, la Universidad de Washingtong, el Colegio Médico de Baylor y el Instituto del Genoma Humano, de California.Estos organismos han venido actuando desde esa época, contando con la financiación de los gobiernos del Japón, Alemania, Francia, China y naturalmente del americano.En sus fases iniciales fue orientado por el Dr. James Watson quien contó...

  15. Valores e Desenvolvimento Humano

    NARCIS (Netherlands)

    F. Comim (Flavio); A. Macedo de Jesus (Anderson); R.C.B Oliveira (Raissa); A. Davison (Anna); S. Galeno (Sabrina); A.C.V. Ribeiro (Ana)

    2010-01-01

    markdownabstractA primeira parte desse Relatório de Desenvolvimento Humano do Brasil 2009/2010 começa com a descrição de um amplo processo de consulta aberta à sociedade, denominada Brasil Ponto a Ponto, para a escolha do tema do relatório. A Campanha Brasil Ponto a Ponto teve por objetivo estimul

  16. Efficacy and safety of peginterferon alfa-2a and ribavirin treatment of chronic hepatitis C in the Republic of Serbia

    Directory of Open Access Journals (Sweden)

    Božić Milena

    2012-01-01

    Full Text Available Introduction. Hepatitis C virus (HCV infection is one of the main causes of chronic liver disease worldwide. Pegylated interferon alfa-2a or 2b (PEG IFN alfa-2a or 2b and ribavirin (RBV represent a standard treatment of chronic hepatitis C (CHC. Sustained virological response (SVR, defined as continued undetectable HCV RNA 24 weeks after completion of treatment, is universally considered as an indicator of treatment efficacy. Objective. The aim of this study was to determine efficacy and safety of PEG IFN alfa-2a and RBV treatment in patients with CHC in Serbia. Methods. One hundred seventy-six patients with CHC were included in this multicenter trial from 8 reference centers in Serbia. The patients were treated with standard PEG IFN alfa- 2a and RBV protocol. We performed the following virological testing: anti-HCV (ELISA, HCV RNK (quantitative PCR, HCV genotype (type-specific PCR, HBsAg, anti-HBs, anti-HBc and anti-HIV (ELISA. Histological activity and the degree of fibrosis were determined according to the Metavir scoring system. Potential predictors for achieving SVR were evaluated using multivariable logistic regression analysis. Results. Of the treated patients with CHC 65.9% were male, and 60.2% of them aged over 40 years. Of the treated patients 68.2% had infection over 5 years, 63% had HCV RNA >400.000 IU/mL, 76.1% had HCV G1/4, and 60.1% had a mild to moderate liver fibrosis. SVR was achieved in 78.9% of patients (G1/4 79.1%; G2/3 78.1%. The factors that indicated a poorer efficacy of the treatment were age >40 (p<0.05, high basal viremia (p=0.013, and the reduction of PEG IFN alfa-2a and RBV doses, with interruption of therapy (p<0.001. Of the treated patients 45.9% had adverse affects (G1/4 50.8%; G2/3 29.7%. Conclusion. Treatment of CHC with PEG IFN alfa-2a and RBV was efficient in 78.9% of patients. The safety profile of therapy was satisfactory. Longer therapy increases the possibility of the development of adverse affects. No

  17. Trihalometanos en aguas de consumo humano

    Directory of Open Access Journals (Sweden)

    C Hernández Sánchez

    2011-01-01

    Full Text Available Los trihalometanos (THMs son subproductos de desinfección que resultan de la cloración de las aguas. Los THMs engloban a sustancias como el cloroformo (CHCl , el 3 bromodiclorometano (CHBrCl , el clorodibromometano (CHBr Cl 2 2 y el tribromometano (CHBr . La Agencia Internacional para la 3 Investigación del Cáncer ha clasificado al cloroformo y al bromodiclorometano en el grupo 2B que incluye a las sustancias posiblemente carcinogénicas en humanos. Debido a su toxicidad y a que el agua de consumo humano constituye la principal vía de exposición del hombre a estos compuestos, su presencia en las aguas de consumo humano está limitada por la Directiva Europea 98/83/CE a 100 ìg/L. En esta revisión se destacan los aspectos más relevantes sobre su toxicidad, reglamentación, determinación, concentración en aguas, variaciones estacionales y eliminación.

  18. JSC “ALFA-BANK” marketing policy. problems and perspectives

    OpenAIRE

    Kirillov, A.; Kuznetcova, E.; Martirosian, M.

    2013-01-01

    The article is devoted to the results of JSC “Alfa-Bank” consumers’ segmentation and the following complex marketing research. The article suggests the ways of the bank’s marketing policy improvement.

  19. Treatment of anemia with darbepoetin alfa in systolic heart failure

    DEFF Research Database (Denmark)

    Swedberg, Karl; Young, James B; Anand, Inder S

    2013-01-01

    Patients with systolic heart failure and anemia have worse symptoms, functional capacity, and outcomes than those without anemia. We evaluated the effects of darbepoetin alfa on clinical outcomes in patients with systolic heart failure and anemia.......Patients with systolic heart failure and anemia have worse symptoms, functional capacity, and outcomes than those without anemia. We evaluated the effects of darbepoetin alfa on clinical outcomes in patients with systolic heart failure and anemia....

  20. Desarrollo humano y justicia

    OpenAIRE

    Abeliuk, René; Acosta, Alberto; Bolívar Espinoza, Gardy Augusto; Bolívar Espinoza , Gardy Augusto; Caloca Osorio, Oscar Rogelio; Carmona Caldera, Cristóbal Gonzalo; Carvacho, Héctor; Cuéllar Saavedra, Óscar; Cuevas Moreno, Ricardo; Elizalde, Antonio; Espejo, Roberto; Foladori,Guillermo; Frei, Raimundo; García, Álvaro; González, Roberto

    2009-01-01

    El desarrollo humano y la justicia, así como las maneras de su realización, han acompañado conflictivamente la historia de la civilización humana. Sin embargo el tema alcanza una especial significación desde la Segunda Guerra , gracias al crecimiento económico y la desigualdad inéditas. Algunos de los más destacados científicos de las ciencias sociales y humanas enfrentaron el desafío desde sus disciplinas a comienzos del siglo XX. Importantes fueron los planteamientos desde la educación y la...

  1. Desarrollo humano sustentable local

    OpenAIRE

    González Cruz, Francisco

    2012-01-01

    El propósito de este ensayo es demostrar que el concepto del desarrollo humano sostenible está relacionado al desarrollo de nuevos paradigmas científicos, lo que le da una excelente base de epistemológica. La validez y el crecimiento de su importancia no se refiere sólo a su preocupación por la degradación ambiental del planeta, sino también a la consecuencia lógica de una nueva mirada a la realidad, fundamentalmente por el abandono de los postivistas racionalistas tan inclinados hacia el det...

  2. Justicia y derechos humanos

    Directory of Open Access Journals (Sweden)

    Joel Flores Rentería

    2011-01-01

    Full Text Available Las libertades básicas y los bienes que contemplan los derechos humanos constituyen los principios de la justicia social y política en los Estados modernos, estos bienes son producto de la evolución histórica, política, cultural y filosófica de la modernidad. Por tal motivo, llevan en sí una conceptualización de lo que es y debe ser la existencia humana; en consecuencia, lo justo sería que toda persona, en una sociedad, se encuentre en posesión de dichos bienes y libertades.

  3. Contratos de capital humano

    Directory of Open Access Journals (Sweden)

    Oscar Alejandro Goyes Viteri

    2005-01-01

    Full Text Available Este documento busca dar a conocer el tema de la inversión en capital humano a través de la celebración de contratos atípicos y utilizando la fiducia mercantil y la titularización como vehículos financieros. Por medio de estos contratos un estudiante obtiene los recursos que requiere para financiar su educación superior, a cambio de entregar un porcentaje de sus ingresos después de su graduación a quien financió la operación.

  4. Individualismo y derechos humanos

    OpenAIRE

    Massini-Correas, C.I. (Carlos Ignacio)

    1987-01-01

    A esta altura de nuestros desarrollos, nos es posible concretar en unas breves conclusiones el resultado de los análisis realizados hasta ahora, con la expresa advertencia de que ellos significan sólo una primera aproximación a la rica problemática que plantea la «doctrina individualista de los derechos humanos ». Estas conclusiones son: 1. Si bien no puede hablarse en los casos analizados de una escuela de pensamiento, existe toda una corriente de ideas, originaria de...

  5. fuente de capital humano

    Directory of Open Access Journals (Sweden)

    Ligia Becerra

    2005-01-01

    Full Text Available El capital intelectual es una concepción novedosa, tipificada como un activo intangible que agrega valor a la empresa; está formado por tres componentes: el capital organizacional, el humano y el relacional. El capital humano está relacionado con el desarrollo y los conocimientos del individuo, que permite diferenciar a un profesional de otro. El objetivo de este trabajo es analizar la formación del Contador Público egresado de la Universidad de Los Andes (ULA de Trujillo, como fuente de capital humano para su desempeño profesional. Los datos se recolectaron aplicando un cuestionario a una muestra aleatoria de 47 de estos profesionales, empleando para el análisis y presentación de los resultados técnicas estadísticas. La investigación evidencia que la mayoría de los encuestados poseen un nivel de satisfacción de medio a bajo con su formación de pregrado, señalando como principales debilidades del Plan de Estudio las áreas tributaria y cambiaria, el manejo instrumental del inglés y el conocimiento de las normativas que rigen el sistema económico. La formación en algunas de estas áreas la han mejorado a través de otras actividades de capacitación. No obstante reconocen algunas fortalezas tales como: el aprendizaje y dominio de conceptos y Principios Contables de Aceptación General, las matemáticas y estadística, el manejo de la contabilidad computarizada y las habilidades para analizar e interpretar problemas contables. Se concluye que a pesar de las deficiencias, la realización de cursos de actualización, junto con las fortalezas en la formación de la carrera, ha contribuido a que el contador público egresado de la ULA de Trujillo constituya un capital humano con ventaja competitiva.

  6. de derechos humanos

    Directory of Open Access Journals (Sweden)

    Ernesto Rey Cantor

    2006-01-01

    Full Text Available Se pretende demostrar que la reelección presidencial como norma constitucional es incompatible con el artículo 23 de la Convención Americana sobre Derechos Humanos, en aquellos Estados que han ratificado el tratado y lo han incorporado al derecho interno, mediante ley, como en los casos de Colombia y Venezuela. Se analiza el conflicto normativo a la luz del Bloque de Constitucionalidad, con base en los artículos 93 de la Constitución colombiana y 23 de la Constitución venezolana.

  7. Recursos humanos 2006

    OpenAIRE

    2011-01-01

    Los recursos humanos son el bien más importante para alcanzar los objetivos de cualquier institución, especial relevancia adquieren para el buen funcionamiento de las bibliotecas, pues además de los conocimientos propios de bibliotecología y ciencia de la información, así como los de la colección y servicios que ofrece el lugar donde laboran, deben poseer espíritu de servicio y una serie de aptitudes, actitudes, hábitos, entre otros, para que la biblioteca satisfaga las necesidades de informa...

  8. Role of elosulfase alfa in mucopolysaccharidosis IVA.

    Science.gov (United States)

    Regier, Debra S; Tanpaiboon, Pranoot

    2016-01-01

    Mucopolysaccharidosis type IVA (MPS IVA or Morquio A) is an autosomal recessive lysosomal storage disease which results in a striking skeletal phenotype, but does not negatively impact the intellect of the patient. MPS IVA has a phenotypic continuum that ranges from a severe and rapidly progressing form to a slowly progressive form. The clinical diagnosis is often made in the preschool years based on abnormal bone findings on physical examination and dysplasia on radiographic imaging. Supportive care has been the mainstay in caring for patients. Orthopedic physicians often form the core of the care team due to the early and severe skeletal abnormalities; however, systemic disease is common and requires aggressive monitoring and management. Interdisciplinary care teams often consist of medical geneticists, cardiologists, pulmonary specialists, gastroenterologists, otolaryngologists, audiologists, and ophthalmologists. With the US Food and Drug Administration's approval of elosulfase alfa, patients >5 years of age now have access to this medication from the time of diagnosis. The clinical trial with once weekly intravenous dosing (2.0 mg/kg per week) showed improvement in the 6-minute walk test. The composite end point analysis to evaluate the combining changes from baseline in 6-minute walk test, 3-minute stair climb test, and respiratory function showed that at a dose of 2.0 mg/kg per week, subjects performed better when compared to placebo. This indication was clinically meaningful in the treatment group. The treatment was generally well tolerated, and the uncommon infusion reactions responded well to traditional enzyme replacement therapy infusion reaction management algorithms. Currently, clinical trials are underway to determine the efficacy and safety in MPS IVA patients <5 years of age.

  9. Desarrollo humano en Venezuela

    Directory of Open Access Journals (Sweden)

    Idana Berosca Rincón Soto

    2013-01-01

    Full Text Available El siguiente artículo tiene como objetivo principal analizar la tendencia y evolución del desarrollo humano en Venezuela para el periodo 2000-2010. Se abordó la investigación enmarcada en una metodología de tipo positivista con técnicas estadísticas. Se concluyó que los recursos escasos y las dificultades históricas exigen un incremento de esfuerzos presupuestarios y de gestión, en cantidad, calidad y transparencia por parte del Estado a través del gasto público. En los últimos años, el Estado no ha aprovechado plenamente el potencial de la política fiscal y los periodos de bonanza económica, precedidos por los auspiciosos auges petroleros, para fomentar, estimular y consolidar el desarrollo humano que permita a la población en general tener calidad de vida cónsonos con una sociedad conducente al bienestar general sostenible y permanente. Esto se explica por diversas limitaciones y retos afrontados, como la falta de diversificación del financiamiento y gasto público, la exigua carga fiscal, la corrupción dentro de la praxis política, la estructura mayormente regresiva del sistema de recaudación, el gasto público y social insuficiente e inequitativo.

  10. Epoetin alfa ja namaluva nefrotoksicnosta inducirana so cisplatin kaj staorci

    Directory of Open Access Journals (Sweden)

    Dimce Zafirov

    2006-06-01

    Full Text Available Klinickata efikasnost na cisplatin kako antitumorski lek e nesomnena, no dozno-limitiracki faktor za negova upotreba pretstavuva izrazitata nefrotoksicnost. Najnovite istrazuvawa pokazuvaat deka epoetin alfa moze da ima znacajna uloga ne samo vo terapiski celi za korekcija na razni vidovi na anemii, tuku istiot moze da bide efikasen i kako nevroprotektiv, hepatoprotektiv, kardioprotektiv i osobeno znacajno kako nefroprotektiv kaj nefrotoksicnost inducirana od preparati na baza na platina. Glavna cel na ovaa studija bese da se utvrdi efektot na epoetin alfa vo prevencijata na nefrotoksicnost eksperimentalno inducirana so dolgotrajna administracija na cisplatin vo doza od 2 mg/kg/t.t./nedela vo tek na 8 nedeli, kaj Wistar staorci. Dobienite rezultati od ovaa studija pokazuvaat deka epoetin alfa signifikantno gi ublazuva funkcionalnite bubrezni poremetuvawa inducirani so dolgotrajna administracija na cisplatin, ja podobruva opstata sostojba i go namaluva mortalitetot kaj ispituvanite zivotni.

  11. Conestat alfa for the treatment of angioedema attacks

    Directory of Open Access Journals (Sweden)

    Davis B

    2011-07-01

    Full Text Available Benjamin Davis, Jonathan A BernsteinUniversity of Cincinnati College of Medicine, Department of Internal Medicine, Division of Immunology/Allergy Section, Cincinnati, OH, USAAbstract: Recently, multiple C1 inhibitor (C1-INH replacement products have been approved for the treatment of hereditary angioedema (HAE. This review summarizes HAE and its current treatment modalities and focuses on findings from bench to bedside trials of a new C1-INH replacement, conestat alfa. Conestat alfa is unique among the other C1-INH replacement products because it is produced from transgenic rabbits rather than derived from human plasma donors, which can potentially allow an unlimited source of drug without any concern of infectious transmission. The clinical trial data generated to date indicate that conestat alfa is safe and effective for the treatment of acute HAE attacks.Keywords: androgens, adverse events, patients, HAE attacks 

  12. Desarrollo humano sustentable, derechos humanos y sexualidad en la salud

    OpenAIRE

    María Isabel Luengas Aguirre; Laura Patricia Sáenz

    2009-01-01

    En México el expresidente Vicente Fox propuso la revolución educativa a partir del desarrollo humano y social y el presidente actual, Felipe Calderón, plantea el desarrollo humano sustentable. Si bien estas propuestas retoman preocupaciones expresadas por la UNESCO para la educación superior (1997), en las que se plantea la pretensión de educar para la paz y los derechos humanos, estos planteamientos no se han reflejado en los currículos ni en la estructura de las IES para crear contextos ...

  13. Derechos humanos y desarrollo humano en México

    OpenAIRE

    Villeda Santana, Mary Carmen

    2011-01-01

    ResumenLos derechos humanos y el desarrollo humano comparten la misma visión y objetivo: garantizar la libertad, el bienestar y la dignidad de todas las personas del mundo. Para alcanzar un desarrollohumano alto es necesario el respeto y el ejercicio eficiente de los derechos humanos, como el acceso a la educación, a los servicios de salud, a la alimentación, a un trabajo dignoy bien remunerado, a la participación activa de las decisiones económicas, entre otros. Al mismo tiempo, es important...

  14. Resolution and t-spectrum for the ALFA detector

    CERN Document Server

    Guergouri, Hichem

    2016-01-01

    My report as Summer Student is in two parts. In the first part I report about my attendance to the run of the ALFA detector to test different collimation schemas and find a new way to get rid of the background. The second part is about the measurement of the resolution of the ALFA detector and comparing the real data with the Monte-Carlo (MC) simulations. First of all I tried to be more familiar with ROOT, worked on understanding the code used to access to the data in the trees inside the Ntuples, plotting histograms,… This was done using old Ntuples which contain MC data.

  15. Rayleigh scattering and laser spot elongation problems at ALFA

    CERN Document Server

    Viard, E; Hubin, N; Ageorges, N; Davies, R

    1999-01-01

    This paper describes the qualitative effects of LGS spot elongation and Rayleigh scattering on ALFA wavefront sensor images. An analytical model of Rayleigh scattering and a numerical model of laser plume generation at the altitude of the Na-layer were developed. These models, integrated into a general AO simulation, provide the sensor sub-aperture images. It is shown that the centroid measurement accuracy is affected by these phenomena. The simulation was made both for the ALFA system and for the VLT Nasmyth Adaptive Optics System (NAOS).

  16. Darbepoetin alfa once every 2 weeks for treatment of anemia in dialysis patients

    DEFF Research Database (Denmark)

    Mann, J; Kessler, M; Villa, Giulio Palludan

    2007-01-01

    AIM: Darbepoetin alfa has a longer half-life than epoetin-(EPO) alfa or beta, allowing administration at less frequent intervals for the treatment of renal anemia. The aim of the present analysis was to evaluate the efficacy and tolerability of an every-2-week (Q2W) schedule of darbepoetin alfa...

  17. de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Javier Pardo Falcón

    2007-01-01

    Full Text Available A pesar de su uso en determinados foros políticos con connotaciones claramente negativas, el término globalización tiene un significado neutro que también puede hacer referencia a fines de bondad indudable. Así, tanto la Declaración Universal de los Derechos Humanos como otros instrumentos internacionales aprobados por las Naciones Unidas son normas jurídicas globalizadoras, surgidas con la idea de extender la vigencia de los derechos básicos de la persona a todos los países del mundo. Desde esta otra visión de la globalización, conseguir la efectiva vigencia de los derechos humanos en los países de Centroamérica resulta una tarea particularmente urgente y necesaria. En efecto, salvo Costa Rica, que puede considerarse una afortunada excepción en la turbulenta historia política centroamericana, todos los demás Estados de la región comparten un pasado marcado por los graves conflictos internos y el escaso desarrollo económico, circunstancias ambas que explican en buena parte un presente caracterizado por la debilidad de las instituciones, la falta de cohesión social y, en consecuencia, la insuficiente garantía de los derechos más básicos de la mayoría de la población. En este contexto, y desde su compromiso con la mejora de las condiciones materiales de vida de sus conciudadanos menos favorecidos, seis autores y autoras centroamericanos abordan, desde distintas perspectivas, la situación actual de los derechos fundamentales en sus respectivos países.

  18. Profesores universitarios y derechos humanos

    OpenAIRE

    Peralta-Varela, Carlos; Pérez-Viramontes, Gerardo

    1997-01-01

    Se presentan algunas reflexiones sobre la forma como los textos internacionales entienden la relación educación-derechos humanos, a partir de la idea de la educación como el instrumento más importante para conformar una cultura universal de respeto a los derechos humanos. Se presenta la situación que guardan la educación y los derechos humanos en América Latina y en particular en México, así como el papel que se les asigna a los maestros para hacer que los valores universales se reafirmen en ...

  19. HBcrAg Identifies Patients Failing to Achieve HBeAg Seroconversion Treated with Pegylated Interferon Alfa-2b

    Directory of Open Access Journals (Sweden)

    Hui Ma

    2016-01-01

    Conclusions: Effective antiviral treatment can decrease HBcrAg levels in the serum. The NPVs of HBcrAg for predicting HBeAg seroconversion at 24-week follow-up was 100%, but the PPVs were not satisfactory (all <31%. The serum HBcrAg levels of the patients with HBeAg seroconversion at the end of the 24-week follow-up steadily declined or even became undetectable during the LTFU.

  20. Physics prospects with the ALFA and AFP detectors

    CERN Document Server

    Hamal, Petr; The ATLAS collaboration

    2013-01-01

    The ATLAS ALFA and AFP detectors - the experimental challenge of measuring forward protons at the LHC. We will describe the experimental challenge presented by the measurement of the forward protons at the LHC. The ATLAS ALFA and AFP projects involve the deployment of detectors capable of detecting protons that emerge intact from the interaction with very small scattering angles. In the case of the ALFA detector, located at ±240m from the ATLAS interaction point, this measurement has to be performed using special high \\beta* beam optics. The detector chosen for the task is a nearly edgeless scintillating fibre tracker capable of making measurements at very low t – below 10-3 GeV2 – in the Nuclear Coulomb interference region. In order to reach these very small t-values we need to deploy the detector very near to the beam line utilizing Roman Pots. The main purpose of the ALFA detector is to measure the total p-p cross-section, a fundamental quantity in hadronic physics of importance to particle and to cos...

  1. Astronaut Scott Carpenter practices in the ALFA trainer at Langley

    Science.gov (United States)

    1962-01-01

    Project Mercury Astronaut M. Scott Carpenter practices in the Air Lubricated Free Attitude (ALFA) trainer located at NASA's Manned Spacecraft Center at Langley AFB, Virginia. This trainer allows the astronaut to see the image of the earth's surface at his feet while manually controlling the spacecraft.

  2. Drotrecogin alfa (activated) in adults with septic shock.

    NARCIS (Netherlands)

    Ranieri, V.M.; Thompson, B.T.; Barie, P.S.; Dhainaut, J.F.; Douglas, I.S.; Finfer, S.; Gardlund, B.; Marshall, J.C.; Rhodes, A.; Artigas, A.; Payen, D.; Tenhunen, J.; Al-Khalidi, H.R.; Thompson, V.; Janes, J.; Macias, W.L.; Vangerow, B.; Williams, M.D.; Pickkers, P.; Raemaekers, J.M.

    2012-01-01

    BACKGROUND: There have been conflicting reports on the efficacy of recombinant human activated protein C, or drotrecogin alfa (activated) (DrotAA), for the treatment of patients with septic shock. METHODS: In this randomized, double-blind, placebo-controlled, multicenter trial, we assigned 1697 pati

  3. El genoma humano

    Directory of Open Access Journals (Sweden)

    García Barreno, Pedro

    2002-01-01

    Full Text Available Not available

    El redescubrimiento de las leyes de Mendel sobre la herencia en las semanas que abrieron el siglo XX incitó una búsqueda científica para comprender la naturaleza y el contenido de la información genética que ha impulsado la biología durante los últimos cien años. El progreso científico conseguido se ha fraguado en cuatro fases que se corresponden, aproximadamente, con los cuatro cuartos del siglo XX. El primero estableció las bases celulares de la herencia: los cromosomas. El segundo definió las bases moleculares de la herencia: la doble hélice de ADN. El tercero descifró las bases informativas de la herencia con el descubrimiento de los mecanismos biológicos mediante los que la célula lee la información codificada en los genes; luego, con la invención de la tecnología del ADN recombinante de clonajey de secuenciación, los científicos pudieron hacer lo mismo. El último cuarto del siglo estuvo marcado por un lento pero constante esfuerzo para descifrar genes primero y, por fin, genomas enteros que han propiciado el desarrollo de la genómica. El día 26 de junio de 2000 se hacía público un «borrador de trabajo» de la secuencia del genoma humano. Las revistas Nature (vol 409, n.º 6822 y Science (vol 291, n.º 5507 dedicaban números especiales a la publicación de la secuencia en el mes de febrero de 2001 (el día 15 Nature y, al día siguiente, Science. «La humanidad ha recibido un gran regalo. La conclusión de la secuencia del genoma humano ofrece una herramienta poderosa para descifrar los secretos de nuestra herencia genética y para precisar nuestro lugar entre otros participantes en la aventura de la vida».

  4. LINGUAGEM, INTERSUBJETIVIDADE E MOVIMENTO HUMANO

    Directory of Open Access Journals (Sweden)

    Lísia Costa Gonçalves de Araújo

    2005-01-01

    Full Text Available Este estudo aborda o tema do Movimento Humano, num contexto interdisciplinar, com base na ontologia da Linguagem em Merleau-Ponty e na teoria do agir comunicativo em Habermas. A Linguagem é tema central no processo educacional. Está intimamente ligada ao Movimento Humano, pois este cria um dinamismo, através da própria percepção que lhe é inerente, abrindo-nos para novas possibilidades de “ser no mundo”.

  5. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  6. El perfil humano y profesional del responsable de recursos humanos

    OpenAIRE

    1995-01-01

    En el presente artículo se realiza un análisis del perfil humano y profesional que poseen actualmente los directivos del campo de Recursos Humanos. En el mismo, además de analizar sus circunstancias personales (sexo, edad, años de experiencia), se profundiza en la forma de acceso al puesto que ocupan, los motivos que les indujeron a entrar en este campo de dirección, la posición real que ocupan en los organigramas, así como las relaciones que poseen con el exterior de sus firmas. Información ...

  7. Structural Analysis Of Alfa Fibers After Chemical Treatment

    Directory of Open Access Journals (Sweden)

    Zakaria Mouallif

    2015-02-01

    Full Text Available Nowadays, natural fibers are used as reinforcement in composite materials. The Alfa fibers have undergone an alkaline treatment with sodium hydroxide NaOH at a concentration of 10%, during an immersion period of two days. After drying, the Fourier transform infrared spectroscopy by attenuated total reflection (FTIR-ATR and X-ray diffraction (XRD were used for the analysis of the chemical properties of these fibers which were extracted from the plant Alfa of the region Al Haouz (Morocco in order to study the modifications resulting from the alkaline treatment. The results proved the presence of the cellulose, with an increase in its proportion in those fibers which have undergone an alkaline treatment with NaOH, the presence of lignin and pectin, as well as their disappearance after the alkaline extraction.

  8. Pathophysiology of hypophosphatasia and the potential role of asfotase alfa

    Directory of Open Access Journals (Sweden)

    Orimo H

    2016-05-01

    Full Text Available Hideo Orimo Division of Metabolism and Nutrition, Department of Biochemistry and Molecular Biology, Nippon Medical School, Tokyo, Japan Abstract: Hypophosphatasia (HPP is an inherited systemic bone disease that is characterized by bone hypomineralization. HPP is classified into six forms according to the age of onset and severity as perinatal (lethal, perinatal benign, infantile, childhood, adult, and odontohypophosphatasia. The causative gene of the disease is the ALPL gene that encodes tissue-nonspecific alkaline phosphatase (TNAP. TNAP is expressed ubiquitously, and its physiological role is apparent in bone mineralization. A defect in bone mineralization can manifest in several ways, including rickets or osteomalacia in HPP patients. Patients with severe forms suffer from respiratory failure because of hypoplastic chest, which is the main cause of death. They sometimes present with seizures due to a defect in vitamin B6 metabolism resulting from the lack of alkaline phosphatase activity in neuronal cells, which is also lethal. Patients with a mild form of the disease exhibit rickets or osteomalacia and a functional defect of exercise. Odontohypophosphatasia shows only dental manifestations. To date, 302 mutations in the ALPL gene have been reported, mainly single-nucleotide substitutions, and the relationships between phenotype and genotype have been partially elucidated. An established treatment for HPP was not available until the recent development of enzyme replacement therapy. The first successful enzyme replacement therapy in model mice using a modified human TNAP protein (asfotase alfa was reported in 2008, and subsequently success in patients with severe form of the disease was reported in 2012. In 2015, asfotase alfa was approved in Japan in July, followed by in the EU and Canada in August, and then by the US Food and Drug Administration in the USA in October. It is expected that therapy with asfotase alfa will drastically change

  9. Physics prospects with the ALFA and AFP detectors

    CERN Document Server

    Hamal, P; The ATLAS collaboration

    2013-01-01

    We will describe the experimental challenge presented by the measurement of the forward protons at the LHC. The ATLAS ALFA and AFP projects involve the deployment of detectors capable of detecting protons that emerge intact from the interaction with very small scattering angles. In the case of the ALFA detector, located at $\\pm${240}~m from the ATLAS interaction point, this measurement has to be performed using special high $\\beta^*$ beam optics. The detector chosen for the task is a nearly edgeless scintillating fibre tracker capable of making measurements at very low $t$ - below $10^{-3} \\text{GeV}^2$ - in the Nuclear Coulomb interference region. In order to reach these very small $t$ values we need to deploy the detector very near to the beam line utilizing Roman Pots. The main purpose of the ALFA detector is to measure the total p-p cross-section, a fundamental quantity in hadronic physics of importance to particle and to cosmic ray physicists and to provide absolute measurement of luminosity which includ...

  10. Upgrade of ATLAS-ALFA for Run2

    CERN Document Server

    Jakobsen, Sune; The ATLAS collaboration

    2016-01-01

    Early experience with the operation of the ALFA detectors in the LHC environment has shown significant beam-induced heating. Comprehensive studies on the effects of heating with a spare detector module have furthermore revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosity. A temporary solution was implemented and kept the detectors below the critical temperature in 2012. In LS1 all ALFA stations have been removed from LHC and are undergoing an upgrade of the geometry of Roman Pots to minimize the impedance losses. When the stations were re-installed ~4 m distance was added between them to gain level arm in the angular measurement between the stations. The updated geometry of the Roman Pot, together with a system to improve the internal heat transfer and an air cooling system, is expected to keep the temperatures of ALFA detectors below critical limits throughout the LHC Run2 and first results from the performance in 2016 will be presented. ...

  11. Derechos Humanos y Derecho Internacional

    Directory of Open Access Journals (Sweden)

    Carrillo Salcedo, Juan Antonio

    2000-09-01

    Full Text Available Not available

    La aparición de un nuevo consenso internacional en torno a las nociones de derechos humanos y democracia, como valores generalmente aceptados por la comunidad de naciones en su conjunto, y la afirmación de que el ser humano es titular de derechos propios, oponibles jurídicamente a todos los Estados, constituyen extraordinarias innovaciones que hacen que, a diferencia del Derecho internacional clásico, la persona no pueda seguir siendo considerada como un mero objeto del Derecho internacional.

  12. Myasis Miasis en humanos

    Directory of Open Access Journals (Sweden)

    Rafael Valderrama Hernández

    1991-02-01

    ón con larvas de mosca produce diversas manifestaciones según el sitio afectado y puede, Incluso, causar la muerte. No es una enfermedad común en humanos pero se observa con alguna regularidad en Colombia y en otros países neotropicales. Afecta con mayor frecuencia las áreas expuestas de la piel y se presenta raramente en ojos, nariz, senos paranasales, tracto urogenital o recto; en estos casos la Infestación se asocia con traumas previos o secreciones purulentas que atraen a las moscas adultas. La carencia de registros y de bibliografía adecuados no permite evaluar el Impacto real de esta parasitosis. Con la presente revisión se pretende contribuir a su conocimiento.

  13. Daclatasvir plus peginterferon alfa and ribavirin for treatment-naive chronic hepatitis C genotype 1 or 4 infection

    DEFF Research Database (Denmark)

    Hézode, Christophe; Hirschfield, Gideon M; Ghesquiere, Wayne

    2015-01-01

    undetectable HCV-RNA at Weeks 4 and 12 (extended rapid virologic response, eRVR) and at 24 weeks post-treatment (sustained virologic response, SVR24) among genotype 1-infected patients. RESULTS: Overall, eRVR was achieved by 54.4% (80/147) of genotype 1-infected patients receiving daclatasvir 20 mg, 54.1% (79......OBJECTIVE: To evaluate the safety and efficacy of daclatasvir, an HCV NS5A inhibitor with pangenotypic activity, administered with peginterferon-alfa-2a/ribavirin. DESIGN: In this Phase 2b double-blind, placebo-controlled study, treatment-naive adults with HCV genotype 1 (N=365) or 4 (N=30......) infection were randomly assigned (2:2:1) to daclatasvir 20 mg or 60 mg, or placebo once daily plus weekly peginterferon-alfa-2a and twice-daily ribavirin. Daclatasvir recipients achieving protocol-defined response (PDR; HCV-RNA

  14. Corte Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Carlos M. Ayala Corao

    2007-01-01

    Full Text Available El autor analiza en el presente artículo el tema de la ejecución de las sentencias dictadas por la Corte Interamericana de Derechos Humanos en los Estados parte, considerando la jurisprudencia de la propia Corte Interamericana y la evolución habida sobre la materia y la legislación de los Estados parte.

  15. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    Directory of Open Access Journals (Sweden)

    Emmanuel eStrahm

    2013-06-01

    Full Text Available Nandrolone (19-nortestosterone is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17 are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are the two main enzymes responsible of 19-norandrosterone glucuronidation. However, the identity of the enzyme involved in nandrolone metabolism in vivo together with their relative contribution and regulation remain unknown.Inhibition assays using human liver microsomes incubated with 19-norandrosterone and selective inhibitors confirmed that UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation, since the presence of the specific UGT2B7 and UGT2B15 inhibitors gemfibrosil and valproic acid inhibited the 19-norandrosterone glucuronidation by 35 and 45 %, respectively. Human liver microsomes were genotyped for UGT2B15 D85Y, UGT2B7 H268Y and the UGT2B17 deletion polymorphism. The glucuronidation activity on 19 norandrosterone was significantly higher in UGT2B15 DD than in the other UGT2B15 genotypes (p<0.05. Moreover, human liver cancer HepG2 cells were exposed to androgens to determine if the transcriptional activity of the genes of interest was affected. Only UGT2B7 mRNA expression was significantly increased (1.8-folds after incubation with nandrolone decanoate.These results show that the UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation and that the UGT2B15 polymorphism (D85Y is the only UGT genetic variation that influences the glucuronidation activity. This could partly explain the inter-individual variation in 19 norandrosterone excretion.

  16. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    OpenAIRE

    Emmanuel eStrahm; Ulf eSjöberg; Mats eGarle; Anders eRane; Lena eEkström

    2013-01-01

    Nandrolone (19-nortestosterone) is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17) are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are...

  17. Pathophysiology of hypophosphatasia and the potential role of asfotase alfa

    Science.gov (United States)

    Orimo, Hideo

    2016-01-01

    Hypophosphatasia (HPP) is an inherited systemic bone disease that is characterized by bone hypomineralization. HPP is classified into six forms according to the age of onset and severity as perinatal (lethal), perinatal benign, infantile, childhood, adult, and odontohypophosphatasia. The causative gene of the disease is the ALPL gene that encodes tissue-nonspecific alkaline phosphatase (TNAP). TNAP is expressed ubiquitously, and its physiological role is apparent in bone mineralization. A defect in bone mineralization can manifest in several ways, including rickets or osteomalacia in HPP patients. Patients with severe forms suffer from respiratory failure because of hypoplastic chest, which is the main cause of death. They sometimes present with seizures due to a defect in vitamin B6 metabolism resulting from the lack of alkaline phosphatase activity in neuronal cells, which is also lethal. Patients with a mild form of the disease exhibit rickets or osteomalacia and a functional defect of exercise. Odontohypophosphatasia shows only dental manifestations. To date, 302 mutations in the ALPL gene have been reported, mainly single-nucleotide substitutions, and the relationships between phenotype and genotype have been partially elucidated. An established treatment for HPP was not available until the recent development of enzyme replacement therapy. The first successful enzyme replacement therapy in model mice using a modified human TNAP protein (asfotase alfa) was reported in 2008, and subsequently success in patients with severe form of the disease was reported in 2012. In 2015, asfotase alfa was approved in Japan in July, followed by in the EU and Canada in August, and then by the US Food and Drug Administration in the USA in October. It is expected that therapy with asfotase alfa will drastically change treatments and prognosis of HPP. PMID:27274262

  18. Reconocimiento de expresiones faciales empleando memorias asociativas Alfa-Beta

    OpenAIRE

    Márquez Olivera, Moisés Vicente

    2016-01-01

    El presente trabajo de tesis orienta su atención en la compleja tarea del reconocimiento automático de las expresiones faciales, el propósito principal es probar la asertividad y competitividad de las memorias asociativas de tipo Alfa-Beta en el reconocimiento automático de expresiones faciales. La primera parte de la tesis brinda una breve introducción, la cual enfatiza la importancia de las expresiones faciales en la comunicación humana, incluyendo los estudios más relevantes dedicados a...

  19. Desarrollo de un sitio web para el proyecto Alfa Gaviota

    OpenAIRE

    Trelles Labairu, Hilton

    2013-01-01

    Este proyecto muestra todos los pasos a seguir para recolectar, organizar, tratar y construir un portal web para el grupo de universidades partícipes en el proyecto Alfa Gaviota III utilizando un sistema gestor de contenidos. Se parte de una base de información recopilada en unas cuántas páginas html realizadas con la tecnología de google docs. Es un requisito indispensable conseguir una forma de almacenar toda la información del proyecto consumiendo el mínimo espacio y recurso...

  20. Naturaleza de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Carlos López Dawson

    2016-07-01

    Full Text Available En la formación de una nueva Carta Fundamental los constituyentes requerirán conocer o consensuar sobre la naturaleza de los derechos humanos; luego, determinar cómo el Estado hará efectivo el respeto de tales derechos. Para ello es necesario recurrir a la historia y evolución de estos derechos, y el presente trabajo trata de contribuir a un debate productivo eficiente sobre la naturaleza de los derechos humanos, para que los ciudadanos puedan decidir en el entendido de que se trata de una decisión democrática reflexionada y fundada en el humanismo. El análisis se sitúa en el contexto técnico-ideológico del sistema republicano vigente que corresponde al estado actual del derecho internacional.

  1. 意大利精灵——Alfa Romeo MITO

    Institute of Scientific and Technical Information of China (English)

    柳柽

    2008-01-01

    Alfa Romeo 是一个对激情执着的品牌,即便是对于MITO这样一部掀背小车也不例外,这部意大利制造的Alfa Romeo MITO上,会让你感受到一种热辣奔放的别样风情。

  2. De radioimmunochemische bepaling van de prostaglandines E2 en F2alfa

    NARCIS (Netherlands)

    Elvers LH; Smit PJ; Loeber JG

    1986-01-01

    In het kader van het onderzoek naar het werkingsmechanisme van de tumorpromotor activiteit van chemische stoffen (LCM, project 658113) werden radioimmunochemische bepalingsmethoden (RIA) voor de prostaglandines E2 (PGE2) en F2alfa (PGF2alfa) ontwikkeld. Het onderzoeksmateriaal, celextracten en medi

  3. Peginterferon alfa-2a for AIDS-associated Kaposi sarcoma: experience with 10 patients.

    Science.gov (United States)

    Rokx, Casper; van der Ende, Marchina E; Verbon, Annelies; Rijnders, Bart J A

    2013-11-01

    In this observational cohort study, 10 patients with extensive or treatment-refractory AIDS-associated Kaposi sarcoma were treated with peginterferon alfa-2a. Tumor responses were observed in 9 patients with a median progression-free survival of 645 days. Peginterferon alfa-2a could be an effective therapy for extensive or treatment-resistant Kaposi sarcoma.

  4. Derechos humanos: estatistas, no cosmopolitas

    Directory of Open Access Journals (Sweden)

    Montero, Julio

    2013-12-01

    Full Text Available Current international law regards human rights as standards relative to the way states treat their own population. This view, which is known as the “state-centric perspective” on human rights, is now resisted by several authors. In this article I defend this view against some critiques recently suggested by Cristina Lafont in Isegoría and other prestigious journals. More concretely, I aim to show that, contrary to Lafont’s claims, the state-centric perspective accurately captures the point and purpose of contemporary human rights and is capable of preserving the interests of human beings from the threatens posed by the new globalized world.La visión imperante en el derecho internacional actual concibe los derechos humanos como normas relativas al trato que los Estados brindan a su propia población. Esta posición, que se conoce como la “perspectiva estatista” sobre los derechos humanos, es actualmente resistida por varios autores. En este artículo intentaré defender la perspectiva estatista contra una serie de críticas recientemente formuladas por Cristina Lafont en Isegoría y en otras importantes revistas especializadas. En particular, trataré de probar que, contrariamente a lo que Lafont argumenta, esta perspectiva captura adecuadamente la razón de ser de la práctica contemporánea de los derechos humanos y dispone de recursos para resguardar los intereses de los seres humanos de las nuevas amenazas surgidas en un mundo globalizado.

  5. Stock footage ATLAS-ALFA experiment November 2016

    CERN Multimedia

    2016-01-01

    This footage shows an ALFA station of the ATLAS experiment in the LHC tunnel. This detector aims to measure the elastic proton scattering and to determine from these data the elastic and total cross sections, as well as the luminosity. Altogether there are two times two stations at both sides of ATLAS at Point 1 in a distance of about 240m. Each station consist of two Roman Pots which are equipped with scintillating fiber detectors. They are used under special beam conditions (high beta*) when the detectors are moved close to the circulating LHC beams (as close as 1mm). In standard high intensity LHC runs the Pots remain in parking position. The movie records the composition of an ALFA station at the C-side of ATLAS in the tunnel section *** 7L1. All stations are placed on the outgoing beams where scattered protons are expected. That's why the station mechanics is partly covered by the tubes of incoming beam lines. The stations are placed in between the large boxes with DQR resistors to absorb the magnet curr...

  6. Alternative method for quantification of alfa-amylase activity

    Directory of Open Access Journals (Sweden)

    DF. Farias

    Full Text Available A modification of the sensitive agar diffusion method was developed for macro-scale determination of alfa-amylase. The proposed modifications lower costs with the utilisation of starch as substrate and agar as supporting medium. Thus, a standard curve was built using alfa-amylase solution from Aspergillus oryzae, with concentrations ranging from 2.4 to 7,500 U.mL-1. Clear radial diffusion zones were measured after 4 hours of incubation at 20 °C. A linear relationship between the logarithm of enzyme activities and the area of clear zones was obtained. The method was validated by testing α-amylase from barley at the concentrations of 2.4; 60; 300 and 1,500 U.mL-1. The proposed method turned out to be simpler, faster, less expensive and able to determine on a macro-scale α-amylase over a wide range (2.4 to 7,500 U.mL-1 in scientific investigation as well as in teaching laboratory activities.

  7. Therapeutic efficacy of a biosimilar epoetin alfa in hemodialysis patients

    Directory of Open Access Journals (Sweden)

    Amel Harzallah

    2015-01-01

    Full Text Available Anemia is a frequent complication in patients with chronic kidney disease. However, human recombinant erythropoietin (rHu-EPO has revolutionized the management of anemia in chronically dialyzed patients. Epomax ® is a new rHu-EPO alfa manufactured in Tunisia (Medis Laboratories. The aim of this study was to evaluate the efficacy and tolerance of Epomax ® in chronic hemodialysis (HD patients in a phase-III, multicenter, clinical trial. Fiftythree HD patients (mean age 47.7 ± 13 years who received a stable dose of rHu-EPO (Hemax ® , a rHu-EPO alfa manufactured by Biosidus Laboratories subcutaneously were switched to Epomax ® via the same route of administration. At baseline, the mean systolic pressure was 132 ± 18 mm Hg and the mean diastolic pressure was 79 ± 8 mm Hg. The mean blood hemoglobin was 10.2 g/dL and the median ferritin level was 667 ng/mL. After a follow-up of 43 days, the mean blood hemoglobin was 10.5 g/dL under the effect of Epomax ® . There was no significant difference in the mean hemoglobin levels between the treatments with both drugs. Few adverse events were reported during the study. We conclude that Epomax ® was effective at maintaining the hemoglobin levels at target concentrations and was well tolerated in HD patients.

  8. Investigation of Class 2b Trucks

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.

    2002-04-03

    The popularity of trucks in the class 2 category--that is, those with a 6,000 to 10,000 pounds (lbs) gross vehicle weight rating (GVWR)--has increased since the late 1970s/early 1980s. The purpose of this research is to identify and examine vehicles in the upper portion of the class 2 weight range (designated as vehicle class 2b) and to assess their impact. Vehicles in class 2b (8,500-10,000 lbs GVWR) include pickup trucks, sport utility vehicles (SUVs), and large vans (i.e., not minivans). Oak Ridge National Laboratory researched each individual truck model to determine which models were class 2b trucks and arrived at four methodologies to derive sales volumes. Two methods--one for calendar year and one for model year sales--were recommended for producing believable and reliable results. The study indicates that 521,000 class 2b trucks were sold in calendar year 1999--6.4% of sales of all trucks under 10,000 lbs. Eighty-two percent of class 2b trucks sold in 1999 were pickups; one third of class 2b trucks sold in 1999 were diesel. There were 5.8 million class 2b trucks on the road in 2000, which amounts to 7.8% of all trucks under 10,000 lbs. Twenty-four percent of the class 2b truck population is diesel. Estimates show that class 2b trucks account for 8% of annual miles traveled by trucks under 10,000 lbs and 9% of fuel use. Data on class 2b trucks are scarce. As the Tier 2 standards, which apply to passenger vehicles in the 8,500-10,000 lb GVWR category, become effective, additional data on class 2b trucks may become available--not only emissions data, but data in all areas. At the moment, distinguishing class 2b trucks from class 2 trucks in general is a substantial task requiring data on an individual model level.

  9. Universalidad de los Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Orlando José Cadrazco Salcedo

    2011-07-01

    Full Text Available Resumen:La dimensión universal de los Derechos Humanos ha sido proclamada reiteradamente en el sistema de las Naciones Unidas. Dicha universalidad pretende reflejar y, a su vez, fortalecer el consenso de la comunidad internacional respecto de dichos derechos, sin que ello tenga que suponer, en principio, la imposición de ningún tipo de hegemonía jurídica, política o cultural, en particular la occidental, euro céntrica o atlantista. Sin embargo, ya sabemos que esto no resulta nada fácil ante la diversidad cultural de nuestro mundo. Por ejemplo, a nosotros, los “occidentales”, ahora nos resultan especialmente chocantes las normas -jurídicas o morales- fuertemente discriminatorias contra las mujeresexistentes en la mayoría de las culturas y religiones.Palabras claves:Derechos Humanos, Universalidad, Estados Sociales de Derecho, Positivización, Seres Humanos, Occidente, Organización de Naciones Unidas.Abstract :The universal dimension of human rights has been proclaimed repeatedly in the United Nations system. This universality is intended to reflect and, in turn, strengthen the international community consensus on these rights, without having to assume, in principle, the imposition of hegemony any legal, political or cultural, including Western central euro or Atlanta. However, we know that it is not easy to cultural diversity of our world. For example, we as “Westerners”, now we are particularly shocking and legal rules or moral, highly discriminatory against women exist in most cultures and religions.Key words:Human Rights, Universality, Social State of Law, Positivization, Human Beings, West, United Nations Organization.

  10. El virus del papiloma humano

    OpenAIRE

    Cabrero Díaz, Sara

    2012-01-01

    La infección por el Virus del Papiloma Humano es en nuestros tiempos una de las enfermedades de transmisión sexual más frecuentes y su prevalencia puede alcanzar hasta el 60% en las personas activas sexualmente. Este trabajo prentende recopilar datos sobre la enfermedad para comprender el por qué de su transmisión (causas), cómo se manifiesta (síntomas), complicaciones que éste puede producir, técnicas que se usan para su diagnóstico, el posible tratamiento y la controversia que éste ha ca...

  11. Derechos humanos y acciones colectivas

    OpenAIRE

    Requejo Isidro, Marta

    2012-01-01

    El presente trabajo está subvencionado por la Consellería de Educación e Ordenación Universitaria de la Xunta de Galicia, la Consellería de Economía e Industria de la Xunta de Galicia (proyecto de investigación ref. INCITE09PXIB202096PR), el Ministerio de Ciencia e Innovación (proyecto de investigación DER2010-17048, subprograma JURI), y el FEDER Buena parte de las acciones civiles entabladas en EEUU por demandantes extranjeros en relación con violaciones de derechos humanos oc...

  12. AFP and ALFA detectors as a momentum spectrometer system - feasibility study

    CERN Document Server

    ABDUL KHALEK, Rabah

    2015-01-01

    We consider a possibility to measure a leading proton momentum using simultaneously the AFP and ALFA detectors. The idea is based on the simple fact that the proton trajectory through the magnetic field between the AFP and ALFA$_{1}$ detectors, depends on the proton's momentum loss $\\xi$. The feasibility of the proton momentum measurement is directly related to the availability of the magnetic fields and their configuration, the overlap between ALFA and AFP detectors and their resolutions as well as energy losses and the multiple scattering effect that could wash away little actions from the magnets on the proton.

  13. Nebulised dornase alfa versus placebo or hypertonic saline in adult critically ill patients

    DEFF Research Database (Denmark)

    Claudius, Casper; Perner, Anders; Møller, Morten Hylander

    2015-01-01

    BACKGROUND: Nebulised dornase alfa is used off-label in critically ill patients. We aimed to assess the benefits and harms of nebulised dornase alfa versus placebo, no prophylaxis, or hypertonic saline on patient-important outcome measures in adult critically ill patients. METHODS: We performed...... a systematic review with meta-analysis and trial sequential analysis (TSA) using the Cochrane Collaboration methodology. Eligible trials were randomised clinical trials comparing nebulised dornase alfa with placebo, no prophylaxis, or hypertonic saline. The predefined outcome measures were all-cause mortality...

  14. Fast radio burst discovered in the Arecibo pulsar ALFA survey

    Energy Technology Data Exchange (ETDEWEB)

    Spitler, L. G.; Freire, P. C. C.; Lazarus, P.; Lee, K. J. [Max-Planck-Institut für Radioastronomie, D-53121 Bonn (Germany); Cordes, J. M.; Chatterjee, S.; Wharton, R. S.; Brazier, A. [Department of Astronomy and Space Sciences, Cornell University, Ithaca, NY 14853 (United States); Hessels, J. W. T. [ASTRON, Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Lorimer, D. R.; McLaughlin, M. A. [Department of Physics and Astronomy, West Virginia University, Morgantown, WV 26506 (United States); Crawford, F. [Department of Physics and Astronomy, Franklin and Marshall College, Lancaster, PA 17604-3003 (United States); Deneva, J. S. [Naval Research Laboratory, 4555 Overlook Ave SW, Washington, DC 20375 (United States); Kaspi, V. M.; Karako-Argaman, C. [Department of Physics, McGill University, Montreal, QC H3A 2T8 (Canada); Allen, B. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee, WI 53211 (United States); Bogdanov, S.; Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Jenet, F. A. [Center for Gravitational Wave Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); Knispel, B., E-mail: lspitler@mpifr-bonn.mpg.de [Leibniz Universität, Hannover, D-30167 Hannover (Germany); and others

    2014-08-01

    Recent work has exploited pulsar survey data to identify temporally isolated, millisecond-duration radio bursts with large dispersion measures (DMs). These bursts have been interpreted as arising from a population of extragalactic sources, in which case they would provide unprecedented opportunities for probing the intergalactic medium; they may also be linked to new source classes. Until now, however, all so-called fast radio bursts (FRBs) have been detected with the Parkes radio telescope and its 13-beam receiver, casting some concern about the astrophysical nature of these signals. Here we present FRB 121102, the first FRB discovery from a geographic location other than Parkes. FRB 121102 was found in the Galactic anti-center region in the 1.4 GHz Pulsar Arecibo L-band Feed Array (ALFA) survey with the Arecibo Observatory with a DM = 557.4 ± 2.0 pc cm{sup –3}, pulse width of 3.0 ± 0.5 ms, and no evidence of interstellar scattering. The observed delay of the signal arrival time with frequency agrees precisely with the expectation of dispersion through an ionized medium. Despite its low Galactic latitude (b = –0.°2), the burst has three times the maximum Galactic DM expected along this particular line of sight, suggesting an extragalactic origin. A peculiar aspect of the signal is an inverted spectrum; we interpret this as a consequence of being detected in a sidelobe of the ALFA receiver. FRB 121102's brightness, duration, and the inferred event rate are all consistent with the properties of the previously detected Parkes bursts.

  15. Pobreza, discapacidad y derechos humanos

    Directory of Open Access Journals (Sweden)

    Beatriz Martínez Ríos

    2013-07-01

    Full Text Available Se estima que el 15% de la población mundial tiene una discapacidad. Existe un vínculo directo entre pobreza y discapacidad. La población con discapacidad se encuentra entre la más desaventajada y discriminada. Sin embargo, las teorías económicas sobre desarrollo han omitido cuestiones esenciales sobre esta población, contribuyendo a su invisibilidad y pobreza. La teoría de las capacidades desde un enfoque basado en los derechos humanos nos proporciona una nueva dimensión del desarrollo. Los costes extraordinarios derivados de la discapacidad y de las barreras psicológicas, físicas y sociales a las que se enfrentan las personas con discapacidad contribuyen a su pobreza, falta de libertad y vulneración de derechos humanos, y así se evidencia en los diferentes estudios llevados a cabo. La cooperación para el desarrollo se convierte en una herramienta esencial para la promoción de los derechos de las personas con discapacidad y la lucha contra la pobreza.

  16. Bioética y administración pública de los recursos humanos

    Directory of Open Access Journals (Sweden)

    Adeyro Colina

    2005-01-01

    Full Text Available El estudio presentado tiene el propósito de dar a conocer los resultados de la investigación bioética aplicada a la administración pública de los recursos humanos y como puede contribuir a elevar la calidad de los procesos administrativos y de servicios públicos. Las características de la administración pública y el perfil de sus empleados, permiten pensar que la bioética es un componente esencial para incentivar la rectitud de una participación ciudadana acorde con las exigencias de un estado moderno. La investigación es de tipo descriptiva y de campo. Se utilizó la escala Lickert con tres alternativas de respuesta; y el método alfa cronbach para la confiabilidad del instrumento. Como resultados se observa que la situación actual de la administración pública es propicia para aplicar un enfoque bioético a sus procesos administrativos y consolidar una concepción ciudadana en los recursos humanos de la misma.

  17. Investigation of Mechanical Behavior of Alfa and Gamma Nano- Alumina/ Epoxy Composite Made By Vartm

    Directory of Open Access Journals (Sweden)

    P. Ghabezi

    2016-06-01

    Full Text Available In this paper, the mechanical properties (flexural and tensional modulus and strength are investigated by manufacturing Epoxy/Glass Nano-composite samples with different Nano-particle wt% (Nano-Alumina to find optimum conditions. The alpha and Gamma grade of Nano alumina were added to the epoxy system with the weight percentage of 1, 2, 3, 4, 5 and 6. The experimental results show that the maximum flexural stiffness in Alfa and Gamma Nano-alumina composite is related to 6 wt% and 4 wt% samples, respectively. And the highest tensional stiffness in Alfa and Gamma Nano-alumina composite is related to 4 wt% and 5 wt% samples, respectively. Also the highest toughness for Alfa and Gamma Nano-composites is observed for 4 wt% and 3 wt% samples and in the same way Nano-alumina in grade Alfa with 1 wt% and Gamma with 3 wt% have highest failure strain.

  18. Measurement of the total cross section with ALFA Detector at ATLAS

    CERN Document Server

    Trzebinski, M; The ATLAS collaboration

    2017-01-01

    The main goals of the Absolute Luminosity For ATLAS (ALFA) detector is to provide an absolute luminosity and total cross section measurement. The measurement method used, the detector alignment and the quality of the collected data are discussed.

  19. Simulation of the ATLAS ALFA detector in comparison with testbeam data

    CERN Document Server

    Pfeiffer, Felix-Fabian; Stenzel, H

    2010-01-01

    ALFA (Absolute Luminosity for ATLAS) is a scintillating fiber detector for the determination of the absolute luminosity. ALFA con- sists of eight Roman Pots, four on each side of ATLAS at a distance of 240 m. Each detector is made of scintillating fibers with quadratic cross section, glued in UV geometry on ten double sided layers. The detectors are mounted in moveable Roman Pots and can approach the LHC beam up to 1.5 mm, to determine the luminosity from the differential t spectrum of elastically scattered protons using the optical theorem. This is done in special LHC calibration runs with large β ∗ , special focusing and low instant luminosity. The results of ALFA are needed for the calibration of ATLAS luminosity monitors like LUCID. This diploma thesis deals with the simulation of ALFA and the most recent testbeam campaign. A special focus is put on the comparison of results from simulation and testbeam.

  20. Alfa tahab TeliaSonerat Türgis üle pakkuda / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2005-01-01

    TeliaSoneraga, kellele kuulub 37 protsenti Türgi operaatorfirma Turkcell aktsiatest, konkureerib täiendava 27 protsendise aktsiapaki ostmises Venemaa operaatorfirmaga Alfa Telecom. Lisa: Kaasosanike huvid põrkuvad. Diagramm: Konkurendid Vene MegaFonis

  1. Elosulfase Alfa: a review of its use in patients with mucopolysaccharidosis type IVA (Morquio A syndrome).

    Science.gov (United States)

    Lyseng-Williamson, Katherine A

    2014-10-01

    Elosulfase alfa (Vimizim(®)) is a recombinant form of the human lysosomal enzyme N-acetylgalactosamine-6-sulfatase (GALNS) that is lacking in patients with mucopolysaccharidosis type IVA (MPS IVA; Morquio A syndrome). It is the first, and currently only, disease-specific treatment option for this very rare, progressively degenerative, autosomal-recessive lysosomal storage disorder. Enzyme replacement therapy with elosulfase alfa aims to restore GALNS activity, thereby preventing the accumulation of keratan sulfate (KS) and chondroitin-6-sulfate in lysosomal compartments of cells that results in the clinical manifestations of MPS IVA. In clinical trials in children and adults with MPS IVA, intravenous elosulfase alfa 2 mg/kg/week provided significant and sustained improvements in urinary levels of KS (a pharmacodynamic biomarker for the disease). In the key placebo-controlled, 24-week, phase 3 trial in patients with MPS IVA aged ≥5 years, elosulfase alfa 2 mg/kg/week significantly improved endurance [least squares mean placebo-adjusted change from baseline in 6-min walk test distance 22.5 m (95 % CI 4.0-40.9)]. Infusion-associated reactions, the primary tolerability issue associated with elosulfase alfa, are generally mild to moderate in severity, self-limiting, and manageable. In the absence of a cure, GALNS enzyme replacement therapy with elosulfase alfa is an important achievement in the treatment of MPS IVA.

  2. Combination of "low-dose" ribavirin and interferon alfa-2a therapy followed by interferon alfa-2a monotherapy in chronic HCV-infected non-responders and relapsers after interferon alfa-2a monotherapy

    Institute of Scientific and Technical Information of China (English)

    Perdita Wietzke-Braun; Volker Meier; Felix Braun; Giuliano Ramadori

    2001-01-01

    AIM To report on the efficacy, safety and tolerability of interferon alfa-2a combined with a "low dose" of ribavirin for relapsers and non responders to alpha interferon monotherapy.METHODS Thirty-four chronic hepatitis C virus-infected non-responders to interferon alfa2a monotherapy (a course of at least 3 months treatment) and 13 relapsers to interferon alfa 2a monotherapy (a dose of 3 to 6 million units three times per week for at least 20 weeks but not more than 18 months) were treated with the same dose of interferon alfa-2a used before (3 to 6 million units three times per week) and ribavirin (10 mg/ kg daily) for 6 months. In complete responders, interferon alfa-2a was administered for further 6 months at the same dose used before as monotherapy.RESULTS Seven (20.6%) of 34 non-responders stopped the combined therapy due to adverse events, including two patients with histological and clinical Child A cirrhosis. In 17/27 (63%)non-responders, the combined therapy was stopped after three months because of non-response. Ten of the 27 non-responders completed the 1;2-month treatment course. At a mean follow up of 28 months (16- 37 months)after the treatment, 4/10 (15%) previous non-responders still remained complete responders,All 13 previous relapsers completed the 12-month treatment course. At a mean follow up of 22months (9 - 36 months) after treatment, 6/13(46%) the previous relapsers were stillsustained complete responders.CONCLUSION Our treatment schedule of the combined therapy for 6 months of interferon alfa2a with a low dose of ribavirin (10 mg/kg/day)followed by 6 months of interferon alfa-2amonotherapy is able to induce a sustainedcomplete response rate in 15% of non-responders and 46% of relapsers with chronic hepatitis C virus-related liver diseases comparable to those obtained with the standarddoses of ribavirin 1000 - 1200 mg/day.Randomized prospective controlled trials using lower total amounts of ribavirin in combination with interferon should be

  3. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  4. B2B Pioneer A Millionaire Maker

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    China should soon see its largest group of instant millionaires after Jack Ma,Chief Executive Officer and Chairman of Alibaba Group,announced on July 27 that the China’s preeminent e-commerce company has initiated the listing of its B2B unit alibaba.com

  5. Fast Radio Burst Discovered in the Arecibo Pulsar ALFA Survey

    CERN Document Server

    Spitler, L G; Hessels, J W T; Lorimer, D R; McLaughlin, M A; Chatterjee, S; Crawford, F; Deneva, J S; Kaspi, V M; Wharton, R S; Allen, B; Bogdanov, S; Brazier, A; Camilo, F; Freire, P C C; Jenet, F A; Karako-Argaman, C; Knispel, B; Lazarus, P; Lee, K J; van Leeuwen, J; Lynch, R; Lyne, A G; Ransom, S M; Scholz, P; Siemens, X; Stairs, I H; Stovall, K; Swiggum, J K; Venkataraman, A; Zhu, W W; Aulbert, C; Fehrmann, H

    2014-01-01

    Recent work has exploited pulsar survey data to identify temporally isolated, millisecond-duration radio bursts with large dispersion measures (DMs). These bursts have been interpreted as arising from a population of extragalactic sources, in which case they would provide unprecedented opportunities for probing the intergalactic medium; they may also be linked to new source classes. Until now, however, all so-called fast radio bursts (FRBs) have been detected with the Parkes radio telescope and its 13-beam receiver, casting some concern about the astrophysical nature of these signals. Here we present FRB 121102, the first FRB discovery from a geographic location other than Parkes. FRB 121102 was found in the Galactic anti-center region in the 1.4-GHz Pulsar ALFA survey with the Arecibo Observatory with a DM = 557.4 $\\pm$ 3 pc cm$^{-3}$, pulse width of $3\\; \\pm 0.5$ ms, and no evidence of interstellar scattering. The observed delay of the signal arrival time with frequency agrees precisely with the expectation...

  6. Performance evaluation and optimization of the luminosity detector ALFA

    CERN Document Server

    Jakobsen, Sune; Grafström, P; Joram, C

    2010-01-01

    The startup of the LHC (Large Hadron Collider) has initialized a new era in particle physics. The standard model of particle physics has for the last 40 years with tremendous success described all measurements with phenomenal precision. The experiments at the LHC will test the standard model in a new energy regime. To normalize the measurements and understand the potential discoveries of the LHC experiments it is often crucial to know the interaction rate - the absolute luminosity. The ATLAS (A Toroidal LHC ApparatuS) detector will measure luminosity by numerous methods. But for most of the methods only the relative luminosity is measured with good precision. The absolute scale has to be provided from elsewhere. Therefore ATLAS plans to measure the flux of protons scattered under very small angles as this flux relates directly and with good precision to the absolute luminosity. This will be done by the ALFA (Absolute Luminosity For ATLAS) detector. The detectors will be positioned about 240 m from the interac...

  7. Interacciones humano-animal: características e implicaciones para el bienestar de los humanos

    OpenAIRE

    Natalia Piar; Diana Granados; Germán Gutiérrez

    2008-01-01

    En este artículo se revisa la literatura reciente sobre interacciones humano-animal, su origen, sus características y cómo dichas interacciones afectan el bienestar físico, psicológico y social. En la primera parte se presentan los orígenes y evolución histórica de las relaciones humano - animal, empezando por los procesos de domesticación y se aborda la naturaleza de las interacciones humano animal. En la segunda parte, se revisan los efectos para los humanos de ...

  8. Derecho humano a la alimentación y desarrollo humano

    OpenAIRE

    Barriga-Rodríguez, Dayana; Saavedra Chumbe, Mónica

    2016-01-01

    En este artículo se revisa la relación entre el derecho humano a la alimentación y el desarrollo humano, así como las políticas públicas de alimentación, existentes a nivel mundial, regional y nacional y los niveles de desarrollo de los países que las ejecutan. Concluyendo que existe una correlación directa entre el derecho humano a la alimentación y el desarrollo humano, tanto a nivel internacional como nacional; Las intervenciones en economía no son suficientes para mejorar el desarrollo hu...

  9. Taliglucerase alfa: an enzyme replacement therapy using plant cell expression technology.

    Science.gov (United States)

    Grabowski, Gregory A; Golembo, Myriam; Shaaltiel, Yoseph

    2014-05-01

    Gaucher disease (GD) is a rare, genetic lysosomal storage disorder caused by functional defects of acid β-glucosidase that results in multiple organ dysfunction. Glycosylation of recombinant acid human β-glucosidase and exposure of terminal mannose residues are critical to the success of enzyme replacement therapy (ERT) for the treatment of visceral and hematologic manifestations in GD. Three commercially available ERT products for treatment of GD type 1 (GD1) include imiglucerase, velaglucerase alfa, and taliglucerase alfa. Imiglucerase and velaglucerase alfa are produced in different mammalian cell systems and require production glycosylation modifications to expose terminal α-mannose residues, which are needed for mannose receptor-mediated uptake by target macrophages. Such modifications add to production costs. Taliglucerase alfa is a plant cell-expressed acid β-glucosidase approved in the United States and other countries for ERT in adults with GD1. A plant-based expression system, using carrot root cell cultures, was developed for production of taliglucerase alfa and does not require additional processing for postproduction glycosidic modifications. Clinical trials have demonstrated that taliglucerase alfa is efficacious, with a well-established safety profile in adult, ERT-naïve patients with symptomatic GD1, and for such patients previously treated with imiglucerase. These included significant improvements in organomegaly and hematologic parameters as early as 6months, and maintenance of achieved therapeutic values in previously treated patients. Ongoing clinical trials will further characterize the long-term efficacy and safety of taliglucerase alfa in more diverse patient populations, and may help to guide clinical decisions for achieving optimal outcomes for patients with GD1.

  10. WTS-2 b: Too close for comfort?

    Directory of Open Access Journals (Sweden)

    Kovács G.

    2013-04-01

    Full Text Available We report the discovery of WTS-2 b, a typical hot Jupiter in an unusually close 1.02-day orbit to a K-dwarf star. This is the second planet to be discovered in the infrared light curves of the WFCAM Transit Survey (WTS and is only one-and-a-half times the separation from its host star at which is would be destroyed by Roche lobe overflow. The predicted remaining lifetime of the planet is just 38 Myrs, assuming a tidal dissipation quality factor of Q'* = 106. The magnitude of Q'* is largely unconstrained by observations, thus WTS-2 b provides a useful calibration point for theories describing how frictional processes within a host star affect the tidal orbital evolution of its companion giant planets. It is expected that stars with large convective envelopes are more efficient at dissipating the orbital energy of the planet, and WTS-2 b provides an observational constraint in the sparsely populated K-dwarf regime. In addition, despite its relatively faint magnitude, the favourable size ratio of the WTS-2 star-planet system and the predicted hot equilibrium temperature of the planet will make it possible to characterise the planet's atmosphere via secondary eclipse measurements using existing ground-based instrumentation.

  11. Effects of MAPP Compatibilization and Acetylation Treatment Followed by Hydrothermal Aging on Polypropylene Alfa Fiber Composites

    Directory of Open Access Journals (Sweden)

    Noura Hamour

    2015-01-01

    Full Text Available This work investigates the effect of hydrothermal aging on the properties of polypropylene/alfa fiber composites. Hydrothermal aging was induced in an environmental testing chamber at 65°C and 75% relative humidity (RH over a 1000 h period. At the beginning (t=0 h, the results showed that Young’s moduli of the untreated alfa fibers and the acetylation-treated fibers increased by 21% and 36%, respectively, compared with the virgin polypropylene (PP. Additionally, Young’s moduli decreased by 7% for the compatibilized composites composed of maleic anhydride grafted polypropylene (MAPP. After 1000 h of aging, Young’s moduli decreased by 36% for untreated alfa fibers and 29% for the acetylation-treated alfa fibers and the compatibilized composites. Significant degradation was observed in the untreated alfa fiber samples. The Fourier transformed infrared (FTIR allows us to distinguish the characteristic absorption bands of the main chemical functions present in the composite material before and after aging. The thermal properties showed that the thermal stability and the degree of crystallinity of the composites decreased after hydrothermal aging; this result was corroborated by the dynamical mechanical analysis (DMA results.

  12. Home infusion program for Fabry disease: experience with agalsidase alfa in Argentina

    Directory of Open Access Journals (Sweden)

    Isaac Kisinovsky

    2013-02-01

    Full Text Available Fabry disease is an X-linked lysosomal storage disorder caused by inherited deficiency of the enzyme α-galactosidase A. Enzyme replacement treatment using agalsidase alfa significantly reduces pain, improves cardiac function and quality of life, and slows renal deterioration. Nevertheless, it is a life-long treatment which requires regular intravenous infusions and entails a great burden for patients. Our objective was to evaluate retrospectively the safety and tolerability of the home infusion of agalsidase alfa in patients with Fabry disease in Argentina. We evaluated all the patients with Fabry disease who received home infusion with agalsidase alfa 0.2 mg/kg between January 2005 and June 2011. The program included 87 patients; 51 males (mean age: 30 years and 36 females (mean age: 34 years. A total of 5229 infusions (mean: 59 per patient; range: 1-150 were administered. A total of 5 adverse reactions were seen in 5 patients (5.7% of patients and 0.9% of the total number of infusions. All were mild in severity and resolved by reducing the rate of infusion and by using antihistaminics. All these 5 patients were positive for IgG antibodies, but none of them presented IgE antibodies and none suffered an anaphylactic shock. In our group 18 patients were switched from agalsidase beta to agalsidase alfa without complications. Home infusion with agalsidase alfa is safe, well tolerated and is associated to high compliance.

  13. Dificuldades na identificação laboratorial da talassemia alfa

    OpenAIRE

    Dias-Penna,Karlla Greick Batista; Melo-Reis,Paulo Roberto de; Mesquita, Mauro Meira de; Silva, Jairo Batista da; Bataus,Luiz Artur Mendes

    2010-01-01

    Introdução: Talassemia alfa é uma síndrome associada à redução da síntese de cadeias de globina do tipo alfa. A gravidade das manifestações clínicas está relacionada com a quantidade de globinas produzida e a estabilidade das cadeias beta presentes em excesso. A talassemia alfa mínima resulta da deleção de apenas um dos quatro genes a (-α/αα). Clinicamente apresenta anemia leve com microcitose ou ausência de anemia, sendo o diagnóstico realizado por meio de visualização da hemo...

  14. Design and Manufacture of the Irradiation Complex "Alfa" for Track Membranes Production

    CERN Document Server

    Alenitsky, Yu G; Vylov, T D; Glazov, A A; Danilov, V I; Denisov, Yu N; Dmitrievsky, V P; Dolya, S N; Zaplatin, N L; Ivashkevich, S A; Kadyshevskij, V G; Kalinichenko, V V; Karamysheva, G A; Klimkin, I P; Kochkin, V A; Morozov, N A; Novikov, D L; Smolkov, A V; Tolstoy, N S; Tychkov, Yu I; Utkin, V A; Fedorenko, S B; Chesnov, A F

    2004-01-01

    The film irradiation complex "Alfa" intended for exposing the polymer films used in the track membranes production was designed and manufactured at the Joint Institute for Nuclear Research for "Trackpore Technology" holding company. The complex consists of the isochronous cyclotron with external injection of ions, the extraction system, the beam transport of accelerated ions and the film irradiation chamber. The complex "Alfa" produces polyethylene terephthalate track membranes with less than 25 {\\mu}m thickness and less than 40 cm width. The film irradiation complex "Alfa" started working in August 2002. Argon ions were accelerated to the project energy - 2.4 MeV/nucleon, extracted beam intensity was about 200 nA, extraction efficiency totaled \\sim 50 %.

  15. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  16. What Happened with Spectrometer Magnet 2B

    Energy Technology Data Exchange (ETDEWEB)

    Green, Michael A

    2010-05-27

    The spectrometer solenoid is supposed to be the first magnets installed in MICE [1]-[4]. This report described what happened during the test of the MICE spectrometer solenoid 2B. First, the report describes the temperatures in the magnet, the cooler top plate and the shield during the run where the magnet quenched at 258 A. During this quench, a lead between the bottom of the HTS leads and the diode bank burned out causing the magnet to quench. Second, three methods for measuring the net heat flow into the cold mass are described. Third, there is a discussion of possible resistive heating in the HTS leads between liquid helium temperature and the copper plate, which is at about 50 K. Fourth, there is a discussion of the measured first stage heat loads in the magnet, when there is no current in the magnet. The first stage heat load calculations are based on knowing the first stage temperatures of the three two-stage pulse tube coolers and the single stage GM cooler. Fifth, the estimated heat load to the first stage when the magnet has current in it is discussed. Sixth, there is a comparison of the stage 1 heat loads in magnet 1A [5], magnet 2A [6], and magnet 2B [7]. Finally there is a discussion of recommended changes for improving the spectrometer solenoids so that the coolers can keep them cold.

  17. Baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF)

    NARCIS (Netherlands)

    McMurray, John J. V.; Anand, Inder S.; Diaz, Rafael; Maggioni, Aldo P.; O'Connor, Christopher; Pfeffer, Marc A.; Solomon, Scott D.; Tendera, Michal; van Veldhuisen, Dirk J.; Albizem, Moetaz; Cheng, Sunfa; Scarlata, Debra; Swedberg, Karl; Young, James B.

    2013-01-01

    Aims This report describes the baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) which is testing the hypothesis that anaemia correction with darbepoetin alfa will reduce the composite endpoint of death from any cause or hospital ad

  18. High-Dose Recombinant Interferon Alfa-2B, Ipilimumab, or Pembrolizumab in Treating Patients With Stage III-IV High Risk Melanoma That Has Been Removed by Surgery

    Science.gov (United States)

    2016-10-10

    Metastatic Non-Cutaneous Melanoma; Non-Cutaneous Melanoma; Recurrent Melanoma of the Skin; Recurrent Non-Cutaneous Melanoma; Stage III Mucosal Melanoma of the Head and Neck; Stage IIIA Skin Melanoma; Stage IIIB Skin Melanoma; Stage IIIC Skin Melanoma; Stage IV Skin Melanoma; Stage IVA Mucosal Melanoma of the Head and Neck; Stage IVB Mucosal Melanoma of the Head and Neck; Stage IVC Mucosal Melanoma of the Head and Neck

  19. Agregación de alfa-sinucleína y degeneración Parkinsoniana

    OpenAIRE

    Fernández-Espejo, Emilio

    2013-01-01

    La alfa-sinucleína es la proteína principal de los cuerpos de Lewy, marcador anatomopatológico de la enfermedad de Parkinson. Dicha proteína puede ver alterada su conformación y adquirir capacidad autoagregante, lo que se relaciona con el depósito de agregados proteináceos en las neuronas y podría constituir un factor fisiopatológico importante en dicha enfermedad. Los agregados poseen fibrillas de alfa-sinucleína alterada, y las moléculas se encuentran unidas entre sí por enlaces no...

  20. The ATLAS ALFA and AFP detectors - the experimental challenge of measuring forward protons at the LHC

    CERN Document Server

    Trzebinski, M; The ATLAS collaboration

    2013-01-01

    The Absolute Luminosity For ATLAS (ALFA) and ATLAS Forward Protons (AFP) detectors are introduced. The forward proton trajectories are shown. The similarities and differences between these two detector systems are described. Finally, the physics possible to be done in these forward detectors is discussed. In particular, in case of ALFA the elastic scattering and exclusive di-pion production are described. In case of AFP, the hard diffractive processes like: Single Diffractive Jet, Double Pomeron Exchange Jet, Exclusive Jet and anomalous coupling production are described.

  1. ESTABILIZACIÓN DE HOLO-alfa-LACTOALBÚMINA EN PRESENCIA DE POLIOLES

    Directory of Open Access Journals (Sweden)

    Alberto Albis

    2010-02-01

    Full Text Available En este trabajo se presenta un estudio sistemático sobre el efecto de las soluciones acuosas de eritritol, xilitol, sorbitol e inositol con diferentes concentraciones, sobre la estabilidad térmica de la holo- alfa-lactoalbúmina bovina con pH 6,5 usando espectroscopia UV-VIS. Los resultados obtenidos muestran que los polioles usados estabilizan la holo-alfa-lactoalbúmina en un grado significativamente menor al reportado para otras proteínas. Se sugiere que este menor efecto de estabilización ocurre debido a que esta proteína presenta un estado desnaturalizado parcialmente desdoblado.

  2. VizieR Online Data Catalog: Arecibo Pulsar-ALFA (PALFA) survey. IV. (Lazarus+, 2015)

    Science.gov (United States)

    Lazarus, P.; Brazier, A.; Hessels, J. W. T.; Karako-Argaman, C.; Kaspi, V. M.; Lynch, R.; Madsen, E.; Patel, C.; Ransom, S. M.; Scholz, P.; Swiggum, J.; Zhu, W. W.; Allen, B.; Bogdanov, S.; Camilo, F.; Cardoso, F.; Chatterjee, S.; Cordes, J. M.; Crawford, F.; Deneva, J. S.; Ferdman, R.; Freire, P. C. C.; Jenet, F. A.; Knispel, B.; Lee, K. J.; van Leeuwen, J.; Lorimer, D. R.; Lyne, A. G.; McLaughlin, M. A.; Siemens, X.; Spitler, L. G.; Stairs, I. H.; Stovall, K.; Venkataraman, A.

    2016-02-01

    The Arecibo Pulsar-ALFA (PALFA) survey observations have been restricted to the two regions of the Galactic plane (|b|<5°) visible from the Arecibo observatory, the inner Galaxy (32°<~l<~77°), and the outer Galaxy (168°<~l<~214°). Integration times are 268s and 180s for inner and outer Galaxy observations, respectively. Observations conducted with the 7-beam Arecibo L-band Feed Array (ALFA) receiver of the Arecibo Observatory William E. Gordon 305m Telescope have a bandwidth of 322MHz centered at 1375MHz. PALFA survey data have been recorded with the Mock spectrometers since 2009. (2 data files).

  3. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.

  4. Asociaciones en el aprendizaje instrumental en humanos

    Directory of Open Access Journals (Sweden)

    A. Matías Gámez Martínez

    2011-03-01

    Full Text Available Para profundizar en el conocimiento del aprendizaje como proceso psicológico es necesario esclarecer cuáles son sus contenidos. En este sentido, durante parte del siglo pasado numerosas investigaciones se han dedicado a determinar qué asociaciones están implicadas tanto en el aprendizaje pavloviano como instrumental en animales no humanos, siendo más escasos los estudios centrados en el ser humano. De esta forma, presentamos a continuación evidencia acerca de las asociaciones que pueden establecerse entre los elementos implicados en una situación de aprendizaje instrumental en seres humanos, a saber, el estímulo, la respuesta a ese estímulo y la consecuencia de dicha respuesta.

  5. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  6. El órgano vomeronasal humano

    OpenAIRE

    Naser G,Alfredo; Fullá O,Juan; Varas P,Mª Antonieta; Nazar S,Rodolfo

    2008-01-01

    El órgano vomeronasal (OVN) es una estructura que estudiamos alguna vez en anatomía, sin embargo su ubicación, frecuencia y función específica en humanos ha sido poco estudiada. Por este motivo se realizó una revisión bibliográfica actualizada acerca del OVN humano, enf atizando en puntos Importantes como su anatomía y relación con algunas conductas. Hoy en día es considerado como un órgano olfatorio accesorio, capaz de percibir la presencia de vomeroferinas. Estas corresponden a un grupo de ...

  7. Flujos migratorios y movilidad del capital humano

    OpenAIRE

    2009-01-01

    En este trabajo se estiman los flujos migratorios de capital humano entre las regiones españolas a partir de un conjunto de hipótesis. Los resultados indican un aumento de la intensidad de los flujos brutos de migrantes con niveles de instrucción de 2° y 3er grado. Se constata que en España existen tres polos de atracción y emisión de capital humano centrados en Madrid, País Vasco y Cataluña, y actuando de forma independiente. Asimismo, se obtiene un grado de adecuación apreciable entre el ni...

  8. Desarrollo emocional: Impactos en el desarrollo humano

    OpenAIRE

    Mulsow G., Gloria Natacha; Instituto de Filosofía y Estudios Educacionales Universidad Austral de Chile

    2008-01-01

    El presente artículo pretende generar espacios de reflexión en torno al hecho que el desarrollo emocional impacta el desarrollo humano y a la vez se ve impactado por éste. Lo que la persona aporta, a través de su constitución y herencia, al medio en el que se desenvuelve, le permite si las condiciones están dadas elaborar competencias socio-emocionales que le posibilitarán desenvolverse mejor y alcanzar una vida de calidad. El desarrollo humano no sólo debe ser sostenible sino que debe permit...

  9. Talento humano y trabajo en equipo del personal directivo de las universidades del municipio Maracaibo

    Directory of Open Access Journals (Sweden)

    Maribel Medina Fuenmayor

    2010-01-01

    Full Text Available El propósito de esta investigación fue determinar la relación entre talento humano y trabajo en equipo del personal directivo de las universidades del Municipio Maracaibo, sobre la base de los enfoques teóricos de Alles (2005, Dolan et al. (2003, Gubman (2000, Hayes (2002, Jericó (2001, entre otros. La investigación se tipificó como correlacional, no experimental y transversal, utilizando una población de 31 sujetos pertenecientes a la planta directiva de administración de las referidas universidades públicas y privadas. La técnica de recolección de datos fue la observación mediante encuesta, para lo cual se diseñaron dos (2 instrumentos de recolección de datos, estructurados con cinco alternativas de respuestas bajo una escala de actitud tipo Likert, utilizando una validez de contenido por el criterio de 10 expertos, utilizando además el análisis discriminante de ítems, lo cual permitió mayor certeza en sus diseños. La confiabilidad fue calculada por el coeficiente Alfa de Cronbach, el cual arrojó un valor de 0.99 para talento humano y 0.91 para trabajo en equipo, siendo altamente consistentes. Los resultados se analizaron mediante estadística descriptiva con frecuencias absolutas y porcentuales, soportadas con medidas de tendencia central, haciendo uso además de la estadística inferencial con pruebas no paramétricas. Como conclusión, se observó una correlación con dirección positiva y magnitud fuerte entre las variables con un índice rho de Spearman de 0.88, lo que sugiere que bajo las actuales condiciones de este estudio existe una fuerte concomitancia entre las variables.

  10. The Synchrony and Diachrony of Bosnian-Croatian-Serbian Adjectival Long-Form Allomorphy (ALFA)

    Science.gov (United States)

    Pennington, James Joshua

    2010-01-01

    In Bosnian-Croatian-Serbian (BCS), the gentive (G) and dative/locative (DL) cases exhibit adjectival long-form allomorphy (ALFA). The genitive -"og" -"oga" and the DL -"om" -"ome" -"omu" stand in free variation, inasmuch as when one form is substituted for another the truth value of an utterance…

  11. A Trial of Darbepoetin Alfa in Type 2 Diabetes and Chronic Kidney Disease

    NARCIS (Netherlands)

    Pfeffer, Marc A.; Burdmann, Emmanuel A.; Chen, Chao-Yin; Cooper, Mark E.; de Zeeuw, Dick; Eckardt, Kai-Uwe; Feyzi, Jan M.; Ivanovich, Peter; Kewalramani, Reshma; Levey, Andrew S.; Lewis, Eldrin F.; McGill, Janet B.; McMurray, John J. V.; Parfrey, Patrick; Parving, Hans-Henrik; Remuzzi, Giuseppe; Singh, Ajay K.; Solomon, Scott D.; Toto, Robert

    2009-01-01

    BACKGROUND Anemia is associated with an increased risk of cardiovascular and renal events among patients with type 2 diabetes and chronic kidney disease. Although darbepoetin alfa can effectively increase hemoglobin levels, its effect on clinical outcomes in these patients has not been adequately te

  12. A trial of darbepoetin alfa in type 2 diabetes and chronic kidney disease

    DEFF Research Database (Denmark)

    Pfeffer, Marc A; Burdmann, Emmanuel A; Chen, Chao-Yin

    2009-01-01

    BACKGROUND: Anemia is associated with an increased risk of cardiovascular and renal events among patients with type 2 diabetes and chronic kidney disease. Although darbepoetin alfa can effectively increase hemoglobin levels, its effect on clinical outcomes in these patients has not been adequatel...

  13. Artur Gas, editor de Josep Pla: breu història d'Ediciones Alfa

    OpenAIRE

    Pla, Xavier

    1997-01-01

    Repàs de la trajectòria professional com a editor, començant com a editor de caire socialista i acabant col·laborant amb la dictadura de Primo de Rivera. Es fa especial menció al seu paper com a editor de Josep Pla i a la seva editorial, Ediciones Alfa

  14. High antibody titer in an adult with Pompe disease affects treatment with alglucosidase alfa.

    Science.gov (United States)

    de Vries, Juna M; van der Beek, Nadine A M E; Kroos, Marian A; Ozkan, Lale; van Doorn, Pieter A; Richards, Susan M; Sung, Crystal C C; Brugma, Jan-Dietert C; Zandbergen, Adrienne A M; van der Ploeg, Ans T; Reuser, Arnold J J

    2010-12-01

    Clinical trials have demonstrated beneficial effects of enzyme replacement therapy (ERT) with alglucosidase alfa in infants, children and adults with Pompe disease. Recent studies have shown that high antibody titers can occur in patients receiving ERT and counteract the effect of treatment. This particularly occurs in those patients with classic-infantile Pompe disease that do not produce any endogenous acid α-glucosidase (CRIM-negative). It is still unclear to what extent antibody formation affects the outcome of ERT in adults with residual enzyme activity. We present the case of a patient with adult-onset Pompe disease. He was diagnosed at the age of 39years by enzymatic testing (10.7% residual activity in fibroblasts) and DNA analysis (genotype: c.-32-13T>G/p.Trp516X). Infusion-associated reactions occurred during ERT and the patient's disease progressed. Concurrently, the antibody titer rose to a similarly high level as reported for some CRIM-negative patients with classic-infantile Pompe disease. Using newly developed immunologic-assays we could calculate that approximately 40% of the administered alglucosidase alfa was captured by circulating antibodies. Further, we could demonstrate that uptake of alglucosidase alfa by cultured fibroblasts was inhibited by admixture of the patient's serum. This case demonstrates that also patients with an appreciable amount of properly folded and catalytically active endogenous acid α-glucosidase can develop antibodies against alglucosidase alfa that affect the response to ERT.

  15. Validación de dos escalas utilizadas en la medición del cuidado humano transpersonal basadas en la Teoría de Jean Watson

    Directory of Open Access Journals (Sweden)

    Margarita del Carmen Poblete-Troncoso

    2012-01-01

    Full Text Available Objetivo: validar Caring Efficacy Scale y Nyberg's Caring Assessment, elementos basados en la Teoría Transpersonal del Cuidado Humano que se fundamenta en los aspectos humanos y éticos del cuidado. Método: los instrumentos fueron validados en una muestra de 360 enfermeras chilenas. Los coeficientes de alfa de Cronbach fueron de 0,76 para Caring Efficacy Scale, y de 0,82 para el Nyberg's Caring Assessment. En cuanto a la validez de constructo ambos instrumentos se correlacionan positiva y significativamente. Resultados: se pondera divergencia como estrategia de esta validez en ambos instrumentos y se utiliza una subescala que evalúa la falta de empatía con el sufrimiento del otro. Conclusión: la validación de estas escalas es un aporte al cuidado humano transpersonal, para conocer el significado que las enfermeras le otorgan, y cuán eficaces se sienten, así cómo remediar aspectos deficitarios en la enseñanza y práctica del cuidado.

  16. Diagnóstico molecular da talassemia ALFA+ (DELEÇÃO -3.7) em indivíduos com microcitose e/ou hipocromia

    OpenAIRE

    Bezerra, Christiane Medeiros

    2009-01-01

    A talassemia alfa, uma das doenças monogênicas mais comuns no mundo, resulta de um desequilíbrio na síntese das cadeias alfa da hemoglobina devido, principalmente, à deleção de um ou ambos os genes da globina alfa, sendo a deleção - a mais freqüente. A talassemia alfa, juntamente com a deficiência de ferro e a talassemia beta, representa uma importante causa de microcitose e hipocromia. Com o objetivo de diagnosticar e verificar a prevalência da talassemia alfa (-3.7) em indivíduos co...

  17. Interacciones humano-animal: características e implicaciones para el bienestar de los humanos

    Directory of Open Access Journals (Sweden)

    Natalia Piar

    2007-07-01

    Full Text Available En este artículo se revisa la literatura reciente sobre interacciones humano-animal, su origen, sus características y cómo dichas interacciones afectan el bienestar físico, psicológico y social. En la primera parte se presentan los orígenes y evolución histórica de las relaciones humano - animal, empezando por los procesos de domesticación y se aborda la naturaleza de las interacciones humano animal. En la segunda parte, se revisan los efectos para los humanos de la interacción con animales, especialmente con sus mascotas y se analiza la literatura científica sobre los efectos físicos, psicológicos y sociales. Finalmente, se aborda brevemente el desarrollo de esta área de investigación en Latinoamérica.

  18. Jurisprudencia del Tribunal Europeo de Derechos Humanos

    OpenAIRE

    Martínez Muñoz, Yolanda

    2016-01-01

    En este trabajo se realiza un análisis de la jurisprudencia del Tribunal Europeo de Derechos Humanos en materia tributaria durante el último año, incidiendo en aquellos problemas más importantes y en la solución del Tribunal en aquellos casos más relevantes.

  19. Los incómodos derechos humanos

    OpenAIRE

    Kesch, Emilie

    2014-01-01

    A casi sesenta y un años de la firma del tratado por la ONU sobre los Derechos Humanos son innumerables los asesinatos, genocidios, y torturas ocurridos en todo el mundo. Basta con ojear un :poco en nuestro pasado histórico para darnos cuenta que la teoría difiere abismalmente de la práctica.

  20. Drotrecogin alfa (activated in severe sepsis: a systematic review and new cost-effectiveness analysis

    Directory of Open Access Journals (Sweden)

    Brophy James M

    2007-06-01

    Full Text Available Abstract Background Activated drotrecogin alfa (human activated protein C, rhAPC, is produced by recombinant DNA technology, and purports to improve clinical outcomes by counteracting the inflammatory and thrombotic consequences of severe sepsis. Controversy exists around the clinical benefits of this drug and an updated economic study that considers this variability is needed. Methods A systematic literature review was performed using Medline, Embase and the International Network of Agencies for Health Technology Assessment (INAHTA databases to determine efficacy, safety and previous economic studies. Our economic model was populated with systematic estimates of these parameters and with population life tables for longer term survival information. Monte Carlo simulations were used to estimate the incremental cost-effectiveness ratios (ICERs and variance for the decision analytic models. Results Two randomized clinical trials (RCTS of drotrecogin alfa in adults with severe sepsis and 8 previous economic studies were identified. Although associated with statistical heterogeneity, a pooled analysis of the RCTs did not show a statistically significant 28-day mortality benefit for drotrecogin alfa compared to placebo either for all patients (RR: 0.93, 95% CI: 0.69, 1.26 or those at highest risk as measured by APACHE II ≥ 25 (RR: 0.90, 95% CI: 0.54, 1.49. Our economic analysis based on the totality of the available clinical evidence suggests that the cost-effectiveness of drotrecogin alfa is uncertain ( Conclusion The evidence supporting the clinical and economic attractiveness of drotrecogin alfa is not conclusive and further research appears to be indicated.

  1. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  2. 7 CFR 301.80-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.80-2b Section 301.80-2b....80-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines. (a) The following articles are exempt from the certification and permit...

  3. 7 CFR 301.85-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles...

  4. Genetics Home Reference: CHMP2B-related frontotemporal dementia

    Science.gov (United States)

    ... Conditions CHMP2B-related frontotemporal dementia CHMP2B-related frontotemporal dementia Enable Javascript to view the expand/collapse boxes. ... Open All Close All Description CHMP2B -related frontotemporal dementia is a progressive brain disorder that affects personality, ...

  5. ¿Derechos humanos o derechos liberales?

    Directory of Open Access Journals (Sweden)

    Esther Parra Ramírez

    2000-01-01

    Full Text Available Compartiendo el desafío planteado por algunas organizaciones no gubernamentales de empezar el siglo y el milenio con la convicción de que desde lo cultural y lo educativo podemos contribuir a transformar los conflictos sin violencia1 , este artículo busca abrir un espacio para la reflexión sobre la problemática de los derechos humanos. Planteamos la necesidad de ahondar en torno a los derechos civiles, políticos, económicos y culturales como la condición sine qua non de la Paz Integral; pretendemos retomar este nuevo paradigma fundamental para afianzar los valores humanos en la conciencia colectiva de los ciudadanos, ya que si bien todos apelamos al lenguaje de los derechos, cada cual parece entender a su manera el sentido y el alcance de los mismos.

  6. Stroke in patients with type 2 diabetes mellitus, chronic kidney disease, and anemia treated with Darbepoetin Alfa

    DEFF Research Database (Denmark)

    Skali, Hicham; Parving, Hans-Henrik; Parfrey, Patrick S

    2011-01-01

    More strokes were observed in the Trial to Reduce Cardiovascular Events With Aranesp Therapy (TREAT) among patients assigned to darbepoetin alfa. We sought to identify baseline characteristics and postrandomization factors that might explain this association....

  7. Dimensiones de los derechos humanos fundamentales

    Directory of Open Access Journals (Sweden)

    MEZZAROBA, Orides

    2013-01-01

    Full Text Available El presente artículo tiene por objetivo proponer un nuevoa bordaje filosófico y jurídico de los derechos humanos fundamentales, con el intuito de desarrollar una herramienta que permita al intérprete evaluar objetivamente casos concretos, de forma que pueda diferenciar una práctica cultural de una violación a la dignidad humana.

  8. Homo floresiensis. Humanos distintos a nosotros.

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Marmelada

    2008-08-01

    Full Text Available Desde su descubrimiento, la polémica en torno al estatus de Homo floresiensis no ha cesado. ¿Son humanos de nuestra propia especie, pero que eran pigmeos que padecieron enanismo, microcefalia y otra serie de patologías, o se trata de miembros de una especie distinta a la nuestra? El hallazgo de restos pertenecientes a 13 individuos y el estudio de varias partes de su esqueleto avalan la segunda hipótesis.

  9. Justicia, propiedad intelectual y genoma humano

    Directory of Open Access Journals (Sweden)

    Maria Graciela De Ortuzar

    2014-06-01

    Full Text Available A partir del conocimiento de la secuenciación del genoma humano es posible el descubrimiento de nuevas terapias, drogas, y causas de enfermedades. Sin embargo, lejos de aumentar el acceso a la atención de la salud, el proyecto genoma humano restringió dicho acceso debido a la rápida comercialización y al creciente ?patentamiento del material humano? -hecho que atenta contra el fundamento ético del sistema jurídico internacional de patentes-.En manos exclusivas de monopolios privados, las ?patentes genéticas? pueden traducirse en altísimos costos de nuevas drogas, tests, y tratamientos para los países en desarrollo. Por lo tanto, si bien la salud humana es presentada como el objetivo último de las investigaciones genómicas, la citada comercialización atenta contra el derecho a la salud y el derecho al conocimiento debido a que imponen una mayor desigualdad y vulnerabilidad de los países en desarrollo por su restricción de acceso. Cabe destacar que es en dichos(países donde se obtiene la información primariaii. En éste nuevo orden internacional de distribución en salud impuesto desde la Organización Mundial de Comercio- OMC- y no desde la Organización Mundial de Salud - OMS-; el actor principal en la ley de patentes, y el beneficiario de la protección que la misma provee, no es ahora el que inventa sino el que invierte.iii Por ello, el objetivo general de la presente investigación es elaborar un marco ético-legal universalista, con especificación plural en ámbitos locales, que regule la investigación del genoma humano en pos de la justa distribución de sus beneficios .

  10. Flujos migratorios y movilidad del capital humano

    Directory of Open Access Journals (Sweden)

    Bernardí Cabrer

    2009-01-01

    Full Text Available En este trabajo se estiman los flujos migratorios de capital humano entre las regiones españolas a partir de un conjunto de hipótesis. Los resultados indican un aumento de la intensidad de los flujos brutos de migrantes con niveles de instrucción de 2° y 3er grado. Se constata que en España existen tres polos de atracción y emisión de capital humano centrados en Madrid, País Vasco y Cataluña, y actuando de forma independiente. Asimismo, se obtiene un grado de adecuación apreciable entre el nivel educativo de los inmigrantes y los requerimientos de cualificación de la mano de obra de cada región. Sin embargo, se obtiene que los años medios de estudio de la población potencialmente activa han aumentado frente a la estabilidad de los de la población migrante, por lo que no cabe señalar la inmigración como un factor relevante para reducir las disparidades interregionales en capital humano.

  11. POBREZA, RECURSOS HUMANOS Y DESARROLLO SOSTENIBLE

    Directory of Open Access Journals (Sweden)

    Jorge Mora Alfaro

    2011-09-01

    Full Text Available Dos desafíos de enorme trascendencia enfrentan América Latina y el Caribe al arribar al siglo XXI: por un lado, crear las condiciones apropiadas para insertarse con éxito en el interconectado, competitivo y exigente mundo contemporáneo. Por otro lado, superar los obstáculos al logro de la aspiración del desarrollo humano sostenible, entre los que sobresale la ausencia de mecanismos eficaces de distribución del ingreso y la significativa cantidad de seres humanos sumidos en la pobreza y las privaciones.Estas dos dimensiones del desarrollo regional se encuentran estrechamente entrelazadas y mutuamente condicionadas. Una distribución más equitativa del ingreso contribuye a elevar la movilidad social, el acceso a la educación, el aumento de la productividad y la estabilidad, aspectos esenciales para acrecentar la capacidad competitiva y para lograr una inserción de calidad en el contexto internacional. Una estrategia de integración en el contexto internacional, sustentada en las fortalezas nacionales, en la identidad cultural y en el capital humano, posibilita la sostenibilidad y la distribución de los beneficios entre los diversos estratos de la sociedad.

  12. Obligaciones morales con seres no humanos

    Directory of Open Access Journals (Sweden)

    Rodrigo J. Ocampo

    2014-06-01

    Full Text Available Entre los modelos de reflexión ética a partir de los cuales es posible dar cuenta del debate sobre las relaciones entre seres humanos y no humanos están: el deontológico, el contractualista, el utilitarista, el neoaristotélico y el discursivo. En este artículo se examinará, a partir de ellos, la cuestión del estatus moral asignado a los animales y a la naturaleza, junto con la posibilidad de cada uno para sustentar la ampliación de las obligaciones morales. Para tal fin, se estudian los principales argumentos para reconocer o negar consideración moral a seres no humanos, así como los alcances de estas justificaciones para comprender el sentido y límites de la comunidad ética. Esto permitirá clasificar los enfoques éticos mencionados atendiendo a sus afinidades con diversas formas de antropocentrismo o biocentrismo.

  13. Darbepoietin-alfa has comparable erythropoietic stimulatory effects to recombinant erythropoietin whilst preserving the bone marrow microenvironment.

    Science.gov (United States)

    Dewamitta, Sita R; Russell, Megan R; Nandurkar, Harshal; Walkley, Carl R

    2013-05-01

    Erythropoiesis stimulating agents are widely used for the treatment of anemia. Recently, we reported erythroid expansion with impaired B lymphopoiesis and loss of trabecular bone in C57BL/6 mice following ten days of treatment with low-dose short acting recombinant human erythropoietin. We have assessed erythropoietin against longer-acting darbepoietin-alfa at a comparable erythroid stimulatory dosage regime. Darbepoietin-alfa and erythropoietin induced similar in vivo erythropoietic expansion. Both agents induced an expansion of the colony-forming unit-erythroid populations. However, unlike erythropoietin, darbepoietin-alfa did not impair bone marrow B lymphopoiesis. Strikingly the bone loss observed with erythropoietin was not apparent following darbepoietin-alfa treatment. This analysis demonstrates that whilst darbepoietin-alfa has similar in vivo erythropoietic potency to erythropoietin, it preserves the bone marrow microenvironment. Thus erythropoietin and darbepoietin-alfa manifest different action showing that erythropoiesis stimulating agents have differential non-erythroid effects dependent on their duration of action.

  14. PTK2b function during fertilization of the mouse oocyte

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Jinping [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); McGinnis, Lynda K. [Department of Molecular and Integrative Physiology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Carlton, Carol [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Beggs, Hilary E. [Department of Ophthalmology, University of California, San Francisco, CA (United States); Kinsey, William H., E-mail: wkinsey@kumc.edu [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States)

    2014-08-01

    Highlights: • PTK2b is expressed in oocytes and is activated following fertilization. • PTK2b suppression in oocytes prevents fertilization, but not parthenogenetic activation. • PTK2b suppression prevents the oocyte from fusing with or incorporating bound sperm. • PTK2b suppressed oocytes that fail to fertilize do not exhibit calcium oscillations. - Abstract: Fertilization triggers rapid changes in intracellular free calcium that serve to activate multiple signaling events critical to the initiation of successful development. Among the pathways downstream of the fertilization-induced calcium transient is the calcium-calmodulin dependent protein tyrosine kinase PTK2b or PYK2 kinase. PTK2b plays an important role in fertilization of the zebrafish oocyte and the objective of the present study was to establish whether PTK2b also functions in mammalian fertilization. PTK2b was activated during the first few hours after fertilization of the mouse oocyte during the period when anaphase resumption was underway and prior to the pronuclear stage. Suppression of PTK2b kinase activity in oocytes blocked sperm incorporation and egg activation although sperm-oocyte binding was not affected. Oocytes that failed to incorporate sperm after inhibitor treatment showed no evidence of a calcium transient and no evidence of anaphase resumption suggesting that egg activation did not occur. The results indicate that PTK2b functions during the sperm-egg fusion process or during the physical incorporation of sperm into the egg cytoplasm and is therefore critical for successful development.

  15. Development of a detector (ALFA) to measure the absolute LHC luminosity at ATLAS

    CERN Document Server

    Mapelli, A; Ask, S; Barrillon, P; Blanchot, G; Blin, S; Braem, André; Cheiklali, C; de La Taille, C; Di Girolamo, B; Efthymiopoulos, I; Faustino, J; Fournier, D; Franz, S; Grafström, P; Gurriana, L; Haguenauer, M; Hedberg, V; Heller, M; Hoffmann, S; Iwanski, W; Joram, C; Kocnar, A; Lavigne, B; Lundberg, B; Maio, A; Maneira, M J P; Marques, C; Mjörnmark, U; Conde-Muíño, P; Puzo, P; Rijssenbeeck, M; Santos, J P; Saraiva, J G; Seguin-Moreau, N; Soares, S; Stenzel, H; Thioye, M; Valladolid-Gallego, E; Vorobel, V; 10th ICATPP Conference on Astroparticle, Particle, Space Physics, Detectors and Medical Physics Applications

    2008-01-01

    The ATLAS collaboration plans to determine the absolute luminosity of the CERN LHC at Interaction Point 1 by measuring the trajectory of protons elastically scattered at very small angles ($\\mu rad$). A scintillating fibre tracker system called ALFA (Absolute Luminosity For ATLAS) is proposed for this measurement. Detector modules will be placed above and below the LHC beam axis in roman pot units at a distance of 240 m on each side of the ATLAS interaction point. They allow the detectors to approach the beam axis to millimeter distance. Overlap detectors also based on the scintillating fibre technology, will measure the precise relative position of the two detector modules. Results obtained during beam tests at DESY and at CERN validate the detectors design and demonstrate the achievable resolution. We also report about radiation hardness studies of the scintillating fibres to estimate the lifetime of the ALFA system at different operating conditions of the LHC.

  16. Deficiência de alfa-1 antitripsina: diagnóstico e tratamento

    OpenAIRE

    2008-01-01

    A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que de...

  17. Haplotypes frequencies of CYP2B6 in Malaysia

    Directory of Open Access Journals (Sweden)

    N Musa

    2012-01-01

    Full Text Available Background: Drugs with complex pharmacology are used in the management of drug use disorder (DUD and HIV/AIDS in Malaysia and in parts of South-East Asia. Their multiethnic populations suggest complexity due to the genetic polymorphism, such as CYP2B6 that metabolizes methadone and anti-retroviral. Aims: Our aim was to explore the genetic polymorphism of CYP2B6 among Malays, Chinese, Indians, and opiate-dependent individuals in Malaysia. Settings and Design: The study utilized DNA from our previous studies on CYPs and new recruitments from opiate-dependent individuals. Materials and Methods: For the new recruitment, after obtaining consent and baseline demography, 5 ml blood was obtained from patients attending methadone maintenance therapy (MMT Clinics. Genomic DNA was extracted using standard methods. 10 nucleotide changes associated with CYP2B6FNx0110, CYP2B6FNx012, CYP2B6FNx0117, CYP2B6FNx0111, CYP2B6FNx018, CYP2B6FNx0114, CYP2B6FNx019, CYP2B6FNx014, CYP2B6FNx016, CYP2B6FNx0127, and CYP2B6FNx0120 were determined using multiplex nested allele-specific PCR. Statistical Analysis: Descriptive statistics were used to summarize demographic data. Differences in allele frequencies between populations were tested using Chi-squared test and were corrected using the Bonferroni test. Results: CYP2B6 polymorphism in Malaysia is variable with trends that suggest an ethnic difference. Reduced activity CYP2B6FNx016 occurred in 13% to 26% among Malays, Chinese, Indians and opiate-dependent individuals. Another ′reduced activity′, CYP2B6FNx012 allele, was found at much lower percentages in the groups. Conclusions: The relative commonness of reduced-activity CYP2B6 alleles in our study called for attention in terms of dosage requirements for MMT and ARV in Malaysia. It also implored follow-up association studies to determine its relevance and consequences in personalized medicine for drug use disorder and HIV/AIDS.

  18. The Arecibo Legacy Fast ALFA Survey: II. Results of Precursor Observations

    CERN Document Server

    Giovanelli, R; Kent, B R; Perillat, P; Catinella, B; Hoffman, G L; Momjian, E; Rosenberg, J L; Saintonge, A; Spekkens, K; Stierwalt, S; Brosch, N; Masters, K L; Springob, C M; Karachentsev, I D; Karachentseva, V E; Koopmann, R A; Müller, E; Van Driel, W; Van Zee, L; Giovanelli, Riccardo; Haynes, Martha P.; Kent, Brian R.; Perillat, Philip; Catinella, Barbara; Momjian, Emmanuel; Rosenberg, Jessica L.; Saintonge, Amelie; Spekkens, Kristine; Stierwalt, Sabrina; Brosch, Noah; Masters, Karen L.; Springob, Christopher M.; Karachentsev, Igor D.; Karachentseva, Valentina E.; Koopmann, Rebecca A.; Muller, Erik; Driel, Wim van; Zee, Liese van

    2005-01-01

    In preparation for the full Arecibo Legacy Fast ALFA extragalactic HI survey, precursor observations were carried out in Aug--Sep 2004 with the 7-beam Arecibo L-band feed array (ALFA) receiver system and the WAPP spectral processors. While these observations were geared mainly at testing and debugging survey strategy, hardware and software, approximately 36 hours of telescope time yielded science--quality data. From those observations, an initial list of 730 tentative detections of varying degree of reliability was extracted. Ninety--eight high signal-to-noise candidates were deemed to be bona fide HI line detections. To test our ability to discriminate cosmic signals from RFI and noise, 165 candidates ranging in reliability likelihood were re--observed with the single beam L--band wide system at Arecibo in Jan--Feb 2005. Of those, 41% were confirmed as real. We present the results of both the ALFA and single beam observations for the sample of 166 confirmed HI sources, as well as our assessment of their opti...

  19. Preparation And Properties Of Bionanocomposite Films Reinforced With Nanocellulose Isolated From Moroccan Alfa Fibres

    Directory of Open Access Journals (Sweden)

    Youssef Benyoussif

    2015-09-01

    Full Text Available Nanocellulose (NC were extracted from the Moroccan Alfa plant (Stipa tenacissima L. and characterised. These Alfa cellulosic nanoparticles were used as reinforcing phase to prepare bionanocomposite films using carboxymethyl cellulose as matrix. These films were obtained by the casting/evaporation method. The crystallinity of NC was analysed by X-ray diffraction, the dimension of NC by atomic force microscopy, molecular interactions due to incorporation of NC in carboxymethyl cellulose (CMC matrix were supported by Fourier transforms infrared (FTIR spectroscopy. The properties of the ensuing bionanocomposite films were investigated using tensile tests, water vapour permeability (WVP study and thermogravimetric analysis. With the progress of purification treatment of cellulose, the crystallinity is improved compared to the untreated fibres; this can be explained by the disappearance of the amorphous areas in cellulose chain of the plant. Consequently, the tensile modulus and tensile strength of CMC film increased by 60 and 47%, respectively, in the bionanocomposite films with 10 wt% of NC, and decrease by 8.6% for WVP with the same content of NC. The NC obtained from the Moroccan Alfa fibres can be used as a reinforcing agent for the preparation of bionanocomposites, and they have a high potential for the development of completely biodegradable food packaging materials.

  20. Oxitocina e comportamento humano Oxitocina y comportamiento humano Oxytocin and human behavior

    OpenAIRE

    Diana Catarina Ferreira de Campos; João Manuel Garcia do Nascimento Graveto

    2010-01-01

    Recentemente, têm surgido numerosas especulações sobre o papel da oxitocina nas emoções e relações sociais do ser humano. O presente artigo retrata um estudo essencialmente reflexivo sobre o papel da oxitocina no comportamento humano. A pesquisa bibliográfica foi efectuada nas bases de dados MEDLINE, versão PubMed e CINAHL. Os principais resultados das pesquisas sustentam que os níveis de oxitocina aumentam em resposta à aplicação de massagem e indução de emoções positivas. A administração in...

  1. Analysis list: GTF2B [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available GTF2B Blood,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GT...F2B.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GTF2B.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/hg19/target/GTF2B.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/GTF2B.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/GTF2B.Uterus.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Uterus.gml ...

  2. Main: 1I2B [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I2B シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Udp-Sulfoquinovose Syntha...AAM47379.1; -.|PIR; T05311; T05311.|PDB; 1I24; X-ray; A=74-477.|PDB; 1I2B; X-ray; A=74-477.|PDB; 1I2C; X-ray...CVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1I2B.jpg ...

  3. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  4. Nacionalismo constitucional y Derecho internacional de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Eduardo Meier García

    2011-01-01

    Full Text Available En este artículo se analizan las sentencias del Tribunal Supremo de Justicia venezolano que desconocen el Derecho internacional de los derechos humanos, al realizar un inusual control de constitucionalidad sobre las sentencias de la Corte Interamericana de Derechos Humanos, desestimar sus efectos directos e indirectos y solicitar la denuncia de la Convención Americana sobre Derechos Humanos.

  5. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I;

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient. ...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  6. RAZVOJ B2B PORTALA ZA POTREBE ELEKTRONSKEGA POSLOVANJA

    OpenAIRE

    Slanič, Matej

    2011-01-01

    V diplomski nalogi opredelimo vlogo B2B portalov in pomen elektronskega poslovanja. B2B portale smo razvrstili glede na različne kriterije in predstavili različne modele trgovanja na njih. Velik del pozornosti smo posvetili tudi strateškemu načrtovanju B2B poslovanja in vključevanju podjetij na B2B portale, dotaknili pa smo se tudi vizije elektronskega poslovanja. Osrednji del naloge obsega predstavitev gradnje specifičnega portala Bbuines.com ter z njo povezane oblikovne in tehnološke rešitv...

  7. Scientific core hole Valles caldera No. 2b (VC-2b), New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Garner, J.N.; Hulen, J.B.; Lysne, P.; Jacobson, R.; Goff, F.; Nielson, D.L.; Pisto, L.; Criswell, C.W.; Gribble, R. (Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Sandia National Labs., Albuquerque, NM (USA); Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Tonto Drilling Services, Inc., Salt Lake City, UT (USA); Los Alamo

    1989-01-01

    Research core hole was continuously cored to 1.762 km on the western flank of the caldera's resurgent dome in 1988. Bottom hole temperature is about 295{degree}C within Precambrian (1.5 Ga) quartz monzonite, deep within the liquid-dominated portions of the Sulphur Springs hydrothermal system. VC-2b may be the deepest, hottest, continuously cored hole in North America. Core recovery was 99.2%. The only major drilling problems encountered were when temperatures at the bit exceeded 225{degree}C below depths of about 1000 m. The result of these conditions was loss of viscosity and/or lubricity in the mud, apparently caused by breakdown of the high temperature polymers. Lithologies in caldera-fill indicate the drill site may be proximal to ignimbrite vents and that an intracaldera lake with temperatures approaching boiling formed soon after the caldera itself. Structural correlations between VC-2b and the 528-m-deep companion hole VC-2a indicate the earlier Toledo caldera (1.45 Ma; Otowi Member tuffs) and even older Lower Tuffs caldera experienced no structural resurgence similar to the 1.12 million year old Valles caldera. The hydrothermal system penetrated by these bores, consists of a shallow vapor-rich cap, which has evolved from an earlier 200{degree}C liquid-dominated system, overlying stacked, liquid-dominated zones up to about 300{degree}C. Geochemistry of mud returns collected during drilling suggests chloride-rich geothermal fluids were entering the bore and mixing with the drilling fluids in the fractured lower Paleozoic and Precambrian sections. 23 refs., 5 figs., 1 tab.

  8. Efecto de compuestos alfa2 y beta-adrenérgicos en modelos experimentales de cáncer de mama humano

    OpenAIRE

    Pérez Piñero, Cecilia

    2011-01-01

    La expresión de receptores β-adrenérgicos (RA-β) es conocida tanto en células tumorales mamarias humanas como en modelos experimentales. Sin embargo, el efecto descripto para agonistas y antagonistas sobre la proliferación celular y crecimiento tumoral es paradójico, impidiendo su utilización como terapia adyuvante, especialmente en tumores refractarios. La expresión de RA-β2 fue confirmada en las células humanas por inmunofluorescencia y RT-PCR. La incorporación de [3H]-timidina se encontró ...

  9. Derecho humano al agua en el Ecuador

    OpenAIRE

    Buitrón Cisneros, Ricardo

    2010-01-01

    En el Ecuador existe un proceso histórico de concentración y acaparamiento del agua. La política de ajuste estructural llevó a que empresas de servicios de agua potable sean privatizadas. La constitución del 2008 modificó el marco normativo para el agua en el país, se reconoce el derecho humano al agua, los derechos de la naturaleza, el manejo exclusivo público y comunitario y su no privatización. El proceso de reorganización institucional y de construcción de la nueva propuesta de ley de ...

  10. La anatomia del cuerpo humano: exposicion temporal

    OpenAIRE

    Antommarchi, Francesco

    2013-01-01

    El cuerpo humano representado en la obra de Paolo Mascagni y posteriormente en la de Antommarchi, plasma en detalle la totalidad de los órganos del cuerpo como el anatomista los podía ver en un cadáver: desde la capa superficial subyacente a los tegumentos comunes, hasta el esqueleto; la red subcutánea formada por los nervios y los vasos sanguíneos superficiales, todos los planos musculares con los nervios, los vasos sanguíneos y los vasos linfáticos; en fin, los órganos que componen las tres...

  11. Genética y derechos humanos

    OpenAIRE

    Gómez-Ojero y Martínez, Luis

    2016-01-01

    [ES]La tesis se propone realizar un análisis de los temás más novedosos en ciencia genética y del estado de la cuestión relativa a los Derechos Humanos y la Genética partiendo de los textos más relevantes, tanto a nivel jurídico como meramente institucional que, como en el caso de Naciones Unidas, tanta importancia tienen en la influencia que de facto suele lograr sobre el Derecho Internacional, el Derecho de la Unión Europea y, por reflejo, indirectamente, en los Ordenamientos Jurídicos Inte...

  12. Nacionalismo, migraciones forzosas y derechos humanos

    OpenAIRE

    2016-01-01

    El presente trabajo tiene como objetivo fundamental el estudio de tres conceptos que se encuentran ligados entre sí pero que en ocasiones entran en conflicto; tales conceptos no son otros que el nacionalismo, las migraciones forzosas y los derechos humanos. El trabajo se divide en dos partes, una primera parte más teórica y extensa dedicada a la explicación pormenorizada de los tres conceptos claves del trabajo y su relación entre ellos; y una segunda parte dedicada a uno de los mayores probl...

  13. Abordagem contingencial no gerenciamento dos recursos humanos

    OpenAIRE

    Pacheco Junior, Waldemar

    2004-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção. O capital humano é tido como um dos fatores estratégicos às organizações, porém, um dos grandes desafios sob o ponto de vista do gerenciamento é o de melhor aproveitar o potencial dos trabalhadores, em face das dificuldades de encontrar formas de congruência entre objetivos de empresa e pessoas nela inseridas. Tal problema é normalmente uma decorrência de dese...

  14. Derechos humanos, no-violencia, comunidad

    Directory of Open Access Journals (Sweden)

    Juan María Parent Jacquemin

    2013-12-01

    Full Text Available La lucha por los derechos humanos universalmente reconocidos se extienden más allá de los límites académicos o sociales en los que nos habíamos acostumbrado. El título de este artículo anuncia, en una trilogía, la existencia de un mundo de instituciones, líderes, activistas que colaboran en este proceso anunciado por los primeros defensores modernos de la justicia y la verdad.

  15. El ácido alfa lipoico y su poder antioxidante frente al cáncer y las patologías de sensibilización central

    Directory of Open Access Journals (Sweden)

    Marisa Durand

    2013-08-01

    Full Text Available Introducción: El ácido alfa lipoico (ALA puede controlar y limitar la cantidad de radicales libres, influyendo el desarrollo de patologías como el cáncer o las enfermedades de sensibilización central, aunque los mecanismos moleculares implicados en este proceso aún están dilucidándose. Objetivo: Reunir y contrastar información sobre las propiedades antioxidantes del ALA en la prevención y desarrollo de las patologías relacionadas con el estrés oxidativo. Material y métodos: En este trabajo, se analizan más de 100 artículos publicados en los últimos 20 años que relacionan el consumo de ALA y la prevalencia y desarrollo de patologías relacionadas con el estrés oxidativo. Los artículos han sido obtenidos en diferentes bases de datos (PubMed central, Web of Science, Elsevier Journal, Science Direct, e incluyen experimentos en células, animales y humanos. Las palabras clave utilizadas fueron: cáncer, enfermedades de sensibilización central, radicales libres, y ALA. Resultados y discusión: Se han reunido resultados de trabajos realizados in vitro y en animales de laboratorio en los que se pone de manifiesto el efecto del ALA en el control de la apoptosis celular de diferentes tipos de cánceres mediante un aumento de las especies reactivas de oxígeno, así como también el retardo en el crecimiento de las mismas. Aparte, se ha demostrado que la capacidad antioxidante del ALA y su potencial para regenerar otros antioxidantes es de gran importancia para tratar las patologías de sensibilización central. Conclusiones: El ALA ha demostrado un papel significativo como antioxidante y prooxidante en el cáncer y las patologías de sensibilización central, aunque son necesarias más investigaciones en humanos.

  16. Genetic and bibliographic information: HTR2B [GenLibi

    Lifescience Database Archive (English)

    Full Text Available HTR2B 5-hydroxytryptamine (serotonin) receptor 2B human alcoholism (MeSH) Disorders... of Environmental Origin (C21) > Substance-Related Disorders (C21.739) > Alcohol-Related Disorders (C21.739.100) > Alcoholism (C21.739.100.250) 01A0634580 ...

  17. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  18. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient....... These mutations lead to C-terminal truncations of the CHMP2B protein and we will review recent advances in our understanding of the molecular effects of these mutant truncated proteins on vesicular fusion events within the endosome-lysosome and autophagy degradation pathways. We will also review the clinical...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  19. Diversidade alfa e beta no cerrado sensu strictu da Chapada Pratinha, Brasil Alfa and Beta diversity in the cerrado sensu stricto

    Directory of Open Access Journals (Sweden)

    Maria Cristina Felfili

    2001-08-01

    Full Text Available O bioma cerrado possui uma das mais ricas floras dentre as savanas mundiais com mais de 6000 espécies, abrange uma vasta extensão territorial, contém as três maiores bacias hidrográficas sul americanas, e se destaca pela elevada biodiversidade. O objetivo deste trabalho, que faz parte do Projeto Biogeografia do Bioma Cerrado, foi analisar as diversidades alfa e beta em comunidades de cerrado sensu stricto. Foram amostrados o Parque Nacional de Brasília, a Estação Ecológica de Águas Emendadas, a Area de Proteção Ambiental (APA Gama-Cabeça de Veado, Silvânia-GO, Paracatu-MG e Patrocínio-MG. A amostragem foi aleatória com 10 parcelas de 20x50m em cada área de estudo. Foram incluídas plantas lenhosas, exceto lianas, que tivessem no mínimo 5cm de diâmetro. Foi calculada a diversidade alfa pelo teste de Shannon & Wienner e o de Simpson. A diversidade beta foi calculada pelo índice de Whittaker que mede a mudança ou taxa de substituição na composição de espécies de um local para outro. Foi efetuada a curva espécie-área para as 60 parcelas amostradas e efetuada a classificação por TWINSPAN. O cerrado sensu stricto da Chapada Pratinha pode ser diferenciado em duas zonas fitogeográficas: Distrito Federal-Silvânia e Paracatu-Patrocínio. Estas coincidem com um zoneamento por sistemas de terra que classifica a primeira zona como terras altas em contraposição à segunda.The cerrado flora is one of the richest among the world's savannas with more than 6000 species. The cerrado covers a large territory, contains the three most important hydrographycal basins in South America and a high diversity. The objective of this work, that is part of the project Biogeography of the Cerrado Biome, was to analyse alfa and beta diversity in the cerrado sensu stricto. The sampled places were: Brasília National Park -- DF, Águas Emendadas Ecological Station -- DF, Environmentally protected Area of Gama-Cabeça de Veado -- DF, Silv

  20. Charles Darwin: um observador do desenvolvimento humano

    Directory of Open Access Journals (Sweden)

    Eloisa Helena Rubello Valler Celeri

    2010-12-01

    Full Text Available Os autores traduzem, pela primeira vez para o português, o artigo de Charles Darwin "A Biographical Sketch of an Infant", publicado no periódico Mind em julho de 1877. Utilizando anotações de observações do desenvolvimento de seus filhos, especialmente de seu filho mais velho William Erasmus (Doddy, Darwin descreve e estuda, a partir de seu enfoque naturalista, o filhote humano, narrando os primeiros indicativos comportamentais de emoções tais como raiva e medo, curiosidade e senso moral, o brincar e o prazer envolvido nesta atividade, a capacidade de imitação e os primeiros indícios daquilo que hoje conhecemos como "teoria da mente". Colocando-se questões sobre as capacidades do bebê, como eles aprendem e como se comunicam e levantando hipóteses sobre possíveis significados de certos comportamentos, questões ainda hoje fundamentais para o estudo do desenvolvimento humano, Darwin mostra-se também um pioneiro no estudo do bebê e da criança pequena, numa época na qual as capacidades dos bebês eram extremamente subestimadas e desconsideradas.

  1. humanos de filiación otopame

    Directory of Open Access Journals (Sweden)

    Zaid Lagunas

    2004-01-01

    Full Text Available Se presenta una revisión bibliográfica de estudios de antropología física y temas afines a esta disciplina, realizados en grupos humanos pertenecientes al tronco lingüístico otopame. A partir de la información arqueológica y antropofísica disponible, se muestran y analizan las distintas formas de disponer de los muertos en la época prehispánica entre estos grupos, tanto de aquellas defunciones ocasionadas por actos de sacrificio humano como los fallecidos por otras causas. Se hace un recuento de la información osteológica, se describen los rasgos físicos y de orden cultural detectables en los restos esqueléticos de los otopames. Por lo que toca a la población contemporánea, se resumen y examinan estudios antropométricos y genéticos realizados en algunas comunidades, tanto en individuos adultos como en jóvenes y niños.

  2. Cárceles y derechos humanos en México

    OpenAIRE

    Comisión Nacional de los Derechos Humanos

    2004-01-01

    Síntesis del informe especial de la Comisión Nacional de los Derechos Humanos sobre la situación de los derechos humanos en los centros de reclusión de la república mexicana, dependientes de gobiernos locales y municipales.

  3. B2B virksomheders brug af sociale medier

    OpenAIRE

    Persdatter Gotfredsen, Karoline

    2016-01-01

    Purpose: The aim of this master thesis is to explore how B2B firms perceive their own usage of social media to establish and strengthen successful relational exchanges. Approach: In-depth interviews were carried out with three key informants responsible for social media marketing at large B2B firms. The findings from the three interviews were then analysed case-by-case and finally a cross case analysis was conducted. Findings: In relation to the market B2B firms mainly see social media...

  4. Homeopathic dilutions of TNF-alfa in psoriasis and rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Ioana Cridon

    2012-09-01

    Full Text Available Aim: Clinical and biological studies in the past years underlined the proinflammatory action of the citokine Tumoral Necrosis Factor in the pathophysiolology of psoriasis, psoriatic arthritis, rheumatoid arthritis. Knowing that the high dilution of substances can have an inverted effect, our hypotesis was that dillution made of TNF-alfa can decrease the clinical manifestation of such diseases. Materials and method: We included as a pilot group 10 patients presented in Lotus Life Integrative Medicine Center or Profamilia Medical Center Iasi with psoriasis and rheumatoid arthritis previously diagnosed by specialists, under speciality treatment with insufficient results and patients who deliberately expressed their preference for alternative treatment. We decided to exclude the patients which during the study could present aggravation of symptoms. The treatment protocol consisted in the administration under the tongue of the dilution of TNF-alfa 9CH in liquid form, 12 drops twice a day for at least 3 months. This was prepared diluting from Guna TNF-alfa 4CH in distiled water, completing with 30% of alcohol in the last solution. Patients under other medications continued to take their previous treatment unchanged. We called the patients for follow-up after 3 months. We took the written consent from the patients and the approval of the Ethical Committee of the University of Medicine and Pharmacy "Gr. T. Popa" of Iasi. Results: To analize the results we followed the subjective evolution of the patients, the total surface and thickness of eruptions in psoriasis patients and the pain intensity and stiffness in arthritis patients. Under this conditions, all the patients showed amelioration, with 2 out of 6 psoriasis patients showing complete clearance of eruptions. No patient reported adverse reactions during the treatment Conclusions: Even though the group of patients was small and not appropriate for statistical data the presence of a clinical

  5. Prospective surveillance study of haemophilia A patients switching from moroctocog alfa or other factor VIII products to moroctocog alfa albumin-free cell culture (AF-CC) in usual care settings.

    Science.gov (United States)

    Parra Lopez, Rafael; Nemes, Laszlo; Jimenez-Yuste, Victor; Rusen, Luminita; Cid, Ana R; Charnigo, Robert J; Baumann, James A; Smith, Lynne; Korth-Bradley, Joan M; Rendo, Pablo

    2015-10-01

    This prospective, open-label, postauthorisation safety surveillance study assessed clinically significant inhibitor development in patients with severe haemophilia A transitioning from moroctocog alfa or other factor VIII (FVIII) replacement products to reformulated moroctocog alfa (AF-CC). Males aged ≥ 12 years with severe haemophilia A (FVIII:C) 150 exposure days (EDs) to recombinant or plasma-derived FVIII products, and no detectable inhibitor at screening were enrolled. Primary end point was the incidence of clinically significant FVIII inhibitor development. Secondary end points included annualised bleeding rate (ABR), less-than-expected therapeutic effect (LETE), and FVIII recovery. Patients were assigned to one of two cohorts based on whether they were transitioning to moroctocog alfa (AF-CC) from moroctocog alfa (cohort 1; n=146) or from another recombinant or plasma-derived FVIII product (cohort 2; n=62). Mean number of EDs on study was 94 (range, 1-139). Six positive FVIII inhibitor results, as determined by local laboratories, were reported in four patients; none were confirmed by a central laboratory, no inhibitor-related clinical manifestations were reported, and all anti-FVIII antibody assays were negative. Median ABRs were 23.4 and 3.4 in patients categorised at baseline as following on-demand and prophylactic regimens, respectively; 86.5% of bleeding episodes resolved after one infusion. LETE incidence was 0.06% and 0.19% in the on-demand and prophylaxis settings, respectively. FVIII recovery remained constant throughout the study. No new safety concerns were identified. This study found no increased risk of clinically significant FVIII inhibitor development in patients transitioning from moroctocog alfa or other FVIII replacement products to moroctocog alfa (AF-CC).

  6. Expressão local do fator de necrose tumoral alfa na ruptura prematura de membranas

    OpenAIRE

    Roveran,Valquíria; SILVA, Maria Antonieta Longo Galvão; Yamano,Lucia; Rodrigues,Lilian de Paiva; Vasquez,Mônica Lopez; Piato, Sebastião

    2009-01-01

    OBJETIVO: comparar a expressão do fator de necrose tumoral alfa (TNF-α) em membranas ovulares com ruptura prematura (RPM) e com ruptura oportuna das mesmas; verificar a associação entre a expressão do TNF-α em membranas ovulares e o grau de corioamnionite das mesmas e correlacionar a expressão do TNF-α e o tempo de ruptura das membranas. MÉTODOS: foram analisadas as membranas ovulares de 31 parturientes com RPM, com idade gestacional acima de 34 semanas, e de 14 parturientes co...

  7. Corifollitropin alfa followed by rFSH in a GnRH antagonist protocol for poor ovarian responder patients

    DEFF Research Database (Denmark)

    Polyzos, Nikolaos P; Devos, Michel; Humaidan, Peter;

    2013-01-01

    OBJECTIVE: To identify whether women with poor ovarian response may benefit from treatment with corifollitropin alfa in a GnRH antagonist protocol. DESIGN: Retrospective pilot study. SETTING: University-based tertiary care center. PATIENT(S): Poor ovarian responders fulfilling the Bologna criteria...... developed by European Society for Human Reproduction and Embryology Consensus Group. INTERVENTION(S): Corifollitropin alfa (150 μg) followed by 300 IU rFSH in a GnRH antagonist protocol. MAIN OUTCOME MEASURE(S): Endocrinologic profile and ongoing pregnancy rates. RESULT(S): Among 43 women treated...... compared with a cohort of patients treated during 2011 with the standard protocol for poor responders in our center (short agonist-hMG) (7% vs. 6.3%). CONCLUSION(S): Treatment of poor ovarian responders, as described by the Bologna criteria, with corifollitropin alfa in a GnRH antagonist protocol results...

  8. Mapping Hydrogen in the Galaxy, Galactic Halo, and Local Group with ALFA: The GALFA-HI Survey Starting with TOGS

    CERN Document Server

    Gibson, S J; Heiles, C; Korpela, E J; Peek, J E G; Putman, M E; Stanimirović, S

    2008-01-01

    Radio observations of gas in the Milky Way and Local Group are vital for understanding how galaxies function as systems. The unique sensitivity of Arecibo's 305m dish, coupled with the 7-beam Arecibo L-Band Feed Array (ALFA), provides an unparalleled tool for investigating the full range of interstellar phenomena traced by the HI 21cm line. The GALFA (Galactic ALFA) HI Survey is mapping the entire Arecibo sky over a velocity range of -700 to +700 km/s with 0.2 km/s velocity channels and an angular resolution of 3.4 arcminutes. We present highlights from the TOGS (Turn on GALFA Survey) portion of GALFA-HI, which is covering thousands of square degrees in commensal drift scan observations with the ALFALFA and AGES extragalactic ALFA surveys. This work is supported in part by the National Astronomy and Ionosphere Center, operated by Cornell University under cooperative agreement with the National Science Foundation.

  9. GSI Helmholz Centre for Heavy Ion Research - ALFA: Next generation concurrent framework for ALICE and FAIR experiments

    CERN Document Server

    CERN. Geneva

    2015-01-01

    FAIR is a new, unique international accelerator facility for the research with antiprotons and ions. It is being built at the GSI Darmstadt in Hesse, Germany. The commonalities between the ALICE and FAIR experiments and their computing requirements led to the development of a common software framework in an experiment independent way; ALFA (ALICE-FAIR framework). ALFA is designed for high quality parallel data processing and reconstruction on heterogeneous computing systems. It provides a data transport layer and the capability to coordinate multiple data processing components. ALFA is a flexible, elastic system which balances reliability and ease of development with performance by using a message based multi-processing in addition to multi-threading. The framework allows for usage of heterogeneous computing architectures by offloading (portions of code are accelerated on the device) or natively (where the full program is executed on the device ).

  10. Secretion of human interferon alpha 2b by Streptomyces lividans.

    Science.gov (United States)

    Pimienta, E; Fando, R; Sánchez, J C; Vallin, C

    2002-02-01

    Biologically active human interferon alpha 2b (HuIFNalpha-2b) was secreted into the culture medium by Streptomyces lividans transformed with recombinant plasmids coding for HuIFNalpha-2b fused to the Streptomyces exfoliatus M11 lipase A signal sequence. Levels were low, 15 or 100 ng/ml, depending on the plasmid used. Neither processed nor unprocessed HuIFNalpha-2b was detected in cell lysates of the transformants secreting the recombinant product. However, the secreted recombinant product was found to partially degrade when cultures reached the stationary phase by the action of an, as yet, unidentified mycelium-associated factor. Experimental evidence suggests that the degrading factor is related to mycelium-associated proteolytic activity.

  11. Rf2a and rf2b transcription factors

    Science.gov (United States)

    Beachy, Roger N.; Petruccelli, Silvana; Dai, Shunhong

    2007-10-02

    A method of activating the rice tungro bacilliform virus (RTBV) promoter in vivo is disclosed. The RTBV promoter is activated by exposure to at least one protein selected from the group consisting of Rf2a and Rf2b.

  12. Study on pharmacodynamics of recombinant interferon α-2b suppository

    Institute of Scientific and Technical Information of China (English)

    LIU Miao; LIU Zheng; SUN Liang

    2008-01-01

    Objective To investigate the antiviral activity of recombinant interferona-2b suppository (IFNα-2b) in vivo and in vitro. Methods The cytopathic-effect inhibition assay was applied in this study to investigate the antiviral activity of this drug as well as yingtelong and axiluowei as positive control. The guinea pig model of vaginitis and skin infection caused by HSV-2 infection were established, treated with IFNα-2b suppository at dosages of 60000、180000、540000 IU, using IFNα-2b injection 180000 IU·kg-1 as controls. Score the pathological changes of appearance and skin, the virus activities of vaginal secretion and tissue sections of viginae were assayed after treatment. Results The TD50 of IFN α-2b and yingtelong for Vero cells was ( 100)μg·mL-1 and ( 100000) IU·mL-1, respectively. The IC50 of IFNα-2b and yingtelong and axiluowei for Herpes virus type 1 was (0.29±0.08)μg·mL-1 and (185.0±28.8) IU·mL-1 and (0.19± 0.03)μg·mL-1, respectively. The mean scores for vaginal and skin lesion of the treated groups were lower than those of untreated group. Among these concentrations, the IFNα-2b suppository of 540000 IU·kg-1 group. Showed highest anti-viral activity. The virus activity in vaginal secretion of treated group was lower than that of untreated group too (P<0.01 or P<0.05). Tissue sections of viginae after treatment with IFNα-2b suppository showed significantly therapeutical effects on the degrees of vaginal lesion. At the same dosage, The anti-HSV activity of IFNα-2b suppository was also compared with IFNα-2b injection , the resuits showed that the activity of suppository of 540000 IU·kg-1 group was similar to that of the injection. Conclusions The IFNα-2b suppository has anti-viruses function both in vivo and in vitro.

  13. Branding of electricity in B2B markets

    OpenAIRE

    Rolanda Simenaite 1986

    2013-01-01

    Branding has gained an important role in the B2B (business-to-business) market. Liberation of the energy markets in recent years has increased competition and branding could create a competitive advantage. This thesis analyzes the branding of electricity in a business-to-business context. In depth, this thesis explores the supplier of electricity brand importance for business customers in both Icelandic and Lithuanian B2B markets. The focus of the thesis is to research how much brands matter ...

  14. Direitos humanos e OEA. Processos e procedimentos

    Directory of Open Access Journals (Sweden)

    Christian Perrone

    2015-08-01

    Full Text Available Este artigo busca preencher a lacuna no tratamento do Direito Internacional dos Direitos Humanos, focando nos procedimentos internos dos organismos internacionais que acabam por dar corpo (positiva ou negativamente para estes conceitos jurídicos. Os três principais eixos serão os órgãos da Organização dos Estados Americanos que tratam destes direitos, os procedimentos gerais, e os mecanismos individuais de proteção. Como conclusão, tem-se que toda a Organização é responsável pela realização, desenvolvimento e proteção de direitos e que a sociedade coletiva ou individualmente possui espaço de influência através de mecanismos próprios.

  15. Direitos Humanos em Kant e Habermas

    Directory of Open Access Journals (Sweden)

    Alessandro Pinzani

    2011-12-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2011v10n1p179O livro de Milene Tonetto é mais ambicioso do que o título poderia deixar pensar. Longe de limitar-se a uma exposição da temática dos direitos humanos nos dois autores em questão, o texto representa uma contribuição importante à discussão acerca dos fundamentos do direito em Kant e da relação entre direito e moral na obra deste pensador, assim como à discussão acerca da fundamentação do direito oferecida por Habermas.

  16. Editorial: Desarrollo humano, pobreza y salud

    OpenAIRE

    Armando Corté

    2006-01-01

    Según el Programa de las Naciones Unidas para el Desarrollo (PNUD) Colombia ha mejorado el índice de desarrollo humano por los logros en la cobertura de educación y salud e incrementar el ingreso per cápita. Esto permitió pasar del puesto 77 al 69. Sin embargo, preocupa estar de undécimo entre los países con peor distribución del ingreso; el ingreso de un rico equivale a lo que reciben 58 personas más pobres de Colombia, mientras en Dinamarca y Japón equivale a 24.7 y 24.9 respectivamente. U...

  17. Expression of zebrafish nos2b surrounds oral cavity.

    Science.gov (United States)

    Poon, Kar-Lai; Richardson, Michael; Korzh, Vladimir

    2008-06-01

    Inducible nitric oxide synthase (NOS2) catalyzes the production of nitric oxide (NO), and is one of the factors establishing innate immunity. In zebrafish, Nos2 is represented by nos2a and nos2b. Here, we report the cloning and expression pattern of the zebrafish nos2b gene, which does not seem to participate in induced immune response. nos2b was mapped to zebrafish linkage group 15. The spatial and temporal expression pattern of nos2b in embryonic zebrafish was analyzed by whole-mount in situ hybridization. nos2b is expressed constitutively in two primordia located along the ventral midline. The first group of cells contributes to the neurohypophysis. Initially at the level of the ventral hindbrain, the second group of cells migrates closely with the thyroid primordium to its final position at the basihyal by 3 dpf. Thus, the analysis of expression pattern of nos2b reveals complex morphogenetic movements resulting in its expression surrounding the oral cavity.

  18. De-squeeze the beams: the TOTEM and ATLAS/ALFA experiments

    CERN Multimedia

    Stefania Pandolfi

    2016-01-01

    A special week-long proton–proton run with larger beam sizes at the interaction point is intended to probe the p-p elastic scattering regime at small angles.   Nicola Turini, deputy spokesperson for TOTEM, in front of one of the experiment’s ‘Roman Pot’ detectors in the LHC tunnel. (Photo: Maximilien Brice/CERN) Usually, the motto of the LHC is “maximum luminosity”. But for a few days per year, the LHC ignores its motto to run at very low luminosity for the forward experiments. This week, the LHC will provide the TOTEM and ATLAS/ALFA experiments with data for a broad physics programme. The TOTEM experiment at Point 5 and the ATLAS/ALFA experiment at Point 1 study the elastic scattering of protons, which are not observable in normal operation runs. In the elastic scattering process, the two protons survive their encounter intact and only change directions by exchanging momentum. To allow this special run, the operators play with the so-c...

  19. Drotrecogin alfa (activated)...a sad final fizzle to a roller-coaster party.

    Science.gov (United States)

    Angus, Derek C

    2012-02-06

    Following the failure of PROWESS-SHOCK to demonstrate efficacy, Eli Lilly and Company withdrew drotrecogin alfa (activated) from the worldwide market. Drotrecogin was initially approved after the original trial, PROWESS, was stopped early for overwhelming efficacy. These events prompt consideration of both the initial approval decision and the later decision to withdraw. It is regrettable that the initial decision was made largely on a single trial that was stopped early. However, the decision to approve was within the bounds of normal regulatory practice and was made by many approval bodies around the world. Furthermore, the overall withdrawal rate of approved drugs remains very low. The decision to withdraw was a voluntary decision by Eli Lilly and Company and likely reflected key business considerations. Drotrecogin does have important biologic effects, and it is probable that we do not know how best to select patients who would benefit. Overall, there may still be a small advantage to drotrecogin alfa, even used non-selectively, but the costs of determining such an effect with adequate certainty are likely prohibitive, and the point is now moot. In the future, we should consider ways to make clinical trials easier and quicker so that more information can be available in a timely manner when considering regulatory approval. At the same time, more sophisticated selection of patients seems key if we are to most wisely test agents designed to manipulate the septic host response.

  20. Mango resistance to fruit flies. II - resistance of the alfa cultivar

    Energy Technology Data Exchange (ETDEWEB)

    Rossetto, C.J.; Bortoletto, N., E-mail: rossetto@iac.sp.gov.b [Agencia Paulista de Tecnologia dos Agronegocios (APTA), Votuporanga, SP (Brazil). Polo Regional do Noroeste Paulista; Walder, J.M.M.; Mastrangelo, T. de A., E-mail: jmwalder@cena.usp.b [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil); Carvalho, C.R.L.; Castro, J.V. de, E-mail: climonta@iac.sp.gov.b, E-mail: josalba@iac.sp.gov.b [Instituto Agronomico de Campinas, SP (Brazil); Pinto, A.C. de Q. [EMBRAPA, Brasilia, DF (Brazil); Cortelazzo, A.L., E-mail: angelo@unicamp.b [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Inst. de Biologia

    2006-07-01

    The percentage of infested mango fruits of five selected mango varieties was evaluated during three years under field conditions. Three varieties with field resistance to fruit flies had less then 10% of fruits infested. Tommy Atkins, the susceptible commercial check, had 42,9% and the susceptible check had 98.9 % of infested fruits. The three field resistant varieties plus the susceptible commercial check, Tommy Atkins, were further tested in laboratory, under caged conditions, with artificial infestation of Anastrepha obliqua. The attempts of oviposition and the number of pupae developed from each fruit were evaluated. Under caged conditions, the cultivar Alfa maintained its field resistance and Espada Stahl and IAC 111 lost the field resistance and were as susceptible as Tommy Atkins. The attempts of oviposition were positively and highly correlated with the number of pupae developed in the fruits. Non preference for oviposition was confirmed as the main mechanism of resistance of mango fruits to fruit flies. In the absence of a more susceptible variety (no choice test) the cultivar Alfa has kept the resistance (author)

  1. FTIR spectroscopy and X-ray powder diffraction characterization of microcrystalline cellulose obtained from alfa fibers

    Directory of Open Access Journals (Sweden)

    Trache D.

    2013-07-01

    Full Text Available Many cereal straws have been used as raw materials for the preparation of microcrystalline cellulose (MCC. These raw materials were gradually replaced with wood products; nevertheless about 10% of the world overall pulp production is obtained from non-wood raw material. The main interest in pulp made from straw is that it provides excellent fibres for different industries with special properties, and that it is the major available source of fibrous raw material in some geographical areas. The aim of the present work was to characterize microcrystalline cellulose prepared from alfa fibers using the hydrolysis process. The products obtained are characterized with FTIR spectroscopy and X-ray powder diffraction. As a result, FTIR spectroscopy is an appropriate technique for studying changes occurred by any chemical treatment. The spectrum of alfa grass stems shows the presence of lignin and hemicelluloses. However, the cellulose spectrum indicates that the extraction of lignin and hemicellulose was effective. The X-ray analysis indicates that the microcrystalline cellulose is more crystalline than the source material.

  2. Papel de la IL-6 y TNF-alfa en la enfermedad periodontal

    Directory of Open Access Journals (Sweden)

    A. Carrillo de Albornoz Sainz

    Full Text Available La periodontitis se inicia por una serie de patógenos que inducen una cascada inflamatoria que estimula la destrucción de los tejidos mediada por el huésped. Están implicados un gran número de mediadores inflamatorios, entre los que destacan IL-6 y TNF-alfa. La IL-6 es una citoquina pleiotrópica de compleja actividad biológica, cuya función principal vinculada a la periodontitis es la inducción de la reabsorción ósea. TNF-alfa es una citoquina proinflamatoria cuya función más destacada es el reclutamiento y estimulación de neutrófilos y monocitos. Su papel en la periodontitis es diverso, ya que promueve tanto la inflamación, como la pérdida ósea y la destrucción del tejido conectivo, a la vez que limita la capacidad de reparación del periodonto.

  3. Pharmacogenetics of Cytochrome P450 2B6 (CYP2B6: Advances on Polymorphisms, Mechanisms, and Clinical Relevance

    Directory of Open Access Journals (Sweden)

    Ulrich M Zanger

    2013-03-01

    Full Text Available Cytochrome P450 2B6 (CYP2B6 belongs to the minor drug metabolizing P450s in human liver. Expression is highly variable both between individuals and within individuals, owing to nongenetic factors, genetic polymorphisms, inducibility and irreversible inhibition by many compounds. Drugs metabolized mainly by CYP2B6 include artemisinin, bupropion, cyclophosphamide, efavirenz, ketamine, and methadone. CYP2B6 is one of the most polymorphic CYP genes in humans and variants have been shown to affect transcriptional regulation, splicing, mRNA and protein expression, and catalytic activity. Some variants appear to affect several functional levels simultaneously, thus, combined in haplotypes, leading to complex interactions between substrate-dependent and -independent mechanisms. The most common functionally deficient allele is CYP2B6*6 [Q172H, K262R], which occurs at frequencies of 15 to over 60% in different populations. The allele leads to lower expression in liver due to erroneous splicing. Recent investigations suggest that the amino acid changes contribute complex substrate-dependent effects at the activity level, although data from recombinant systems used by different researchers are not well in agreement with each other. Another important variant, CYP2B6*18 [I328T], occurs predominantly in Africans (4 to 12% and does not express functional protein. A large number of uncharacterized variants are currently emerging from different ethnicities in the course of the 1000 Genomes Project. The CYP2B6 polymorphism is clinically relevant for HIV-infected patients treated with the reverse transcriptase inhibitor efavirenz, but it is increasingly being recognized for other drug substrates. This review summarizes recent advances on the functional and clinical significance of CYP2B6 and its genetic polymorphism, with particular emphasis on the comparison of kinetic data obtained with different substrates for variants expressed in different recombinant

  4. Un nuevo orden en los recursos humanos de las organizaciones

    OpenAIRE

    2014-01-01

    Ha sido mucho lo que se ha escrito sobre el comportamiento y la gestión de los recursos humanos. Este trabajo se fundamenta en dos tesis doctorales realizadas en España y en Holanda, en las que los autores se sirvieron de sus experiencias como investigadores en recursos humanos y profesores universitarios dedicados a la formación de ”profesionales reflexivos” que entiendan los recursos humanos desde el desarrollo de nuevas ideas y prácticas para su gestión. Desde un planteamiento personal ...

  5. Entre Confucianismo y Derechos Humanos: Individuo y Rey

    OpenAIRE

    2011-01-01

    RESUMEN En este artículo se aborda la cuestión de China y los derechos humanos  desde la perspectiva que, según opinión común, constituye la base de esa cultura: el confucianismo. Una perspectiva que es analizada tanto desde su marco contextual como en sí misma, cotejándola con el concepto de derechos humanos. El resultado de todo ello lleva a la conclusión de que los derechos humanos son ajenos al confucianismo y por ello a la cultura china. Sin embargo, no son necesariamente incompatibles c...

  6. La metafísica de los derechos humanos

    OpenAIRE

    Carlos Bernal Pulido

    2010-01-01

    Los derechos humanos, en cuanto institución, suscitan interesantes preguntas metafísicas u ontológicas. Las más importantes son qué tipo de entidades componen los derechos humanos, qué propiedades revisten esas entidades y cuál es la estructura con la que dichas propiedades se organizan para conformar tales entidades. Este texto se dedica a responder estos interrogantes pero sólo en cuanto se refiere a la acepción jurídica del término derechos humanos, es decir, entendidos como derechos del i...

  7. La metafísica de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Carlos Bernal Pulido

    2010-12-01

    Full Text Available Los derechos humanos, en cuanto institución, suscitan interesantes preguntas metafísicas u ontológicas. Las más importantes son qué tipo de entidades componen los derechos humanos, qué propiedades revisten esas entidades y cuál es la estructura con la que dichas propiedades se organizan para conformar tales entidades. Este texto se dedica a responder estos interrogantes pero sólo en cuanto se refiere a la acepción jurídica del término derechos humanos, es decir, entendidos como derechos del individuo garantizados por los sistemas internacionales de protección de los derechos humanos. En este sentido, este texto defiende la tesis de que los derechos humanos son una especie del género derechos jurídicos subjetivos. Los derechos humanos son derechos jurídicos subjetivos cuya differentia specifica estriba en su carácter de “humanos”. La formulación de un concepto de derechos humanos debe pasar, por tanto, primero, por entender el concepto de derechos jurídicos subjetivos y, segundo, por identificar cuáles son las propiedades constitutivas del carácter de “humanos” de los derechos humanos. Este artículo estudia la estructura de los derechos humanos y sus diferentes propiedades formales y materiales. Las propiedades formales son: la inclusión en los instrumentos internacionales sobre derechos humanos y el reconocimiento por parte de la jurisprudencia sobre derechos humanos de los tribunales internacionales especializados. Las propiedades materiales tienen que ver con la relación del derecho con los conceptos de persona propios del Estado liberal, democrático y social. Este texto examina hasta qué punto cada una de estas propiedades debe considerarse como una propiedad necesaria, suficiente o necesaria y suficiente para que un derecho sea considerado como un derecho humano.

  8. Interferon alfa-2a versus combination therapy with interferon alfa-2a, interleukin-2, and fluorouracil in patients with untreated metastatic renal cell carcinoma (MRC RE04/EORTC GU 30012): an open-label randomised trial.

    NARCIS (Netherlands)

    Gore, M.E.; Griffin, C.L.; Hancock, B.; Patel, P.M.; Pyle, L.; Aitchison, M.; James, N.; Oliver, R.T.D.; Mardiak, J.; Hussain, T.; Sylvester, R.; Parmar, M.K.; Royston, P.; Mulders, P.F.A.

    2010-01-01

    BACKGROUND: In metastatic renal cell carcinoma combinations of interferon alfa-2a, interleukin-2, and fluorouracil produce higher response rates and longer progression-free survival than do single agents. We aimed to compare overall survival in patients receiving combination treatment or interferon

  9. Lithium insertion in nanostructured TiO(2)(B) architectures.

    Science.gov (United States)

    Dylla, Anthony G; Henkelman, Graeme; Stevenson, Keith J

    2013-05-21

    Electric vehicles and grid storage devices have potentialto become feasible alternatives to current technology, but only if scientists can develop energy storage materials that offer high capacity and high rate capabilities. Chemists have studied anatase, rutile, brookite and TiO2(B) (bronze) in both bulk and nanostructured forms as potential Li-ion battery anodes. In most cases, the specific capacity and rate of lithiation and delithiation increases as the materials are nanostructured. Scientists have explained these enhancements in terms of higher surface areas, shorter Li(+) diffusion paths and different surface energies for nanostructured materials allowing for more facile lithiation and delithiation. Of the most studied polymorphs, nanostructured TiO2(B) has the highest capacity with promising high rate capabilities. TiO2(B) is able to accommodate 1 Li(+) per Ti, giving a capacity of 335 mAh/g for nanotubular and nanoparticulate TiO2(B). The TiO2(B) polymorph, discovered in 1980 by Marchand and co-workers, has been the focus of many recent studies regarding high power and high capacity anode materials with potential applications for electric vehicles and grid storage. This is due to the material's stability over multiple cycles, safer lithiation potential relative to graphite, reasonable capacity, high rate capability, nontoxicity, and low cost (Bruce, P. G.; Scrosati, B.; Tarascon, J.-M. Nanomaterials for Rechargeable Lithium Batteries. Angew. Chem., Int. Ed.2008, 47, 2930-2946). One of the most interesting properties of TiO2(B) is that both bulk and nanostructured forms lithiate and delithiate through a surface redox or pseudocapacitive charging mechanism, giving rise to stable high rate charge/discharge capabilities in the case of nanostructured TiO2(B). When other polymorphs of TiO2 are nanostructured, they still mainly intercalate lithium through a bulk diffusion-controlled mechanism. TiO2(B) has a unique open crystal structure and low energy Li

  10. Sources of alpha-, beta-, gamma-, delta- and epsilon-carotenes: a twentieth century review Fontes de alfa-, beta-, gama-, delta-, e epsilon-carotenos: uma revisão do século XX

    Directory of Open Access Journals (Sweden)

    José M. Barbosa-Filho

    2008-03-01

    Full Text Available Since humans cannot synthesize carotenoids, they depend upon the diet exclusively for the source of these micronutrients. It has claimed that they may alleviate chronic diseases such as cancers. The present communication constitutes a global review of the scientific literature on plants and others organisms that biosynthesize carotenoids, which include the series alpha-, beta-, gamma-, delta- and epsilon-carotenes. The results of the literature survey lists more than five hundred sources.Uma vez que os humanos não podem sintetizar carotenóides, dependem exclusivamente da dieta como fonte desses micronutrientes. Tem sido afirmado que eles podem aliviar doenças crônicas, tais como cânceres. O presente artigo constitui uma revisão global da literatura científica sobre plantas e outros organismos que biossintetizam carotenóides, que incluem as séries alfa-, beta-, gama-, delta-, e epsilon-carotenos. Os resultados das listas de pesquisa da literatura mostram mais de quinhentas fontes.

  11. Cytochrome P450 2B (CYP2B)-mediated activation of methyl-parathion in rat brain extracts.

    Science.gov (United States)

    Albores, A; Ortega-Mantilla, G; Sierra-Santoyo, A; Cebrián, M E; Muñoz-Sánchez, J L; Calderón-Salinas, J V; Manno, M

    2001-10-15

    The role of cytochrome P450 (CYP) and the CYP isoform involved in the activation of the widely used pesticide methyl-parathion (MePA) were investigated in rat brain extracts by measuring the effect of different CYP inhibitors on acetylcholinesterase (AChE) inhibition by MePA. Brain extracts provide a useful tool to study the activation mechanisms of organophosphorus compounds (OP) since they contain both the activating enzyme(s) and the molecular target for OP toxicity. As expected, in incubations of rat brain extract supplemented with NADPH, AChE activity was non-competitively inhibited by the presence of MePA, indicating that MePA was activated to its reactive metabolite methyl-paraoxon (MePO). Indeed, Vmax(app) decreased from 13.4 to 8.7 micromol thionitrobenzoic acid (TNB)/min per mg protein. MePA activation by rat brain extracts, as measured by the AChE inhibition produced by the presence of the pesticide in the incubation, was fully prevented by previously bubbling the incubation mix with CO, by the presence of monoclonal anti-rat CYP2B1/2B2 antibodies and by the addition of phenobarbital (PB), a CYP2B substrate. Interestingly, MePA showed a greater affinity for CYP2B than PB. CYP1A1 antibodies showed no effect on MePA activation. The presence of cytochrome P450 2B (CYP2B) in the rat brain extracts was confirmed by immunoblotting. These results demonstrate indisputably the responsibility of CYP2B in MePA activation in the rat brain in vitro, suggesting that metabolic activation of OP compounds in situ might be crucial for their organ specific toxicity to the central nervous system also in vivo.

  12. e implicaciones para el bienestar de los humanos

    Directory of Open Access Journals (Sweden)

    Germán Gutiérrez

    2007-01-01

    Full Text Available En este artículo se revisa la literatura reciente sobre interacciones humano-animal, su origen, sus características y cómo dichas interacciones afectan el bienestar físico, psicológico y social. En la primera parte se presentan los orígenes y evolución histórica de las relaciones humano - animal, empezando por los procesos de domesticación y se aborda la naturaleza de las interacciones humano animal. En la segunda parte, se revisan los efectos para los humanos de la interacción con animales, especialmente con sus mascotas y se analiza la literatura científica sobre los efectos físicos, psicológicos y sociales. Finalmente, se aborda brevemente el desarrollo de esta área de investigación en Latinoamérica.

  13. PARA UNA LECTURA CRÍTICA DEL DESARROLLO HUMANO

    Directory of Open Access Journals (Sweden)

    Melisa Campana

    2013-01-01

    Full Text Available El presente trabajo propone una lectura crítica del discurso del desarrollo humano articulado por Amartya Sen en Desarrollo y Libertad , desde el enfoque de la gubernamentalidad. En primer lugar, se precisa la perspectiva teórica adoptada, haciendo hincapié en las particularidades de la razón gubernamental neoliberal, marco en el que emerge el discurso del desarrollo humano. Se rastrea, luego, un conjunto de premisas del modelo de la elección racional, que brinda elementos conceptuales al discurso del desarrollo humano. A partir de estas claves, se examina una serie de postulados vertebradores de la propuesta de Amartya Sen, a los fines de identificar algunos de los efectos que ha producido el discurso del desarrollo humano en términos de concepción de la pobreza y de los dispositivos de intervención sobre ella.

  14. Substrate Recognition of Histone H2B by DUBm

    Science.gov (United States)

    Henderson, Elizabeth; Berndsen, Christopher; Wolberger, Cynthia

    2011-03-01

    The SAGA complex is a transcriptional coactivator that regulates gene expression in eukaryotes via histone acetylation and deubiquitination, which are crucial for transcription. Our lab is investigating the SAGA-dependent deubiquitination of histone H2B. The deubiquitinating module (DUBm) of SAGA is comprised of a ubiquitin-specific protease, Ubp8, and three other proteins. It is known that Ubp8 cleaves ubiquitin from histone H2B, however, the specific way in which the enzyme binds to the substrate remains elusive. In order to unravel this mechanism, we attempted to determine the crystal structure of the substrate binding complex. We obtained this substrate by exploiting the techniques of intein chemistry to artificially ubiquitinate a histone H2B peptide, which we then co-crystallized with DUBm. Additionally, we synthesized Ub-K63R-linked chains and Ub-K48-linked chains and co-crystallized them with DUBm.

  15. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery......, service, configuration and customisation of the products in their company as well as to develop an apposite understanding of the key values and characteristics of the client organisation. Based on a design-ethnographical study of real sales practice in lift truck business the paper draws parallels between...

  16. Molecular design and downstream processing of turoctocog alfa (NovoEight), a B-domain truncated factor VIII molecule.

    Science.gov (United States)

    Ahmadian, Haleh; Hansen, Ernst B; Faber, Johan H; Sejergaard, Lars; Karlsson, Johan; Bolt, Gert; Hansen, Jens J; Thim, Lars

    2016-07-01

    Turoctocog alfa (NovoEight) is a third-generation recombinant factor VIII (rFVIII) with a truncated B-domain that is manufactured in Chinese hamster ovary cells. No human or animal-derived materials are used in the process. The aim of this study is to describe the molecular design and purification process for turoctocog alfa. A five-step purification process is applied to turoctocog alfa: protein capture on mixed-mode resin; immunoaffinity chromatography using a unique, recombinantly produced anti-FVIII mAb; anion exchange chromatography; nanofiltration and size exclusion chromatography. This process enabled reduction of impurities such as host cell proteins (HCPs) and high molecular weight proteins (HMWPs) to a very low level. The immunoaffinity step is very important for the removal of FVIII-related degradation products. Manufacturing scale data shown in this article confirmed the robustness of the purification process and a reliable and consistent reduction of the impurities. The contribution of each step to the final product purity is described and shown for three manufacturing batches. Turoctocog alfa, a third-generation B-domain truncated rFVIII product is manufactured in Chinese hamster ovary cells without the use of animal or human-derived proteins. The five-step purification process results in a homogenous, highly purified rFVIII product.

  17. alfa-Deuterium kinetic isotope effects in reactions of methyllithium. Is better aggregation the cause of lower reactivity?

    DEFF Research Database (Denmark)

    Holm, Torkil

    1996-01-01

    The value of kH/kD for alfa deuterium kinetic isotope effects for the reaction of methyllithium and methylmagnesium iodid with a series of substrates are consistently ca. 10-15 % higher for the lithium reagent. This may indicate a pre-equilibrium...

  18. Comprehensive safety analysis of concomitant drotrecogin alfa (activated) and prophylactic heparin use in patients with severe sepsis

    NARCIS (Netherlands)

    M. Levy; M. Levi; M.D. Williams; M. Antonelli; D. Wang; M.A. Mignini

    2009-01-01

    Purpose: The safety of using heparin concomitantly with drotrecogin alfa (activated) {DrotAA} was explored in the XPRESS study. No heparin effect on mortality was observed. Safety results from that study are explored in more detail. Methods: A randomized, double-blind trial of prophylactic heparin v

  19. Il trattamento di pazienti con sepsi grave mediante drotrecogin alfa: una valutazione economica con riferimento all’Italia

    Directory of Open Access Journals (Sweden)

    Carlo Lucioni

    2002-09-01

    Full Text Available Sepsis can be defined as a spectrum of clinical conditions caused by the immune response of a host to infection or trauma and characterized by systemic inflammation and coagulation. Particularly in elderly, immunocompromised and critically ill patients, sepsis is a major cause of morbidity and mortality in intensive care units (ICUs worldwide. In the US, sepsis is the leading cause of death in noncoronary ICU patients. Drotrecogin alfa, or recombinant human activated protein C, has antithrombotic, antiinflammatory, and profibrinolytic properties. Recently in a phase III trial (PROWESS, Drotrecogin alfa demonstrated significantly reduced mortality in severe sepsis patients at 28 days. In this trial important value factors for the assessment of costs and outcomes of severe sepsis were also considered. The purpose of the present study is to determine the economic burden of the treatment with Drotrecogin alfa, according to a cost-effectiveness analysis based on the data of the PROWESS trial. The study has been adapted to the italian health environment. As regards to the costs per surviving patient and costs per QALY (Quality Adjusted Life Year, the predicted cost-effectiveness ratio of drotrecogin alfa in severe sepsis patients is much lower than the standard values considered as acceptable in the international litterature.

  20. The Arecibo Legacy Fast ALFA Survey : X. The HI Mass Function and Omega_HI From the 40% ALFALFA Survey

    NARCIS (Netherlands)

    Martin, Ann M.; Papastergis, Emmanouil; Giovanelli, Riccardo; Haynes, Martha P.; Springob, Christopher M.; Stierwalt, Sabrina

    2010-01-01

    The Arecibo Legacy Fast ALFA (ALFALFA) survey has completed source extraction for 40% of its total sky area, resulting in the largest sample of HI-selected galaxies to date. We measure the HI mass function from a sample of 10,119 galaxies with 6.2

  1. Accurate Learning with Few Atlases (ALFA): an algorithm for MRI neonatal brain extraction and comparison with 11 publicly available methods

    Science.gov (United States)

    Serag, Ahmed; Blesa, Manuel; Moore, Emma J.; Pataky, Rozalia; Sparrow, Sarah A.; Wilkinson, A. G.; MacNaught, Gillian; Semple, Scott I.; Boardman, James P.

    2016-03-01

    Accurate whole-brain segmentation, or brain extraction, of magnetic resonance imaging (MRI) is a critical first step in most neuroimage analysis pipelines. The majority of brain extraction algorithms have been developed and evaluated for adult data and their validity for neonatal brain extraction, which presents age-specific challenges for this task, has not been established. We developed a novel method for brain extraction of multi-modal neonatal brain MR images, named ALFA (Accurate Learning with Few Atlases). The method uses a new sparsity-based atlas selection strategy that requires a very limited number of atlases ‘uniformly’ distributed in the low-dimensional data space, combined with a machine learning based label fusion technique. The performance of the method for brain extraction from multi-modal data of 50 newborns is evaluated and compared with results obtained using eleven publicly available brain extraction methods. ALFA outperformed the eleven compared methods providing robust and accurate brain extraction results across different modalities. As ALFA can learn from partially labelled datasets, it can be used to segment large-scale datasets efficiently. ALFA could also be applied to other imaging modalities and other stages across the life course.

  2. Randomized, controlled, open-label, non-inferiority study of the CONSORT algorithm for individualized dosing of follitropin alfa

    NARCIS (Netherlands)

    Olivennes, F.; Trew, G.; Borini, A.; Broekmans, F.; Arriagada, P.; Warne, D. W.; Howles, C. M.

    2015-01-01

    In this randomized, controlled, open-label, phase IV study, ovarian response after a follitropin alfa starting dose determined by the CONSORT calculator was compared with a standard dose (150 IU). Normo-ovulatory women (aged 18-34 years) eligible for assisted reproductive techniques were recruited (

  3. Oxitocina e comportamento humano Oxitocina y comportamiento humano Oxytocin and human behavior

    Directory of Open Access Journals (Sweden)

    Diana Catarina Ferreira de Campos

    2010-07-01

    Full Text Available Recentemente, têm surgido numerosas especulações sobre o papel da oxitocina nas emoções e relações sociais do ser humano. O presente artigo retrata um estudo essencialmente reflexivo sobre o papel da oxitocina no comportamento humano. A pesquisa bibliográfica foi efectuada nas bases de dados MEDLINE, versão PubMed e CINAHL. Os principais resultados das pesquisas sustentam que os níveis de oxitocina aumentam em resposta à aplicação de massagem e indução de emoções positivas. A administração intranasal de oxitocina aumenta os níveis de calma, diminui o nível de ansiedade e promove comportamentos de confiança entre as pessoas. Uma melhor compreensão dos mecanismos neurobioquímicos e biológicos do comportamento humano têm implicações cruciais para o desenvolvimento do conhecimento científico sobre patologias psiquiátricas com especial handicap nas relações sociais (exemplo: autismo, esquizofrenia, personalidade borderline.Recientemente, han surgido numerosas especulaciones sobre el papel de la oxitocina en las emociones y relaciones sociales del ser humano. El presente artículo retrata un estudio esencialmente reflexivo sobre el papel de la oxitocina en el comportamiento humano. La investigación bibliográfica fue efectuada en las bases de datos MEDLINE, versión PubMed y CINAHL. Los principales resultados de la investigación sustentan que los niveles de oxitocina aumentan en respuesta a la aplicación del masaje e inducción de emociones positivas. La administración intranasal de oxitocina aumenta los niveles de tranquilidad, disminuye el nivel de ansiedad y promueve comportamientos de confianza entre las personas. Una mejor comprensión de los mecanismos neurobioquímicos y biológicos del comportamiento humano tiene implicaciones cruciales para el desarrollo del conocimiento científico sobre patologías psiquiátricas con especial handicap en las relaciones sociales (ejemplo: autismo, esquizofrenia

  4. Factores humanos y su influencia en la productividad

    OpenAIRE

    Mirza Cequea; Miguel Núñez Bottini

    2011-01-01

    La productividad es un concepto de naturaleza multidimensional en la que influyen ciertas características y comportamientos del individuo, dicha influencia implica procesos psicológicos y psicosociales complejos de cuantificar que constituyen los factores humanos. El objetivo general de la investigación, es analizar los factores humanos y su influencia en la productividad, vista desde la perspectiva de tres unidades diferentes; individuo, grupo y organización. Para tal fin, se plantearon ...

  5. Customized E-Learning for B2B Companies

    Directory of Open Access Journals (Sweden)

    Tim Thomasma

    2014-06-01

    Full Text Available Business-to-Business (B2B companies have customers that are primarily other corporations. These companies have unique problems in workplace training. They must train their customers and their customers’ employees. A B2B company may operate with only a few dozen employees, but they may need to help thousands of customers learn how to make best use of their product or service. Discussions with industry executives suggest an ideal training solution might include a number of features that are reviewed in this paper.

  6. LA GENÉTICA Y LA DIGNIDAD DEL SER HUMANO

    Directory of Open Access Journals (Sweden)

    Nicolás Jouve de Barreda

    2013-01-01

    Full Text Available Los elementos biológicos del hombre no son suficientes para afrontar las cuestiones bioéticas que se plantean en torno al concepto de persona, pero son necesarios para definir con precisión las propiedades de los seres humanos y los aspectos teológicos, filosóficos y jurídicos que son atribuibles a cada persona. El ser humano es un ser singular. En él que conviven dos dimensiones de distinta naturaleza, una material y otra espiritual, y precisamente esta es la principal de las diferencias entre el hombre y el resto de seres vivos. Pero además en el hombre aparece una nueva característica, única entre los seres vivos, la componente ética. Los valores y pautas del comportamiento moral y ético del ser humano deben considerarse de origen natural ya que han contribuido al éxito y supervivencia de la especie. El hombre no es solo Homo sapiens sino también Homo moralis. El reconocimiento de culpa, autodominio, solidaridad, amor, generosidad, altruismo y honestidad, entre otras, son cualidades innatas en los seres humanos. La antropología filosófica destaca el carácter único e irrepetible propio de cada ser humano, cada persona. Esto coincide plenamente con los datos de la ciencia, que destaca la identidad genética individual y singular de cada ser humano.

  7. Dificuldades na identificação laboratorial da talassemia alfa Difficulty on laboratory identification of alpha thalassemia

    Directory of Open Access Journals (Sweden)

    Karlla Greick Batista Dias-Penna

    2010-04-01

    Full Text Available Introdução: Talassemia alfa é uma síndrome associada à redução da síntese de cadeias de globina do tipo alfa. A gravidade das manifestações clínicas está relacionada com a quantidade de globinas produzida e a estabilidade das cadeias beta presentes em excesso. A talassemia alfa mínima resulta da deleção de apenas um dos quatro genes a (-α/αα. Clinicamente apresenta anemia leve com microcitose ou ausência de anemia, sendo o diagnóstico realizado por meio de visualização da hemoglobina (Hb H por eletroforese alcalina em acetato de celulose ou por identificação de inclusões celulares de Hb H coradas pelo azul de crezil brilhante. Objetivo: Avaliar portadores de talassemia alfa e seus respectivos progenitores, correlacionando perfil hematológico e presença de Hb H, utilizando procedimentos laboratoriais clássicos em três diferentes amostragens. Discussão e conclusão: Os dados obtidos mostram que a presença de Hb H, indicativo de talassemia alfa, pode não ser confirmada em uma análise posterior. Entre os fatores que podem influenciar no não aparecimento de Hb H em pessoa comprovadamente com talassemia alfa está a deficiência de ferro. A talassemia alfa está associada a defeitos envolvendo os genes codificadores da cadeia alfa, mas também pode estar relacionada com desbalanciamento temporário na expressão dos genes globina, diminuição de alfa ou aumento de beta, o que poderia explicar o aparecimento de tetrâmeros de cadeia beta (Hb H, sugerindo diagnóstico de talassemia alfa mínima.Introduction: Alpha thalassemia is a syndrome with associated with the reduction of alpha globin chain synthesis. The severity of clinical manifestations is related to the amount of globins produced and the stability of beta chains that are present in excess. Alpha thalassemia minor is caused by the deletion of one of the four genes a (-α/αα. Clinically, it presents mild anemia with microcytosis or absence of anemia. The

  8. Quilombolas e direitos humanos no Suriname

    Directory of Open Access Journals (Sweden)

    Richard Price

    1999-05-01

    Full Text Available Resumo Desde a independência do Suriname em 1975, o relacionamento entre o Estado e sua população quilombola (cerca de 52 mil pessoas, talvez 15% da população nacional deteriorou. Do ponto de vista quilombola, os tipos de atrocidades associadas às guerras coloniais do século dezoito voltaram à tona. A Guerra Civil que começou em 1986, que jogou o exército nacional contra os “Jungle Commandos” (compostos principalmente de quilombolas só fez piorar a situação dos quilombolas. Um grande julgamento pela Corte Inter-Americana de Direitos Humanos em 1992, tendo como réu o Estado do Suriname, terminou com uma vultosa indenização por danos aos quilombolas Saramaka, autores da queixa. Recentemente a situação piorou, quando os quilombolas – sem qualquer proteção legal sob a constituição do Suriname – viram as terras pelas quais os seus antepassados lutaram e morreram serem confiscadas unilateralmente pelo Estado e doadas, em concessões gigantescas, a companhias madeireiras e mineradoras multinacionais (da Indonésia, da Malásia, da China e do Canadá. O efeito das atuais políticas para os quilombolas não é nada menos do que etnocídio.

  9. POBREZA MUNDIAL, JUSTICIA Y DERECHOS HUMANOS

    Directory of Open Access Journals (Sweden)

    Mauricio Andrés Gallo Callejas

    2010-11-01

    Full Text Available En este escrito pregunto por el estatus normativo que, bajo nuestras creencias actuales, debemos dar a la situación de millones de personas condenadas a pasar una vida en condiciones de pobreza extrema alrededor de todo el planeta. Asunto frente al cual formulo las siguientes dos tesis: (i la construcción de juicios normativos que nos permitan redescribir el sentido valorativo que estamos dando a su situación no sólo es posible, sino que es nuestro deber. Tal redescripción significa incluir su dolor y sufrimiento dentro de los asuntos dejusticia política global que incumben a toda la comunidad de seres humanos. Y (ii dicha redescripción, o lo que es igual, otorgar este nuevo estatus normativo a la pobreza mundial no nos exige ni proponer la creación de instituciones que, como la república mundial o principios globales de justicia distributiva, ponganen peligro el valor de los actuales Estados nación, ni mucho menos, justificar la violencia como herramienta de lucha política en búsqueda de la corrección moralde dichas instituciones.

  10. Supporting B2B Business Documents in XML Web Services

    Institute of Scientific and Technical Information of China (English)

    KIM Hyoungdo

    2004-01-01

    While XML web services become recognized as a solution to business-to-business transactions, there are many problems that should be solved. For example, it is not easy to manipulate business documents of existing standards such as RosettaNet and UN/EDIFACT EDI, traditionally regarded as an important resource for managing B2B relationships. As a starting point for the complete implementation of B2B web services, this paper deals with how to support B2B business documents in XML web services. In the first phase, basic requirements for driving XML web services by business documents are introduced. As a solution, this paper presents how to express B2B business documents in WSDL, a core standard for XML web services. This kind of approach facilitates the reuse of existing business documents and enhances interoperability between implemented web services. Furthermore, it suggests how to link with other conceptual modeling frameworks such as ebXML/UMM, built on a rich heritage of electronic business experience.

  11. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    2010-01-01

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The Net

  12. The ATLAS Forward Detectors - LUCID, ALFA and AFP: Past, Present and Future

    CERN Document Server

    Caforio, D; The ATLAS collaboration

    2013-01-01

    LUCID is a gas Cerenkov detector deployed near to the beam‐pipe at 17 m either side of the ATLAS Intersection point. The LUCID detector ‐ when calibrated via a Van der Meer scan – is now measuring absolute luminosity on a bunch‐by‐bunch basis. It is now measuring integrated luminosity up to high luminosity with a precision of around 3%. The technical challenges that had to faced to make this measurement as well as upgrade plans for LUCID will be presented. In addition to LUCID, we will discuss that ALFA detector (Absolute Luminosity for ATLAS) and its status as well as the progress on the ATLAS Forward Protons project (AFP) that plans to deploy detectors to tag and measure, with 3‐D silicon detectors, both protons in exclusive central diffractive processes.

  13. Analise dos alelos S e Z da alfa 1 antitripsina em uma amostra de pacientes fibrocisticos

    OpenAIRE

    2002-01-01

    A fibrose cística é uma alteração genética que cursa principalmente com manifestações pulmonares e pancreáticas. A correlação genótipo-fenótipo da fibrose cística é motivo de árduos estudos. Somente a correlação com a insuficiência pancreática foi encontrada. Percebeu-se, também, que o curso e a severidade da manifestação pulmonar não estão correlacionados com o genótipo CFTR. A alfaI antitripsina inibe as proteases que desencadeiam as reações inflamatórias do plasma. Seu papel inibitório mai...

  14. Arecibo Pulsar Survey Using ALFA. III. Probing Radio Pulsar Intermittency and Transients

    CERN Document Server

    Deneva, J S; McLaughlin, M A; Nice, D J; Lorimer, D R; Crawford, F; Bhat, N D R; Camilo, F; Champion, D J; Freire, P C C; Edel, S; Kondratiev, V I; Hessels, J W T; Jenet, F A; Kasian, L; Kaspi, V M; Krämer, M; Lazarus, P; Van Leeuwen, J; Ransom, S M; Stairs, I H; Stappers, B W; Brazier, A; Venkataraman, A; Zollweg, J A

    2008-01-01

    We present radio transient search algorithms, results, and statistics from the ongoing Arecibo Pulsar ALFA (PALFA) Survey of the Galactic plane. We have discovered seven objects by detecting isolated dispersed pulses and one of the new discoveries has a duty cycle of 0.01%, the smallest known. The impact of selection effects on the detectability and classification of intermittent sources is discussed, and the relative efficiencies of periodicity vs. single pulse searches are compared for various pulsar classes. We find that scintillation, off-axis detection and few rotation periods within an observation may misrepresent normal periodic pulsars as intermittent sources. Finally, we derive constraints on transient pulse rate and flux density from the PALFA survey parameters and results.

  15. GRIN2B predicts attention problems among disadvantaged children.

    Science.gov (United States)

    Riva, Valentina; Battaglia, Marco; Nobile, Maria; Cattaneo, Francesca; Lazazzera, Claudio; Mascheretti, Sara; Giorda, Roberto; Mérette, Chantal; Émond, Claudia; Maziade, Michel; Marino, Cecilia

    2015-07-01

    It is well established that adversities and GRIN2B (coding an N-methyl-D-aspartate receptor subunit) are independently associated with behavioral and cognitive impairments in childhood. However, a high proportion of children exposed to adversities have good, long-term outcomes. We hypothesized that among children exposed to adversities, GRIN2B variants would predict the worst cognitive and behavioral outcomes. 6 single nucleotide polymorphisms of GRIN2B were genotyped in 625 children aged 6-11 years from an Italian community-based sample. The interacting effect of GRIN2B variants with 4 measures of adversities [low socioeconomic status (SES), preterm delivery, maternal smoking during pregnancy, and absence of breastfeeding] was investigated upon blindly assessed cognitive abilities (vocabulary, block design, digit spans of Wechsler's Intelligence Scale, and Rey complex figure) and parents-rated behavioral problems (Child Behavior Checklist/6-18). Rs2268119 × SES interaction (Hotelling's Trace = 0.07; F(12,1154) = 3.53; p = 0.00004) influenced behavior, with more attention problems among children in the 'either A/T or T/T genotype and low SES' group, compared to all other groups. This interaction effect was not significant in an independent, replication sample of 475 subjects from an Italian community-based sample. GRIN2B variants predict children with the worst outcome in attention functioning among children exposed to low SES. Our findings, if replicated, could help in the identification of children with the highest risk and may prompt cost-effective preventive/treatment strategies.

  16. Mechanochemical synthesis and characterization of pure Co$_2$B nanocrystals

    Indian Academy of Sciences (India)

    MUSTAFA BARIS; TUNCAY SIMSEK; ADNAN AKKURT

    2016-08-01

    Cobalt boride (Co$_2$B) is a significant transition metal boride having a wide range of usage area due to its high oxidation, abrasion and corrosion resistance as well as its superior electrochemical, magnetic and anisotropicproperties. In this study, pure Co2B nanocrystals were synthesized with Co, B$_2$O$_3$ and Mg as starting materials via the mechanochemical synthesis (MCS) method by high-energy planetary ball mill in a hardened steel vial withhardened steel balls. All the experiments were conducted under Ar atmosphere at different rotational speeds and at 20:1–30:1–40:1 ball-to-powder ratios. Leaching of Co$_2$B $+$ MgO powder mixtures occurred after milling andpurified with acetic acid and pure Co$_2$B nanocrystals were obtained in solid form. The Co2Bs were characterized through X-ray diffraction, scanning electronmicroscopy, vibrating samplemagnetometer, Brunauer–Emmett–Tellerand specific density analyses, and effects of synthesis parameters on product properties were revealed. Surface areas of the powders synthesized at 40:1 ball-to-powder ratio at different rotational speeds were measured as 21.14,40.36 and 52.33 m$^2$ g$^{−1}$, respectively. Crystallite sizes of Co$_2$B nanocrystals were between 7.27 and 9.84 nm and their specific density varied between 7.61 and 7.78 g cm$^{−3}$. It was determined that all samples were saturated and exhibited hysteresis and ferromagnetic behaviours, and saturation magnetization was between 35 and 50 emu g$^{−1}$.

  17. Recombinant interferon alfa-2a, an active agent in advanced cutaneous T-cell lymphomas.

    Science.gov (United States)

    Bunn, P A; Ihde, D C; Foon, K A

    1987-01-01

    The cutaneous T-cell lymphomas including mycosis fungoides and the Sézary syndrome, are indolent lymphomas with early systemic dissemination. Like the indolent B-cell lymphomas, they cannot be cured by currently available systemic chemotherapy so new systemic therapies need to be developed. A study of very high-dose recombinant interferon alfa-2a was, therefore, initiated in 20 patients with advanced cutaneous T-cell lymphoma (5 in stage II, 2 in stage III and 13 in stage IV). All patients were refractory to at least 2 standard therapies, including topical nitrogen mustard (18 patients), psoralens and ultraviolet A light (12 patients), total skin electron irradiation (14 patients) and systemic chemotherapy (16 patients). Nine out of 20 patients (45%; 95% confidence interval 25-69%) had either objective partial or complete responses within 3 months of starting treatment. Maximal response, however, often did not occur for at least one year. The median duration of response was 5.5 months and all complete responses lasted more than 2 years. Response frequencies were equal at both cutaneous and extracutaneous sites and in patients with or without prior chemotherapy. Toxicity was exhibited primarily as a flu-like syndrome consisting of fever, malaise, fatigue, anorexia and weight loss which necessitated dose reductions in all patients. Transient elevations in liver function and decreases in renal function and granulocyte counts occurred in some patients. It is concluded that interferon alfa-2a is highly active against advanced cutaneous T-cell lymphomas and that it should be studied in its early stages. It should also be evaluated in combination with other biological agents and with chemotherapy.

  18. Properties of Cold HI Emission Clouds in the Inner-Galaxy ALFA Survey

    Science.gov (United States)

    Hughes, James Marcus; Gibson, Steven J.; Noriega-Crespo, Alberto; Newton, Jonathan; Koo, Bon-Chul; Douglas, Kevin A.; Peek, Joshua Eli Goldston; Park, Geumsook; Kang, Ji-hyun; Korpela, Eric J.; Heiles, Carl E.; Dame, Thomas M.

    2017-01-01

    Star formation, a critical process within galaxies, occurs in the coldest, densest interstellar clouds, whose gas and dust content are observed primarily at radio and infrared wavelengths. The formation of molecular hydrogen (H2) from neutral atomic hydrogen (HI) is an essential early step in the condensation of these clouds from the ambient interstellar medium, but it is not yet completely understood, e.g., what is the predominant trigger? Even more troubling, the abundance of H2 may be severely underestimated by standard tracers like CO, implying significant "dark" H2, and the quantity of HI may also be in error if opacity effects are neglected. We have developed an automated method to account for both HI and H2 in cold, diffuse clouds traced by narrow-line HI 21-cm emission in the Arecibo Inner-Galaxy ALFA (I-GALFA) survey. Our algorithm fits narrow (2-5 km/s), isolated HI line profiles to determine their spin temperature, optical depth, and true column density. We then estimate the "visible" H2 column in the same clouds with CfA and Planck CO data and the total gas column from dust emission measured by Planck, IRAS, and other surveys. Together, these provide constraints on the dark H2 abundance, which we examine in relation to other cloud properties and stages of development. Our aim is to build a database of H2-forming regions with significant dark gas to aid future analyses of coalescing interstellar clouds. We acknowledge support from NSF, NASA, Western Kentucky University, and Williams College. I-GALFA is a GALFA-HI survey observed with the 7-beam ALFA receiver on the 305-meter William E. Gordon Telescope. The Arecibo Observatory is a U.S. National Science Foundation facility operated under sequential cooperative agreements with Cornell University and SRI International, the latter in alliance with the Ana G. Mendez-Universidad Metropolitana and the Universities Space Research Association.

  19. Migraciones forzosas, nuevos refugios y derechos humanos

    Directory of Open Access Journals (Sweden)

    Gortázar Rotaeche, Cristina

    2005-06-01

    antiguo, este Derecho ha entendido que los movimientos migratorios obedecen a motivaciones más o menos voluntarias, mientras que el refugio implica que una persona se encuentra sin posibilidad de protección en su Estado de origen. Sin embargo, en el Derecho internacional contemporáneo nos encontramos ante un cuadro dominado por la imprecisión: ¿Son voluntarias las migraciones provenientes desde el tercer mundo? En caso de respuesta negativa, ¿cuáles son forzosas y cuáles no lo son? ¿Acaso sólo son involuntarias las provocadas por el Estado de origen, sea por acción u omisión? ¿Qué sucede entonces con los desplazamientos humanos que traen causa en las catástrofes naturales?. Por fin, la respuesta de los Estados ante las migraciones forzosas y la protección de los nuevos refugiados trae consigo una toma de postura coherente ante la diversidad cultural, ya que ésta será determinante para que la denominada «integración» de los inmigrantes y refugiados. Asimismo, cualquier reflexión sobre la convivencia entre distintas culturas nos conduce al perdurable debate sobre el origen de los derechos humanos fundamentales y de su carácter universal, inderogable e indivisible.

  20. Defesa dos direitos humanos: sistemas regionais

    Directory of Open Access Journals (Sweden)

    Hélio Bicudo

    2003-04-01

    Full Text Available O texto discorre sobre a institucionalização dos sistemas de promoção dos Direitos Humanos, ao longo do século XX. Tomando a Declaração Universal dos Direitos do Homem, de 1948, como base e ponto de partida, o articulista aborda as três principais vertentes dos sistemas de promoção desses direitos: a européia, a americana e a africana. A evolução de cada uma delas descrita analógica e epistemologicamente, de forma a salientar singularidades sem perder de vista as influências recíprocas ou mesmo as determinantes próprias do contexto espaço-social. Para finalizar, o articulista destaca a importância do Tribunal Penal Internacional no estabelecimento de uma justiça ecumênica. Concomitantemente, alerta para o perigo contido na ameaça de os EUA não o ratificarem.The text underlines the institutional character acquired by the main systems to promote Human Rights in the twentieth century. Taking the Universal Human Rigths Declaration, of 1948, as the basis for analysis, the author brings up three different approaches to promote these rights: the European, the American and the African. The evolution of each of them is described using its procedure as a basic reference. Besides, an analogical analysis, brings to the fore singularities, without ignoring reciprocal influences dictated by particular contexts, though. The author stresses the importance of the International Penal Court, as a means to establish ecumenical justice. At the same time, he reminds the reader of the risks implicit in the possible non-ratification of the IPC by United States.

  1. Fronteras abiertas, derechos humanos y justicia global

    Directory of Open Access Journals (Sweden)

    Velasco, Juan Carlos

    2012-06-01

    Full Text Available A world with “open borders”, which does not mean a “world without borders”, would provide the most appropriate institutional framework for the recognition of human rights and the implementation of distributive justice on a global scale. This is the thesis we want to substantiate in this article. Such still fictional horizon is compared with the actual state of affairs, characterized by the systematic impediment of free circulation of people. Against this background, and with the aim to face in a more comprehensive way the question of international migration, the necessity of adopting a cosmopolitan point of view is demonstrated. To keep in view such utopian option that nevertheless is not beyond the bounds of possibility results indispensable for a critique of the disturbing perspective that conceives of human mobility as a potential threat for the established order.

    Un mundo con “fronteras abiertas”, que no un “mundo sin fronteras”, aporta el marco institucional más propicio para el respeto de los derechos humanos y la instauración de la justicia distributiva a nivel planetario. En este artículo se argumenta a favor de esta tesis. El horizonte propuesto se compara con el actual estado de cosas, caracterizado por la obstrucción sistemática de la libre circulación de personas. Ante este panorama, y con el fin de afrontar de manera más integral la cuestión de las migraciones internacionales, se señala la necesidad de adoptar una mirada cosmopolita. Mantener a la vista una opción situada más allá de lo realmente existente, que no de lo posible, resulta imprescindible para poder someter a una mirada crítica la inquietante perspectiva que nos presenta la movilidad humana como una potencial amenaza para el orden establecido.

  2. Ser humano: Ser-en-la-existencia

    Directory of Open Access Journals (Sweden)

    Víctor Ricardo Moreno Holguín

    2014-01-01

    Full Text Available Es necesario superar el discurso sobre el SER y la Existencia para adentrarse en un camino práctico, que redescubre el dinamismo de la existencia de la persona humana como presencia encarnada del SER. Guiados por las palabras del místico Maestro Eckhart de Hochheim se redescubre al SER como Principio y Fundamento de la esencia de la perso- na, (SER al que buena parte de la humanidad ha llamado “Dios”, que por medio de diversas ma- nifestaciones percibidas a nivel psicológico, parece llamarlo al reencuentro. Por esto conviene ampliar la mirada para releer manifestaciones tales como la ansiedad y los estados emocionales incomprendidos por quienes los padecen y que la medicina tradicio- nal los trata como situaciones estáticas, como signos de un proceso dinámico en el alma. Así es nece- saria una psicología del Camino Interior durante el proceso que la persona realiza hasta acceder al Ser esencial. Este Camino Interior incluye la liberación de la dictadura de las emociones y de otras dolencias del alma. Finaliza este artículo con una anotación a una práctica que puede orientar hacia dónde dirigir la mirada cuando se opta por el Camino Interior; la práctica del sentarse, como no-acción y recogimien- to interior, el vivir con plena atención y mantener la respiración correcta, como se practica en muchos monasterios, que además de alejar del activismo y el frenesí de la cotidianidad, abre las puertas para el descubrimiento interior del ser humano como SER hecho Existencia

  3. Propiedades electrofisiológicas de las variantes normales de actividad alfa en el continuo vigilia-sueño

    Directory of Open Access Journals (Sweden)

    José Luis Cantero

    2001-01-01

    Full Text Available El estudio de los ritmos cerebrales puede ser abordado mediante el análisis de sus propiedades electrofisiológicas usando técnicas de EEG cuantitativo. En aquellos casos donde una misma actividad aparece espontáneamente en diferentes estados de activación cerebral, el estudio de estas propiedades ayudaría a establecer diferencias funcionales asociadas a cada uno de estos estados. El presente trabajo revisa aquellos estudios que han determinado las propiedades electrofisiológicas de las diferentes variantes normales de alfa que aparecen en el continuo vigilia-sueño, más concretamente en vigilia relajada, somnolencia y durante la fase REM del sueño. Los resultados indican que cada variante normal de alfa, aun mostrando una distribución topográfica similar en cada uno de los estados cerebrales, presenta características diferenciales atendiendo a su composición espectral, relaciones funcionales entre regiones corticales, y micro-estados cerebrales subyacentes. De acuerdo con estos hallazgos, cada variante de alfa desempeñaría diferentes funciones cerebrales. El ritmo alfa de vigilia parece ser el resultado de una máxima sincronización neuronal como consecuencia de la ausencia de procesamiento sensorial, mientras que la presencia de actividad alfa durante la somnolencia estaría más asociada al procesamiento de las imágenes hipnagógicas que ocurren al comienzo del sueño. Los brotes de alfa de REM, sin embargo, constituirían un punto de contacto entre el cerebro dormido y el ambiente externo. Esta caracterización electrofisiológica encuentra su campo de aplicación más directo en el diseño de algoritmos para clasificar el sueño de forma automática, así como en el diagnóstico y evaluación de determinadas patologías donde pudieran verse afectados los mecanismos cerebrales de generación de esta actividad a lo largo del continuo vigilia-sueño.

  4. Chemical Reactivity Perspective into the Group 2B Metals Halides.

    Science.gov (United States)

    Özen, Alimet Sema; Akdeniz, Zehra

    2016-06-30

    Chemical reactivity descriptors within the conceptual density functional theory can be used to understand the nature of the interactions between two monomers of the Group 2B metal halides. This information might be valuable in the development of adequate force law parameters for simulations in the liquid state. In this study, MX2 monomers and dimers, where M = Zn, Cd, Hg and X = F, Cl, Br, I, were investigated in terms of chemical reactivity descriptors. Relativistic effects were taken into account using the effective core potential (ECP) approach. Correlations were produced between global and local reactivity descriptors and dimerization energies. Results presented in this work represent the first systematic investigation of Group 2B metal halides in the literature from a combined point of view of both relativistic effects and chemical reactivity descriptors. Steric effects were found to be responsible for the deviation from the chemical reactivity principles. They were introduced into the chemical reactivity descriptors such as local softness.

  5. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...... and is independent of specific implementation technologies. In the next stage of the research the emerging reference model will be extended to create an assessment model for analysing the maturity level of a given company in a specific supply chain....

  6. Structured Crowdsourcing: A B2B Innovation Roadmap

    DEFF Research Database (Denmark)

    Edgeman, Rick; Engell, Toke; Jensen, Nik Grewy

    Crowdsourcing is an increasingly popular source of both ideas and funding. Crowdsourcing in a B2B context is less well understood and, as such, much of our discussion will highlight business-to-business crowdsourcing. More generally discussion will address crowdsourcing relative to innovation...... from crowd-sourcing efforts. The roadmap emphasizes on early stages in the overall innovation management activity that is related to development and specification of the task to be crowdsourced, the identification of the crowd, the creation of the environment to connect the crowdsourcer, the task...... and the crowd, motivation of the crowd, and actual activities in reaching the crowd. Managing the input from the crowd is regarded as a later stage in the overall innovation management but also as a focal point in the arguments for improving B2B crowdsourcing. In crowd selection processes this paper aims...

  7. B2B Models for DoD Acquisition

    Science.gov (United States)

    2008-01-15

    business (B2B) e- commerce refers to transactions between businesses conducted electronically over the Internet, intranets, extranets, or private...types of electronic marketplace participation: 1) Sell-side, 2) Buy- side, 3) Exchanges, and 4) Collaborative commerce . In sell-side commerce , there...types are collectively referred to as company-centric electronic commerce , because they address a single company buying or selling needs. Exchanges

  8. Inbound-markkinoinnin opas pienille B2B-asiantuntijayrityksille

    OpenAIRE

    Halonen, Tuija

    2016-01-01

    Digitalisaatio on muuttanut asiakkaiden ostokäyttäytymistä, minkä vuoksi myös markkinoinnin on muututtava. Asiakaslähtöinen inbound-markkinointi on vetovoimainen vaihtoehto perinteiselle yksisuuntaiselle markkinoinnille, jonka teho on laskussa. Tämän toiminnallisen opinnäytetyön tarkoituksena oli rakentaa opas, joka auttaa pieniä suomalaisia B2B-asiantuntijayrityksiä suunnittelemaan ja toteuttamaan toimivaa ja kustannustehokasta inbound-markkinointia. Teoreettisen viitekehyksen pohjal...

  9. CBERS-2B Monitored Forest Fires In Yunnan Province

    Institute of Scientific and Technical Information of China (English)

    Rain.L

    2008-01-01

    @@ Several forest fires hit Yunnan Province,in the southwest of China from April 6 to 9.Two disastrous fires happened near Shangri-La County,Yunnan Province.According to the requirement of the Land and Surveying Department of Yunnan Province,the China Center for Resources Satellite Data & Application (CRESDA) provided satellite monitoring images to detect the events.The processed CBERS-2B images were delivered to the related departments for decision making and disaster relief.

  10. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  11. A Randomized Study of Peginterferon Lambda-1a Compared to Peginterferon Alfa-2a in Combination with Ribavirin and Telaprevir in Patients with Genotype-1 Chronic Hepatitis C

    Science.gov (United States)

    Flisiak, Robert; Shiffman, Mitchell; Arenas, Juan; Cheinquer, Hugo; Nikitin, Igor; Dong, Yuping; Rana, Khurram; Srinivasan, Subasree

    2016-01-01

    Background A randomized, double-blind, multinational, phase 3 study was conducted comparing the efficacy and safety of peginterferon lambda-1a (Lambda)/ribavirin (RBV)/telaprevir (TVR) vs. peginterferon alfa-2a (Alfa)/RBV/TVR in patients with chronic hepatitis C virus (HCV) genotype-1 (GT-1) infection. Methods Patients (treatment-naïve or relapsers on prior Alfa/RBV treatment) were randomly assigned in a 2:1 ratio to receive Lambda/RBV/TVR or Alfa/RBV/TVR. Total duration of treatment was either 24 or 48 weeks (response-guided treatment), with TVR administered for the first 12 weeks. The primary endpoint was the proportion of patients who achieved a sustained virologic response at post treatment week 12 (SVR12), which was tested for noninferiority of Lambda/RBV/TVR. Results A total of 838 patients were enrolled, and 617 were treated; 411 and 206 patients received Lambda/RBV/TVR and Alfa/RBV/TVR, respectively. The majority of patients were treatment-naïve, with HCV GT-1b and a high baseline viral load (≥800,000 IU/mL). Less than 10% of patients had cirrhosis (Lambda, 7.5%; Alfa, 6.8%). Lambda/RBV/TVR did not meet the criterion for noninferiority (lower bound of the treatment difference interval was -12.3%); the SVR12 in all patients (modified intent-to-treat) was 76.2% in the Lambda arm and 82.0% in the Alfa arm. Overall, the frequency of adverse events in each arm was comparable (Lambda, 91.7%; Alfa, 97.1%). As expected based on the safety profile of the 2 interferons, there were more hepatobiliary events observed in the Lambda arm and more hematologic events in the Alfa arm. Conclusions In this comparison of Lambda/RBV/TVR and Alfa/RBV/TVR in patients who were treatment-naïve or had relapsed on prior Alfa/RBV treatment, Lambda failed to demonstrate noninferiority based on SVR12 results. Treatment with Lambda/RBV/TVR was associated with a higher incidence of relapse. More patients discontinued Lambda/RBV/TVR treatment during the first 4 weeks of study treatment

  12. 40 CFR Table 2b to Subpart E of... - Reactivity Factors for Aliphatic Hydrocarbon Solvent Mixtures

    Science.gov (United States)

    2010-07-01

    ... Hydrocarbon Solvent Mixtures 2B Table 2B to Subpart E of Part 59 Protection of Environment ENVIRONMENTAL... Hydrocarbon Solvent Mixtures Bin Averageboiling point * (degrees F) Criteria Reactivityfactor 1 80-205 Alkanes... + Dry Point) / 2 (b) Aromatic Hydrocarbon Solvents...

  13. Editorial: Desarrollo humano, pobreza y salud

    Directory of Open Access Journals (Sweden)

    Armando Corté

    2006-03-01

    Full Text Available Según el Programa de las Naciones Unidas para el Desarrollo (PNUD Colombia ha mejorado el índice de desarrollo humano por los logros en la cobertura de educación y salud e incrementar el ingreso per cápita. Esto permitió pasar del puesto 77 al 69. Sin embargo, preocupa estar de undécimo entre los países con peor distribución del ingreso; el ingreso de un rico equivale a lo que reciben 58 personas más pobres de Colombia, mientras en Dinamarca y Japón equivale a 24.7 y 24.9 respectivamente. Una de las mayores barreras para reducir la pobreza es la inequidad distributiva de la riqueza. La sociedad colombiana es pobre, presenta una distribución desigual del ingreso y crece poco. Es probable que una mejor distribución del ingreso facilite el crecimiento económico, que sólo es posible con una base institucional confiable y con políticas macroeconómicas estables enfocadas hacia el desarrollo individual. Catorce millones de colombianos sobreviven con menos de dos dólares diarios. En total, 64 de cada 100 colombianos están en el «umbral» de pobreza y algunas regiones padecen niveles casi africanos, como el Chocó. La ruta más expedita para salir de la pobreza es el desarrollo humano. Para impulsarlo debe haber acceso a servicios de salud y educación de buena calidad. Si Colombia quiere tener pros-peridad y justicia social, requiere atender la equidad entre sus zonas rurales y urbanas, entre sus regiones, entre grupos étnicos y entre hombres y mujeres en aspectos como el acceso a la educación, la propiedad de la tierra y la distribución del ingreso. Según la encuesta de salud sexual y reproductiva de PROFAMILIA del año 2005, la sociedad colombiana ha cambiado radicalmente en los últimos 50 años, con descenso de la tasa global de fecundidad de 6.8 a 2.4, el de mortalidad bruta de 16.7 a 5.5 y el de mortalidad infantil de 123.2 a 25.6 (aún vergonzosa. La esperanza de vida de los colombianos aumentó de 50.6 a 72.2 años, pero

  14. La izquierda y los derechos humanos en el siglo XXI

    Directory of Open Access Journals (Sweden)

    Manuel Alcaraz Ramos

    2000-01-01

    Full Text Available El artículo trata de ofrecer una visión general de las relaciones históricas entre la izquierda, en sus diversas tradiciones, y los problemas políticos planteados por la emergencia y desarrollo conceptual y práctico de los Derechos Humanos. Se resalta que la relación entre izquierdas y Derechos Humanos ha estado marcada, en muchas ocasiones, por la contradicción cuando no por determinadas incompresiones y desencuentros. Sin embargo, el fin de la Guerra Fría y las convulsiones producidas en la izquierda por los cambios experimentados abren un nuevo curso ideológico a la relación izquierda - Derechos humanos, hasta el punto de que el autor considera inevitable que la defensa radical de éstos debe comvertirse en un eje central de la recuperación de la identidad perdida de las izquierdas.

  15. OPTIMIZACIÓN DEL CAPITAL HUMANO VERSUS DESEMPLEO

    Directory of Open Access Journals (Sweden)

    Armando Cuesta Santos

    2003-12-01

    Full Text Available

    Es argumentada la necesidad de trascender los paradigmas de considerar al trabajador como un costo y también de concebirlo como una inversión de la empresa, asumiendo el paradigma de considerarlo como inversión de su propio capital humano. En consecuencia, el enfoque reductor de personal con el consiguiente desempleo en aras del incremento de la productividad del trabajo, deberá ser superado por el enfoque de optimización del capital humano en la organización. El objetivo de este trabajo es contribuir a esa optimización al ir asumiendo el paradigma del trabajador como inversor de su capital humano, en oposición al desempleo implicado por el paradigma predominante concibiendo al trabajador como un costo.

  16. Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy was underpowered

    Directory of Open Access Journals (Sweden)

    Ortiz A

    2015-11-01

    Full Text Available Alberto Ortiz,1,2 Maria Dolores Sanchez-Niño1,2 1Department of Nephrology, IIS-Fundacion Jimenez Diaz, School of Medicine, Universidad Autónoma de Madrid, 2Department of Nephrology, Instituto Reina Sofia de Investigación Nefrológica, Madrid, Spain We read with interest the report by Goláň et al on the “Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy in adults with Fabry disease”.1 Based on the reported results, the authors conclude that no efficacy or safety differences were found when the approved every-other-week (EOW dosage of agalsidase alfa was increased to weekly administration. However, the key question is whether the study, as designed and performed, could have had a different outcome. View original article by Goláň et al.

  17. Deficiência de alfa-1-antitripsina na doença pulmonar obstrutiva crónica

    OpenAIRE

    2009-01-01

    Introdução – A deficiência de alfa-1-antitripsina é uma das alterações genéticas graves encontradas por todo o mundo. Porém, permanece subdiagnosticada, apesar da forte predisposição à doença pulmonar obstrutiva crónica que condiciona. Objectivos – Os objectivos deste artigo de revisão incluem o estudo e avaliação das implicações da deficiência de alfa-1-antitripsina em indivíduos com doença pulmonar obstrutiva crónica, a apresentação dos esquemas de diagnóstico e terapêuticos mais utiliza...

  18. Fe3O4/Au magnetic nanoparticle amplification strategies for ultrasensitive electrochemical immunoassay of alfa-fetoprotein

    Directory of Open Access Journals (Sweden)

    Gan N

    2011-12-01

    Full Text Available Ning Gan1*, Haijuan Jin1*, Tianhua Li1, Lei Zheng21The State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Material Science and Chemical Engineering, Ningbo University, Ningbo, 2Department of Laboratory Medicine, Nanfang Hospital, Southern Medical University, Guangzhou, People's Republic of China *Both authors contributed equally to this workBackground: The purpose of this study was to devise a novel electrochemical immunosensor for ultrasensitive detection of alfa-fetoprotein based on Fe3O4/Au nanoparticles as a carrier using a multienzyme amplification strategy.Methods and results: Greatly enhanced sensitivity was achieved using bioconjugates containing horseradish peroxidase (HRP and a secondary antibody (Ab2 linked to Fe3O4/Au nanoparticles (Fe3O4/Au-HRP-Ab2 at a high HRP/Ab2 ratio. After a sandwich immunoreaction, the Fe3O4/Au-HRP-Ab2 captured on the electrode surface produced an amplified electrocatalytic response by reduction of enzymatically oxidized hydroquinone in the presence of hydrogen peroxide. The high content of HRP in the Fe3O4/Au-HRP-Ab2 could greatly amplify the electrochemical signal. Under optimal conditions, the reduction current increased with increasing alfa-fetoprotein concentration in the sample, and exhibited a dynamic range of 0.005–10 ng/mL with a detection limit of 3 pg/mL.Conclusion: The amplified immunoassay developed in this work shows good precision, acceptable stability, and reproducibility, and can be used for detection of alfa-fetoprotein in real samples, so provides a potential alternative tool for detection of protein in the laboratory. Furthermore, this immunosensor could be regenerated by simply using an external magnetic field.Keywords: Fe3O4/Au nanoparticles, alfa-fetoprotein, sandwich immunoassay, electrochemical immunosensor

  19. El acceso al agua para consumo humano en Colombia

    Directory of Open Access Journals (Sweden)

    Martha Yánez Contreras

    2013-12-01

    Full Text Available El acceso al agua es un derecho humano que se debe garantizar sin ninguna discriminación. Este artículo examina la existencia de inequidades en el ejercicio de este derecho mediante un análisis discriminante que identifica los factores que explican las diferencias en la calidad del agua para consumo humano entre los municipios colombianos en 2009. Los resultados indican que existen inequidades en el acceso al agua potable. En particular, los municipios más pobres registran los niveles de calidad más bajos.

  20. Europa y Estados Unidos ante los Derechos Humanos en Cuba

    OpenAIRE

    Susanne Gratius

    2008-01-01

    El caso cubano señala el alto grado de politización del tema de los derechos humanos en las relaciones internacionales, puesto que el debate se centra en la falta de derechos civiles y políticos o de las libertades democráticas en el único régimen autoritario de las Américas. Cuba demuestra, al mismo tiempo, que tanto las sanciones impuestas por Washington como el compromiso condicionado de la UE no han sido estrategias eficaces para promover los derechos humanos en la isla. Al ser diferen...

  1. derechos humanos, Chile y el caso del DL 2191

    Directory of Open Access Journals (Sweden)

    Rodrigo Pica

    2005-01-01

    Full Text Available El presente trabajo busca esclarecer la jurisprudencia relativa a la validez de las leyes de autoamnistía y en particular, del decreto ley 2191 de 1978, en relación a lo dispuesto por los arts. 1, 2, 8 y 25 de la Convención Americana de Derechos Humanos en la jurisprudencia de la Corte Interamericana de Derechos Humanos, y en forma secundaria, de los pronunciamientos que la Comisión Interamericana ha emitido respecto del Decreto ley 2191 de 1978

  2. El sujeto humano en la organización

    OpenAIRE

    2016-01-01

    Este artículo pone al sujeto humano en el centro de la discusión del Comportamiento Humano Organizacional, mediante la búsqueda del factor común de los autores representativos en el tema, que revele cuál ha sido su preocupación predominante. Desde la tradición burocrática weberiana, la teoría organizacional ha sido testigo del objetivo lucrativo que se les ha dado a las organizaciones. Para los supuestos actuales, las formas legítimas de dominación estarían fundamentadas por la incapacidad de...

  3. Derechos Humanos y Políticas Públicas. Manual

    OpenAIRE

    Deluchey, Jean-François Y.; Alza Barco, Carlos; Montoya Céspedes, Nicolás; Estupiñan-Silva, Rosmerlin; Fernández Gómez, Itziar; Sánchez Mojica, Beatriz Eugenia; Gavazzo,Natalia; Aguiar de Luque, Luis; Alencar Mayer Feitosa, María Luiza; Salmon, Elizabeth; Bregaglio, Renata; Urueña, René; Sánchez, Beatriz Eugenia; Anzola, Sergio

    2014-01-01

    El presente manual, el tercero y último elaborado en el marco de la Red Derechos Humanos y Educación Superior, tiene por objetivo ilustrar las relaciones que se establecen entre los derechos humanos y las políticas públicas. Se trata de un vínculo bastante más complejo de lo que a primera vista podría parecer. En efecto, los primeros no sólo son objeto de las segundas, como estrategia para alcanzar su garantía. También se han convertido en elementos centrales en el diseño...

  4. Direito processual internacional dos direitos humanos - do que estamos falando?

    OpenAIRE

    Ferreira, Rafael Fonseca; Freire, Simone Grohs

    2011-01-01

    Trata-se de um trabalho que tem por intuito, diante de um cenário de jurisdição internacional exercido pela Corte Interamericana de Direitos Humanos, trazer ao debate a possibilidade de desenvolvimento da proposta de uma teoria processual internacional – Direito Processual Internacional – em matéria de direitos humanos, enquanto instrumento correlato (político e jurídico) da eficácia e legitimidade das decisões da Corte. E diante disso, se há espaço para uma teoria desta natureza, tomando ...

  5. PARA UNA LECTURA CRÍTICA DEL DESARROLLO HUMANO

    OpenAIRE

    Melisa Campana

    2013-01-01

    El presente trabajo propone una lectura crítica del discurso del desarrollo humano articulado por Amartya Sen en Desarrollo y Libertad , desde el enfoque de la gubernamentalidad. En primer lugar, se precisa la perspectiva teórica adoptada, haciendo hincapié en las particularidades de la razón gubernamental neoliberal, marco en el que emerge el discurso del desarrollo humano. Se rastrea, luego, un conjunto de premisas del modelo de la elección racional, que brinda elementos conceptuales al dis...

  6. Proceso experiencial: comprendiendo al ser humano en primera persona

    OpenAIRE

    2012-01-01

    Este es un artículo de revisión y reflexión teórica acerca de los fundamentos psicológicos del proceso experiencial de los seres humanos. Este artículo nació de la necesidad de situar en primera persona la participación y postura psicológica que los seres humanos asumen en la vida cotidiana a partir de los significados, valores e intenciones que tratan de afirmar ante las distintas experiencias, situaciones y determinismos que enfrentan. A partir de la revisión de distintos autores contemporá...

  7. Competencias laborales de los gerentes de talento humano

    OpenAIRE

    Gregorio Calderón Hernández; Julia Clemencia Naranjo Valencia

    2004-01-01

    El reconocimiento de la importancia de las personas en el desarrollo de las organizaciones, especialmente por la posibilidad de construir ventaja competitiva fundamentada en el talento humano, está demandando de quienes lideran el área de recursos humanos el desarrollo de competencias que respondan a los nuevos retos. La revisión de investigaciones realizadas sobre el tema en otras latitudes permite concluir que existen diferentes tipologías de competencias para los profesionales del área de ...

  8. Grupo de sala de espera: sentidos do envelhecimento humano

    OpenAIRE

    Cesar Sandoval Moreira Jr.; Marisa Japur

    2003-01-01

    Este trabalho parte da consideração do envelhecimento humano como experiência heterogênea. Busca pôr em diálogo o grupo de sala de espera, recorrendo ao construcionismo social, para descrevê-lo como prática discursiva. Problematizando essa modalidade de intervenção psicológica, nesse estudo objetivamos descrever o processo de produção de sentidos sobre o envelhecimento humano nesse contexto. Dez grupos de sala de espera, gravados e transcritos, foram pré-analisados favorecendo a escolha de um...

  9. Microbioma humano: implicações biomédicas

    OpenAIRE

    Correia, Filipe André Saraiva

    2015-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz O microbioma humano é o conjunto dos microrganismos presentes no organismo, sendo estes microrganismos caracterizados através da análise qualitativa do seu genoma. O desenvolvimento de técnicas analíticas inovadoras permitiu a identificação e compreensão das funções do microbioma humano. Este desempenha importantes funções metabólicas e influencia o funcionamento do sistema imunitário. O micro...

  10. La formación universitaria y los derechos humanos

    OpenAIRE

    Meneses-Morales, Ernesto

    1991-01-01

    Ponencia magistral del II Seminario La Universidad y los Derechos Humanos en América Latina, realizado del 7 al 9 de noviembre de 1990 en la Universidad Iberoamericana. Se enfatiza en la importancia de la formación universitaria para preparar al futuro profesionista en el conocimiento y respeto de los derechos humanos. Se establece que las universidades deben asumir la responsabilidad de proporcionar, junto con la preparación científica y profesional, el conocimiento de dichos derechos, su an...

  11. Derechos humanos: ley natural, ley divina o ley moral

    OpenAIRE

    Huelgos Sierra, Ruth Liliana

    2016-01-01

    Existe una posición doctrinaria, ampliamente defendida, respecto a que los Derechos Humanos no son el producto de una interpretación acomodada de preceptos morales o religiosos, tampoco provienen de algún tipo de entidad superior, ni mucho menos son leyes naturales. Se estipula, por tanto, que los Derechos Humanos son un reconocimiento de las obligaciones y facultades que tiene todo individuo, toda comunidad y todo Estado, por el mero hecho de pertenecer a la sociedad. Sin embargo, esta es un...

  12. El acceso al agua para consumo humano en Colombia

    OpenAIRE

    Martha Yánez Contreras; Karina Acevedo González

    2014-01-01

    El acceso al agua es un derecho humano que se debe garantizar sin ninguna discriminación. Este artículo examina la existencia de inequidades en el ejercicio de este derecho mediante un análisis discriminante que identifica los factores que explican las diferencias en la calidad del agua para consumo humano entre los municipios colombianos en 2009. Los resultados indican que existen inequidades en el acceso al agua potable. En particular, los municipios más pobres registran los niveles de cali...

  13. Detection of DNA-recombinant human epoetin-alfa as a pharmacological ergogenic aid.

    Science.gov (United States)

    Wilber, Randall L

    2002-01-01

    The use of DNA-recombinant human epoetin-alfa (rhEPO) as a pharmacological ergogenic aid for the enhancement of aerobic performance is estimated to be practised by at least 3 to 7% of elite endurance sport athletes. rhEPO is synthesised from Chinese hamster ovary cells, and is nearly identical biochemically and immunologically to endogenous epoetin-alfa (EPO). In a clinical setting, rhEPO is used to stimulate erythrocyte production in patients with end-stage renal disease and anaemia. A limited number of human studies have suggested that rhEPO provides a significant erythropoietic and ergogenic benefit in trained individuals as evidenced by increments in haemoglobin, haematocrit, maximal oxygen uptake (VO2max) and exercise endurance time. The purpose of this review is to summarise the various technologies and methodologies currently available for the detection of illicit use of rhEPO in athletes. The International Olympic Committee (IOC) banned the use of rhEPO as an ergogenic aid in 1990. Since then a number of methods have been proposed as potential techniques for detecting the illegal use of rhEPO. Most of these techniques use indirect markers to detect rhEPO in blood samples. These indirect markers include macrocytic hypochromatic erythrocytes and serum soluble transferrin receptor (sTfr) concentration. Another indirect technique uses a combination of 5 markers of enhanced erythropoiesis (haematocrit, reticulocyte haematocrit, percentage of macrocytic red blood cells, serum EPO, sTfr) to detect rhEPO. The electrophoretic mobility technique provides a direct measurement of urine and serum levels of rhEPO, and is based on the principle that the rhEPO molecule is less negatively charged versus the endogenous EPO molecule. Isoelectric patterning/focusing has emerged recently as a potential method for the direct analysis of rhEPO in urine. Among these various methodologies, the indirect technique that utilises multiple markers of enhanced erythropoiesis appears to

  14. Assessment of Lifespan Functioning Attainment (ALFA) scale: A quantitative interview for self-reported current and functional decline in schizophrenia.

    Science.gov (United States)

    Joseph, Jamie; Kremen, William S; Glatt, Stephen J; Franz, Carol E; Chandler, Sharon D; Liu, Xiaohua; Johnson, Barbara K; Tsuang, Ming T; Twamley, Elizabeth W

    2015-06-01

    Schizophrenia has been characterized as a disorder with poor outcomes across various functional domains, especially social and occupational functioning. Although these outcomes have been investigated based on patients' current functioning, few studies have considered the assessment of functional outcomes across the lifespan in schizophrenia. We developed a novel and brief scale of adulthood lifespan functioning, the Assessment of Lifespan Functioning Attainment (ALFA). We assessed current functioning and percentage of pre- and post-psychosis onset engagement for five functional domains including paid employment, living independently, romantic partnerships, close friendships, and recreational engagement with others. Pre-to post-psychosis functional decline was observed for all domains, with paid employment having the greatest decline (d = 2.68) and living independently having the least decline (d = .59). Our exploratory factor analysis suggests that a single factor accounted for the most variance in Pre-Psychosis Functioning in ALFA domains. Two factors explain the majority of variance in Post-Psychosis Functioning and Pre-to-Post Psychosis Decline: a sociability factor (close friendships and recreational engagement with others) and an independence factor (paid employment, living independently, romantic relationships). To our knowledge, this is the first study to report on a self-reported quantitative assessment of adult lifespan functioning in schizophrenia. The ALFA scale may be a useful tool for future research on functional outcomes in schizophrenia.

  15. The oxidation of methionine-54 of epoetinum alfa does not affect molecular structure or stability, but does decrease biological activity.

    Science.gov (United States)

    Labrenz, Steven R; Calmann, Melissa A; Heavner, George A; Tolman, Glen

    2008-01-01

    Erythropoietin therapy is used to treat severe anemia in renal failure and chemotherapy patients. One of these therapies based on recombinant human erythropoietin is marketed under the trade name of EPREX and utilizes epoetinum alfa as the active pharmaceutical ingredient. The effect of oxidation of methionine-54 on the structure and stability of the erythropoietin molecule has not been directly tested. We have observed partial and full chemical oxidation of methionine-54 to methionine-54 sulfoxide, accomplished using tert-Butylhydroperoxide and hydrogen peroxide, respectively. A blue shift in the fluorescence center of spectral mass wavelength was observed as a linear response to the level of methionine sulfoxide in the epoetinum alfa molecule, presumably arising from a local change in the environment near tryptophan-51, as supported by potassium iodide quenching studies. Circular dichroism studies demonstrated no change in the folded structure of the molecule with methionine oxidation. The thermal unfolding profiles of partial and completely oxidized epoetinum alfa overlap, with a T(m) of 49.5 degrees C across all levels of methionine sulfoxide content. When the protein was tested for activity, a decrease in biological activity was observed, correlating with methionine sulfoxide levels. An allosteric effect between Met54, Trp51, and residues involved in receptor binding is proposed. These results indicate that methionine oxidation has no effect on the folded structure and global thermodynamic stability of the recombinant human erythropoietin molecule. Oxidation can affect potency, but only at levels significantly in excess of those seen in EPREX.

  16. Medida de la concentración de actividad Alfa/Beta grueso, en agua potable

    OpenAIRE

    Zutta Villate, Julián Mateo

    2014-01-01

    Introducción: La calidad del agua de consumo humano es de creciente interés en el mundo; para que esta pueda ser considerada como potable, debe ajustarse a ciertos niveles biológicos, químicos, físicos y radiológicos. Siguiendo recomendaciones de organismos internacionales de salud o, a estándares emitidos por cada país, establecidos según sus condiciones tanto ambientales, como socioeconómicas. La Organización Mundial de la Salud (OMS), en sus guías de potabilización del agua de consu...

  17. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  18. Educação em Direitos Humanos: para uma cultura da paz

    OpenAIRE

    Gorczevski, Clovis; Tauchen, Gionara

    2008-01-01

    O presente artigo analisa e caracteriza, num primeiro instante, os conceitos de cidadania e Direitos Humanos para, num segundo momento, problematizar e refletir sobre os caminhos da educação em Direitos Humanos e para a paz. Sugere a educação em Direitos Humanos como educação complementar formal. Descritores – Cidadania; Direitos Humanos; educação.

  19. El coleccionismo: el rescate de las cosas y lo humano = Colecionismo: o resgate das coisas e do humano

    Directory of Open Access Journals (Sweden)

    Valis, Noël

    2013-01-01

    Full Text Available Proposta de uma reflexão aprofundada sobre o ato de colecionar, uma das pulsões menos compreendidas pelo pensamento contemporâneo, aqui concebido como uma extensão humanizadora do Ser. O destino dos objetos é o nosso destino, porque sem eles não existiríamos como seres verdadeiramente humanos. O artigo se apóia em teóricos como Walter Benjamin ou Hannah Arendt e se detêm em romancistas que têm refletido sobre o colecionismo em suas distopias, em que o ser humano é tratado como um objeto

  20. Educação em Direitos Humanos: para uma cultura da paz

    Directory of Open Access Journals (Sweden)

    Gorczevski, Clovis

    2008-01-01

    Full Text Available O presente artigo analisa e caracteriza, num primeiro instante, os conceitos de cidadania e Direitos Humanos para, num segundo momento, problematizar e refletir sobre os caminhos da educação em Direitos Humanos e para a paz. Sugere a educação em Direitos Humanos como educação complementar formal

  1. Effect of wool and thermo-binder fibers on adhesion of alfa fibers in polyester composite

    Science.gov (United States)

    Omri, Med. Amin; Triki, A.; Guicha, M.; Hassen, Med. Ben; Arous, M.; Ahmed El Hamzaoui, H.; Bulou, A.

    2013-12-01

    Dielectric study was investigated in order to probe the interfacial region fibers/matrix of the polyester composite reinforced with alfa/wool/thermo-binder fibers. Dielectric spectra were measured in the frequency range from 10-1 Hz to 106 Hz, and temperature interval from 40 °C to 150 °C. This study revealed the presence of two dielectric relaxations in the composite. While the first one was attributed to the α mode relaxation associated with the glass transition of the matrix, the second was associated with the conductivity resulting from the carriers' charges diffusion noted for high temperature above glass transition and low frequencies. As this study did not show the presence of the interfacial polarization effect in the composite, it was accomplished with the vibrational study using the FT-IR and Raman techniques. A great compatibility between fibers and matrix was proven by a less hydrophilic character of the reinforcement giving rise to additional valence vibrations from wool fibers and hydrogen bonds.

  2. Arecibo Pulsar Survey Using ALFA. III. Precursor Survey and Population Synthesis

    CERN Document Server

    Swiggum, J K; McLaughlin, M A; Bates, S D; Champion, D J; Ransom, S M; Lazarus, P; Brazier, A; Hessels, J W T; Nice, D J; Ellis, J; Senty, T R; Allen, B; Bhat, N D R; Bogdanov, S; Camilo, F; Chatterjee, S; Cordes, J M; Crawford, F; Deneva, J S; Freire, P C C; Jenet, F A; Karako-Argaman, C; Kaspi, V M; Knispel, B; Lee, K J; Van Leeuwen, J; Lynch, R; Lyne, A G; Scholz, P; Siemens, X; Stairs, I H; Stappers, B W; Stovall, K; Venkataraman, A; Zhu, W W

    2014-01-01

    The Pulsar Arecibo L-band Feed Array (PALFA) Survey uses the ALFA 7-beam receiver to search both inner and outer Galactic sectors visible from Arecibo ($32^{\\circ}\\lesssim \\ell \\lesssim 77^{\\circ}$ and $168^{\\circ}\\lesssim \\ell \\lesssim 214^{\\circ}$) close to the Galactic plane ($|b|\\lesssim5^{\\circ}$) for pulsars. In this paper we detail a precursor survey of this region with PALFA, which observed a subset of the full region (slightly more restrictive in $\\ell$ and $|b|\\lesssim1^{\\circ}$) and detected 45 pulsars. For both Galactic millisecond and normal pulsar populations, we compare the survey's detections with simulations to model these populations and, in particular, to estimate the number of observable pulsars in the Galaxy. We place 95\\% confidence intervals of 82,000 to 143,000 on the number of detectable normal pulsars and 9,000 to 100,000 on the number of detectable millisecond pulsars in the Galactic disk. These are consistent with previous estimates. Given the most likely population size in each ca...

  3. Reversing anticoagulant effects of novel oral anticoagulants: role of ciraparantag, andexanet alfa, and idarucizumab

    Directory of Open Access Journals (Sweden)

    Hu TY

    2016-02-01

    Full Text Available Tiffany Y Hu,1 Vaibhav R Vaidya,2 Samuel J Asirvatham2,31Mayo Medical School, 2Division of Cardiovascular Diseases, Department of Internal Medicine, 3Department of Pediatrics and Adolescent Medicine, Mayo Clinic, Rochester, MN, USAAbstract: Novel oral anticoagulants (NOACs are increasingly used in clinical practice, but lack of commercially available reversal agents is a major barrier for mainstream use of these therapies. Specific antidotes to NOACs are under development. Idarucizumab (aDabi-Fab, BI 655075 is a novel humanized mouse monoclonal antibody that binds dabigatran and reverses its anticoagulant effect. In a recent Phase III study (Reversal Effects of Idarucizumab on Active Dabigatran, a 5 g intravenous infusion of idarucizumab resulted in the normalization of dilute thrombin time in 98% and 93% of the two groups studied, with normalization of ecarin-clotting time in 89% and 88% patients. Two other antidotes, andexanet alfa (PRT064445 and ciraparantag (PER977 are also under development for reversal of NOACs. In this review, we discuss commonly encountered management issues with NOACs such as periprocedural management, laboratory monitoring of anticoagulation, and management of bleeding. We review currently available data regarding specific antidotes to NOACs with respect to pharmacology and clinical trials.Keywords: novel oral anticoagulant, dabigatran, idarucizumab, reversal

  4. [PROWESS, ENHANCE and ADDRESS: clinical implications for the treatment with drotrecogin alfa (activated)].

    Science.gov (United States)

    Cobas Meyer, M; Langenfeld, H; Rossaint, R; Sablotzki, A

    2006-06-01

    Drotrecogin alfa (activated) (DrotAA) represents a therapeutic advance in the treatment of severe sepsis. In the pivotal PROWESS trial DrotAA had demonstrated a significant decrease in 28-day mortality, most evident in the subgroup of patients at higher risk of death. Thus, DrotAA was licensed throughout Europe for treatment of adult patients with severe sepsis with multiple organ failure when added to best standard care. The ADDRESS trial was mandated by the FDA to investigate prospectively the treatment effect of DrotAA in patients at low risk of death, e.g. single organ failure. The trial was prematurely stopped due to futility, because no reduction in mortality was observed in this non-indicated patient population. The ENHANCE open-label trial enrolled similar patients to the PROWESS trial and the observed 28-day mortality was consistent with the results seen in the PROWESS trial. Survival rates for patients receiving DrotAA early within 24 h from the first sepsis-induced organ dysfunction were significantly higher than in patients treated later. In this overview we will discuss the results of the ENHANCE and ADDRESS trials in the context of the PROWESS study and clinical implications for the treatment with DrotAA.

  5. The Arecibo Legacy Fast ALFA Survey: VI. Second HI Source Catalog of the Virgo Cluster Region

    CERN Document Server

    Kent, Brian R; Haynes, Martha P; Martin, Ann M; Saintonge, Amélie; Stierwalt, Sabrina; Balonek, Thomas J; Brosch, Noah; Koopmann, Rebecca A

    2008-01-01

    We present the third installment of HI sources extracted from the Arecibo Legacy Fast ALFA extragalactic survey. This dataset continues the work of the Virgo ALFALFA catalog. The catalogs and spectra published here consist of data obtained during the 2005 and 2006 observing sessions of the survey. The catalog consists of 578 HI detections within the range 11h 36m 6.5; (b) high velocity clouds in the Milky Way or its periphery; and (c) signals of lower S/N which coincide spatially with an optical object and known redshift. 75% of the sources are newly published HI detections. Of particular note is a complex of HI clouds projected between M87 and M49 that do not coincide with any optical counterparts. Candidate objects without optical counterparts are few. The median redshift for this sample is 6500 km/s and the cz distribution exhibits the local large scale structure consisting of Virgo and the background void and the A1367-Coma supercluster regime at cz_sun ~7000 km/s. Position corrections for telescope poin...

  6. LHC Report: special run with de-squeezed beams for ATLAS/ALFA and TOTEM

    CERN Multimedia

    Helmut Burkhardt for the LHC team

    2015-01-01

    The main high-luminosity proton-proton run of the LHC is complemented by one week per year of special proton-proton runs. The special runs are performed with larger beam sizes at the interaction points to allow the forward physics experiments, TOTEM and ATLAS/ALFA, the chance to make precise measurements of protons as they emerge from collisions at small angles.   In standard high-luminosity operation, the beams are squeezed to give small beam sizes at the interaction points to maximise the collision rates. The “squeeze” takes place at top energy and the beam size at the centre of ATLAS (IP1) and CMS (IP5) is reduced from 66 micrometres at the top of the ramp to 18 micrometres before colliding beams are established. Protons that avoid the fate of an inelastic collision but yet still interact – in elastic or diffractive events – are scattered and emerge in the forward direction. The reduction in beam size has a side effect of increasing the an...

  7. Pharmacokinetics of Novel Plant Cell-Expressed Taliglucerase Alfa in Adult and Pediatric Patients with Gaucher Disease.

    Directory of Open Access Journals (Sweden)

    Richat Abbas

    Full Text Available Taliglucerase alfa is a beta-glucocerebrosidase enzyme replacement therapy approved in the United States, Israel, and other countries for treatment of Type 1 Gaucher disease in adults, and is the first approved plant cell--expressed recombinant protein. In this report, taliglucerase alfa pharmacokinetics were assessed in adult and pediatric patients with Gaucher disease from separate multicenter trials of 30 Units/kg and 60 Units/kg doses infused every 2 weeks. Serial blood samples were obtained from adult patients following single-dose administration on day 1 (n = 26 and multiple doses at week 38 (n = 29, and from pediatric patients following administration of multiple doses of taliglucerase alfa for 10-27 months (n = 10. In both adult and pediatric patients, maximum plasma concentration (Cmax, area under the plasma concentration-time curve from time zero to last measureable concentration (AUC0-t, and from time zero to infinity (AUC0-∞ were higher after 60 Units/kg dose than 30 Units/kg dose. No tendency for accumulation or change in taliglucerase alfa pharmacokinetic parameters over time from day 1 to week 38 was observed with repeated doses of 30 or 60 Units/kg in adults. After multiple doses, mean (range dose-normalized pharmacokinetic parameters were similar for adult versus pediatric patients receiving 60 Units/kg: Cmax expressed in ng/mL/mg was 42.4 (14.5-95.4 in adults and 46.6 (34.4-68.4 in pediatric patients, AUC0 t expressed in ng • h/mL/mg was 63.4 (26.3-156 in adults and 63.9 (39.8-85.1 in pediatric patients, t1/2 expressed in minutes was 34.8 (11.3-104 in adults and 31.5 (18.0-42.9 in pediatric patients and total body clearance expressed in L/h was 19.9 (6.25-37.9 in adults and 17.0 (11.7-24.9 in pediatric patients. These pharmacokinetic data extend the findings of taliglucerase alfa in adult and pediatric patients.ClinicalTrials.gov. NCT00376168 (in adults; NCT01411228 (in children.

  8. 2b or Not 2b: Experimental Evolution of Functional Exogenous Sequences in a Plant RNA Virus

    Science.gov (United States)

    Zwart, Mark P.; Ambrós, Silvia; Carrasco, José L.; Elena, Santiago F.

    2017-01-01

    Horizontal gene transfer (HGT) is pervasive in viruses and thought to be a key mechanism in their evolution. On the other hand, strong selective constraints against increasing genome size are an impediment for HGT, rapidly purging horizontally transferred sequences and thereby potentially hindering evolutionary innovation. Here, we explore experimentally the evolutionary fate of viruses with simulated HGT events, using the plant RNA virus Tobacco etch virus (TEV), by separately introducing two functional, exogenous sequences to its genome. One of the events simulates the acquisition of a new function though HGT of a conserved AlkB domain, responsible for the repair of alkylation or methylation damage in many organisms. The other event simulates the acquisition of a sequence that duplicates an existing function, through HGT of the 2b RNA silencing suppressor from Cucumber mosaic virus. We then evolved these two viruses, tracked the maintenance of the horizontally transferred sequences over time, and for the final virus populations, sequenced their genome and measured viral fitness. We found that the AlkB domain was rapidly purged from the TEV genome, restoring fitness to wild-type levels. Conversely, the 2b gene was stably maintained and did not have a major impact on viral fitness. Moreover, we found that 2b is functional in TEV, as it provides a replicative advantage when the RNA silencing suppression domain of HC-Pro is mutated. These observations suggest a potentially interesting role for HGT of short functional sequences in ameliorating evolutionary constraints on viruses, through the duplication of functions. PMID:28137747

  9. Competencias laborales de los gerentes de talento humano

    Directory of Open Access Journals (Sweden)

    Gregorio Calderón Hernández

    2004-01-01

    Full Text Available El reconocimiento de la importancia de las personas en el desarrollo de las organizaciones, especialmente por la posibilidad de construir ventaja competitiva fundamentada en el talento humano, está demandando de quienes lideran el área de recursos humanos el desarrollo de competencias que respondan a los nuevos retos. La revisión de investigaciones realizadas sobre el tema en otras latitudes permite concluir que existen diferentes tipologías de competencias para los profesionales del área de recursos humanos, que no existen estudios específicos de competencias para los gerentes del área y que se puede construir un modelo de competencias a través de análisis cualitativos. Estas consideraciones motivaron la presente investigación, que contó con el apoyo de la Asociación Colombiana de Gestión Humana (ACRIP. Se utilizó una metodología hermenéutica mediante la aplicación de entrevistas de eventos conductuales y de mapa funcional. Los resultados se reflejan en un modelo que comprende cuatro categorías y 18 competencias, además de los valores de los gerentes de talento humano y el diccionario de competencias.

  10. Los derechos humanos laborales en el Derecho Internacional

    Directory of Open Access Journals (Sweden)

    Miguel Canessa Montejo

    2009-12-01

    Full Text Available El presente estudio pretende abordar esa temática desde el horizonte del Derecho internacional. En el primer acápite se plantea un concepto para este selecto grupo de derechos laborales básicos, así como se postulan los argumentos que justifican su reconocimiento jurídico en los instrumentos internacionales de derechos humanos. En el segundo acápite se aborda la identificación de los derechos laborales con los derechos sociales, como una forma de desvalorizar su relevancia jurídica. En el tercer acápite se resaltan las singularidades de los derechos humanos laborales, lo que dificulta someterlos a la clásica división entre derechos civiles y derechos sociales. En el cuarto acápite se establecen las obligaciones internacionales que se desprenden de los derechos humanos laborales hacia los Estados. Asimismo, se hace un breve recorrido sobre los procedimientos internacionales de control y los más importantes pronunciamientos de protección de los derechos humanos laborales. Finalmente, en el último acápite se presenta el jus cogens laboral como pilar del Derecho internacional del trabajo.

  11. Desenvolvimento, educação e direitos humanos

    Directory of Open Access Journals (Sweden)

    Álvaro Laborinho Lúcio

    2013-01-01

    Full Text Available Se revisará la cuestión referida al sentido, el valor y el desarrollo de los derechos humanos en el contexto actual. Se tratará de conocer el lugar y papel que ocupa el sujeto, su autonomía y su condición de ciudadano en las democracias modernas. Se anticipa como hipótesis que, en relación al proceso de enseñanza y aprendizaje, será importante perseguir un triple objetivo centrado en el saber pensar, el saber seleccionar y el saber hacer. Otro aspecto fundamental será el de la exclusión social, tratada aquí como el lado negativo de los derechos humanos y del desarrollo. Se concluye que la existencia de los derechos humanos reclama un compromiso ético integrando la búsqueda simultánea de la igualdad, esto es, del reconocimiento del ‘otro’ en su autonomía y diversidad como sujetos de derecho y con derechos. De ahí la necesidad de educar para los derechos, que significa educar para los derechos del ‘otro’, para los derechos como instrumento de convivencia entre sujetos libres, para los derechos individuales y también para la conciencia del valor de los derechos colectivos. Palabras clave Derechos Humanos; Educación; Desarrollo; Democracia

  12. Skinner: sobre ciência e comportamento humano

    Directory of Open Access Journals (Sweden)

    Angelo Augusto Silva Sampaio

    Full Text Available Atualmente, não se pode pensar no estudo do comportamento humano sem considerar a abordagem científica a este objeto: o campo da Psicologia científica. Esse campo é disputado por diversos enfoques teóricos que divergem quanto ao modo como definem ciência e comportamento humano. A abordagem de B. F. Skinner foi bastante proeminente no século XX, mas ainda continua a ser mal-entendida. Partindo do desenvolvimento histórico de sua obra, o presente texto visa a iluminar alguns aspectos relacionados às noções de ciência e comportamento humano desse autor e ressaltar as transformações por que passaram. Analisam-se três tópicos da obra de Skinner: seu período inicial (de 1930 a cerca de 1938, a obra "Ciência e Comportamento Humano" de 1953, e as influências da Biologia. São enfatizados aspectos relevantes da sua teorização sobre o tema: busca por relações funcionais, ênfase nos dados empíricos, operacionismo, externalismo, multideterminação do comportamento, experimentalismo, previsão e controle, ética.

  13. Valores e Desenvolvimento Humano [Values and Human Development

    NARCIS (Netherlands)

    F. Comim; A. Macedo de Jesus (Anderson); R.C.B Oliveira; A. Davison; S. Galeno; A. Ribeiro

    2010-01-01

    markdownabstract__Abstract__ | 19 A primeira parte desse Relatório de Desenvolvimento Humano do Brasil 2009/2010 começa com a descrição de um amplo processo de consulta aberta à sociedade, denominada Brasil Ponto a Ponto, para a escolha do tema do relatório. A Campanha Brasil Ponto a Ponto teve por

  14. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  15. Relaciones entre el arte y los derechos humanos

    Directory of Open Access Journals (Sweden)

    Yolanda Sierra León

    2014-07-01

    Full Text Available Este artículo se propone reflexionar sumariamente acerca de la vinculación entre el arte y los derechos humanos, teniendo en cuenta el origen o proveniencia de las manifestaciones artísticas. Para el efecto, se consideran tres tipos de obras: 1. Obras originadas en una decisión judicial o estatal como medio de reparación a las víctimas; 2. Obras de arte provenientes de la propia iniciativa de los artistas, y 3. Obras o prácticas artísticas que realizan las víctimas que han sufrido violaciones a sus derechos humanos. Este texto parte de considerar que las obras de arte o las prácticas artísticas, relacionadas con los derechos humanos, tienen objetivos diferentes según sea su origen. Se plantea que el fin del Estado es reparar a las víctimas y contribuir con la garantía de no repetición; mientras que el fin de los artistas es manifestar su sensibilidad en relación con un tema específico que les interesa abordar; y para las víctimas, son mecanismos de resistencia y denuncia que permiten pasar del trauma individual a la conformación de sujetos colectivos con capacidad para incidir en las condiciones sociales que generan la violación a sus derechos humanos. Para pensar el tema, se abordan algunas sentencias del Sistema Interamericano de Derechos Humanos, y obras y prácticas artísticas de víctimas del conflicto armado colombiano.

  16. Encephalomyocarditis virus viroporin 2B activates NLRP3 inflammasome.

    Directory of Open Access Journals (Sweden)

    Minako Ito

    Full Text Available Nod-like receptors (NLRs comprise a large family of intracellular pattern- recognition receptors. Members of the NLR family assemble into large multiprotein complexes, termed the inflammasomes. The NLR family, pyrin domain-containing 3 (NLRP3 is triggered by a diverse set of molecules and signals, and forms the NLRP3 inflammasome. Recent studies have indicated that both DNA and RNA viruses stimulate the NLRP3 inflammasome, leading to the secretion of interleukin 1 beta (IL-1β and IL-18 following the activation of caspase-1. We previously demonstrated that the proton-selective ion channel M2 protein of influenza virus activates the NLRP3 inflammasome. However, the precise mechanism by which NLRP3 recognizes viral infections remains to be defined. Here, we demonstrate that encephalomyocarditis virus (EMCV, a positive strand RNA virus of the family Picornaviridae, activates the NLRP3 inflammasome in mouse dendritic cells and macrophages. Although transfection with RNA from EMCV virions or EMCV-infected cells induced robust expression of type I interferons in macrophages, it failed to stimulate secretion of IL-1β. Instead, the EMCV viroporin 2B was sufficient to cause inflammasome activation in lipopolysaccharide-primed macrophages. While cells untransfected or transfected with the gene encoding the EMCV non-structural protein 2A or 2C expressed NLRP3 uniformly throughout the cytoplasm, NLRP3 was redistributed to the perinuclear space in cells transfected with the gene encoding the EMCV 2B or influenza virus M2 protein. 2B proteins of other picornaviruses, poliovirus and enterovirus 71, also caused the NLRP3 redistribution. Elevation of the intracellular Ca(2+ level, but not mitochondrial reactive oxygen species and lysosomal cathepsin B, was important in EMCV-induced NLRP3 inflammasome activation. Chelation of extracellular Ca(2+ did not reduce virus-induced IL-1β secretion. These results indicate that EMCV activates the NLRP3 inflammasome by

  17. Co-ontogenia: Humano e não-humano no espaço da linguagem

    Directory of Open Access Journals (Sweden)

    Beto Vianna

    2011-05-01

    Full Text Available A linguagem tem sido estudada, desde meados do século passado, em seus aspectos biológicos e cognitivos, sempre no contexto de uma biologia e de uma cognição especificamente humanas. Ainda assim, há aspectos do viver e do conhecer que remetem ao seres vivos em geral, e não apenas aos humanos, e que são cruciais para se falar nos processos gerativos da linguagem, ou seja, os relacionamentos recorrentes e recursivos entre dois ou mais organismos (co-ontogenia que estabelecem vivências partilhadas entre esses organismos. Para falar sobre esses aspectos é preciso superar o discurso estritamente objetivista da ciência e atentar para o papel que nós, investigadores e leitores de trabalhos acadêmicos, exercemos ao descrever comportamentos lingüísticos. Utilizando o caminho explicativo de determinadas teorias sistêmicas e relatos de meu contato com grandes símios não-humanos na Alemanha, argumento que o viver e o conhecer de organismos humanos e não-humanos, e o nosso viver e conhecer enquanto observadores desses organismos, são igualmente instrumentais na explicação das relações co-ontogênicas recorrentes e do fenômeno a que chamamos linguagem.

  18. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  19. Mania associated with interferon α2b treatment

    Directory of Open Access Journals (Sweden)

    Basanth K

    2006-01-01

    Full Text Available Neuropsychiatric side effects are common with Interferon α 2b. Psychosis and depression have been reported. Several cases of mania have been reported but only few have been associated with treatment for hepatitis B. We report a case of mania with psychotic symptoms in a 21-year-old female diagnosed to have hepatitis-B infection, who was receiving interferon. The report supports the view that dose reductions or pauses during interferon treatment can cause mania. Family history of mood disorder could be a risk factor. Atypical presentations are common in interferon-induced mania. Mania induced by interferon responds well to antimanic drugs. Since the use of interferon is increasing in developing countries, the need for awareness of side effects and management issues are important and these are highlighted.

  20. Vortex lattice transitions in YNi2B2C

    Indian Academy of Sciences (India)

    S J Levett; C D Dewhurst; D McK Paul

    2002-05-01

    We have performed extensive small-angle neutron scattering (SANS) diffraction studies of the vortex lattice in single crystal YNi2B2C for $B||c$. High-resolution SANS, combined with a field-oscillation vortex lattice preparation technique, allows us to separate Bragg scattered intensities from two orthogonal domains and accurately determine the unit cell angle, . The data suggest that upon increasing field there is a finite transition width where both low- and high-field distorted hexagonal vortex lattice phases, mutually rotated by 45°, coexist. The smooth variation of diffracted intensity from each phase through the transition corresponds to a redistribution of populations between the two types of domains.

  1. Semantic ETL into i2b2 with Eureka!

    Science.gov (United States)

    Post, Andrew R; Krc, Tahsin; Rathod, Himanshu; Agravat, Sanjay; Mansour, Michel; Torian, William; Saltz, Joel H

    2013-01-01

    Clinical phenotyping is an emerging research information systems capability. Research uses of electronic health record (EHR) data may require the ability to identify clinical co-morbidities and complications. Such phenotypes may not be represented directly as discrete data elements, but rather as frequency, sequential and temporal patterns in billing and clinical data. These patterns' complexity suggests the need for a robust yet flexible extract, transform and load (ETL) process that can compute them. This capability should be accessible to investigators with limited ability to engage an IT department in data management. We have developed such a system, Eureka! Clinical Analytics. It extracts data from an Excel spreadsheet, computes a broad set of phenotypes of common interest, and loads both raw and computed data into an i2b2 project. A web-based user interface allows executing and monitoring ETL processes. Eureka! is deployed at our institution and is available for deployment in the cloud.

  2. Ensaio sobre desenvolvimento humano na pós-modernidade Ensayo sobre desarrollo humano en la pos-modernidad Essay on human development in the post-modernity

    Directory of Open Access Journals (Sweden)

    José Antônio Damásio Abib

    2008-09-01

    Full Text Available Neste ensaio, o conceito de desenvolvimento humano na pós-modernidade apóia-se em uma filosofia pós-moderna de direitos humanos, e na modernidade apóia-se em uma filosofia moderna de direitos humanos. O Estado moderno fracassou na realização da filosofia moderna dos direitos humanos. Uma filosofia pós-moderna de direitos humanos deixa para trás a filosofia moderna de direitos humanos. Isso significa abandonar o fundacionismo ético e as grandes narrativas emancipatórias de desenvolvimento humano. Sugerimos que uma ética pragmatista da alteridade e uma política pós-moderna da alteridade podem contribuir para elaborar uma filosofia pós-moderna de direitos humanos.En este ensayo, el concepto de desarrollo humano en el pos-modernidad es apoyado en una filosofía pos-moderna de los derechos humanos y en la modernidad, es apoyado en una filosofía moderna de los derechos humanos. El Estado moderno fracasó en la realización de la filosofía moderna de los derechos humanos. Una filosofía pos-moderna de derechos humanos deja atrás la filosofía moderna de derechos humanos. Lo que significa abandonar el fundacionismo ético y las grandes narrativas emancipatorias del desarrollo humano. Sugerimos que una ética pragmatista de la alteridad y una política pos-moderna de alteridad pueden contribuir en la elaboración de una filosofía pos-moderna de derechos humanos.Whereas the concept of human development in post-modernity is supported by a post-modern philosophy of human rights, in modernity it is supported by a modern philosophy of human rights. The modern State has failed in the modern philosophy of human rights and the post-modern philosophy of human rights has laid aside a modern philosophy of human rights. This means that ethical foundationalism and emancipatory great narratives of human development have been discarded. We suggest that a pragmatist ethics of alterity and a post-modern policy of alterity may be a help in the

  3. Morfología comparada de la escápula de primates humanos y no humanos mediante morfometría geométrica. Estudio preliminar.

    OpenAIRE

    2013-01-01

    Este trabajo estudia la morfología comparada de la escápula de primates humanos y no humanos mediante morfometría geométrica. Se han utilizado 62 omóplatos de individuos adultos de sexo desconocido (22 humanos actuales, 1 Neandertal y 39 primates no humanos), procedentes de las colecciones de las Universidades UAB, UB y del Museo de Ciencias Naturales de Barcelona. Cada escápula se fotografió ortogonalmente y se cuantificó su morfología mediante el uso de puntos anatómicos de referencia (12 p...

  4. Structure of human nucleosome containing the testis-specific histone variant TSH2B

    Energy Technology Data Exchange (ETDEWEB)

    Urahama, Takashi; Horikoshi, Naoki; Osakabe, Akihisa; Tachiwana, Hiroaki; Kurumizaka, Hitoshi, E-mail: kurumizaka@waseda.jp [Waseda University, 2-2 Wakamatsu-cho, Shinjuku-ku, Tokyo 162-8480 (Japan)

    2014-03-25

    The crystal structure of human nucleosome containing the testis-specific TSH2B variant has been determined. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, and induces a local structural difference between TSH2B and H2B in nucleosomes. The human histone H2B variant TSH2B is highly expressed in testis and may function in the chromatin transition during spermatogenesis. In the present study, the crystal structure of the human testis-specific nucleosome containing TSH2B was determined at 2.8 Å resolution. A local structural difference between TSH2B and canonical H2B in nucleosomes was detected around the TSH2B-specific amino-acid residue Ser85. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, but in the canonical nucleosome the H2B Asn84 residue (corresponding to the TSH2B Ser85 residue) forms water-mediated hydrogen bonds with the H4 Arg78 residue. In contrast, the other TSH2B-specific amino-acid residues did not induce any significant local structural changes in the TSH2B nucleosome. These findings may provide important information for understanding how testis-specific histone variants form nucleosomes during spermatogenesis.

  5. Autoantibodies to alfa-fodrin in patients with Hashimoto thyroiditis and Sjögren's syndrome: possible markers for a common secretory disorder.

    Science.gov (United States)

    Szanto, Antonia; Csipo, Istvan; Horvath, Ildiko; Biro, Edit; Szodoray, Peter; Zeher, Margit

    2008-09-01

    Presence of autoantibodies to alfa-fodrin was investigated in patients with Sjögren's syndrome (n = 61), Hashimoto thyroiditis (n = 27), Sjögren's syndrome associated with Hashimoto thyroiditis (n = 31) and in healthy persons (n = 77). In each group, level of alfa-fodrin antibodies was higher than in the controls. There was no significant difference in their presence either between patients with Hashimoto thyroiditis with or without Sjögren's syndrome, or-in IgA isotype-between Sjögren's and Hashimoto thyroiditis patients. Correlation was found between the level of IgG alfa-fodrin and anti-thyroglobulin antibodies. Based on these findings, fodrin can be associated with both endocrine and exocrine glandular secretion. Antibodies to alfa-fodrin might have a role in the pathogenesis of Hashimoto thyroiditis concerning the "final common effectory pathway", secretion. Alfa-fodrin antibodies can be good markers of secretory disorders. Assessment of these autoantibodies might help the diagnosis and follow-up of patients with impaired secretory capability of not only autoimmune origin.

  6. Effects of alfa-hydroxy-isocaproic acid on body composition, DOMS and performance in athletes

    Directory of Open Access Journals (Sweden)

    Karila Tuomo AM

    2010-01-01

    Full Text Available Abstract Background Alfa-Hydroxy-isocaproic acid (HICA is an end product of leucine metabolism in human tissues such as muscle and connective tissue. According to the clinical and experimental studies, HICA can be considered as an anti-catabolic substance. The present study investigated the effects of HICA supplementation on body composition, delayed onset of muscle soreness (DOMS and physical performance of athletes during a training period. Methods Fifteen healthy male soccer players (age 22.1+/-3.9 yr volunteered for the 4-week double-blind study during an intensive training period. The subjects in the group HICA (n = 8 received 583 mg of sodium salt of HICA (corresponding 500 mg of HICA mixed with liquid three times a day for 4 weeks, and those in the group PLACEBO (n = 7 received 650 mg of maltodextrin mixed with liquid three times a day for the same period. According to a weekly training schedule, they practiced soccer 3 - 4 times a week, had strength training 1 - 2 times a week, and had one soccer game during the study. The subjects were required to keep diaries on training, nutrition, and symptoms of DOMS. Body composition was evaluated with a dual-energy X-ray absorptiometry (DXA before and after the 4-week period. Muscle strength and running velocity were measured with field tests. Results As compared to placebo, the HICA supplementation increased significantly body weight (p th week of the treatment (p Conclusion Already a 4-week HICA supplementation of 1.5 g a day leads to small increases in muscle mass during an intensive training period in soccer athletes.

  7. Análise comparativa do controle interno no contas a receber e a pagar nas empresas Beta Ltda e Alfa Ltda = A comparative internal control analysis of receivable and payable accounts in Beta and Alfa Ltd Companies

    Directory of Open Access Journals (Sweden)

    Cleyton de Oliveira Ritta

    2010-07-01

    Full Text Available A necessidade constante de um excelente desempenho empresarial leva à busca da qualidade e confiabilidade da informação para o auxílio na tomada de decisão. Neste contexto, a auditoria contábil tem um papel importante na análise das práticas administrativas adotadas pelas entidades. Desse modo, o objetivo deste artigo é comparar a estruturação dos controles internos no contas a receber e a pagar nas empresas Beta Ltda, a qual não contrata serviços de auditoria externa, e Alfa Ltda, que os contrata. Este estudo caracteriza-se como de caso comparativo de caráter descritivo por meio de questionário e entrevista. Os resultados apontam que a empresa Alfa Ltda tem melhores níveis de controle interno e, consequentemente, está menos exposta a erros e fraudes. Desse modo, entende-se que os seviços de auditoria atuam como um instrumento de auxílio para minimização dos riscos operacionais e servem de alerta aos gestores quanto à eficiência das transações. Contudo, percebe-se que a qualidade dos controles internos nas organizações depende diretamente da utilização de procedimentos de monitoramento.The constant need for excellent business performance triggers the quest for information quality and reliability to help in decision making. Considering this context, accounting auditing plays an important role in the analysis of administrative practices adopted by entities. Thus, the objective of this article is to compare the structure of the internal controls for receivable and payable accounts in Beta Ltd companies, which do not contract external auditing services, and Alfa Ltd, which does. This study is a descriptive comparative case study, carried out through questionnaire and interview. The results have showed that Alfa Ltd has better internal control levels and consequently is less exposed to errors and fraud. This way, auditing services are seen as auxiliary instruments to minimize operational risks and serve to alert

  8. Efficient cell culture system for hepatitis C virus genotype 2B

    DEFF Research Database (Denmark)

    2014-01-01

    The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from...... transfection experiments revealed that 2b/2a was genetically stable. Conclusion: The developed 2b/2a viruses provide a robust in vitro tool for research in HCV genotype 2b, including vaccine studies and functional analysis.......The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from 2...

  9. SH2B1 regulation of energy balance, body weight, and glucose metabolism

    Institute of Scientific and Technical Information of China (English)

    Liangyou; Rui

    2014-01-01

    The Src homology 2B(SH2B)family members(SH2B1,SH2B2 and SH2B3)are adaptor signaling proteins containing characteristic SH2 and PH domains.SH2B1(also called SH2-B and PSM)and SH2B2(also called APS)are able to form homo-or hetero-dimers via their N-terminal dimerization domains.Their C-terminal SH2 domains bind to tyrosyl phosphorylated proteins,including Janus kinase 2(JAK2),TrkA,insulin receptors,insulin-like growth factor-1 receptors,insulin receptor substrate-1(IRS1),and IRS2.SH2B1 enhances leptin signaling by both stimulating JAK2 activity and assembling a JAK2/IRS1/2 signaling complex.SH2B1 promotes insulin signaling by both enhancing insulin receptor catalytic activity and protecting against dephosphorylation of IRS proteins.Accordingly,genetic deletion of SH2B1 results in severe leptin resistance,insulin resistance,hyperphagia,obesity,and type 2 diabetes in mice.Neuronspecific overexpression of SH2B1βtransgenes protects against diet-induced obesity and insulin resistance.SH2B1 in pancreaticβcells promotesβcell expansion and insulin secretion to counteract insulin resistance in obesity.Moreover,numerous SH2B1 mutations are genetically linked to leptin resistance,insulin resistance,obesity,and type 2 diabetes in humans.Unlike SH2B1,SH2B2 and SH2B3 are not required for the maintenance of normal energy and glucose homeostasis.The metabolic function of the SH2B family is conserved from insects to humans.

  10. Los dos discursos del desarrollo humano. Las contradicciones del PNUD

    Directory of Open Access Journals (Sweden)

    Juan Telleria

    2014-10-01

    Full Text Available Un discurso que explícitamente afirma una idea pero implícitamente refuerza la contraria es el instrumento perfecto para desactivar cualquier iniciativa de cambio. El presente artículo muestra que éste es el caso de los Informes del Desarrollo Humano del Programa de Naciones Unidas para el Desarrollo (PNUD. Mediante un sencillo ejercicio hermenéutico se demuestra que existen fuertes contradicciones entre lo que se expresa explícitamente y lo que subyace implícitamente. El individuo supuestamente libre, clave en el concepto de desarrollo humano, deviene un autómata carente de libertad bajo el imperio de la eficiencia y la racionalidad instrumental. El PNUD, asumiendo acríticamente los fundamentos filosóficos y antropológicos que han dado forma al status quo político-cultural actual, cae en los mismos vicios que supuestamente pretende superar.

  11. Europa y Estados Unidos ante los Derechos Humanos en Cuba

    Directory of Open Access Journals (Sweden)

    Susanne Gratius

    2008-01-01

    de la UE no han sido estrategias eficaces para promover los derechos humanos en la isla. Al ser diferentes, las políticas de la UE y EEUU incluso han contribuido a mantener el régimen castrista en el poder: la UE por su reconocimiento diplomático y la cooperación económica; EEUU, al proporcionar una imagen de enemigo externo. Por ello, y ante el nuevo panorama que ofrece el cambio de gobierno en Cuba, la próxima revisión de la Posición Común de la UE y las elecciones presidenciales en EEUU, es necesario replantearse los objetivos y estrategias políticas para incentivar los derechos humanos en Cuba.

  12. Aspectos sociotécnicos das TI & Relacionamento Humano & Sinergia

    Directory of Open Access Journals (Sweden)

    Sergio Vieira Holtz Filho

    2008-06-01

    Full Text Available As Tecnologias de Informação (TI estão entre os principais agentes de mudança sociais. Para gerir tais mudanças, uma miríade de áreas do conhecimento humano têm muito a contribuir para a abordagem dos aspectos sociotécnicos das TI e promover sinergia. Como uma organização empresarial atua no sentido de provocar mudanças no comportamento das pessoas, visando a melhoria contínua, esse processo de mudança provocada chama-se aprendizagem. Isto posto, neste artigo apresentaremos resultados observados em empresas em processo de reengenharia e submetidas a utilização de metodologias integradas (PDCA, Método Paulo Freire e Roteiro Integração de Equipes, abordando os aspectos sociotécnicos das TI & relacionamentos humanos pela praxe da pedagogia como elemento de sinergia.

  13. en la jurisprudencia de la Corte Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Claudio Nash Rojas

    2008-01-01

    Full Text Available Este artículo trata el tema de la relación del derecho a la vida privada y la libertad de expresión en la jurisprudencia de la Corte Interamericana de Derechos Humanos. El objetivo es plantear algunos de los problemas que surgen de la jurisprudencia de la Corte Interamericana de Derechos Humanos al resolver conflictos entre libertad de expresión y honra. En particular, se aborda la forma de solución de conflictos entre derechos expresados como principios, la exigibilidad de un mayor umbral de tolerancia a la crítica por parte de funcionarios públicos y la legitimidad de la acción penal como instrumento para garantizar el derecho a la honra.

  14. Los derechos humanos hoy: perspectivas y retos XXII Conferencias Aranguren

    Directory of Open Access Journals (Sweden)

    Pérez Luño, Antonio-Enrique

    2014-12-01

    Full Text Available The first part, on human rights generations, analyzes the historical evolution of freedoms. Human rights were born within modernity, with marked individualistic imprint as individual freedoms that form the first phase or generation of human rights. This individualistic ideological matrix undergo an extensive process of erosion and challenge in the social struggles of the nineteenth century. These protest movements become apparent the need to complete the catalog of rights and freedoms of the first generation with a second generation of rights: economic, social and cultural rights. The protest human rights strategy is presented today with the novel unequivocally polarized around issues such as the right to peace, the rights of consumers, the right to quality of life, liberty or computer features. Based on it, it opens up, with increasing intensity, the conviction that we are dealing with a third generation of human rights complements earlier stages. The second part is the impact of teledemocracy and cyber citizenship in the human rights sphere. The theme of generations of law extends a reference to the rights of third generation nuclear aspect: The projection of the NT and ICTs in the political process of democratic societies (teledemocracy and as one of the main aspects of this phenomenon, the exercise of human rights of political participation through new technological means (cyber citizenship . We study here the main advantages and risks involved in such technology projections in the exercise of human rights.La primera parte versa sobre las generaciones de derechos humanos y analiza la evolución histórica de las libertades. Los derechos humanos nacieron en el seno de la Modernidad, con marcada impronta individualista, como libertades individuales que configuran la primera fase o generación de los derechos humanos. Dicha matriz ideológica individualista sufrirá un amplio proceso de erosión e impugnación en las luchas sociales del siglo

  15. LA TUTELA SUPRACONSTITUCIONAL DE LOS DERECHOS HUMANOS EN COSTA RICA

    Directory of Open Access Journals (Sweden)

    Gilbert Armijo

    2003-01-01

    Full Text Available El presente artículo analiza la posición de los derechos fundamentales y la recepción de los derechos humanos en el ordenamiento jurídico de Costa Rica, considerando la eficacia de los instrumentos internacionales sobre la materia y la jurisprudencia de la Comisión y la Corte Interamericana de Derechos Humanos. El artículo analiza especialmente la jurisprudencia de la Sala Constitucional de la Corte Suprema de Costa Rica.This article analyzes the place of human rights and their reception in the Costa Rican legal system, considering the effectiveness of international treaties on the subject and the decisions of the Inter-American Commission and Court on Human Rights. The decisions of the Constitutional Chamber of the Costa Rican Supreme Court are also commented.

  16. Remesas y desarrollo humano: el caso de Zacatecas

    Directory of Open Access Journals (Sweden)

    Ramón A. Castillo Ponce

    2008-01-01

    Full Text Available Tradicionalmente, el estudio de las remesas se ha enfocado a evaluar su repercusión económica en la comunidad receptora. El presente estudio adopta una visión alternativa y analiza su efecto en el desarrollo humano de las familias que las reciben. El interés es saber si los fondos que llegan del extranjero son empleados en rubros distintos a los del consumo tradicional; tales como cuidado médico o educación. Con datos de la muestra del XII Censo general de población y vivienda, se construyó un índice de desarrollo humano (IDH, para Zacatecas y se estimó su relación estadística con las remesas. Mediante una metodología de variables instrumentales, se encontró que están positiva y significativamente relacionadas con el IDH.

  17. Factor de necrosis tumoral alfa en pacientes con preeclampsia a término y pretérmino

    Directory of Open Access Journals (Sweden)

    Eduardo Reyna Villasmil

    2012-07-01

    Full Text Available El objetivo de la investigación fue identificar y comparar las concentraciones de factor de necrosis tumoral alfa en pacientes con preeclampsia a término y pre-término. Se seleccionó un total de 50 pacientes. Se incluyeron a 20 pacientes preeclámpticas pre-término (grupo A y 30 preeclámpticas a término (grupo B. Las muestras de sangre para la determinación de factor de necrosis tumoral alfa se recolectaron en todas las pacientes antes del parto e inmediatamente después del diagnóstico de preeclampsia. No se encontraron diferencias significativas con relación a la edad materna e Índice de masa corporal al momento de la toma de la muestra. Se observaron diferencias estadísticamente significativas entre los grupos con respecto a la edad gestacional (p < 0,0001. El valor promedio de la presión arterial sistólica en el grupo A fue de 149,4 ± 11,3 mmHg mientras que en las pacientes del grupo B fue de 148,1 ± 12,3 mmHg (p = 0,7071 y el valor promedio de presión arterial diastólica en el grupo A fue de 103,8 ± 8,6 mmHg y en el grupo B fue de 102,7 ± 7,9 mmHg (p = 0,6436. Las concentraciones de factor de necrosis tumoral alfa fueron similares en el grupo de preeclámpticas pre-término (98,2 ± 45,1 pg/mL comparado con el grupo de preeclámpticas a término (96,6 ± 48,7 pg/mL; p = 0,9072. Al realizar la correlación entre los valores de factor de necrosis tumoral alfa con los valores de presión arterial se observó que no existía correlación con la presión arterial sistólica (r = 0,129; p = 0,374 ni con la de presión arterial diastólica (r = 0,158, p = 0,273. Se concluye que las concentraciones sanguíneas del factor de necrosis tumoral alfa resultaron similares en las pacientes preeclámpticas con embarazo pretérmino y a término. La correlación de las concentraciones de factor de necrosis tumoral alfa con los valores de presión arterial sistólica y diastólica resultó no significativa. Palabras clave:Factor de

  18. Mucoproteína versus alfa-1-glicoproteína ácida: o que quantificar?

    Directory of Open Access Journals (Sweden)

    Picheth Geraldo

    2002-01-01

    Full Text Available A quantificação sérica da alfa-1-glicoproteína (GPA ácida é útil no diagnóstico e no acompanhamento dos processos agudos resultantes de múltiplas causas. Esta proteína também pode ser estimada pela quantificação da mucoproteína (Muco, ensaio que reflete as glicoproteínas com elevado teor de açúcar, entre as quais a GPA é majoritária. O objetivo deste trabalho é verificar a correlação e a performance analítica das determinações de mucoproteína (Muco e alfa-1-glicoproteína ácida (GPA, propondo uma equação de regressão linear. Amostras de soros de 540 pacientes, com idades entre 10 e 79 anos (média de 34,6, predominando mulheres (71,3%, foram analisadas simultaneamente para Muco (Winzler, manual com reagentes próprios e GPA (imunoturbidimetria automatizada, Roche; Cobas mira. A análise de regressão, fixando a Muco como variável dependente, apresentou Muco (mg/dl em tirosina = 0,031 x GPA (mg/dl + 0,8 (r = 0,91; e, fixando o intercepto em zero, Muco = 0,039 x GPA (r = 0,98. A imprecisão interensaio foi de 23,4% e 5,2% (coeficiente de variação, respectivamente, para Muco e GPA. Conclusão: a elevada variabilidade analítica da quantificação da mucoproteína pelo método de Winzler recomenda que este ensaio seja substituído pela dosagem da alfa-1-glicoproteína ácida. Quando necessário, recomendamos estimar a mucoproteína, quantificando a alfa-1-glicoproteína ácida com ensaios de mesmo desempenho que o do utilizado neste trabalho, e usar a equação de regressão AGP (mg/dl x 0,039 = Muco (mg/dl em tirosina.

  19. Tratamento de reposição na deficiência de alfa-1-antitripsina em doentes com enfisema pulmonar

    OpenAIRE

    2013-01-01

    A doença pulmonar obstrutiva crónica é uma das principais causas de incapacidade respiratória e a quarta causa de morte em todo o Mundo, sendo mais frequente no sexo masculino. A exposição ao fumo do tabaco é considerada o principal fator de risco ambiental, no entanto, existem outros fatores igualmente importantes como, por exemplo, a deficiência de alfa-1-antitripsina, a única desordem genética conhecida associada a esta patologia até aos dias de hoje. Esta enzima é maioritariamente produzi...

  20. Secondary bronchiolitis obliterans organizing pneumonia during treatment of chronic hepatitis C: role of pegylated interferon alfa-2a

    Directory of Open Access Journals (Sweden)

    Ronaldo Soares Martins

    2012-10-01

    Full Text Available The treatment of chronic hepatitis C has frequent side effects such as cytopenias and neuropsychiatric symptoms. However, pulmonary toxicity associated with interferon is rarely described. This paper describes the clinical case of a 67-year-old female patient with chronic hepatitis C who presented an acute onset of dry cough, dyspnoea, and fever 36 weeks after the use of pegylated interferon alfa-2a and ribavirin. The lung biopsy confirmed the diagnosis of a bronchiolitis obliterans organizing pneumonia (BOOP. Corticotherapy was initiated, with clinical and radiological improvement. This paper aims to advise physicians to this occasional, though severe, adverse event related to hepatitis C virus (HCV treatment.

  1. Comportamiento de glicinina, beta-conglicinina y alfa-amilasa en semillas de soja deterioradas y no deterioradas

    OpenAIRE

    2002-01-01

    El objetivo del trabajo fue estudiar el comportamiento de glicinina y beta-conglicinina y la actividad de alfa-amilasa en semillas deterioradas y no deterioradas de 10 cultivares de soja [Glycine max (L.) Merr.]. Las semillas se sometieron a dos tratamientos: deterioradas por envejecimiento acelerado y no deterioradas. Se determinó la presencia de las proteínas de reserva a partir de semillas con 0, 3 y 8 días de germinadas por electroforesis en geles de poliacrilamida (SDS-PAGE). La activida...

  2. Natural releases from contaminated groundwater, Example Reference Biosphere 2B

    Energy Technology Data Exchange (ETDEWEB)

    Simon, I. [CIEMAT/PIRA, Avda Complutense 22, 28040 Madrid (Spain)]. E-mail: isc@csn.es; Naito, M. [Nuclear Waste Management Organization of Japan (NUMO), 4-1-23 Shiba, Minato-ku, Tokyo, 108-0014 (Japan); Thorne, M.C. [Mike Thorne and Associates Limited, Abbotsleigh, Kebroyd Mount, Ripponden, Halifax, West Yorkshire HX6 3JA (United Kingdom); Walke, R. [Enviros QuantiSci, Building D5, Culham Science Centre, Culham, Oxfordshire OX14 3DB (United Kingdom)

    2005-07-01

    Safety assessment is a tool which, by means of an iterative procedure, allows the evaluation of the performance of a disposal system and its potential impact on human health and the environment. Radionuclides from a deep geological disposal facility may not reach the surface environment until many tens of thousands of years after closure of the facility. The BIOMASS Programme on BIOsphere Modelling and ASSessment developed Examples of 'Reference Biospheres' to illustrate the use of the methodology and to demonstrate how biosphere models can be developed and justified as being fit for purpose. The practical examples are also intended to be useful in their own right. The Example Reference Biosphere 2B presented here involves the consideration of alternative types of geosphere-biosphere interfaces and calculation of doses to members of hypothetical exposure groups arising from a wide range of exposure pathways within agricultural and semi-natural environments, but without allowing for evolution of the corresponding biosphere system. The example presented can be used as a generic analysis in some situations although it was developed around a relatively specific conceptual model. It should be a useful practical example, but the above numerical results are not intended to be understood as prescribed biosphere 'conversion factors'.

  3. Phonon linewidths in YNi2B2C

    Indian Academy of Sciences (India)

    L Pintschovius; F Weber; W Reichardt; A Kreyssig; R Heid; D Reznik; O Stockert; K Hradil

    2008-10-01

    Phonons in a metal interact with conduction electrons which give rise to a finite linewidth. In the normal state, this leads to a Lorentzian shape of the phonon line. Density functional theory is able to predict the phonon linewidths as a function of wave vector for each branch of the phonon dispersion. An experimental verification of such predictions is feasible only for compounds with very strong electron–phonon coupling. YN2B2C was chosen as a test example because it is a conventional superconductor with a fairly high c (15.2 K). Inelastic neutron scattering experiments did largely confirm the theoretical predictions. Moreover, they revealed a strong temperature dependence of the linewidths of some phonons with particularly strong electron–phonon coupling which can as yet only qualitatively be accounted for by theory. For such phonons, marked changes of the phonon frequencies and linewidths were observed from room temperature down to 15 K. Further changes were observed on entering into the superconducting state. These changes can, however, not be described simply by a change of the phonon linewidth.

  4. Analysis of exoplanet XO-2 b observed with HST NICMOS

    Science.gov (United States)

    Crouzet, Nicolas; McCullough, P. R.; Burke, C.; Long, D.

    2011-09-01

    We present the photometric and spectroscopic analysis of the transiting planet XO-2 b, from HST NICMOS. Three transits of the planet have been observed. The field of view contains not only the XO-2 star but also a second star of very similar properties, which we use as a comparison star. We first perform a white-light photometric analysis of the data. The high signal to noise ratio yields improved parameters for the planet and host star. We then build the spectrum of this system in the range 1.2-1.8 microns with a spectral resolution of R 35, taking into account systematic effects. To investigate the validity of the method and the reliability of NICMOS data, we also build a spectrum for the exoplanet XO-1 b. We find an overall shape close to Tinetti et al. (ApJL 2010), although differences appear for some particular features. In the context of a debate about planetary spectra obtained with NICMOS, this study suggests that NICMOS data, although clearly affected by systematics, contain enough information to derive planetary spectra at least at low resolution.

  5. Lithium decreased NR2B tyrosine phosphorylation and interactions of NR2B and PSD-95 with Src in rat hippocampus following cerebral ischemia

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Objective: To study the effects of chronic lithium on N-methyl-d-aspartate receptor subunit 2B (NR2B) tyrosine phosphorylation and the interactions of NR2B and PSD-95 with Src induced by cerebral ischemia/reperfusion (I/R). Methods: Transient (15 min) cerebral ischemia was induced by four-vessel occlusion procedure in SD rats. Immunoprecipitation (IP) and immunoblotting (IB)were performed to investigate the phosphorylation and interactions of proteins. The effects of lithium on tyrosine phosphorylation of NR2B and its interactions with PSD-95 and Src were examined. Results: Transient cerebral ischemia 15 min followed by reperfusion 6 h (I/R 6h) caused a significant increase in tyrosine phosphorylation of NR2B. Administration of LiCl for 7days before ischemia caused a profound decrease in tyrosine phosphorylation of NR2B. Similiarly, the interactions of NR2B and PSD-95 with Src were also enhanced by I/R 6 h.moreover, these interactions were also inhibited by chronic lithium. Conclusion: Pretreatment with lithium decrease tyrosine phosphorylation of NR2B and interactions of NR2B and PSD-95 with Src during cerebral I/R.

  6. VALUACIÓN BIOÉTICA DEL PROYECTO "GENOMA HUMANO"

    OpenAIRE

    Santos y Vargas,Leonides

    2002-01-01

    Este texto propone una serie de reflexiones que se desprenden de los recientes progresos acaecidos en las investigaciones sobre el Proyecto del Genoma Humano, los cuales conducen al fortalecimiento acelerado de conocimientos y tecnologías biomédicas. Las nuevas afirmaciones sobre la naturaleza biológica de la especie humana, legitimadas por estos nuevos progresos, posibilitan reexaminar explicaciones mitológicas y metafísicas acumuladas desde hace milenios, en el contexto de una nueva antropo...

  7. Los Derechos Humanos y la Responsabilidad Social Empresarial

    Directory of Open Access Journals (Sweden)

    Alberto Carlo D´ Andreis Zapata

    2012-07-01

    Full Text Available ResumenSer responsable socialmente y respetar los Derechos Humanos ya no es un lujo, sino una necesidad, una prioridad para poder competir de una manera leal, legal y sostenible, toda vez que el Pacto Mundial de la Naciones Unidas ha considerado que el respeto o aplicación de los Derechos Humanos debe ser una prioridad para las empresas y no puede seguir tratándose como una acción propia de las acciones de gobiernos, sino que también hace parte de las acciones de las empresas, quienes tienen obligaciones sociales y legales con todos los grupos de interés, por eso en este artículo de investigación hemos decidido resaltar nuevas cuestiones relacionadas con los derechos humanos, así como identificar y promocionar herramientas y recursos de utilidad en el campo de los derechos humanos que como producto de nuestra investigación consideramos que se traducen en buenas prácticas para las empresas.AbstractBeing socially responsible and respect human rights is no longer a luxury but a necessity, a priority in order to compete in a fair, legal and sustainable, since the Global Compact United Nations considered that respect or application of Human rights should be a priority for businesses and can not longer be treat- ed as a custom action in the actions of governments, but also part of the shares of the companies who have social and legal obligations to all stakeholders, so in this article we have chosen to highlight new research issues related to human rights and to identify and promote useful tools and resources in the field of human rights as a result of our research we consider that translate into best practices for companies.

  8. Modelos econometricos de capital humano: Principales enfoques y evidencia empirica

    OpenAIRE

    Neira, Isabel

    2003-01-01

    En este trabajo se realiza una revision a la literatura empirica de crecimiento economico, desde la vertiente del capital humano. Se analiza la consideracion de la educacion en la economia desde el pensamiento clasico hasta las mas actuales teorias de crecimiento endogeno, teniendo en cuenta efectos directos, como el efecto nivel y el efecto tasa, y efectos indirectos como el efecto inversion y otros. Se incluyen estimaciones cross-section y con datos de panel de los paises de la OCDE.

  9. ¿Hubo humanos diminutos en las islas Palaos?

    Directory of Open Access Journals (Sweden)

    Carlos A. Marmelada

    2008-03-01

    Full Text Available El reciente descubrimiento de 25 esqueletos de Homo sapiens en las islas Palaos (Micronesia ha causado revuelo en la comunidad científica por tratarse de humanos diminutos, quizá debido a un efecto de insularidad. Queda pendiente esclarecer cuál podría ser su relación con los Homo floresiensis, homínidos también de reducido tamaño encontrados en la isla de Flores (Indonesia.

  10. El Proyecto Genoma Humano: aspectos éticos

    Directory of Open Access Journals (Sweden)

    Hernández Yago, José

    1999-02-01

    Full Text Available Not available.Todo conocimiento científico es positivo en cuanto que su contenido incrementa el control de la realidad. El desciframiento del genoma humano, con la consiguiente identificación y localización de los 50.000 a 100.000 genes que configuran su patrimonio genético, permitirá el progresivo esclarecimiento de los mecanismos reguladores de la expresión génica y pondrá al alcance del hombre posibilidades espléndidas, que requerirá años desentrañar. El acelerado ritmo en la caracterización de nuevos genes está desencadenando la posibilidad de pronosticar un número cada vez mayor de enfermedades genéticas y, por tanto, puede propiciar la práctica de una Medicina preventiva cada vez más rigurosa. Sin embargo, las posibles aplicaciones del conocimiento científico que aporta este proyecto suscitan también importantes inquietudes, desde el momento en que cada ser humano puede convertirse en un ser sin intimidad biológica. Por otra parte, la tecnología del ADN recombinante, al tiempo que aporta la enorme posibilidad de una futura terapia génica, suscita también legítimas preocupaciones sobre el correcto uso de estos conocimientos. En este artículo se abordan algunas de las cuestiones de carácter ético que ya plantea actualmente el Proyecto del Genoma Humano. Se adopta la perspectiva según la cual el respeto al patrimonio genético debería estar siempre presidido por un principio básico: no perder nunca de vista al hombre, esto es, al ser humano y su derecho a la identidad personal propia.

  11. GluN2B-containing NMDA receptors promote glutamate synapse development in hippocampal interneurons.

    Science.gov (United States)

    Kelsch, Wolfgang; Li, Zhijun; Wieland, Sebastian; Senkov, Oleg; Herb, Anne; Göngrich, Christina; Monyer, Hannah

    2014-11-26

    In postnatal development, GluN2B-containing NMDARs are critical for the functional maturation of glutamatergic synapses. GluN2B-containing NMDARs prevail until the second postnatal week when GluN2A subunits are progressively added, conferring mature properties to NMDARs. In cortical principal neurons, deletion of GluN2B results in an increase in functional AMPAR synapses, suggesting that GluN2B-containing NMDARs set a brake on glutamate synapse maturation. The function of GluN2B in the maturation of glutamatergic inputs to cortical interneurons is not known. To examine the function of GluN2B in interneurons, we generated mutant mice with conditional deletion of GluN2B in interneurons (GluN2B(ΔGAD67)). In GluN2B(ΔGAD67) mice interneurons distributed normally in cortical brain regions. After the second postnatal week, GluN2B(ΔGAD67) mice developed hippocampal seizures and died shortly thereafter. Before the onset of seizures, GluN2B-deficient hippocampal interneurons received fewer glutamatergic synaptic inputs than littermate controls, indicating that GluN2B-containing NMDARs positively regulate the maturation of glutamatergic input synapses in interneurons. These findings suggest that GluN2B-containing NMDARs keep the circuit activity under control by promoting the maturation of excitatory synapses in interneurons.

  12. Co-infection of SENV-D among chronic hepatitis C patients treated with combination therapy with high-dose interferon-alfa and ribavirin

    Institute of Scientific and Technical Information of China (English)

    Chia-Yen Dai; Liang-Yen Wang; Ming-Lung Yu; Wan-Long Chuang; Wen-Yu Chang; Shinn-Cherng Chen; Li-Po Lee; Ming-Yen Hsieh; Nei-Jen Hou; Zu-Yau Lin; Ming-Yuh Hsieh

    2005-01-01

    AIM: The clinical significance of co-infection of SENV-D among patients with chronic hepatitis C (CHC) and response of both viruses to combination therapy with high-dose interferon-alfa (IFN) plus ribavirin remain uncertain and are being investigated.METHODS: Total 164 (97 males and 67 females, the mean age 48.1±11.4 years, range: 20-73 years, 128histologically proved) naive CHC patients were enrolled in this study. SENV-D DNA was tested by PCR method.Detection of serum HCV RNA was performed using a standardized automated qualitative RT-PCR assay (COBAS AMPLICOR HCV Test, version 2.0). HCV genotypes 1a,1b, 2a, 2b, and 3a were determined by using genotypespecific primers. Pretreatment HCV RNA levels were determined by using the branched DNA assay (Quantiplex HCV RNA 3.0). There are 156 patients receiving combination therapy with IFN 6 MU plus ribavirin for 24 wk and the response to therapy is determined.RESULTS: Sixty-one (37.2%) patients were positive for SENV-D DNA and had higher mean age than those who were negative (50.7±10.6 years vs46.6±11.6 years,P = 0.026). The rate of sustained viral response (SVR)for HCV and SENV-D were 67.3% (105/156) and 56.3%(27/48), respectively. By univariate analysis, the higher rate of SVR was significantly related to HCV genotype non-1b (P<0.001), younger ages (P = 0.014), lower pretreatment levels of HCV RNA (P = 0.019) and higher histological activity index (HAI) score for intralobular regeneration and focal necrosis (P = 0.037). By multivariate analyses, HCV genotype non-1b, younger age and lower pretreatment HCV RNA levels were significantly associated with HCV SVR (odds ratio (OR)/95% confidence interval (CI): 12.098/0.02-0.19, 0.936/0.890-0.998, and 3.131/1.080-9.077, respectively). The SVR of SENV-D was higher among patients clearing SENV-D than those who had viremia at the end of therapy (P = 0.04).CONCLUSION: Coexistent SENV-D infection, apparently associated with higher ages, is found in more than onethird Taiwanese

  13. O contrário dos direitos humanos (explicitando Zizek

    Directory of Open Access Journals (Sweden)

    J. A. Lindgren Alves

    2002-06-01

    Full Text Available O presente artigo analisa a situação atual dos direitos humanos, guiado pelas afirmações críticas do autor esloveno Slavoj Zizek, quando defende que a nova normatividade emergente para os direitos humanos acaba por ser a forma em que aparece o seu exato oposto. Abarcando os atentados de 11 de setembro, sem que isso se constitua o foco central do estudo, o artigo avalia a validade dessa afirmação ante as vicissitudes empíricas com que os direitos humanos vêm se defrontando nos últimos anos.The article analyses the current situation of human rights, guided by the critic affirmations of the Slovene author Slavoj Zizek, when he supports that the new emerging normativity of the human rights ends to be the form of appearance of its very opposite. Contemplating the 11th of September, without this constitutes the central focus of the study, the article evaluates the validity of these affirmations the empirical vicissitudes which the human rights have been facing in the last years.

  14. Desenvolvimento humano: contribuições da psicologia moral

    Directory of Open Access Journals (Sweden)

    Yves de La Taille

    2007-03-01

    Full Text Available Procuramos avaliar as contribuições do conhecimento acumulado pela Psicologia Moral para a compreensão do desenvolvimento humano, para sustentar a tese segundo a qual a fonte energética do dever moral precisa ser procurada não só em sentimentos exclusivamente morais, mas também em sentimentos que desempenham um papel para o próprio desenvolvimento humano no seu conjunto. Três são os passos da análise deste artigo. Em primeiro lugar, verifi car se há possibilidade de articulação entre teorias psicológicas que enfatizam a dimensão afetiva da moralidade (Freud e Durkheim e outras que enfatizam a dimensão intelectual (Piaget e Kohlberg. Em segundo lugar, uma vez constatada a impossibilidade dessa articulação, sustentar que o sentimento de vergonha, presente na moralidade mas também em outras dimensões do desenvolvimento humano, é condição necessária ao sentimento de obrigatoriedade. Finalmente, analisar se tal sentimento é passível de ser evocado como fonte energética essencial nas abordagens que enfatizam a dimensão intelectual da moralidade.

  15. Factores humanos y su influencia en la productividad

    Directory of Open Access Journals (Sweden)

    Mirza Cequea

    2011-01-01

    Full Text Available La productividad es un concepto de naturaleza multidimensional en la que influyen ciertas características y comportamientos del individuo, dicha influencia implica procesos psicológicos y psicosociales complejos de cuantificar que constituyen los factores humanos. El objetivo general de la investigación, es analizar los factores humanos y su influencia en la productividad, vista desde la perspectiva de tres unidades diferentes; individuo, grupo y organización. Para tal fin, se plantearon tres modelos diseñados con relaciones causales diferentes, a objeto de determinar el modelo que mejor explica esta influencia. La metodología utilizada fue explicativa de tipo experimental. El método aplicado fue el hipotético deductivo. Se compararon tres modelos utilizando la técnica de modelos rivales de la metodología de Ecuaciones Estructurales. Este criterio permite contrastar modelos a fin de determinar el de mejor ajuste. El resultado determinó que los tres modelos presentan ajustes razonables de aceptación y explican las relaciones causales planteadas y su influencia en la productividad. Del análisis de los ajustes de los tres modelos se concluye que el Modelo B es el que mejor explica la relación de los factores humanos y la productividad

  16. Informe sobre el Proyecto Alfa Biblioteca de Babel: ¿Un atajo para la administración de bibliotecas universitarias? Biblioteca de Babel Alfa Project Report: A shortcut for the academic libraries management?

    Directory of Open Access Journals (Sweden)

    Liliana Laura Rega

    2006-12-01

    Full Text Available El Proyecto Alfa Biblioteca de Babel que reúne bibliotecas universitarias de América Latina y Europa comenzó en marzo de 2005 y prevé su conclusión en marzo de 2007. El presente trabajo intenta describir los objetivos y los resultados esperados, e informa las actividades realizadas por la Red Biblioteca de Babel. Finalmente se analizan las propuestas del proyecto en cuanto al rol de las bibliotecas universitarias, y su relación con la innovación en las prácticas pedagógicas.Biblioteca de Babel Alfa Project that assembles academic libraries from Latin America and Europe was approved on March, 2005 and its conclusion is foreseen on March, 2007. This article attempts to describe the aims and the expected results, and reports the activities of the Biblioteca de Babel Network. Finally it analizes the proposals of the project about the role of academic libraries and their relationship with innovations in pedagogical practices.

  17. Data of evolutionary structure change: 1CLMA-2B1UA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2B1UA 1CLM 2B1U A A LTEEQIAEFKEAFALFD-KDGDGTITTKELGTVMRSLGQ...NPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA FALFD-KDGDG

  18. Data of evolutionary structure change: 1BHNF-2B8PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PB 1BHN 2B8P F B ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------ EVID>EVID> 0 1BHN F 1BHNF FMRAS-ED

  19. Uso de la tierra y diversidades alfa, beta y gamma de diplópodos en la cuenca del río Otún, Colombia

    OpenAIRE

    2010-01-01

    Objetivo: Determinar la relación entre los cambios promovidos por la intervención humana en ecosistemas y grosistemas y la diversidad alfa, beta y gamma de Diplopoda de la cuenca media del río Otún. Materiales y métodos: Se utilizó un diseño sistemático estratificado con la selección de siete ventanas y 16 puntos de muestreo. Se separaron los diplópodos en familias y morfotipos para calcular la diversidad alfa, beta y gamma relacionada con la heterogeneidad de usos del terreno. Resultados: Se...

  20. Associação entre deficiência de alfa-1-antitripsina e a gravidade da fibrose cística

    OpenAIRE

    2005-01-01

    OBJETIVO: Verificar a distribuição dos genótipos da alfa-1-antitripsina e correlacionar com a gravidade da doença pulmonar em pacientes fibrocísticos. MÉTODO: Estudo clínico-laboratorial de corte transversal, com 70 pacientes fibrocísticos do Hospital Universitário da UNICAMP. Os fibrocísticos tiveram diagnóstico confirmado clínica e laboratorialmente. A gravidade da fibrose cística foi avaliada pelo escore de Shwachman. Todos os pacientes foram analisados para os alelos S e Z de alfa-1-antit...

  1. Evidencia de la eficacia de los fármacos anti-TNF Alfa en el tratamiento de la espondilitis anquilosante

    OpenAIRE

    Montilla Salas, Juan Manuel

    2011-01-01

    OBJETIVO Establecer la evidencia de los estudios clínicos sobre la eficacia de las terapias anti-TNF alfa para el tratamiento de la espondilitis anquilosante (EA). MÉTODOS Se realizó una búsqueda con los diferentes fármacos anti-NTF alfa actualmente utilizados en terapia de la espondilitis anquilosante (Infiximab, Etanercept y Adalimumab). La revisión bibliográfica se realizó en Medline, Embase y la librería Cochrane para los estudios controlados y randomizados publicados hasta 1-enero-2005. ...

  2. Metastable Equilibria for the Quaternary System Li2B4O7+ Na2B4O7+K2B4O7+H2Oat15℃

    Institute of Scientific and Technical Information of China (English)

    SANG,Shi-Hua; YIN,Hui-An; NI,Shi-Jun; DENG,Miao

    2008-01-01

    Metastable equilibrium solubilities and such physico-chemical properties as densities, conductivity, pH, refractive index and viscosity of the solution for the quaternary system Li2B4O7+Na2B4O7+K2B4O7+H2O at 15℃ were determined experimentally. According to the experimental data, the metastable equilibrium phase diagram was plotted. In the metastable phase diagram, there are one invariant point, three univariant curves, and three fields of crystallization: Li2B2O4·16H2O, Na2B4O7·10H2O, and K2B4O7·4H2O. Potassium borate (K2B4O7·4H2O) has the smallest crystallization field and sodium borate (borax) has the biggest one. Also, the relationship diagram between the properties and the ion concentration of solution was constructed. It can be seen from the relationship diagram that the metastable equilibrium solution density values, viscosity values and refractive index values are increased apparently with the rise of lithium borate concentration, reaching the maximum values at invariant point F. Electrical conductivity values and pH values, however, fall down with the rise of ion concentration on the whole.

  3. Hanstholm phase 2B. Offshore wave energy test 1994 - 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The wave power converter consists of a float 2.5 meter in diameter, connected by a rope to a seabed-mounted piston pump, installed on 25 meter deep water 2,5 km offshore Hanstholm, Denmark. The converter is designed to absorb an average maximum power of 1 kW. Measured data in real sea conditions are compared to results based on computer simulations and previous tank testing. Losses caused by rope elasticity and hysteresis, friction in the pump and back flow through the valves are assessed. The economic perspectives of a large wave power plant are presented, based on a revised prototype incorporating the results and experience gained during the test period. The wave energy conversion test `Hanstholm phase 2B` has showed, that it it technically possible to exploit the offshore wave energy resource. This source of energy could become attractive for commercial enterprise. The wave power converter demonstrated a reliable performance over a period of nine months. It produced energy under all wave conditions and survived storm waves of 9,6 m. A 300 MW wave power plant in the Danish part of the North sea is estimated to produce electricity at a cost between 2,1 - 2,4 DKK/kWh. The electrical transmission to shore contribute to approximately 20% of the cost. New data predict a potential of 23 kW per meter wave front. The energy plan Energy 21 proposed by the Danish Department of Energy, includes a scenario incorporating wave energy in the energy system year 2030. A strategy for the development of wave energy, has been proposed as part of the project OWEC-1 supported by the European Joule R and D programme. A proposal for future Danish initiatives to develop second generation point absorber systems is outlined. (ARW) 29 refs.

  4. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  5. Diagnóstico molecular da talassemia alfa+ (deleção–a3.7) em indivíduos com microcitose e/ou hipocromia atendidos no Hemocentro Dalton Barbosa Cunha em Natal, Rio Grande do Norte

    OpenAIRE

    Bezerra, Christiane Medeiros

    2009-01-01

    A talassemia alfa, uma das doenças monogênicas mais comuns no mundo, resulta de um desequilíbrio na síntese das cadeias alfa da hemoglobina devido, principalmente, à deleção de um ou ambos os genes da globina alfa, sendo a deleção -α3.7 a mais freqüente. A talassemia alfa, juntamente com a deficiência de ferro e a talassemia beta, representa uma importante causa de microcitose e hipocromia. Com o objetivo de diagnosticar e verificar a prevalência da talassemia alfa (-α3.7) em indivíduos com m...

  6. Derechos de los animales, deberes de los humanos

    Directory of Open Access Journals (Sweden)

    López de la Vieja, María Teresa

    2005-06-01

    Full Text Available Applied Ethics usually refers to human beings, to their practical problems and to their interests. However, the sphere of ethical issues has expanded during the last years. In spite of the fact that the moral point of view is still grounded on anthropocentrism, the environment and living beings are now the aim object of some moral concern. Justice, as a moral principle, could expand itself, as well, in order to include nonhuman beings: their interest and their welfare. Prom a moderate anthropocentric standpoint, this article defends an asymmetrical moral concern. Indeed, we could understand animal' s rights only as a result of human duties towards the own species. This essay claims for direct duties to future generations of humans, and for indirect duties to nonhUman. Therefore, justice between species would enlarge justice between generations.

    La Ética aplicada se suele referir a los problemas prácticos e intereses de los seres humanos. Sin embargo, las cuestiones éticas se han ido ampliando en los últimos años. A pesar de que el punto de vista moral sigue anclado en un enfoque antropocéntrico, el medio ambiente y los seres vivos son ahora objeto de alguna consideración moral. La justicia, como principio moral, puede ampliarse también hasta incluir a los no humanos, sus intereses y su bienestar. Desde un enfoque antropocéntrico moderado, el artículo defiende en este tema una consideración moral asimétrica; pues sólo podemos entender los derechos de los animales como resultado de los deberes de los humanos hacia la propia especie. Son deberes directos hacia las generaciones futuras de humanos, deberes indirectos hacia los no humanos. Por tanto, la justicia entre especies amplía la idea de justicia entre generaciones.

  7. Los Derechos Humanos en América Latina

    Directory of Open Access Journals (Sweden)

    Jovanny Boss Agudelo

    2012-07-01

    Full Text Available ResumenEl objeto central del presente artículo de reflexión se sitúa en la promoción y protección de los Derechos Humanos en América Latina. Para su desarrollo, se parte de una aproximación conceptual a la idea de los Derechos Humanos y luego se da paso a un análisis del estado de éstos (inclusión, conquista y evolución en el territorio en el contexto iberoamericano. La finalidad es responder a la pregunta por la vigencia y legitimidad de los Derechos Humanos en el marco de los grandes conflictos que han determinado a la región a lo largo del siglo XX, con especial énfasis a partir de 1948, año en que se promulga la Declaración Universal de los Derechos Humanos y nace el Derecho Internacional Humanitario como una aspiración civilista de occidente, con proyección a la defensa de la familia humana sin discriminación de nacionalidad u origen cultural. El ensayo finaliza elevando una propuesta para la intervención civil en el respeto y protección de los Derechos Humanos, desde la condición de ciudadanía como paso fundamental a la condición civil de la persona ante el Estado. AbstractThe central object of this paper is placed on the promotion and protection of human rights in Latin America. For its development of a conceptual approach to the idea of human rights and then leads a discussion of the status of these (including, conquest and evolution in the area in the Latin American context. The purpose is to answer the question of the validity and legitimacy of human rights in the context of the major conflicts that have shaped the region over the twentieth century, with special emphasis since 1948, promulgating the Declaration universal human Rights and International Humanitarian Law is born, as a civilian aspiration of the West, with projection to the defense of the human family without distinction of nationality or cultural background. The essay ends with a proposal for bringing civil action in respect and protection

  8. Factor de necrosis tumoral alfa en una población infanto-juvenil con sobrepeso

    Directory of Open Access Journals (Sweden)

    Teresita del R. Carrizo

    2013-08-01

    Full Text Available El sobrepeso infantil está asociado a sobrepeso/obesidad en la edad adulta. El tejido adiposo en obesos produce una cantidad incrementada de citoquinas proinflamatorias como el factor de necrosis tumoral alfa (TNF-a, ejerciendo un efecto deletéreo sobre la función vascular. El objetivo de este trabajo fue evaluar niveles de TNF-a en una población infantojuvenil con sobrepeso y su relación con otras variables. Se estudiaron 30 niños con sobrepeso (12 varones de edades entre 8-13 años, se midió circunferencia de cintura (CC e índice de masa corporal (IMC y fueron comparados con 20 controles de edad y sexo semejantes. Se consideró criterio de inclusión un IMC = 85 < 95 percentilo para edad y sexo. En ambos grupos se determinó: glucemia en ayunas (método glucosa oxidasa, insulina plasmática (ECLIA, fibrinógeno (Fg, método de Clauss, proteína C reactiva ultrasensible (uPCR, método inmunoturbidimétrico, TNF-a (ELISA, perfil lipídico (métodos enzimáticos, eritrosedimentación y se calculó el índice HOMA. Los datos se expresaron como mediana y rango intercuartil y con el coeficiente de Spearman se investigaron las correlaciones entre variables, considerándose significativo un p < 0.05. Los niveles de TNF-a fueron mayores en los sujetos con sobrepeso [15.4 (13.2-24.0 vs. 12.7 (11.2-14.8 pg/ml; p = 0.028]. También resultaron más elevados los valores de Fg, insulina plasmática, índice HOMA, uPCR y triglicéridos. El TNF-a se correlacionó con la CC (r = 0.654; p = 0.021. Los niveles elevados de TNF-a, uPCR y Fg encontrados confirman un estado proinflamatorio asociado a obesidad abdominal en la población estudiada.

  9. Estimadores de consistencia interna en las investigaciones en salud: el uso del coeficiente alfa

    Directory of Open Access Journals (Sweden)

    Franciele Cascaes da Silva

    Full Text Available La producción académica ha aumentado en el área de la salud, exigiendo cada vez más calidad en las publicaciones de gran impacto. Una de las formas de considerar la calidad es por medio de procedimientos que aumentan la consistencia del análisis de los datos, como la confiabilidad, que dependiendo del tipo de datos, puede ser evaluada por diferentes coeficientes, en especial el coeficiente alfa. Basados en lo anterior, la presente revisión reúne sistemáticamente artículos científicos producidos en los últimos cinco años, que de manera metodológica hicieron uso psicométrico del coeficiente α como un estimador de consistencia interna y de confiabilidad en procesos de construcción, adaptación y validación de instrumentos. La identificación de los estudios fue realizada sistemáticamente en las bases de datos Biomed Central Journals, Google Scholar, Web of Science, Wiley Online Library, Medline via Pubmed, Scielo, Scopus, Journals@Ovid, BMJ y Springer por medio del Portal de Periódicos CAPES, utilizando criterios de inclusión y exclusión. El análisis de los datos fue realizado por medio de triangulación, análisis de contenido y análisis descriptivo. Se obtuvo que la mayoría de los estudios fueron realizados principalmente en Irán (f=3, España (f=2 y Brasil (f=2, estos estudios tuvieron como objetivo testar las propiedades psicométricas de instrumentos, siendo que ocho estudios utilizaron el coeficiente α para evaluar la confiabilidad y nueve para evaluar la consistencia interna. Todos los estudios fueron clasificados como investigaciones metodológicas al analizar sus objetivos. Adicionalmente, cuatro estudios también fueron clasificados como correlacionales y uno como descriptivo-correlacional. Se puede concluir que a pesar de que el coeficiente α es ampliamente utilizado como uno de los principales parámetros para la evaluación de consistencia interna de instrumentos de medición del tipo cuestionario en el

  10. Estimadores de consistencia interna en las investigaciones en salud: el uso del coeficiente alfa

    Directory of Open Access Journals (Sweden)

    Franciele Cascaes da Silva

    2015-03-01

    Full Text Available La producción académica ha aumentado en el área de la salud, exigiendo cada vez más calidad en las publicaciones de gran impacto. Una de las formas de considerar la calidad es por medio de procedimientos que aumentan la consistencia del análisis de los datos, como la confiabilidad, que dependiendo del tipo de datos, puede ser evaluada por diferentes coeficientes, en especial el coeficiente alfa. Basados en lo anterior, la presente revisión reúne sistemáticamente artículos científicos producidos en los últimos cinco años, que de manera metodológica hicieron uso psicométrico del coeficiente α como un estimador de consistencia interna y de confiabilidad en procesos de construcción, adaptación y validación de instrumentos. La identificación de los estudios fue realizada sistemáticamente en las bases de datos Biomed Central Journals, Google Scholar, Web of Science, Wiley Online Library, Medline via Pubmed, Scielo, Scopus, Journals@Ovid, BMJ y Springer por medio del Portal de Periódicos CAPES, utilizando criterios de inclusión y exclusión. El análisis de los datos fue realizado por medio de triangulación, análisis de contenido y análisis descriptivo. Se obtuvo que la mayoría de los estudios fueron realizados principalmente en Irán (f=3, España (f=2 y Brasil (f=2, estos estudios tuvieron como objetivo testar las propiedades psicométricas de instrumentos, siendo que ocho estudios utilizaron el coeficiente α para evaluar la confiabilidad y nueve para evaluar la consistencia interna. Todos los estudios fueron clasificados como investigaciones metodológicas al analizar sus objetivos. Adicionalmente, cuatro estudios también fueron clasificados como correlacionales y uno como descriptivo-correlacional. Se puede concluir que a pesar de que el coeficiente α es ampliamente utilizado como uno de los principales parámetros para la evaluación de consistencia interna de instrumentos de medición del tipo cuestionario en el

  11. Arecibo pulsar survey using ALFA. III. Precursor survey and population synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Swiggum, J. K.; Lorimer, D. R.; McLaughlin, M. A.; Bates, S. D.; Senty, T. R. [Department of Physics and Astronomy, West Virginia University, Morgantown, WV 26506 (United States); Champion, D. J.; Lazarus, P. [Max-Planck-Institut für Radioastronomie, D-53121 Bonn (Germany); Ransom, S. M. [NRAO, Charlottesville, VA 22903 (United States); Brazier, A.; Chatterjee, S.; Cordes, J. M. [Astronomy Department, Cornell University, Ithaca, NY 14853 (United States); Hessels, J. W. T. [ASTRON, Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Nice, D. J. [Department of Physics, Lafayette College, Easton, PA 18042 (United States); Ellis, J.; Allen, B. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee WI 53211 (United States); Bhat, N. D. R. [Center for Astrophysics and Supercomputing, Swinburne University, Hawthorn, Victoria 3122 (Australia); Bogdanov, S.; Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Crawford, F. [Department of Physics and Astronomy, Franklin and Marshall College, Lancaster, PA 17604-3003 (United States); Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); and others

    2014-06-01

    The Pulsar Arecibo L-band Feed Array (PALFA) Survey uses the ALFA 7-beam receiver to search both inner and outer Galactic sectors visible from Arecibo (32° ≲ ℓ ≲ 77° and 168° ≲ ℓ ≲ 214°) close to the Galactic plane (|b| ≲ 5°) for pulsars. The PALFA survey is sensitive to sources fainter and more distant than have previously been seen because of Arecibo's unrivaled sensitivity. In this paper we detail a precursor survey of this region with PALFA, which observed a subset of the full region (slightly more restrictive in ℓ and |b| ≲ 1°) and detected 45 pulsars. Detections included 1 known millisecond pulsar and 11 previously unknown, long-period pulsars. In the surveyed part of the sky that overlaps with the Parkes Multibeam Pulsar Survey (36° ≲ ℓ ≲ 50°), PALFA is probing deeper than the Parkes survey, with four discoveries in this region. For both Galactic millisecond and normal pulsar populations, we compare the survey's detections with simulations to model these populations and, in particular, to estimate the number of observable pulsars in the Galaxy. We place 95% confidence intervals of 82,000 to 143,000 on the number of detectable normal pulsars and 9000 to 100,000 on the number of detectable millisecond pulsars in the Galactic disk. These are consistent with previous estimates. Given the most likely population size in each case (107,000 and 15,000 for normal and millisecond pulsars, respectively), we extend survey detection simulations to predict that, when complete, the full PALFA survey should have detected 1000{sub −230}{sup +330} normal pulsars and 30{sub −20}{sup +200} millisecond pulsars. Identical estimation techniques predict that 490{sub −115}{sup +160} normal pulsars and 12{sub −5}{sup +70} millisecond pulsars would be detected by the beginning of 2014; at the time, the PALFA survey had detected 283 normal pulsars and 31 millisecond pulsars, respectively. We attribute the deficiency in normal pulsar

  12. Nº 1. Inicio de la vida de cada ser humano. ¿Qué hace humano el cuerpo del hombre?

    Directory of Open Access Journals (Sweden)

    Natalia López Moratalla

    2011-01-01

    Full Text Available La Biología aporta un conocimiento directo y objetivo acerca del comienzo de la vida de cada concebido de nuestra especie. Desde la fase de zigoto estamos en presencia de un cuerpo humano en los procesos temporales de la transmisión de la vida. Afirma que el mismo individuo humano es el que existe en la vida embrionaria, en la juventud o en la ancianidad. Aunque el cuerpo cambia continuamente, desde el inicio a la muerte a través de las etapas embrionarias, fetales y después del nacimiento, sin embargo mantiene su identidad corporal. Aporta además un conocimiento indirecto del origen de cada ser humano al mostrar que en la única vida de cada uno se entrelazan en un sólo sujeto el dinamismo propio de los procesos biológicos y el dinamismo personal que le libera del encierro del automatismo fisiológico.

  13. TGF- induces Lysyl hydroxylase 2b in human synovial osteoarthritic fibroblasts through ALK5 signaling

    NARCIS (Netherlands)

    Remst, Dennis F. G.; Davidson, Esmeralda N. Blaney; Vitters, Elly L.; Bank, Ruud A.; van den Berg, Wim B.; van der Kraan, Peter M.

    2014-01-01

    Lysyl hydroxylase 2b (LH2b) is known to increase pyridinoline cross-links, making collagen less susceptible to enzymatic degradation. Previously, we observed a relationship between LH2b and osteoarthritis-related fibrosis in murine knee joint. For this study, we investigate if transforming growth fa

  14. File list: His.PSC.50.H2B.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H2B.AllCell mm9 Histone H2B Pluripotent stem cell SRX1034714,SRX1034721,...SRX1034715,SRX1034720 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.H2B.AllCell.bed ...

  15. Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology

    DEFF Research Database (Denmark)

    Clayton, Emma L.; Mizielinska, Sarah; Edgar, James R.;

    2015-01-01

    Mutations in the charged multivesicular body protein 2B (CHMP2B) cause frontotemporal dementia (FTD). We report that mice which express FTD-causative mutant CHMP2B at physiological levels develop a novel lysosomal storage pathology characterised by large neuronal autofluorescent aggregates. The a...

  16. Data of evolutionary structure change: 1BHNF-2B8PA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PA 1BHN 2B8P F A ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKE-----YFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------- EVID>EVID> 0 ... 1BHN F 1BHNF FMRAS-E...5856934 EVID> 1 2B8P

  17. Baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF)

    Science.gov (United States)

    McMurray, John J.V.; Anand, Inder S.; Diaz, Rafael; Maggioni, Aldo P.; O'Connor, Christopher; Pfeffer, Marc A.; Solomon, Scott D.; Tendera, Michal; van Veldhuisen, Dirk J.; Albizem, Moetaz; Cheng, Sunfa; Scarlata, Debra; Swedberg, Karl; Young, James B.; Amuchastegui, M.; Belziti, C.; Bluguermann, J.; Caccavo, M.; Cartasegna, L.; Colque, R.; Cuneo, C.; Fernandez, A.; Gabito, A.; Goicochea, R.; Gonzalez, M.; Gorosito, V.; Grinfeld, L.; Hominal, M.; Kevorkian, R.; Litvak Bruno, M.; Llanos, J.; Mackinnon, I.; Manuale, O.; Marzetti, E.; Nul, D.; Perna, E.; Riccitelli, M.; Sanchez, A.; Santos, D.; Schygiel, P.; Toblli, J.; Vogel, D.; Aggarwal, A.; Amerena, J.; De Looze, F.; Fletcher, P.; Hare, D.; Ireland, M.; Krum, H.; Lattimore, J.; Marwick, T.; Sindone, A.; Thompson, P.; Waites, J.; Altenberger, J.; Ebner, C.; Lenz, K.; Pacher, R.; Poelzl, G.; Charlier, F.; de Ceuninck, M.; De Keulenaer, G.; Dendale, P.; Maréchal, P.; Mullens, W.; Thoeng, J.; Vanderheyden, M.; Vanhaecke, J.; Weytjens, C.; Wollaert, B.; Albuquerque, D.; Almeida, D.; Aspe y Rosas, J.; Bocchi, E.; Bordignon, S.; Clausell, N.; Kaiser, S.; Leaes, P.; Martins Alves, S.; Montera, M.; Moura, L.; Pereira de Castro, R.; Rassi, S.; Reis, A.; Saraiva, J.; Simões, M.; Souza Neto, J.; Teixeira, M.; Benov, H.; Chompalova, B.; Donova, T.; Georgiev, P.; Gotchev, D.; Goudev, A.; Grigorov, M.; Guenova, D.; Hergeldjieva, V.; Ivanov, D.; Kostova, E.; Manolova, A.; Marchev, S.; Nikolov, F.; Popov, A.; Raev, D.; Tzekova, M.; Czarnecki, W.; Giannetti, N.; Haddad, H.; Heath, J.; Huynh, T.; Lepage, S.; Liu, P.; Lonn, E.; Ma, P.; Manyari, D.; Moe, G.; Parker, J.; Pesant, Y.; Rajda, M.; Ricci, J.; Roth, S.; Sestier, F.; Sluzar, V.; Sussex, B.; Vizel, S.; Antezana, G.; Bugueno, C.; Castro, P.; Conejeros, C.; Manriquez, L.; Martinez, D.; Potthoff, S.; Stockins, B.; Vukasovic, J.; Gregor, P.; Herold, M.; Jerabek, O.; Jirmar, R.; Kuchar, R.; Linhart, A.; Podzemska, B.; Soucek, M.; Spac, J.; Spacek, R.; Vodnansky, P.; Bronnum-Schou, J.; Clemmensen, K.; Egstrup, K.; Jensen, G.; Kjoller-Hansen, L.; Kober, L.; Markenvard, J.; Rokkedal, J.; Skagen, K.; Torp-Pedersen, C.; Tuxen, C.; Videbak, L.; Laks, T.; Vahula, V.; Harjola, V.; Kettunen, R.; Kotila, M.; Bauer, F.; Cohen Solal, A.; Coisne, D.; Davy, J.; De Groote, P.; Dos Santos, P.; Funck, F.; Galinier, M.; Gibelin, P.; Isnard, R.; Neuder, Y.; Roul, G.; Sabatier, R.; Trochu, J.; Anker, S.; Denny, S.; Dreykluft, T.; Flesch, M.; Genth-Zotz, S.; Hambrecht, R.; Hein, J.; Jeserich, M.; John, M.; Kreider-Stempfle, H.; Laufs, U.; Muellerleile, K.; Natour, M.; Sandri, M.; Schäufele, T.; von Hodenberg, E.; Weyland, K.; Winkelmann, B.; Tse, H.; Yan, B.; Barsi, B.; Csikasz, J.; Dezsi, C.; Edes, I.; Forster, T.; Karpati, P.; Kerekes, C.; Kis, E.; Kosa, I.; Lupkovics, G.; Nagy, A.; Preda, I.; Ronaszeki, A.; Tomcsanyi, J.; Zamolyi, K.; Agarwal, D.; Bahl, V.; Bordoloi, A.; Chockalingam, K.; Chopda, M.; Chopra, V.; Dugal, J.; Ghaisas, N.; Ghosh, S.; Grant, P.; Hiremath, S.; Iyengar, S.; Jagadeesa Subramania, B.; Jain, P.; Joshi, A.; Khan, A.; Mullasari, A.; Naik, S.; Oomman, A.; Pai, V.; Pareppally Gopal, R.; Parikh, K.; Patel, T.; Prakash, V.; Sastry, B.; Sathe, S.; Sinha, N.; Srikanthan, V.; Subburamakrishnan, P.; Thacker, H.; Wander, G.; Admon, D.; Katz, A.; Klainman, E.; Lewis, B.; Marmor, A.; Moriel, M.; Mosseri, M.; Shotan, A.; Weinstein, J.; Zimlichman, R.; Agostoni, P.; Albanese, M.; Alunni, G.; Bini, R.; Boccanelli, A.; Bolognese, L.; Campana, C.; Carbonieri, E.; Carpino, C.; Checco, L.; Cosmi, F.; D'Angelo, G.; De Cristofaro, M.; Floresta, A.; Fucili, A.; Galvani, M.; Ivleva, A.; Marra, S.; Musca, G.; Peccerillo, N.; Perrone Filardi, P.; Picchio, E.; Russo, T.; Scelsi, L.; Senni, M.; Tavazzi, L.; Erglis, A.; Jasinkevica, I.; Kakurina, N.; Veze, I.; Volans, E.; Bagdonas, A.; Berukstis, E.; Celutkiene, J.; Dambrauskaite, A.; Jarasuniene, D.; Luksiene, D.; Rudys, A.; Sakalyte, G.; Sliaziene, S.; Aguilar-Romero, R.; Cardona-Muñoz, E.; Castro-Jimenez, J.; Chavez-Herrera, J.; Chuquiure Valenzuela, E.; De la Pena, G.; Herrera, E.; Leiva-Pons, J.; Lopez Alvarado, A.; Mendez Machado, G.; Ramos-Lopez, G.; Basart, D.; Buijs, E.; Cornel, J.; de Leeuw, M.; Dijkgraaf, R.; Dunselman, P.; Freericks, M.; Hamraoui, K.; Lenderlink, T.; Linssen, G.; Lodewick, P.; Lodewijks, C.; Lok, D.; Nierop, P.; Ronner, E.; Somsen, A.; van Dantzig, J.; van der Burgh, P.; van Kempen, L.; van Vlies, B.; Voors, A.; Wardeh, A.; Willems, F.; Dickstein, K.; Gundersen, T.; Hole, T.; Thalamus, J.; Westheim, A.; Dabrowski, M.; Gorski, J.; Korewicki, J.; Kuc, K.; Miekus, P.; Musial, W.; Niegowska, J.; Piotrowski, W.; Podolec, P.; Polonski, L.; Ponikowski, P.; Rynkiewicz, A.; Szelemej, R.; Trusz-Gluza, M.; Ujda, M.; Wojciechowski, D; Wysokinski, A.; Camacho, A.; Fonseca, C.; Monteiro, P.; Apetrei, E.; Bruckner, I.; Carasca, E.; Coman, I.; Datcu, M.; Dragulescu, S.; Ionescu, P.; Iordachescu-Petica, D.; Manitiu, I.; Popa, V.; Pop-Moldovan, A.; Radoi, M.; Stamate, S.; Tomescu, M.; Vita, I.; Aroutiounov, G.; Ballyuzek, M.; Bart, B.; Churina, S.; Glezer, M.; Goloshchekin, B.; Ivleva, A.; Kobalava, Z.; Kostenko, V.; Lopatin, Y.; Martynov, A.; Orlov, V.; Semernin, E.; Shogenov, Z.; Sidorenko, B.; Skvortsov, A.; Storzhakov, G.; Sulimov, V.; Talibov, O.; Tereshenko, S.; Tsyrline, V.; Zadionchenko, V.; Zateyshchikov, D.; Dzupina, A.; Hranai, M.; Kmec, J.; Micko, K.; Murin, J.; Pella, D.; Sojka, G.; Spisak, V.; Vahala, P.; Vinanska, D.; Badat, A.; Bayat, J.; Dawood, S.; Delport, E.; Ellis, G.; Garda, R.; Klug, E.; Mabin, T.; Naidoo, D.; Pretorius, M.; Ranjith, N.; Van Zyl, L.; Weich, H.; Anguita, M.; Berrazueta, J.; Bruguera i Cortada, J.; de Teresa, E.; Gómez Sánchez, M.; González Juanatey, J.; Gonzalez-Maqueda, I.; Jordana, R.; Lupon, J.; Manzano, L.; Pascual Figal, D.; Pulpón, L.; Recio, J.; Ridocci Soriano, F.; Rodríguez Lambert, J.; Roig Minguell, E.; Roig Minguell, E.; Romero, J.; Valdovinos, P.; Klintberg, L.; Kronvall, T.; Lycksell, M.; Morner, S.; Rydberg, E.; Swedberg, K.; Timberg, I.; Wikstrom, G.; Moccetti, T.4; Ashok, J.; Banerjee, P.; Carr-White, G.; Cleland, J.; Connolly, E.; Francis, M.; Greenbaum, R.; Kadr, H.; Lindsay, S.; McMurray, J.; Megarry, S.; Memon, A.; Murdoch, D.; Senior, R.; Squire, I.; Tan, L.; Witte, K.; Adams, K.; Adamson, P.; Adler, A.; Altschul, L.; Altschuller, A.; Amirani, H.; Anand, I.; Andreou, C.; Ansari, M.; Antonishen, M.; Banchs, H.; Banerjee, S.; Banish, D.; Bank, A.; Barbagelata, A.; Barnard, D.; Bellinger, R.; Benn, A.; Berk, M.; Berry, B.; Bethala, V.; Bilazarian, S.; Bisognano, J.; Bleyer, F.; Blum, M.; Boehmer, J.; Bouchard, A.; Boyle, A.; Bozkurt, B.; Brown, C.; Burlew, B.; Burnham, K.; Butler, J.; Call, J.; Cambier, P.; Cappola, T.; Carlson, R.; Chandler, B.; Chandra, R.; Chandraratna, P.; Chernick, R.; Colan, D.; Colfer, H.; Colucci, W.; Connelly, T.; Costantini, O.; Dadkhah, S.; Dauber, I.; Davis, J.; Davis, S.; Denning, S.; Drazner, M.; Dunlap, S.; Egbujiobi, L.; Elkayam, U.; Elliott, J.; El-Shahawy, M.; Essandoh, L.; Ewald, G.; Fang, J.; Farhoud, H.; Felker, G.; Fernandez, J.; Festin, R.; Fishbein, G.; Florea, V.; Flores, E.; Floro, J.; Gabris, M.; Garg, M.; Gatewood, R.; Geller, M.; Ghali, J.; Ghumman, W.; Gibbs, G.; Gillespie, E.; Gilmore, R.; Gogia, H.; Goldberg, L.; Gradus-Pizlo, I.; Grainger, T.; Gudmundsson, G.; Gunawardena, D.; Gupta, D.; Hack, T.; Hall, S.; Hamroff, G.; Hankins, S.; Hanna, M.; Hargrove, J.; Haught, W.; Hauptman, P.; Hazelrigg, M.; Herzog, C.; Heywood, J.; Hill, T.; Hilton, T.; Hirsch, H.; Hunter, J.; Ibrahim, H.; Imburgia, M.; Iteld, B.; Jackson, B.; Jaffrani, N.; Jain, D.; Jain, A.; James, M.; Jimenez, J.; Johnson, E.; Kale, P.; Kaneshige, A.; Kapadia, S.; Karia, D.; Karlsberg, R.; Katholi, R.; Kerut, E.; Khoury, W.; Kipperman, R.; Klapholz, M.; Kosinski, E.; Kozinn, M.; Kraus, D.; Krueger, S.; Krum, H.; Kumar, S.; Lader, E.; Lee, C.; Levy, W.; Lewis, E.; Light-McGroary, K.; Loh, I.; Lombardi, W.; Machado, C.; Maislos, F.; Mancini, D.; Markus, T.; Mather, P.; McCants, K.; McGrew, F.; McLaurin, B.; McMillan, E.; McNamara, D.; Meyer, T.; Meymandi, S.; Miller, A.; Minami, E.; Modi, M.; Mody, F.; Mohanty, P.; Moscoso, R.; Moskowitz, R.; Moustafa, M.; Mullen, M.; Naz, T.; Noonan, T.; O'Brien, T.; Oellerich, W.; Oren, R.; Pamboukian, S.; Pereira, N.; Pitt, W.; Porter, C.; Prabhu, S.; Promisloff, S.; Ratkovec, R.; Richardson, R.; Ross, A.; Saleh, N.; Saltzberg, M.; Sarkar, S.; Schmedtje, J.; Schneider, R.; Schuyler, G.; Shanes, J.; Sharma, A.; Siegel, C.; Siegel, R.; Silber, D.; Singh, V.; Singh, N.; Singh, J.; Sklar, J.; Small, R.; Smith, A.; Smith, E.; Smith, E.; Smull, D.; Sotolongo, R.; Staniloae, C.; Stapleton, D.; Steele, P.; Stehlik, J.; Stein, M.; Tang, W.; Thadani, U.; Torre-Amoine, G.; Trichon, B.; Tsai, C.; Tummala, R.; Van Bakel, A.; Vicari, R.; Vijay, N.; Vijayaraghavan, K.; Vittorio, T.; Vossler, M.; Wagoner, L.; Wallis, D.; Ward, N.; Widmer, M.; Wight, J.; Wilkins, C.; Williams, C.; Williams, G.; Winchester, M.; Winkel, E.; Wittmer, B.; Wood, D.; Wormer, D.; Wright, R.; Xu, Z.; Yasin, M.; Zolty, R.

    2013-01-01

    Aims This report describes the baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) which is testing the hypothesis that anaemia correction with darbepoetin alfa will reduce the composite endpoint of death from any cause or hospital admission for worsening heart failure, and improve other outcomes. Methods and results Key demographic, clinical, and laboratory findings, along with baseline treatment, are reported and compared with those of patients in other recent clinical trials in heart failure. Compared with other recent trials, RED-HF enrolled more elderly [mean age 70 (SD 11.4) years], female (41%), and black (9%) patients. RED-HF patients more often had diabetes (46%) and renal impairment (72% had an estimated glomerular filtration rate <60 mL/min/1.73 m2). Patients in RED-HF had heart failure of longer duration [5.3 (5.4) years], worse NYHA class (35% II, 63% III, and 2% IV), and more signs of congestion. Mean EF was 30% (6.8%). RED-HF patients were well treated at randomization, and pharmacological therapy at baseline was broadly similar to that of other recent trials, taking account of study-specific inclusion/exclusion criteria. Median (interquartile range) haemoglobin at baseline was 112 (106–117) g/L. Conclusion The anaemic patients enrolled in RED-HF were older, moderately to markedly symptomatic, and had extensive co-morbidity. PMID:23329651

  18. Alfa247®: Un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking

    Directory of Open Access Journals (Sweden)

    Rodolfo Iván Martínez Lemos

    2010-03-01

    Full Text Available La técnica alfa y el método de los 7 pasos constituyen un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking (NW. NW consiste en caminar con bastones especialmente diseñados y utilizando una técnica precisa que moviliza una gran parte de la masa muscular total y tiene efectos beneficiosos probados sobre la salud. Alfa247® hace posible que cualquier persona, con independencia de su nivel de habilidad o condición física, pueda familiarizarse y aprender la técnica de caminar con bastones. Este nuevo concepto de movimiento saludable está todavía dando sus primeros pasos en España y es probable que en un futuro próximo pueda jugar un papel importante dentro del currículo de la Educación Física Escolar, como ya ha hecho en otros países del entorno.

  19. Vortex phase diagram studies in the weakly pinned single crystals of YNi2B2C and LuNi2B2C

    Indian Academy of Sciences (India)

    D Jaiswal-Nagar; D Pal; M R Eskildsen; P C Canfield; H Takeya; S Ramakrishnan; A K Grover

    2006-01-01

    We present a study of magnetization measurements performed on the single crystals of YNi2B2C and LuNi2B2C. For both the compounds, we find flux jumps in magnetisation values in the respective field regions, where the structural transitions in the flux line lattice symmetry have been reported in these systems via the small angle neutron scattering experiments. The magnetisation hysteresis loops and the AC susceptibility measurements show pronounced peak effect as well as second magnetisation peak anomaly for both YNi2B2C and LuNi2B2C. Based on these results, a vortex phase diagram has been constructed for YNi2B2C for $H \\Arrowvert c$ depicting different glassy phases of the vortex matter.

  20. ab initio calculation study on vibrational spectra of C2B10H12,NB11H12 and C2B10H11Cl

    Institute of Scientific and Technical Information of China (English)

    于微舟; 张明瑜; 孙家钟

    1996-01-01

    Geometrical optimization and theoretical calculation of the vibrational frequencies have been performed for C2B10H12, NB11H12 and C2B10Cl by using Gaussian 92 program at 6-31G basis set. The results obtained in this work are in agreement with experimental ones. The optimized geometry and vibrational spectra show that the icosahedral configuration remains unchanged upon converting from B12H122- to the title compounds. The vibrational spectrum of C2B10H11Cl features the absence of C-Cl stretching vibration. But the (C2B10H11)-Cl vibration mode in the low frequency region is as the case for two-atom molecules if the group (C2B10H11) is considered as a pseudoatom

  1. Functional role of human NK cell receptor 2B4 (CD244) isoforms.

    Science.gov (United States)

    Mathew, Stephen O; Rao, Krithi K; Kim, Jong R; Bambard, Nowland D; Mathew, Porunelloor A

    2009-06-01

    2B4 (CD244), a member of the signaling lymphocyte-activation molecule (SLAM/CD150), is expressed on all NK cells, a subpopulation of T cells, monocytes and basophils. Human NK cells express two isoforms of 2B4, h2B4-A and h2B4-B that differ in a small portion of the extracellular domain. In the present investigation, we have studied the functions of h2B4-A and h2B4-B. Our study demonstrated that these two isoforms differ in their binding affinity for CD48, which results in differential cytotoxic activity as well as intracellular calcium release by NK cells upon target cell recognition. Analysis of the predicted 3-D structure of the two isoforms showed conformational differences that could account for their differences in binding affinity to CD48. h2B4-A was able to mediate natural cytotoxicity against CD48-expressing K562 target cells and induce intracellular calcium release, whereas h2B4-B showed no effects. NK-92MI, U937, THP-1, KU812, primary monocytes, basophils and NK cells showed expression of both h2B4-A and h2B4-B whereas YT and IL-2-activated NK cells did not show any h2B4-B expression. Stimulation of NK cells through 2B4 resulted in decreased mRNA levels of both h2B4-A and h2B4-B indicating that down-regulation of 2B4 isoforms may be an important factor in controlling NK cell activation during immune responses.

  2. Los perfiles de exigencias en la ocupación del profesional de recursos humanos

    OpenAIRE

    2003-01-01

    En este trabajo se presentan los resultados de un estudio exploratorio que se llevó a cabo en la Universidad Complutense de Madrid para definir el perfil de exigencias ocupacionales del profesional de recursos humanos. En este estudio se considera como profesional de recursos humanos al licenciado, ingeniero o doctor que desarrolla su actividad en el área de recursos humanos sin ocupar puestos directivos dentro de la estructura de la organización. Los resultados de este estu...

  3. La aplicación por los tribunales chilenos del derecho internacional de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Fernández González

    2010-01-01

    Full Text Available La aplicación del Derecho Internacional de los derechos humanos por los tribunales chilenos ha ido evolucionando. La jurisprudencia nacional ha ido experimentando un cambio en cuanto a la aplicación de los tratados internacionales de derechos humanos. En este trabajo se examinan casos tanto ante la justicia ordinaria como ante la justicia constitucional, donde se intenta demostrar el alcance cada vez mayor que posee el Derecho Internacional de los derechos humanos.

  4. Role of adenosine A2b receptor overexpression in tumor progression.

    Science.gov (United States)

    Sepúlveda, Cesar; Palomo, Iván; Fuentes, Eduardo

    2016-12-01

    The adenosine A2b receptor is a G-protein coupled receptor. Its activation occurs with high extracellular adenosine concentration, for example in inflammation or hypoxia. These conditions are generated in the tumor environment. Studies show that A2b receptor is overexpressed in various tumor lines and biopsies from patients with different cancers. This suggests that A2b receptor can be used by tumor cells to promote progression. Thus A2b participates in different events, such as angiogenesis and metastasis, besides exerting immunomodulatory effects that protect tumor cells. Therefore, adenosine A2b receptor appears as an interesting therapeutic target for cancer treatment.

  5. Ações afirmativas da perspectiva dos direitos humanos Affirmative action from a human rights perspective

    OpenAIRE

    2005-01-01

    Objetiva o artigo desenvolver uma análise a respeito das ações afirmativas sob a perspectiva dos direitos humanos. Inicialmente, trata da concepção contemporânea de direitos humanos, introduzida pela Declaração Universal de 1948, com ênfase na universalidade, indivisibilidade e interdependência dos direitos humanos. Em um segundo momento são apreciadas as ações afirmativas da perspectiva dos direitos humanos, com destaque dos valores da igualdade e diversidade. Por fim, são avaliadas as persp...

  6. Turismo Alternativo y Educación. Una propuesta para contribuir al desarrollo humano.

    OpenAIRE

    César David Torres Fernández; Pablo Zaldívar Martínez; Fabián Enríquez García

    2013-01-01

    Este trabajo realiza una propuesta para contribuir al desarrollo humano, la problemática a tratar es la falta del mismo en este planeta. Por desarrollo humano se entiende la evolución integral del ser humano desde el punto de vista socioeconómico, político, cultural y espiritual (en armonía consigo mismo, con la naturaleza y con los demás seres humanos). En nuestro país existe pobreza, desempleo, corrupción, desigualdad, una pésima educación y cultura, así como problemas de alimentación que l...

  7. DERECHOS HUMANOS, LIBERTAD Y FACTICIDAD: UNA LECTURA ALTERNATIVA DESDE EL PENSAMIENTO SARTRIANO

    OpenAIRE

    Arrieta Burgos, Enán

    2016-01-01

    El discurso de los derechos humanos ha servido para legitimar prácticas de dominación y resistencia. Críticos y defensores de los derechos humanos coinciden en la necesidad de problematizar su fundamento teórico. Pues bien, a partir del pensamiento de Jean-Paul Sartre, este artículo pretende sentar las bases de una nueva concepción de los derechos humanos. Con esta finalidad, se despejan algunos malos entendidos relacionados con la visión sartriana de los derechos humanos, se realiza una lect...

  8. Copy Number Variation of UGT 2B Genes in Indian Families Using Whole Genome Scans

    Directory of Open Access Journals (Sweden)

    Avinash M. Veerappa

    2016-01-01

    Full Text Available Background and Objectives. Uridine diphospho-glucuronosyltransferase 2B (UGT2B is a family of genes involved in metabolizing steroid hormones and several other xenobiotics. These UGT2B genes are highly polymorphic in nature and have distinct polymorphisms associated with specific regions around the globe. Copy number variations (CNVs status of UGT2B17 in Indian population is not known and their disease associations have been inconclusive. It was therefore of interest to investigate the CNV profile of UGT2B genes. Methods. We investigated the presence of CNVs in UGT2B genes in 31 members from eight Indian families using Affymetrix Genome-Wide Human SNP Array 6.0 chip. Results. Our data revealed >50% of the study members carried CNVs in UGT2B genes, of which 76% showed deletion polymorphism. CNVs were observed more in UGT2B17 (76.4% than in UGT2B15 (17.6%. Molecular network and pathway analysis found enrichment related to steroid metabolic process, carboxylesterase activity, and sequence specific DNA binding. Interpretation and Conclusion. We report the presence of UGT2B gene deletion and duplication polymorphisms in Indian families. Network analysis indicates the substitutive role of other possible genes in the UGT activity. The CNVs of UGT2B genes are very common in individuals indicating that the effect is neutral in causing any suspected diseases.

  9. Impaired ventilatory and thermoregulatory responses to hypoxic stress in newborn Phox2b heterozygous knockout mice

    Directory of Open Access Journals (Sweden)

    Nelina eRamanantsoa

    2011-09-01

    Full Text Available The Phox2b gene is necessary for the development of the autonomic nervous system, and especially, of respiratory neuronal circuits. In the present study, we examined the role of Phox2b in ventilatory and thermoregulatory responses to hypoxic stress, which are closely related in the postnatal period. Hypoxic stress was generated by strong thermal stimulus, combined or not with reduced inspired O2. To this end, we exposed 6-day-old Phox2b+/- pups and their wild-type littermates (Phox2b+/+ to hypoxia (10% O2 or hypercapnia (8% CO2 under thermoneutral (33°C or cold (26°C conditions. We found that Phox2b+/- pups showed less normoxic ventilation (VE in the cold than Phox2b+/+ pups. Phox2b+/- pups also showed lower oxygen consumption (VO2 in the cold, reflecting reduced thermogenesis and a lower body temperature. Furthermore, while the cold depressed ventilatory responses to hypoxia and hypercapnia in both genotype groups, this effect was less pronounced in Phox2b+/- pups. Finally, because serotonin (5-HT neurons are pivotal to respiratory and thermoregulatory circuits and depend on Phox2b for their differentiation, we studied 5-HT metabolism using high-pressure liquid chromatography, and found that it was altered in Phox2b+/- pups. We conclude that Phox2b haploinsufficiency alters the ability of newborns to cope with metabolic challenges, possibly due to 5-HT signaling impairments.

  10. Una mirada al Sistema Interamericano de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Ariel E. DULITZKY

    2009-11-01

    Full Text Available RESUMEN: El artículo analiza el debate actual que se da en el ámbito del sistema interamericano de derechos humanos. En primer lugar examina la evolución de la situación en América Latina en los últimos 20 años, mostrando como el paso de dictaduras a gobiernos elegidos democráticamente no necesariamente se reflejó en una mejoría en los derechos humanos. Luego de describir el funcionamiento de la Comisión y la Corte Interamericanas de Derechos Humanos, analiza dos tendencias presentes en el actual debate sobre el futuro del sistema interamericano. Una posición calificada como "promoción-reforma" entiende que el sistema debería orientarse hacia actividades exclusivamente de promoción de los derechos humanos antes que tareas de protección. Para ello proponen reformar la Convención Americana sobre Derechos Humanos. La segunda posición , la denomina "protección-perfeccionamiento" ya que sostiene que la realidad actual de América Latina, requiere que la Comisión y la Corte se dediquen fundamentalmente a la protección de los derechos humanos. Finalmente el artículo presenta cinco objetivos que deberían orientar el trabajo del sistema y muestra cómo las dos posiciones anteriormente mencionadas difieren en cuanto a estos objetivos o a la manera de alcanzarlos.ABSTRACT: The article analizes the current debate within the inter-American System of human rights. The article begins by describing the evolution of the human rights situation in Latin-America over the last 20 years, from military dictatorships to elected goverments. The article points out that these changes do not necessarily imply an improvement in the enjoyment of human rights. After describing the functioining of the Inter-American Commission and Court, the article .describes two different lines of thought in the present debate regarding the future of the Inter-American System. The first position "promotion-reform" suggests that the inter-American system should deal

  11. Functional characterization of cytochromes P450 2B from the desert woodrat Neotoma lepida

    Energy Technology Data Exchange (ETDEWEB)

    Wilderman, P. Ross, E-mail: pwilderman@ucsd.edu [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Jang, Hyun-Hee [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Malenke, Jael R. [Department of Biology, University of Utah, Salt Lake City, UT (United States); Salib, Mariam; Angermeier, Elisabeth; Lamime, Sonia [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Dearing, M. Denise [Department of Biology, University of Utah, Salt Lake City, UT (United States); Halpert, James R. [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States)

    2014-02-01

    Mammalian detoxification processes have been the focus of intense research, but little is known about how wild herbivores process plant secondary compounds, many of which have medicinal value or are drugs. cDNA sequences that code for three enzymes of the cytochrome P450 (CYP) 2B subfamily, here termed 2B35, 2B36, and 2B37 have been recently identified from a wild rodent, the desert woodrat (Malenke et al., 2012). Two variant clones of each enzyme were engineered to increase protein solubility and to facilitate purification, as reported for CYP2B enzymes from multiple species. When expressed in Escherichia coli each of the woodrat proteins gave the characteristic maximum at 450 nm in a reduced carbon monoxide difference spectrum but generally expressed at lower levels than rat CYP2B1. Two enzymes, 2B36 and 2B37, showed dealkylation activity with the model substrates 7-ethoxy-4-(trifluoromethyl)coumarin and 7-benzyloxyresorufin, whereas 2B35 was inactive. Binding of the monoterpene (+)-α-pinene produced a Type I shift in the absorbance spectrum of each enzyme. Mutation of 2B37 at residues 114, 262, or 480, key residues governing ligand interactions with other CYP2B enzymes, did not significantly change expression levels or produce the expected functional changes. In summary, two catalytic and one ligand-binding assay are sufficient to distinguish among CYP2B35, 2B36, and 2B37. Differences in functional profiles between 2B36 and 2B37 are partially explained by changes in substrate recognition site residue 114, but not 480. The results advance our understanding of the mechanisms of detoxification in wild mammalian herbivores and highlight the complexity of this system. - Highlights: • Three CYP2B enzymes from Neotoma lepida were cloned, engineered, and expressed. • A mix of catalytic and binding assays yields unique results for each enzyme. • Mutational analysis indicates CYP{sub 2}B substrate recognition remains to be clarified. • Reported N. lepida gene

  12. The brain-specific neural zinc finger transcription factor 2b (NZF-2b/7ZFMyt1 suppresses cocaine self-administration in rats

    Directory of Open Access Journals (Sweden)

    Vijay Chandrasekar

    2010-04-01

    Full Text Available Brain-specific neural-zinc-finger transcription factor-2b (NZF2b/7ZFMyt1 is induced in the mesolimbic dopaminergic region after chronic cocaine exposure and lentiviral-mediated expression of NZF2b/7ZFMyt1 in the nucleus accumbens results in decreased locomotor activity (Chandrasekar and Dreyer, 2009. In this study the role of NZF2b/7ZFMyt1 in active cocaine seeking and of its interaction with histone deacetylase on the altered behavior has been observed. Localized expression of NZF2b/7ZFMyt1 in the nucleus accumbens resulted in attenuated cocaine self-administration, whereas silencing this transcription factor with lentiviruses expressing siRNAs increased the animal′s motivation to self-infuse cocaine. Low doses of sodium butyrate, a potent inhibitor of histone deacetylase, were sufficient to reverse the NZF2b/7ZFMyt1-mediated decrease in cocaine self-administration. NZF2b/7ZFMyt1 expression resulted in strong induction of transcription factors REST1 and NAC1 and of the dopamine D2 receptor, with concomitant inhibition of BDNF and its receptor TrkB. We show that NZF2b/7ZFMyt1 colocalizes with histone deacetylase-2 (HDAC2, probably overcoming the suppression of transcriptional activity caused by Lingo1. These findings show that molecular adaptations mediated by NZF2b/7ZFMyt1 expression possibly lead to decreased responsiveness to the reinforcing properties of cocaine and play a prominent role in affecting the behavioral changes induced by the drug.

  13. derechos humanos y el derecho interno en Argentina

    Directory of Open Access Journals (Sweden)

    Víctor Bazán

    2007-01-01

    Full Text Available Desde un plano general de análisis, el autor advierte que los puntos de contacto (en no pocas ocasiones tensionales entre el derecho internacional de los derechos humanos y el derecho interno se multiplican, patentizándose la necesidad de lograr una pacífica articulación de tales fuentes mediante su retroalimentación y complementariedad para procurar la solidificación del sistema general de derechos, lo que es tan sencillo de predicar discursivamente como arduo de concretar en la realidad fáctica. Bajo esa óptica, y ya en particular acerca del escenario jurídico argentino (aunque con varias referencias al derecho comparado, analiza la evolución jurisprudencial y normativa de distintos aspectos que la interacción del derecho internacional de los derechos humanos y el derecho doméstico generan: la ubicación jerárquica de los instrumentos internacionales sobre la materia en el contexto nacional, la cotización jurídica interna que la Corte Suprema de Justicia asigna a los pronunciamientos de la Comisión y la Corte Interamericanas de Derechos Humanos, y la siempre sensible problemática de la ejecución en sede doméstica de las sentencias de dicho tribunal interamericano; temas, todos, que forman parte de los retos más trascendentes a los que se enfrenta cualquier propósito verdadero de consolidación del Estado Constitucional de Derecho sustentado axiológicamente en el respeto cabal de la democracia y los derechos fundamentales.

  14. Estudio de Recursos Humanos del Sector Salud en Colombia.

    Directory of Open Access Journals (Sweden)

    Gustavo Malagón Londoño

    1997-12-01

    Full Text Available

    Antecedentes


    Siendo el recurso humano el en cargado de movilizar los demás recursos e impulsarlos de tal manera que conlleve a una dinámica de producción masiva de bienes o servicios, su estudio para llegar a una identificación real, categorización, clasificación; es necesario en cualquier área del conocimiento.

    Frente al nuevo esquema de prestación de servicios propuestos, los profesionales de la salud han perdido aquella posición digna, de respeto y liderazgo dentro del sistema y dentro de su entorno social, lo cual ha llevado a muchos de ellos a desertar de sus oficios originales, con lo cual se llega a la falla en la instauración del Sistema.

    Así mismo la Ley 100 de 1993 que debió ser vista como una nueva oportunidad de negocios dentro de las diferentes profesiones de la salud, se transformó en una seria amenaza para el ejercicio independiente de cada profesión.

    No es apropiado ni satisfactorio dejar un proceso decisorio de tal magnitud en manos de otros sectores que únicamente verán y obtendrán estadísticas del acceso de la población colombiana a estudios superiores y los renglones en los cuales quieren desempeñarse y se desempeñarán en un futuro. El sector de la salud debe tomar un claro papel protagónico frente a la promulgación de políticas de formación y utilización de su recurso humano.

    La Academia Nacional de Medicina consciente del vacío existente en el sector con respecto al tema, ha querido desde su posición estratégica con respecto a las profesiones del área y las universidades, liderar un proceso que conlleve a la organización de un Estudio del recurso humano del Sector Salud en Colombia, tomando como punto de partida el censo de los trabajadores de la salud en todas las áreas, de tal manera que se identifique su disponibilidad, su capacidad, la ubicación, las facilidades laborales en zonas aisladas y su grado de satisfacción, entre otras

  15. Políticas de estado y derechos humanos

    Directory of Open Access Journals (Sweden)

    Patricia Aschieri

    2005-07-01

    Full Text Available La Red de Defensorías de Niñas, Niños y Adolescentes del Gobierno de la Ciudad de Buenos Aires (DNNYA tiene por objetivo declarado la difusión, promoción y defensa de los derechos que han surgido de la Convención Internacional de los Derechos del Niño (CIDN. Se propone, además, como un espacio que ofrece un modo alternativo de resolución de conflictos que no tienen que pasar necesariamente por la justicia. Este objetivo está estrechamente vinculado con la idea de que la tutela del Estado viola sistemáticamente los derechos de los jóvenes y que, por consiguiente, solo debe acudirse a ella cuando todos los mecanismos por los que pudieran proteger se sus derechos, han sido agotados. En tanto la CIDN constituye una especificación de los Derechos Humanos para las particulares circunstancias de vida de la infancia y la adolescencia, el presente trabajo tiene por objeto, en primer término, reflexionar acerca de la posibilidad de considerar a los Derechos Humanos como un catalogo de valores de carácter universal. En segundo lugar, a la luz de los resultados arrojados por mi trabajo de tesis, me propongo analizar las contradicciones que supone la articulación entre lo político y lo económico y la aplicación de políticas de Derechos Humanos en un organismo del Estado.

  16. Hemoglobinas AS/alfa talassemia: importância diagnóstica Hemoglobins AS/alpha thalassemia: diagnostic importance

    Directory of Open Access Journals (Sweden)

    Renata Tomé-Alves

    2000-12-01

    Full Text Available Portadores de traço falciforme (hemoglobina AS associados a talassemia alfa apresentam alterações na morfologia dos eritrócitos, normalmente ausentes nos heterozigotos para esta variante de hemoglobina. A interação entre hemoglobina S e talassemia alfa tem sido descrita como um dos fatores responsáveis pela melhora no quadro clínico de portadores homozigotos de hemoglobina S (anemia falciforme, diminuindo os episódios de crises de falcização. Os mecanismos genéticos desta influência são avaliados em análises moleculares dos genes da globina humana. Com o objetivo de verificar a presença de talassemia alfa em portadores de hemoglobina S em heterozigose, com presença de anemia, encaminhados ao Laboratório de Hemoglobinas do Departamento de Biologia da UNESP, de São José do Rio Preto, analisamos 1.002 amostras de sangue com traço falciforme, no período de 1990 a 1998. As amostras foram colhidas com EDTA como anticoagulante, após prévia autorização dos portadores. Para o diagnóstico laboratorial as amostras de sangue foram submetidas a procedimentos eletroforéticos em pH alcalino e ácido e pesquisa citológica de hemoglobina H. Os procedimentos eletroforéticos confirmaram a presença de hemoglobina AS. A pesquisa citológica evidenciou a presença de talassemia alfa. Deste total analisado, 16 (1,59 % amostras de sangue apresentaram a associação entre hemoglobina AS e alfa talassemia, sendo que duas eram de indivíduos de uma mesma família. Os resultados obtidos nos direcionaram a sugerir aos laboratórios de rotina que realizem a pesquisa de alfa talassemia entre os portadores de hemoglobina AS, com presença de anemia, para verificar a interação com talassemia alfa, fornecendo assim aos portadores informação importante sobre seu perfil hematológico.Sickle Cell disease is a generic term for a group of genetic disorders characterized by the predominance of hemoglobin S. These disorders include Sickle Cell anemia

  17. Alfa Laval to meet the ballast water challenge%阿法拉伐应对压载水的挑战

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Alfa Laval, the market leader in separation, heat transfer and freshwater generation, is widening its offering of solutions for environmental protection. The company hereby announces that a potent technology for dealing with unwanted organisms in ballast water will be commercially available as early as 2006.

  18. Stability is maintained in adults with Gaucher disease type 1 switched from velaglucerase alfa to eliglustat or imiglucerase: A sub-analysis of the eliglustat ENCORE trial.

    Science.gov (United States)

    Pleat, Rebecca; Cox, Timothy M; Burrow, T Andrew; Giraldo, Pilar; Goker-Alpan, Ozlem; Rosenbloom, Barry E; Croal, Laura R; Underhill, Lisa H; Gaemers, Sebastiaan J M; Peterschmitt, M Judith

    2016-12-01

    Gaucher disease type 1 is an autosomal recessive disorder caused by deficient activity of the lysosomal enzyme acid β-glucosidase resulting in accumulation of glucosylceramide and clinical manifestations of anemia, thrombocytopenia, hepatosplenomegaly, and skeletal disease. The historic standard of care is intravenous recombinant enzyme therapy with imiglucerase. Eliglustat, an oral substrate reduction therapy, is a first-line treatment for adults with Gaucher disease type 1 who have a compatible CYP2D6-metabolizer phenotype (≈ 95% of patients). The 12-month ENCORE trial (NCT00943111) found eliglustat non-inferior to imiglucerase in maintaining stability in adult Gaucher patients previously stabilized after ≥ 3 years of enzyme therapy (imiglucerase or velaglucerase alfa). This post-hoc analysis examined safety and efficacy in the 30 ENCORE patients who were receiving velaglucerase alfa at study entry and were randomized to eliglustat (n = 22) or imiglucerase (n = 8). Efficacy and safety in velaglucerase alfa-transitioned patients were consistent with the full ENCORE trial population; 90% of patients switched to eliglustat and 88% of patients switched to imiglucerase met the composite endpoint (stable hemoglobin concentration, platelet count, spleen volume, and liver volume). Clinical stability was maintained for 12 months in Gaucher disease type 1 patients in the ENCORE trial who switched from velaglucerase alfa to either eliglustat or imiglucerase.

  19. Effectiveness of interferon alfa on incidence of hepatocellular carcinoma and decompensation in cirrhosis type C. European Concerted Action on Viral Hepatitis (EUROHEP)

    DEFF Research Database (Denmark)

    Fattovich, G; Giustina, G; Degos, F

    1997-01-01

    The role of interferon alfa treatment in improving morbidity endpoints in patients with chronic hepatitis C infection is currently under debate. The aim of this study was to evaluate the effectiveness of interferon in preventing hepatocellular carcinoma and decompensation in cirrhosis type C....

  20. El virus sincitial respiratorio humano: una panorámica

    OpenAIRE

    Mylene Corzo-López; Odalys Valdés-Ramírez

    2013-01-01

    Las infecciones respiratorias agudas, son la principal causa de morbilidad y mortalidad en niños de todo el mundo. Dentro de las principales infecciones virales con características respiratorias, ocupa un lugar preponderante las provocadas por el virus sincitial respiratorio humano. Este virus es uno de los patógenos más importantes que causa infección en el tracto respiratorio en niños pequeños, ancianos y pacientes inmunodeprimidos. Su distribución es mundial. Las epidemias causadas por est...

  1. Perfeccionamiento de los recursos humanos en archivología

    Directory of Open Access Journals (Sweden)

    Teresa Fittipaldi Huelmo

    2013-11-01

    Full Text Available Se analiza la situación y las posibles soluciones para mejorar los recursos humanos disponibles en el área de Archivología. Este tema está considerado en varios aspectos: la formación docente de docentes e investigadores; la calidad y la cantidad de los estudiantes; la capacitación de las personas que se encuentran realizando tareas en Archivos. El tema se analiza en el marco de la situación concreta del Uruguay. 

  2. La Santa Muerte y la cultura de los derechos humanos

    OpenAIRE

    Pilar Castells Ballarín

    2008-01-01

    Este artículo tiene su origen en la siguiente pregunta: ¿qué valores se construyen en el culto a La Santa Muerte y cómo afectan el contexto socio-simbólico de los derechos humanos? Reflexiono el culto a La Santa Muerte como un fenómeno social con dos pautas: 1. Una original expresión estratégica para enfrentar la precariedad y muerte social (como efectos indeseados del neoliberalismo); 2. Una expresión que confirma la cultura del miedo como instrumento de control social.

  3. La Libertad: Condición de los Derechos Humanos

    OpenAIRE

    Juan María Parent Jacquemin

    2000-01-01

    La libertad es la base genuina para un completo desarrollo de los derechos humanos. Tenemos que distinguir entre libertad como una facultad del hombre y libertad, como la realización existencial de él mismo. Si damos demasiada importancia a la libertad, podemos elegir una concepción teórica y corremos el riesgo de caer en hipocresías. Si limitamos nuestra elección a la libertad, nos olvidamos de que el hombre es más que sus propias decisiones y perdemos el ideal implícito de los derechos huma...

  4. Los dos discursos del desarrollo humano. Las contradicciones del PNUD

    OpenAIRE

    2014-01-01

    Un discurso que explícitamente afirma una idea pero implícitamente refuerza la contraria es el instrumento perfecto para desactivar cualquier iniciativa de cambio. El presente artículo muestra que éste es el caso de los Informes del Desarrollo Humano del Programa de Naciones Unidas para el Desarrollo (PNUD). Mediante un sencillo ejercicio hermenéutico se demuestra que existen fuertes contradicciones entre lo que se expresa explícitamente y lo que subyace implícitamente. El individuo supue...

  5. Pedagogía de la corporeidad y potencial humano

    OpenAIRE

    Castro Carvajal, Julia Adriana

    2004-01-01

    Frente a la pregunta sobre el desarrollo del potencial humano y la función de la motricidad en esta tarea de humanización, se propone una pedagogía que busca activar en las personas la capacidad del movimiento intencionado y significativo que conduzca al autoconocimiento. Esta propuesta ubica a la acción y sus múltiples dimensiones como el fundamento de la experiencia humana, caracteriza a la motricidad como capacidad desde una perspectiva compleja y sistémica, y recupera como centro del apre...

  6. Incidencia de los recursos humanos en la cadena de suministro

    OpenAIRE

    Gómez Cedeño, Milena G.

    2015-01-01

    La gestión de la cadena de suministro (SCM) es un crisol de diversas disciplinas, con influencias de la logística y el transporte, operaciones y materiales, distribución, así como compras y las tecnologías de la información. Se considera que la cadena de suministro (SC) es una mezcla 50/50 de infraestructura y tecnología, cuando más bien debería ser 45/45/10, como mezcla del comportamiento humano, tecnología e infraestructura. Además, se incide en esta idea, al considerar que muchas empresas ...

  7. EL RECONOCIMIENTO AL DERECHO HUMANO A LA PAZ

    OpenAIRE

    Diana Gabriela Moreira Aguirre

    2011-01-01

    RESUMO El presente artículo pretende desarrollar conceptualmente algunas nociones esenciales sobre la paz y el derecho, y como la relación entre estos sirve para el análisis que se realiza en el presente trabajo sobre la necesidad de que el derecho humano a la paz se convierta en una realidad jurídica de cumplimiento para los Estados. Para esto resulta importante revisar brevemente el pensamiento histórico de cuatro juristas excepcionales que en diferentes momentos históricos de la humanidad ...

  8. Por un enfoque psicobiológico del desarrollo humano

    OpenAIRE

    Perinat, Adolfo

    1982-01-01

    Para entender cabalmente el desarrollo humano, el psicólogo debe partir de la biología funcional y de biología evolucionista. En el ámbito de la primera el estudio del desarrollo es escudriñar cómo lo que empieza siendo funcionamiento orgánico acaba convirtiéndose en intercambio funcional y comportamiento especifico. Dentro de la perspectiva evolucionista hay que contemplar a la infancia como un periodo d e la vida que posee su propia historia, paralela a la de la especie. Aquí cobra gran imp...

  9. Os direitos humanos e a responsabilidade do credor internacional

    Directory of Open Access Journals (Sweden)

    Douglas Antônio Rocha Pinheiro

    2014-09-01

    Full Text Available Partindo do conceito moderno de dívida odiosa e da política creditícia do Banco Mundial, o presente artigo pretende destacar a viabilidade de se exigir o respeito aos direitos humanos como requisito indispensável ao empréstimo internacional. Based on the modern concept of odious debt and the loan policy of the World Bank, this article intends to point out the viability of requiring respect for human rights as an essential condition for the international lending.

  10. Comportamiento Organizacional del Talento Humano en las Instituciones Educativas

    OpenAIRE

    Margareth Genesi; Nercida Romero; Yasmarili Tinedo

    2016-01-01

    La investigación, tuvo como objetivo general analizar el comportamiento organizacional del talento humano en las instituciones educativas del Municipio Cabimas. Se fundamentó en las teorías de Robbins (2004), Schermerhorm (2007) y Alles (2007). Fue analítica-descriptiva de campo, diseño no experimental-transeccional. La población constó de 60 sujetos. La técnica utilizada para recabar información fue la observación por encuesta. Los resultados indicaron que la capacitación y la estructura son...

  11. Desarrollo humano y crecimiento económico en Colombia

    OpenAIRE

    2011-01-01

    En el presente artículo se hace un análisis de la relación desarrollo humano y crecimiento económico en Colombia. Para ello, adaptamos a escala regional los métodos de estudio propuestos durante los últimos años por Ranis, Stewart y Ramírez en los que consideran la existencia de cuatro situaciones distintas en la relación entre ambas variables: círculos viciosos, círculos virtuosos, sesgos pro-crecimiento y sesgos pro-desarrollo. Previamente se estudia la relación en el ámbito mundial, con el...

  12. La Santa Muerte y la cultura de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Pilar Castells Ballarín

    2008-06-01

    Full Text Available Este artículo tiene su origen en la siguiente pregunta: ¿qué valores se construyen en el culto a La Santa Muerte y cómo afectan el contexto socio-simbólico de los derechos humanos? Reflexiono el culto a La Santa Muerte como un fenómeno social con dos pautas: 1. Una original expresión estratégica para enfrentar la precariedad y muerte social (como efectos indeseados del neoliberalismo; 2. Una expresión que confirma la cultura del miedo como instrumento de control social.

  13. Remesas y desarrollo humano: el caso de Zacatecas

    OpenAIRE

    Ramón A. Castillo Ponce; Anayatzin Larios Candelas

    2008-01-01

    Tradicionalmente, el estudio de las remesas se ha enfocado a evaluar su repercusión económica en la comunidad receptora. El presente estudio adopta una visión alternativa y analiza su efecto en el desarrollo humano de las familias que las reciben. El interés es saber si los fondos que llegan del extranjero son empleados en rubros distintos a los del consumo tradicional; tales como cuidado médico o educación. Con datos de la muestra del XII Censo general de población y...

  14. Realidad indigena de Guatuso: Resistencia cultural y derechos humanos

    OpenAIRE

    Barrante, Trino

    2015-01-01

    Se ofrecen algunos rastgos que sirvan para enriquecer el debate acerca del proceso de occidentalización que viven hoy los malekus. Aunque históricamente los pueblos originarios de América han resistido por más de 500 años, la sistemática violación a sus derechos humanos se convierte en una norma del mundo occidental. Por eso, parte de nuestro objetivo con esta investigación es conocer en términos concretos cuáles son esos derechos fundamentales que enfrentan los palenques del Sol, Margarita y...

  15. O uso da drotrecogina alfa ativada na prática clínica e as atuais evidências Drotrecogin alfa activated in clinical practice and the current evidences

    Directory of Open Access Journals (Sweden)

    Márcio Soares

    2008-06-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O debate sobre a segurança e eficácia da drotrecogina alfa (DrotAA encontra-se na ordem do dia, principalmente, em função dos resultados negativos observados em ensaios clínicos subseqüentes ao PROWESS e do impacto econômico no sistema de saúde relacionado ao custo elevado do fármaco. O objetivo deste estudo foi rever os principais estudos sobre a utilização da DrotAA em pacientes com sepse grave, com ênfase nas questões ligadas a sua eficácia e segurança. CONTEÚDO: Foram selecionados artigos sobre a utilização da DrotAA em pacientes com sepse publicados nos últimos dez anos no MedLine. Os seguintes unitermos foram utilizados: activated protein C; drotrecogin alfa; sepsis; septic shock; Xigris®. Estudos referenciados nos artigos selecionados na busca também foram utilizados. CONCLUSÕES: As taxas de letalidades e as complicações hemorrágicas associadas com o uso do fármaco foram maiores em grandes estudos observacionais do que aquelas descritas previamente nos ensaios clínicos. A luz dos resultados atualmente disponíveis, o uso da DrotAA deve ser reconsiderado até que novos ensaios clínicos possam subsidiar com informações adicionais sobre eficácia, segurança e na identificação dos subgrupos de pacientes com sepse grave que porventura possam ter benefício com o uso deste medicamento. A DrotAA deve servir de exemplo para que haja maior cautela com a rápida transposição de evidências ainda em construção para recomendações e diretrizes de tratamento de pacientes com sepse grave.BACKGROUND AND OBJECTIVES: The debate on efficacy and patient safety related to the use of drotrecogin alfa (DrotAA is timely, principally due to the negative results observed in clinical studies performed after the PROWESS study, and the economic cost-related impact of the drug on the healthcare system. The aim of this study was to review the main studies on the use of DrotAA in patients with severe

  16. Overexpression of SULT2B1b Promotes Angiogenesis in Human Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Wen Chen

    2016-03-01

    Full Text Available Background/Aims: Overexpression of cytosolic sulfotransferase 2B1b (SULT2B1b has been commonly found in colorectal and hepatocellular carcinoma, suggesting that SULT2B1b might act as a potential oncogenic protein. However, its clinical significance and biological role in gastric cancer progression remain largely unknown. Methods: Expressions of SULT2B1b in clinical gastric cancer (GC samples were examined using qRT-PCR and Western blot. Results: SULT2B1b was markedly overexpressed in human GC samples, and positively correlated with vessel density and associated with poor clinical features. We also demonstrated that overexpression of SULT2B1b resulted in increased tumor angiogenesis and tumor growth in mouse GC models. In addition, ablation of SULT2B1b in human GC cells lines BGC823 and MKN45 decreased the capability of the cells to recruit endothelial cells. Moreover, depletion of SULT2B1b in GC cells reduced VEGF-A expression by downregulating SP1 and AP2. Conclusion: Our results suggested that the SULT2B1b-mediated angiogenic pathway could serve as biomarkers for GC diagnosis and prognosis, and suppressing SULT2B1b-mediated angiogenic signaling might be a promising strategy for developing novel GC treatment.

  17. X-ray powder diffraction studies and thermal behaviour of NaK 2B 9O 15, Na(Na .17K .83) 2B 9O 15, and (Na .80K .20)K 2B 9O 15

    Science.gov (United States)

    Bubnova, R.; Albert, B.; Georgievskaya, M.; Krzhizhanovskaya, M.; Hofmann, K.; Filatov, S.

    2006-09-01

    The crystal structures of NaK 2B 9O 15 ( a=9.1158(1) Å, b=6.6246(1) Å, c=20.6812(3) Å, β=94.080(1)°, R=0.047, R=0.059, R=0.026), Na(Na .17K .83) 2B 9O 15 ( a=9.0559(1) Å, b=6.6170(1) Å, c=20.5833(3) Å, β=94.228(2)°, R=0.053, R=0.068, R=0.026), and (Na .80K .20)K 2B 9O 15 ( a=9.1534(1) Å, b=6.6296(1) Å, c=20.7422(3) Å, β=94.071(1)°, Z=4, R=0.041, R=0.052, R=0.023) were refined in the monoclinic space groups P2 1/ c(Z=4) using X-ray powder diffraction data and the Rietveld method. These nonaborates are isostructural to K 3B 9O 15. Their crystal structure consists of a three-dimensional open framework built up from three crystallographically independent triborate groups. The alkali metal cations are located on three different sites in the voids of the framework. High-temperature X-ray diffraction studies show that NaK 2B 9O 15 decomposes at about 700 °C in accordance with the peritectic reaction NaK 2B 9O 15↔K 5B 19O 31+liquid. The thermal expansion of NaK 2B 9O 15 and Na(Na .17K .83) 2B 9O 15 is highly anisotropic. A similarity of the thermal and compositional (Na-K substitution) deformations of NaK 2B 9O 15 is revealed: heating of NaK 2B 9O 15 by 1 °C leads to the same deformations of the crystal structure as increasing the amount of K atoms in (Na 1-xK x) 3B 9O 15 by 0.04 at% K.

  18. Evaluation of NR2B peptide as subunit vaccines against experimental neuropathic pain

    Institute of Scientific and Technical Information of China (English)

    WANG Gong-ming; TIAN Yu-ke; CHEN Jian-ping; TIAN Xu-bi; GAO Feng; YANG Hui; AN Ke; MA Guo-ping

    2007-01-01

    Background NR2B containing N-methyl-D-aspartate (NMDA) receptor plays an important role in the facilitation and maintenance of neuropathic pain. The discrete distribution of NR2B subunit in the central nervous system (CNS) may support reduced side effects of agents that act selectively at this site. Therefore, we investigated the hypothesis that a humoral autoimmune response targeting the NR2B subunit of NMDA receptor relieves pain like behaviours produced by peripheral injury.Methods Rats were immunized subcutaneously with NR2B-Keyhole Limpet Hemocyanin (NR2B-KLH) three times at two-week intervals. NR2B specific IgG titres in sera and cerebrospinal fluid were determined by indirect ELISA. Seven days after the third immunization, 2 of the 3 terminal branches of the sciatic nerve (tibial and common peroneal nerves) were tightly ligated. Behavioural testing was carried out on every other day after surgery, until 7 days after surgery. The lumbar spinal cord (L4-6) was removed on day 7 after ligation. The expression of NR2B protein in the lumbar spinal cord was determined using Western blotting.Results After the second vaccination, NR2B specific IgG in sera was detected to be >0.5 μg/ml in six of nine rats. After the third vaccination, all the immunized rats had >2.2 μg/ml. Titres of NR2B specific IgG in sera peaked 42 days post initial immunization and persisted for over 70 days. No NR2B specific IgG was detected in sera from PBS or KLH group.The behavioural thresholds in NR2B group were significantly higher than those in PBS and KLH groups on day 7 after ligation. NR2B specific IgG in CSF in NR2B group could not be detected on day 1 before spinal dissection; but could be detected on day 7 after surgery. The expression of NR2B protein in group NR2B was significantly lower than in PBS and KLH groups on day 7 after surgery.Conclusion The NR2B peptide could be used as a vaccine against neuropathic pain, which could be associated with reduction of NR2B protein in

  19. Gradualismo y equilibrio puntuado en el origen del comportamiento humano

    Directory of Open Access Journals (Sweden)

    Ignacio de la TORRE SÁINZ

    2009-12-01

    Full Text Available RESUMEN: La visión tradicional de la evolución del comportamiento ha sobrevalorado algunos de los aspectos materiales de la cultura concebidos como propiamente humanos. Sin embargo, en los últimos años una serie de estudios han revelado la existencia de estos rasgos adaptativos en otros primates. Esto ha cuestionado seriamente la validez de muchos de las aproximaciones materialistas que parten de la premisa de que sólo lo que aparece en el registro arqueológico es factible de ser interpretado. En este artículo se pasa revista a las explicaciones gradualistas y puntuadas de la aparición del comportamiento humano, y se subraya la necesidad de enfocar el problema desde una consideración socioecológica.ABSTRACT: The traditional views on the evolution of human behavior have overemphasized some of the material aspects of culture, conceived as properly human. However, during the last years, the studies of apes have revealed the existence of these adaptive traits in other primates. This fact has seriously damaged the validity of such a materialist - biased approach (only what is left in the archaeological record is liable to be interpreted as a clear-cut human diagnosis. Gradualist and punctuated explanations of the emergence of human behavior are mentioned as theoretical frameworks and the need of focusing such an issue from a socio-ecological consideration is proposed.

  20. Capital humano y capacidad humana Human capital and human capacity

    Directory of Open Access Journals (Sweden)

    Sen Amartya Kumar

    1998-12-01

    Full Text Available En este articulo se examinan las relaciones y diferencias entre el concepto de 'capital humano' y el concepto de 'capacidad humana'. El concepto de capital humano es mas limitado puesto que solo concibe las cualidades humanas en su relación con el crecimiento económico mientras que el concepto de capacidades da énfasis a la expansión de libertad humana para vivir el tipo de vida que la gente considera valedera. Cuando se adopta esa visión mas amplia, el proceso de desarrollo no puede verse simplemente como un incremento del PIB sino como la expansión de la capacidad humana para llevar una vida mas libre y mas digna.In this article the relationships and the differences between the concept of 'human capital' and the concept of 'human capability' are examined. The concept of human capital is more limited since it only conceives human qualities in relation to economic growth, whereas the concept of capabili ties puts emphasis on the expansion of human freedom to live the kind of life that people judge valuable. Whenthis broader vision is adopted, the process of development cannot be seen as simply an increase in the GNP, but rather as the expansion of the human capability to live a more free and worthy life.

  1. Desarrollo Humano, educación y aprendizaje

    Directory of Open Access Journals (Sweden)

    Zulay Pereira Pérez

    2004-09-01

    Full Text Available

    Resumen. Se aborda el análisis del concepto de desarrollo humano y su aplicación a la educación. Asume su contexto histórico social y lo complementa con la dimensión individual, la cual es analizada desde la perspectiva de áreas y etapas que la caracterizan, manteniendo en mente la integralidad que en todo momento presenta el desarrollo humano.

    Se propone un análisis de las implicaciones y aplicaciones para la educación de los procesos básicos que se dan en cada una de las etapas del desarrollo de las personas menores de edad, con el objetivo de plantear posibles actividades que lo promuevan.

     

    Abstract. This article analyzes the concept of human development and its implications in education. It considers the historical and social dimension as well as the individual ones, the latter are considered in terms of the stages and areas, keeping in mind the wholeness that characterizes human development.

    Besides, it analyzes the educational implications of the basic principles characteristic human development in children and adolescents, with the objective of establishing possible educational activities that will promote this development.

  2. Los Derechos Humanos y desaparecidos en dictaduras militares

    Directory of Open Access Journals (Sweden)

    Juan Carlos GUTIÉRREZ CONTRERAS

    2009-11-01

    Full Text Available RESUMEN: La doctrina de la seguridad nacional jugó un papel predominante como soporte ideológico de las dictaduras del Cono Sur americano. Dentro de este marco se adelantó el "Plan Cóndor" que llevó a la múltiple y sistemática violación de derechos humanos en los países en los que se desarrolló. El artículo hace un análisis jurídico de la responsabilidad de los actores a la luz del derecho penal internacional y del derecho internacional de los derechos humanos, con especial énfasis en la competencia para el juzgamiento de los hechos. Concluye con el análisis del terrorismo de Estado manifestado a través del genocidio, la tortura y las desapariciones forzadas cometidos durante las dictaduras militares.ABSTRACT: The doctrine of national secutiry played a leading role as an ideological endorsement of the South American dictatorships. The Plan Condor was created in this context, and it led to systematic and multiple human rights violations. This article analyzes the responsibility of different actors in the light of International Law, and puts special emphasis in the competence of courts to judge those facts. It concludes with an analysis of state terrorísm, which led to genocide, torture and disapperances under military dictatorships.

  3. El crimen: una perspectiva desde los derechos humanos

    Directory of Open Access Journals (Sweden)

    Rafael Eduardo Carrillo Pumarejo

    2012-07-01

    Full Text Available ResumenEn este trabajo se busca analizar la relevancia que tienen los derechos humanos en el estudio del crimen. Se muestra como el estudio del crimen ha evolucionado a partir de las ideas humanitarias de la Ilustración europea hasta convertirse en una disciplina científica con diversos enfoques. Se indaga la relación entre derechos humanos, y la legislación penal internacional. Finalmente se esbozan los postulados básicos de la economía del crimen cuya preponderancia actual es innegable dado las ideas dominantes de la teoría económica neoclásica. La metodología empleada fue de tipo funcional-comparativo.AbstractThis work seeks to analyze the relevance of human rights in the study of crime. We show how the study of crime has evolved from humanitarian ideas of the European Enlightenment into a scientific discipline with various approaches. It explores the relationship between human rights and international criminal law. Finally, we outline the basic tenets of the economics of crime whose current dominance is undeniable given the dominant ideas of neoclassical economic theory. The methodology was comparative-functional type.

  4. Los recursos humanos y el sistema de salud en Brasil

    Directory of Open Access Journals (Sweden)

    Machado M.H.

    2002-01-01

    Full Text Available El presente artículo examina algunas cuestiones relacionadas con los recursos humanos que actúan en el sistema de salud brasileño. Identifica, inicialmente, cuestiones de recursos humanos que se expresan como tendencia en el sector salud en los últimos años. A continuación, se hace un breve comentario sobre la reforma del sistema de salud, apuntando cambios en el diseño del modelo de salud por medio de la implementación del Programa de Salud de la Familia, que busca reorientar el modelo asistencial a partir de la atención básica, en sustitución del modelo tradicional de asistencia dirigido hacia la cura de enfermedades y el hospital. Señala cambios importantes en las condiciones de trabajo de médicos, odontólogos, etc., tales como bajos salarios, pluriempleo, consultas pagadas por seguro-salud, flexibilización de los contratos de trabajo o pérdida de las garantías laborales. Por último, identifica problemas serios con relación a este Programa de Salud de la Familia, especialmente los que se refieren a la inestabilidad del proceso de trabajo y a la disminución de la protección social de los trabajadores que actúan en el programa.

  5. Grupo de sala de espera: sentidos do envelhecimento humano

    Directory of Open Access Journals (Sweden)

    Cesar Sandoval Moreira Jr.

    2003-06-01

    Full Text Available Este trabalho parte da consideração do envelhecimento humano como experiência heterogênea. Busca pôr em diálogo o grupo de sala de espera, recorrendo ao construcionismo social, para descrevê-lo como prática discursiva. Problematizando essa modalidade de intervenção psicológica, nesse estudo objetivamos descrever o processo de produção de sentidos sobre o envelhecimento humano nesse contexto. Dez grupos de sala de espera, gravados e transcritos, foram pré-analisados favorecendo a escolha de um deles para análise extensiva. Essa análise apontou que, nesse processo conversacional, a vivência do envelhecimento como experiência individual vai sendo paulatinamente reconstruída pelos interlocutores como de natureza sócio-interacional, apontando para posições mais ativas na produção de qualidade de vida no envelhecimento. Assim, os participantes em co-autoria, falando de seus cotidianos, abrem possibilidades de novas descrições sobre si mesmos enquanto pessoas idosas, nesse contexto interativo.

  6. Externalidades del capital humano en México

    Directory of Open Access Journals (Sweden)

    Edna María Villarreal Peralta

    2016-01-01

    Full Text Available El presente trabajo estima las externalidades del capital humano en México em- pleando los enfoques más utilizados en la literatura. Con el propósito de reducir el potencial sesgo de endogenedidad de la escolaridad individual y promedio rea- lizamos estimaciones con variables instrumentales. Para lo cual empleamos como instrumento de la primera la reforma educativa de 1993 que promulgó la obligatoriedad de la educación secundaria. Para la segunda utilizamos la proporción de egresados de educación media superior y superior y la estructura de la población de los estados en un periodo previo. Los resultados muestran que existe una fuer - te relación positiva y estadísticamente significativa entre experiencia, educación individual y educación promedio estatal con los salarios individuales. Asimismo, confirmamos por medio de la aplicación de los diversos enfoques a través de la coincidencia en los resultados encontrados que existen externalidades significativas del capital humano a nivel estatal en México para el periodo 2000-2010.

  7. BANCO DE LEITE HUMANO NA PERSPECTIVA DA MULHER DOADORA

    Directory of Open Access Journals (Sweden)

    Valdecyr Herdy Alves

    2013-01-01

    Full Text Available El objetivo fue significar los valores relacionados al acto de donar leche que emergen en las parcelas simbólicas imaginarias de mujeres/amamantadoras y comprender el significado de las estructuras imaginarias valorativas que revelan la acción de mujeres donantes. Estudio descriptivo con once amamantadoras del banco de leche humano de un hospital universitario, a través de observación sistematizada y entrevista individual. La preocupación de las amamantadoras con acción transformadora, dispuesta a donar su leche creyendo ser este el camino para el cambio del mundo. Los valores engendrados en el acto de donar leche humano emergen del campo simbólico de actuación de los profesionales de salud, caracterizando el mito imaginario de las amamantadoras. La donación exige prácticas que refuercen el imaginario social durante la atención a la salud por el Banco de leche.

  8. Psiconeuroinmunologia: relaciones entre factores psicologicos e inmunitarios en humanos

    Directory of Open Access Journals (Sweden)

    Pablo E. Vera Villarroel

    1999-01-01

    Full Text Available La Psiconeuroinmunología (PNI es un campo que estudia las relaciones bidireccionales entre la conducta, el cerebro y el sistema inmune. Desde los estudios iniciales de inmunodepresión e inmunoactivación condicionada realizadaen animales se han llevado acabo una gran cantidad de estudios en humanos, intentando verificar hasta qué punto el sistema inmune está sujeto a las influencias psicosociales. El presente artículo revisa algunos avances en esta área centrándose exclusivamente en participantes humanos. Se comienza coñ las definiciones que fundamentan el área, se describen los elementos y funcionamiento del sistema inmune así como también las formas de medirlo. Se continúa con las descripciones de los estudios en áreas como: situaciones sociales, ansiedad y estrés, depresión, procesos cognitivos, cáncer y sida. Por último es necesario destacar que la mayoría de la literatura se ha centrando en investigadores de habla inglesa, sin embargo, ya se conocen interesantes trabajos de investigadores iberoamericanos de países como Brasil, Chile, España, México, etc.

  9. El alivio del dolor: ¿es un derecho humano?

    Directory of Open Access Journals (Sweden)

    G. Saruwatari Zavala

    2012-06-01

    Full Text Available En este trabajo se analiza el artículo titulado "El alivio del dolor como un derecho humano", escrito por F. Brennan y M. Cousins, en donde los autores proclaman la formulación de un novedoso derecho fundamental y revisan diversos instrumentos internacionales de Derechos Humanos, para sustentar el argumento de que el paciente debe ser protegido contra el insuficiente tratamiento del dolor. Diversos autores y organizaciones han denunciado las causas, debidas a diversos factores, por las cuales el dolor no es tratado en toda su extensión. Los factores normativos estriban en la autorización y/o prohibición de la distribución, consumo, uso y comercialización de fármacos, por parte de las agencias gubernamentales. Los factores económicos son multicausales puesto que se relacionan directamente con el acceso a servicios de salud y a medicamentos. Se identifica como un serio problema de salud pública, el que no se destinen suficientes recursos para la implementación de unidades para tratamiento del dolor crónico o temporal o para la investigación relativa al tema. La falta de educación y actualización de los profesionales de salud es otro problema importante. Dentro de las causas sociales se encuentran entre otras, la desigualdad en el acceso a los servicios de salud, la pobreza, la falta de cobertura médica y la discriminación hacia ciertos grupos sociales. En el texto se hace un sucinto recorrido por los principales instrumentos internacionales de Derechos Humanos. Se retoman los instrumentos examinados por Brennan y Cousins, con la aportación de agregar documentos regionales del Sistema Interamericano de Derechos Humanos. Para los Estados Miembros de la Organización de los Estados Americanos (OEA, que padecen la problemática propia de los países en vías de desarrollo: muchas necesidades, alta densidad de población y escasez de recursos, se torna urgente plantearse el Derecho a la Salud bajo nuevas perspectivas. Pensar

  10. DERECHO HUMANO A LA LIBERTAD DE RELIGIÓN

    Directory of Open Access Journals (Sweden)

    Jorge Alonso Benítez Hurtado

    2011-08-01

    Full Text Available RESUMO En este artículo nos proponemos analizar el reconocimiento del derecho humano a la libertad de religión en los instrumentos internacionales de derechos humanos y su influencia en el constitucionalismo ecuatoriano. Partimos del análisis del contenido de este derecho, para después analizar su reconocimiento en los diferentes instrumentos internacionales especialmente en la Declaración Universal de los Derechos Humanos. Este fundamento permitirá abordar el tema en el contexto de las diferentes Constituciones que ha tenido el Ecuador desde que se fundó como república en 1830 hasta llegar a la actual Constitución de la República del Ecuador del 2008. La libertad de religión en el constitucionalismo ecuatoriano ha venido poco a poco evolucionando a lo largo de la historia desde la imposición de una sola religión por parte del Estado en épocas conservadoras, pasando después a un liberalismo laico donde inclusive se prohibía toda práctica religiosa, hasta llegar a épocas modernas en donde se establece la libertad de religión como un derecho propiamente dicho en el que se garantiza a las personas la libertad de profesar la religión de su elección. Palavras- chave: Derechos humanos, liberdad de religión, reconocimiento del derecho a la liberdad de religión, derecho a la liberdad de religión en el constitucionalismo ecuatoriano. HUMAN RIGHT TO FREEDOM OF RELIGION ABSTRACT In this article we analyze the recognition of the human right to freedom of religion in international instruments of human rights and their influence on Ecuadorian constitutionalism. We start by analyzing the content of this right. Next we analyze the recognition of this right in various international instruments especially the Universal Declaration of Human Rights. This information allows us to then address the issue in the context of the various Constitutions which Ecuador has had since its foundation as a republic in 1830 through the present Constitution

  11. Genetic loss of SH2B3 in acute lymphoblastic leukemia

    Science.gov (United States)

    Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Hadler, Michael; Rigo, Isaura; LeDuc, Charles A.; Kelly, Kara; Jalas, Chaim; Paietta, Elisabeth; Racevskis, Janis; Rowe, Jacob M.; Tallman, Martin S.; Paganin, Maddalena; Basso, Giuseppe; Tong, Wei; Chung, Wendy K.

    2013-01-01

    The SH2B adaptor protein 3 (SH2B3) gene encodes a negative regulator of cytokine signaling with a critical role in the homeostasis of hematopoietic stem cells and lymphoid progenitors. Here, we report the identification of germline homozygous SH2B3 mutations in 2 siblings affected with developmental delay and autoimmunity, one in whom B-precursor acute lymphoblastic leukemia (ALL) developed. Mechanistically, loss of SH2B3 increases Janus kinase-signal transducer and activator of transcription signaling, promotes lymphoid cell proliferation, and accelerates leukemia development in a mouse model of NOTCH1-induced ALL. Moreover, extended mutation analysis showed homozygous somatic mutations in SH2B3 in 2 of 167 ALLs analyzed. Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of ALL and highlight a possible link between genetic predisposition factors in the pathogenesis of autoimmunity and leukemogenesis. PMID:23908464

  12. Estudios sobre alfa-amilasa en saliva como marcador de estrés en la especie humana y otras especies animales= Studies on salivary alpha-amylase as a maker of stress in human and different animal species

    OpenAIRE

    Fuentes Rubio, María

    2014-01-01

    OBJETIVOS 1. Evaluar el uso de la alfa amilasa salivar como marcador de estrés usando técnicas tradicionales (ensayos enzimáticos) en humana, usando como modelo experimental a estudiantes de veterinaria que tenían que realizar una presentación oral de un trabajo en lengua extranjera. 2. Evaluar el uso de la alfa amilasa salivar como marcador de estrés usando técnicas tradicionales (ensayos enzimáticos) en cerdos. 3. Implementar nuevos enfoques para la medición de la alfa-amilasa e...

  13. Marcos globales de los derechos humanos aplicables a los migrantes LGBTI

    OpenAIRE

    Tabak, Shana; Levitan, Rachel

    2013-01-01

    Aunque no existe un instrumento jurídico internacional para proteger específicamente los derechos humanos de las personas LGBTI, en los últimos años los órganos jurídicos internacionales han interpretado las disposiciones básicas de los derechos humanos para aplicarlas a la población LGBTI.

  14. Una propuesta de fundamentación de los derechos humanos en el derecho internacional

    OpenAIRE

    Mola, Attilio

    1995-01-01

    SUMARIO:!. Premisa. 2. Las posiciones negativas radicales. 3. Las posiciones «realistas». 4. La paradoja de la internacionalización: una aproximación parcial. 5. Los derechos humanos en los principios del Derecho internacional. 6. La fundamentación de los derechos humanos en el Derecho internacional. 7. Conclusión. Publicado

  15. Allele and genotype frequencies of CYP2B6 in a Turkish population.

    Science.gov (United States)

    Yuce-Artun, Nazan; Kose, Gulcin; Suzen, H Sinan

    2014-06-01

    Increasing interest in cytochrome P450 2B6 (CYP2B6) genetic polymorphism was stimulated by revelations of a specific CYP2B6 genotype significantly affecting the metabolism of various drugs in common clinical use in terms of increasing drug efficacy and avoiding adverse drug reactions. The present study aimed to determine the frequencies of CYP2B6*4 CYP2B6*5, CYP2B6*6, CYP2B6*7 and CYP2B6*9 alleles in healthy Turkish individuals (n = 172). Frequencies of three single nucleotide polymorphisms were 516G>T (28%), 785A>G (33%), and 1459C>T (12%). The frequencies of CYP2B6*1, *4, *5, *6, *7, and *9 alleles were 54.3 (95% CI 49.04-59.56), 6.4% (95% CI 3.81-8.99), 11% (95% CI 7.69-14.31), 25.3% (95% CI 20.71-29.89), 0.87% (95% CI -0.11-1.85) and 2.0% (95% CI 0.52-3.48), respectively. Allele *6 was more frequent (25.3%) than the other variant alleles in Turkish subjects. The frequencies of CYP2B6*4, *5, *6, *7, and *9 alleles were similar to European populations but significantly different from that reported for Asian populations. This is the first study to document the frequencies of the CYP2B6*4, *5, *6, *7, *9 alleles in the healthy Turkish individuals and our results could provide clinically useful information on drug metabolism by CYP2B6 in Turkish population.

  16. Do self-service technologies affect interfirm relationships? A B2B perspective

    OpenAIRE

    Raechel Johns

    2014-01-01

    While considerable literature examines business-to business (B2B) relationships, the impact of technology on these relationships has lacked attention. IT has impacted the way businesses operate in a B2B context as well as influencing services by altering the way services are delivered. To understand the way in which Internet technology has impacted these B2B services, it is essential to examine its impact not only on business processes but on business relationships too. One technology, enable...

  17. B2B marketingová komunikace společnosti John Deere

    OpenAIRE

    2013-01-01

    The aim of this master's thesis is to evaluate the implementation of the B2B marketing strategy of John Deere on a specific example. The theoretical part of the thesis focuses on defining the basics of modern marketing communications. Next it deals with defining the concept of B2B marketing and related strategies. The practical part focuses on the characterisation of the agricultural machinery industry and the slovak agricultural sector. Further it includes the introduction of other B2B marke...

  18. Deficiência de alfa-1 antitripsina: diagnóstico e tratamento Alpha-1 antitrypsin deficiency: diagnosis and treatment

    Directory of Open Access Journals (Sweden)

    Aquiles A Camelier

    2008-07-01

    Full Text Available A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que determina polimerização e acúmulo dentro dos hepatócitos. O acúmulo e a conseqüente redução dos níveis séricos de alfa-1 antitripsina determinam, respectivamente, doença hepática e pulmonar, sendo que esta se manifesta principalmente sob a forma de enfisema de aparecimento precoce, habitualmente com predomínio basal. O diagnóstico envolve a detecção de níveis séricos reduzidos de alfa-1 antitripsina e a confirmação fenotípica. Além do tratamento usual para doença pulmonar obstrutiva crônica, existe atualmente uma terapia específica com infusão de concentrados de alfa-1 antitripsina. Essa terapia de reposição, aparentemente segura, ainda não teve a eficácia clínica definitivamente comprovada, e o custo-efetividade também é um tema controverso e ainda pouco abordado. Apesar da sua importância, não existem dados epidemiológicos brasileiros a respeito da prevalência da doença ou da freqüência de ocorrência dos alelos deficientes. O subdiagnóstico também tem sido uma importante limitação tanto para o estudo da doença quanto para o tratamento adequado dos pacientes. Espera-se que a criação do Registro Internacional de Alfa-1 venha a resolver essas e outras importantes questões.Alpha-1 antitrypsin deficiency is a recently identified genetic disease that occurs almost as frequently as cystic fibrosis. It is caused by various mutations in the SERPINA1 gene, and has numerous clinical

  19. 77 FR 28764 - Temporary Non-agricultural Employment of H-2B Aliens in the United States

    Science.gov (United States)

    2012-05-16

    ... H-2B Aliens in the United States AGENCY: Employment and Training Administration, Labor. ] ACTION... Aliens in the United States, published February 21, 2012 (the 2012 H-2B Final Rule). The 2012 H-2B...

  20. Insights into CYP2B6-mediated drug–drug interactions

    Directory of Open Access Journals (Sweden)

    William D. Hedrich

    2016-09-01

    Full Text Available Mounting evidence demonstrates that CYP2B6 plays a much larger role in human drug metabolism than was previously believed. The discovery of multiple important substrates of CYP2B6 as well as polymorphic differences has sparked increasing interest in the genetic and xenobiotic factors contributing to the expression and function of the enzyme. The expression of CYP2B6 is regulated primarily by the xenobiotic receptors constitutive androstane receptor (CAR and pregnane X receptor (PXR in the liver. In addition to CYP2B6, these receptors also mediate the inductive expression of CYP3A4, and a number of important phase II enzymes and drug transporters. CYP2B6 has been demonstrated to play a role in the metabolism of 2%–10% of clinically used drugs including widely used antineoplastic agents cyclophosphamide and ifosfamide, anesthetics propofol and ketamine, synthetic opioids pethidine and methadone, and the antiretrovirals nevirapine and efavirenz, among others. Significant inter-individual variability in the expression and function of the human CYP2B6 gene exists and can result in altered clinical outcomes in patients receiving treatment with CYP2B6-substrate drugs. These variances arise from a number of sources including genetic polymorphism, and xenobiotic intervention. In this review, we will provide an overview of the key players in CYP2B6 expression and function and highlight recent advances made in assessing clinical ramifications of important CYP2B6-mediated drug–drug interactions.

  1. Reversal of pathology in CHMP2B-mediated frontotemporal dementia patient cells using RNA interference

    DEFF Research Database (Denmark)

    Nielsen, Troels Tolstrup; Mizielinska, Sarah; Hasholt, Lis;

    2012-01-01

    BACKGROUND: Frontotemporal dementia is the second most common form of young-onset dementia after Alzheimer's disease, and several genetic forms of frontotemporal dementia are known. A rare genetic variant is caused by a point mutation in the CHMP2B gene. CHMP2B is a component of the ESCRT...... role in the pathogenesis of the disease. METHODS: In the present study, we used lentiviral vectors to efficiently knockdown CHMP2B by delivering microRNA embedded small hairpin RNAs. RESULTS: We show that CHMP2B can be efficiently knocked down in patient fibroblasts using an RNA interference approach...

  2. Migrantes deportados: entre la concepción de los desechos humanos y la de los derechos humanos

    Directory of Open Access Journals (Sweden)

    Joaquín A. Mejía R.

    2011-08-01

    Full Text Available La crisis económica mundial está provocando una crisis de los valores democráticos en las sociedades del Norte cuando se trata de abordar el fenómeno migratorio.Cada vez más los Estados de Europa y Estados Unidos ven en la migración un asunto que se desecha cuando ya no es útil ni rentable y los derechos humanos de los inmigrantes son sacrificados en el altar de la seguridad nacional, del orden público y de la recesión económica. De esta manera, en nombre de su soberanía, los Estadosaplican políticas migratorias que atentan contra los derechos de las poblaciones migrantes sujetas a deportación, negándoles el derecho básico a ser oído por un juez independiente e imparcial. El objetivo de este artículo es mostrar que cuando un Estado falla en su obligación de respetar y garantizar los derechos humanos,se pueden activar los sistemas de protección internacional para revertir decisiones estatales que responden a una política migratoria discriminatoria y contraria a la dignidad humana.

  3. Daclatasvir vs telaprevir plus peginterferon alfa/ribavirin for hepatitis C virus genotype 1

    Science.gov (United States)

    Jacobson, Ira; Zeuzem, Stefan; Flisiak, Robert; Knysz, Brygida; Lueth, Stefan; Zarebska-Michaluk, Dorota; Janczewska, Ewa; Ferenci, Peter; Diago, Moises; Zignego, Anna Linda; Safadi, Rifaat; Baruch, Yaacov; Abdurakhmanov, Dzhamal; Shafran, Stephen; Thabut, Dominique; Bruck, Rafael; Gadano, Adrian; Thompson, Alexander James; Kopit, Justin; McPhee, Fiona; Michener, Tracy; Hughes, Eric A; Yin, Philip D; Noviello, Stephanie

    2016-01-01

    AIM: To evaluate daclatasvir vs telaprevir, each combined with peginterferon alfa-2a/ribavirin (pegIFN/RBV), in treatment-naive hepatitis C virus (HCV) genotype (GT) 1-infected patients. METHODS: In this phase 3, randomized, open-label, noninferiority study, 602 patients were randomly assigned (2:1) to daclatasvir vs telaprevir, stratified by IL28B rs12979860 host genotype (CC vs non-CC), cirrhosis status (compensated cirrhosis vs no cirrhosis), and HCV GT1 subtype (GT1a vs GT1b). Patients were selected by study inclusion criteria from a total of 793 enrolled patients. Patients received daclatasvir 60 mg once daily or telaprevir 750 mg 3 times daily plus pegIFN/RBV. Daclatasvir recipients received 24 wk of daclatasvir plus pegIFN/RBV; those without an extended rapid virologic response (eRVR; undetectable HCV-RNA at weeks 4 and 12) received an additional 24 wk of pegIFN/RBV. Telaprevir-treated patients received 12 wk of telaprevir plus pegIFN/RBV followed by 12 (with eRVR) or 36 (no eRVR) wk of pegIFN/RBV. The primary objective was to compare for noninferiority of sustained virologic response rates at posttreatment week 12 (SVR12) in GT1b-infected patients. Key secondary objectives were to demonstrate that the rates of anemia (hemoglobin < 10 g/dL) and rash-related events, through week 12, were lower with daclatasvir + pegIFN/RBV than with telaprevir + pegIFN/RBV among GT1b-infected patients. Resistance testing was performed using population-based sequencing of the NS5A region for all patients at baseline, and for patients with virologic failure or relapse and HCV-RNA ≥ 1000 IU/mL, to investigate any link between NS5A polymorphisms associated with daclatasvir resistance and virologic outcome. RESULTS: Patient demographics and disease characteristics were generally balanced across treatment arms; however, there was a higher proportion of black/African Americans in the daclatasvir groups (6.0% and 8.2% in the GT1b and GT1a groups, respectively) than in the

  4. Regulation of PI-2b Pilus Expression in Hypervirulent Streptococcus agalactiae ST-17 BM110

    Science.gov (United States)

    du Merle, Laurence; Rosinski-Chupin, Isabelle; Gominet, Myriam; Bellais, Samuel; Poyart, Claire; Trieu-Cuot, Patrick

    2017-01-01

    The widely spread Streptococcus agalactiae (also known as Group B Streptococcus, GBS) “hypervirulent” ST17 clone is strongly associated with neonatal meningitis. The PI-2b locus is mainly found in ST17 strains but is also present in a few non ST17 human isolates such as the ST-7 prototype strain A909. Here, we analysed the expression of the PI-2b pilus in the ST17 strain BM110 as compared to the non ST17 A909. Comparative genome analyses revealed the presence of a 43-base pair (bp) hairpin-like structure in the upstream region of PI-2b operon in all 26 ST17 genomes, which was absent in the 8 non-ST17 strains carrying the PI-2b locus. Deletion of this 43-bp sequence in strain BM110 resulted in a 3- to 5-fold increased transcription of PI-2b. Characterization of PI-2b promoter region in A909 and BM110 strains was carried out by RNAseq, primer extension, qRT-PCR and transcriptional fusions with gfp as reporter gene. Our results indicate the presence of a single promoter (Ppi2b) with a transcriptional start site (TSS) mapped 37 bases upstream of the start codon of the first PI-2b gene. The large operon of 16 genes located upstream of PI-2b codes for the group B carbohydrate (also known as antigen B), a major constituent of the bacterial cell wall. We showed that the hairpin sequence located between antigen B and PI-2b operons is a transcriptional terminator. In A909, increased expression of PI-2b probably results from read-through transcription from antigen B operon. In addition, we showed that an extended 5’ promoter region is required for maximal transcription of gfp as a reporter gene in S. agalactiae from Ppi2b promoter. Gene reporter assays performed in Lactococcus lactis strain NZ9000, a related non-pathogenic Gram-positive species, revealed that GBS-specific regulatory factors are required to drive PI-2b transcription. PI-2b expression is up-regulated in the BM110ΔcovR mutant as compared to the parental BM110 strain, but this effect is probably indirect

  5. Efecto de enzimas proteolíticas y de la abstinencia sexual en la cuantificación bioquímica de alfa-glucosidasa en plasma seminal humano

    OpenAIRE

    2001-01-01

    Background: alpha-glucosidase is found in human seminal plasma as an acid form, located in accessory glands, and as a neutral form secreted almost exclusively by the epididymis. Quantification of alpha-glucosidase activity is a marker of the secretory function of the epididymis and indemnity of the sperm transport pathway Aim: To obtain reference values for alpha-glucosidase in normal samples of seminal plasma, to evaluate its behavior in serial samples and to determine the effect of proteoly...

  6. Determination of total alpha and beta activity in water for human consumption by LSC(Liquid Scintillation Counter); Determinacao de atividades alfa e beta total em agua para consumo humano por LSC (Contador de Cintilacao Liquida))

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-07-01

    The Ordinance Brazilian of Ministry of Health (MS 2914/2011) establishes the standards for quality of water intended for human consumption, being limits values of 5.0 Bq/L for gross alpha, and 1.0 Bq/L for gross beta radioactivity. The liquid scintillation spectrometry (LSC) technique has been presented as an alternative to conventional procedure using gas flow proportional counter. The present work shows a review of the methods for determination of gross alpha and gross beta in water by using LSC. Between the factors that influence the accuracy and repeatability of the analytical results we can highlight: thermal preconcentration, type of the acid and calibration standard. A procedure was established and carried out to samples of the National Program of Intercomparison of Radionuclides in Environmental Samples for evaluation of its performance. The gross alpha and gross beta analysis in samples of the public water supplies in the Metropolitan Region of Goiania, state of Goias was carried out. The results are consistent with the guideline values form the Ministry of Health concerning radioactivity. (author)

  7. Cidadania e feminismo no reconhecimento dos direitos humanos das mulheres

    OpenAIRE

    2012-01-01

    Este artigo examina ações de cidadania e de proteção dos direitos humanos das mulheres. Aborda a articulação global de movimentos de mulheres e feministas e o seu impacto na configuração de acordos internacionais e agendas públicas nacionais nos três últimos decênios. A análise busca a conexão entre estudos feministas, de gênero e de capital social para refletir sobre os padrões de inserção política feminina nos âmbitos mundial e brasileiro, avaliar os sentidos e significados dessa participaç...

  8. LA ÍNDOLE TECNOLÓGICA DEL SER HUMANO

    Directory of Open Access Journals (Sweden)

    José Luis del Barco Collazos

    2009-01-01

    Full Text Available La técnica no es accidental, sino esencial, al ser humano. Es el modo de vida del homo sapiens sapiens. No ha habido vida humana pretecnológica ni un periodo de la historia sin ella. Desde que el hombre puso los pies sobre la tierra empezó a fabricar instrumentos. Y seguirá fabricándolos. El arado, la aeronave y los ingenios técnicos del futuro son fases del progreso técnico. La asombrosa capacidad humana para fabricar se debe a la conexión entre las manos y el cerebro. La técnica no debe ser objeto de reverencia ni de temor pero sí debe ser gobernada.

  9. SEGURIDAD EN ACTIVOS DE INFORMACIÓN HUMANOS

    Directory of Open Access Journals (Sweden)

    Jorge Mario Cadavid-Aguirre

    2013-07-01

    Full Text Available Las empresas invierten grandes cantidades de dinero en estrategias de seguridad orientadas al control tecnológico: Antivirus, FireWall, Cifrado, IPS, IDS , pero a pesar de todos esos esfuerzos siguen siendo vulneradas. El problema radica en que dichas tecnologías no cubren el activo que más interactúa con la información; El ser humano. Está ponencia tuvo como objetivo concientizar al usuario final, hacerle ver la importancia de sus hábitos y comportamientos para mantener niveles seguros en su información sensible tanto empresarial como personal. Al final de la charla, se realizaron laboratorios prácticos con el fin de mostrar cómo operan los ciberdelincuentes y las técnicas de hacking más comunes de ataque al usuario final.

  10. Efectividad de la vacuna contra el virus del papiloma humano

    OpenAIRE

    2016-01-01

    El Virus del Papiloma Humano (VPH) es el causante de una infección de trasmisión sexual de gran relevancia debido a las graves lesiones que puede ocasionar. El cáncer de cérvix representa el sexto tumor maligno más frecuente a nivel mundial. En España, en los últimos años se ha producido un aumento de mujeres que presentan infección por el VPH, lo que implica que hay un mayor riesgo de padecer cáncer de cérvix, representando en la actualidad el 10% de los cánceres que afectan a la mujer. La O...

  11. O capital humano e o desenvolvimento econômico

    Directory of Open Access Journals (Sweden)

    Beatriz Maria Witkowski

    2007-07-01

    Full Text Available Um ambiente competitivo de negócios é decorrência cada vez maior de uma administração eficaz do capital humano. Estrutura, tecnologia, recursos financeiros e materiais são aspectos meramente físicos e inertes que precisam ser administrados inteligentemente por meio das pessoas que constituem a organização. A Teoria do Capital Humano é uma derivação da Teoria Econômica Neoclássica e, ao mesmo tempo, uma atualização, do axioma liberal do indivíduo livre, soberano e racional. Ressurgiu com a crise do modelo tayloris ta-fordis ta, associada à redefinição das relações de trabalho na empresa e do papel do sistema educacional. A qualidade dos funcionários de uma organização, seus conhecimentos e habilidades, entusiasmo e satisfação com seus cargos, seu senso de iniciativa para gerar riqueza, tudo isso tem forte impacto na produtividade da organização, no nível de serviço ao cliente, na reputação e na competitividade. Para qualquer que seja a área empresarial escolhida, o futuro administrador necessita ter uma visão sobre como lidar com assuntos relacionados com pessoas para alcançar o seu sucesso profissional e levar a sua organização rumo à excelência e à competitividade. Em seu conjunto, as pessoas constituem o capital humano da organização. Esse capital pode valer mais ou valer menos, na medida em que contenha talentos capazes de agregar valor à organização e torná-la mais ágil e competitiva. Portanto, esse capital vale mais na medida em que consiga influenciar as ações e os destinos da organização. A era da informação torna o trabalho menos físico e mais mental, pois as pessoas deixaram de ser fornecedoras de mão-de-obra para serem alçadas à categoria de fornecedoras de conhecimento e de competências. Do mesmo modo que o capital humano é relevante para a sociedade e para as organizações, observa-se que o desenvolvimento econômico também possui um papel de suma importância. Define

  12. El Recurso Humano frente a la Globalización

    OpenAIRE

    Aguilar Zuluaga, Ignacio

    2003-01-01

    El panorama mundial y en particular el panorama de los negocios viene cambiando rápidamente. El acelerador de hoy no es diferente al concepto y a la realidad de la globalización. La globalización dió termino a los conceptos de producción; empresa; inversión que venían del siglo pasado. Ese fenómeno obliga a fijarse en el factor que siempre permanece y que no es diferente al factor humano.De ahí que la gestión humana tome cada día mayor importancia y que para poder sobrevivir dentro de ...

  13. Desarrollo humano y crecimiento económico en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Gualdrón Guerrero

    2011-01-01

    Full Text Available En el presente artículo se hace un análisis de la relación desarrollo humano y crecimiento económico en Colombia. Para ello, adaptamos a escala regional los métodos de estudio propuestos durante los últimos años por Ranis, Stewart y Ramírez en los que consideran la existencia de cuatro situaciones distintas en la relación entre ambas variables: círculos viciosos, círculos virtuosos, sesgos pro-crecimiento y sesgos pro-desarrollo. Previamente se estudia la relación en el ámbito mundial, con el objetivo de tener una visión más amplia de la misma que nos permita contextualizar el caso colombiano.

  14. ECONOMIA DOS RECURSOS HUMANOS: TEORIA E EVIDÊNCIAS

    Directory of Open Access Journals (Sweden)

    Andre Carraro

    2014-12-01

    Full Text Available Este trabalho tem como objetivo discutir as diversas contribuições dadas ao longo das últimas décadas à economia dos recursos humanos, uma área de crescente destaque tanto entre a comunidade acadêmica, quanto entre empresários e trabalhadores. Discutem-se os diversos tópicos que compõem as abrangentes relações empresariais, estabelecidos na literatura em quatro tópicos principais: treinamento, incentivos, organização e seleção de pessoas. É feita uma análise dos principais artigos e autores de cada uma dessas subáreas, com o intuito principal de facilitar o acesso à informação, apontar caminhos para novas pesquisas e incentivar potenciais pesquisadores.

  15. Comportamiento Organizacional del Talento Humano en las Instituciones Educativas

    Directory of Open Access Journals (Sweden)

    Margareth Genesi

    2011-04-01

    Full Text Available La investigación, tuvo como objetivo general analizar el comportamiento organizacional del talento humano en las instituciones educativas del Municipio Cabimas. Se fundamentó en las teorías de Robbins (2004, Schermerhorm (2007 y Alles (2007. Fue analítica-descriptiva de campo, diseño no experimental-transeccional. La población constó de 60 sujetos. La técnica utilizada para recabar información fue la observación por encuesta. Los resultados indicaron que la capacitación y la estructura son aplicadas en forma positiva, que la personalidad y el cambio organizacional son escasos, por lo que se debe hacer un esfuerzo para proporcionar al gerente y al docente el mejoramiento en estas habilidades.

  16. Data of evolutionary structure change: 1BEDA-2B6MA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BEDA-2B6MA 1BED 2B6M A A AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTF---...HHHHHHHHHH EEEE EEEEE HHHHHHHHHHHHHH - 0 1BED... A 1BEDA HCNTF---E...e> ALA CA 306 SER CA 272 1BED... A 1BEDA HTLRKPPKDEQ

  17. The SH2B1 obesity locus and abnormal glucose homeostasis

    DEFF Research Database (Denmark)

    Prudente, S; Copetti, M; Morini, E

    2013-01-01

    affecting risk of obesity and insulin resistance might also modulate risk of T2D. Recently, 32 loci have been associated with body mass index (BMI) by genome-wide studies, including one locus on chromosome 16p11 containing the SH2B1 gene. Animal studies have suggested that SH2B1 is a physiological enhancer...

  18. Preparation and application of hydroxyapatite(HA) nanoparticles/NR2B-siRNA complex

    Institute of Scientific and Technical Information of China (English)

    YANG Hui; HUANG Dong; ZHU Shai-hong; YAN Xue-bin; GU Yong-hong; YAN Hui; WU Li-xiang

    2008-01-01

    Hydroxyapatite(HA) nanoparticles were prepared by coprecipitation-hydrothermal synthesis and their exosyndrome was estimated via transmission electron microscopy. Agarose gel electrophoresis and ultraviolet spectrophotometry were used to evaluate the ability of HA to bind NR2B-siRNA at different pH values and at different HA-NR2B-siRNA ratios. And the stability of the complex in saline was also evaluated. The effect of HA/NR2B-siRNA complex on chronic inflammatory pain was evaluated in vivo in mice. Transmission electron microscopy(TEM) reveals that HA nanoparticles are thin strips or short rod in shape and the one-dimensional particle size of HA nanoparticles is 40-50 nm. Under the acid or neutral condition, the Zeta potential of HA is positive; nanoparticles can completely bind NR2B-siRNA when the HA:NR2B-siRNA ratio is at or larger than 35-1; while under the alkaline condition, the affinity of HA to NR2B-siRNA is rather weak. HA/NR2B-siRNA complex is not dissociated when being resuspended in saline. The nociception of the tonic phase induced by formalin is significantly reduced in the HA/NR2B-siRNA treated mice as compared with the controls. Therefore, HA may be a new siRNA nano-vector material.

  19. SRC Inhibition Reduces NR2B Surface Expression and Synaptic Plasticity in the Amygdala

    Science.gov (United States)

    Sinai, Laleh; Duffy, Steven; Roder, John C.

    2010-01-01

    The Src protein tyrosine kinase plays a central role in the regulation of N-methyl-d-aspartate receptor (NMDAR) activity by regulating NMDAR subunit 2B (NR2B) surface expression. In the amygdala, NMDA-dependent synaptic plasticity resulting from convergent somatosensory and auditory inputs contributes to emotional memory; however, the role of Src…

  20. Smoking, alcoholism and genetic polymorphisms alter CYP2B6 levels in human brain.

    Science.gov (United States)

    Miksys, Sharon; Lerman, Caryn; Shields, Peter G; Mash, Deborah C; Tyndale, Rachel F

    2003-07-01

    CYP2B6 metabolizes drugs such as nicotine and bupropion, and many toxins and carcinogens. Nicotine induces CYP2B1 in rat brain and in humans polymorphic variation in CYP2B6 affects smoking cessation rates. The aim of this study was to compare CYP2B6 expression in brains of human smokers and non-smokers and alcoholics and non-alcoholics (n=26). CYP2B6 expression was brain region-specific, and was observed in both neurons and astrocytes. CYP2B6 levels were higher in brains of smokers and alcoholics, particularly in cerebellar Purkinje cells and hippocampal pyramidal neurons, cells known to be damaged in alcoholics. Significantly more (penzyme levels, stability and activity. Preliminary genotyping of this small sample (n=24) suggested that individuals with the CC genotype had higher brain CYP2B6 than those with the CT or TT genotype. Higher brain CYP2B6 activity in smokers and alcoholics may cause altered sensitivity to centrally acting drugs, increased susceptibility to neurotoxins and carcinogenic xenobiotics and contribute to central tolerance to nicotine.

  1. Noncanonical sortase-mediated assembly of pilus type 2b in group B Streptococcus.

    Science.gov (United States)

    Lazzarin, Maddalena; Cozzi, Roberta; Malito, Enrico; Martinelli, Manuele; D'Onofrio, Mariapina; Maione, Domenico; Margarit, Immaculada; Rinaudo, C Daniela

    2015-11-01

    Group B Streptococcus (GBS) expresses 3 structurally distinct pilus types (1, 2a, and 2b) identified as important virulence factors and vaccine targets. These pili are heterotrimeric polymers, covalently assembled on the cell wall by sortase (Srt) enzymes. We investigated the pilus-2b biogenesis mechanism by using a multidisciplinary approach integrating genetic, biochemical, and structural studies to dissect the role of the 2 pilus-2b-associated Srts. We show that only 1 sortase (SrtC1-2b) is responsible for pilus protein polymerization, whereas the second one (Srt2-2b) does not act as a pilin polymerase, but similarly to the housekeeping class A Srt (SrtA), it is involved in cell-wall pilus anchoring by targeting the minor ancillary subunit. Based on its function and sequence features, Srt2-2b does not belong to class C Srts (SrtCs), nor is it a canonical member of any other known family of Srts. We also report the crystal structure of SrtC1-2b at 1.9 Å resolution. The overall fold resembles the typical structure of SrtCs except for the N-terminal lid region that appears in an open conformation displaced from the active site. Our findings reveal that GBS pilus type 2b biogenesis differs significantly from the current model of pilus assembly in gram-positive pathogens.

  2. Genetics Home Reference: RRM2B-related mitochondrial DNA depletion syndrome, encephalomyopathic form with renal ...

    Science.gov (United States)

    ... Munnich A, Rötig A. Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion. Nat Genet. 2007 Jun;39(6):776-80. Epub 2007 May 7. Citation on PubMed GeneReview: RRM2B-Related Mitochondrial Disease Pontarin G, Ferraro P, Bee L, Reichard P, ...

  3. First identification of Porcine Circovirus Type 2b mutant in pigs from Uruguay.

    Science.gov (United States)

    Ramos, Natalia; Mirazo, Santiago; Castro, Gustavo; Arbiza, Juan

    2015-07-01

    Porcine Circovirus Type 2 (PCV2) is a worldwide distributed virus and is considered an important emerging pathogen related to several distinct disease syndromes in pigs. PCV2 strains are classified into three genotypes: PCV2a, with five subtypes (2A-2E), PCV2b with three subtypes (1A-1C) and PCV2c, only found in Denmark. Recently, several reports suggested the circulation of newly emerging PCV2b mutants (mPCV2b) isolated from pigs with PCVAD in cases of suspected vaccine failure. In this work, we report for the first time the identification of mPCV2b in pigs from Uruguay, providing an additional evidence of a global circulation. Complete genome characterization and phylogenetic analysis reveal that Uruguayan strains, as well as mPCV2b previously reported are closely related to other sequences already classified as PCV2b-1C. Furthermore, results showed that mPCV2b presented different genetic markers in the capsid protein compared with classical PCV2a/b strains. Further investigation about antigenic shift of the mPCV2b strains including the Uruguayan isolates is needed.

  4. Data of evolutionary structure change: 1ANTI-2B4XL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-2B4XL 1ANT 2B4X I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE...Chain> 1ANT I 1ANTI AASTA----VVIA...14> 1ANT I 1ANTI...ntryChain> 1ANT I 1ANTI

  5. Fabrication Report for the AFC-2A and AFC-2B Capsule Irradiations in the ATR

    Energy Technology Data Exchange (ETDEWEB)

    Timothy A. Hyde

    2007-10-01

    This document provides a general narrative description of the AFC-2A and 2B fuel fabrication processes for the AFC 2A and AFC 2B fuel irradiation experiments fabricated at the Idaho National Laboratory’s Materials and Fuels Complex (MFC) for irradiation in the Advanced Test Reactor (ATR).

  6. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2010 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  7. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2011

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2011 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  8. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2012

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2012 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  9. A Decompositional Approach to Executing Quality Data Model Algorithms on the i2b2 Platform

    Science.gov (United States)

    Mo, Huan; Jiang, Guoqian; Pacheco, Jennifer A.; Kiefer, Richard; Rasmussen, Luke V.; Pathak, Jyotishman; Denny, Joshua C.; Thompson, William K.

    2016-01-01

    The Quality Data Model (QDM) is an established standard for representing electronic clinical quality measures on electronic health record (EHR) repositories. The Informatics for Integrated Biology and the Bedside (i2b2) is a widely used platform for implementing clinical data repositories. However, translation from QDM to i2b2 is challenging, since QDM allows for complex queries beyond the capability of single i2b2 messages. We have developed an approach to decompose complex QDM algorithms into workflows of single i2b2 messages, and execute them on the KNIME data analytics platform. Each workflow operation module is composed of parameter lists, a template for the i2b2 message, an mechanism to create parameter updates, and a web service call to i2b2. The communication between workflow modules relies on passing keys ofi2b2 result sets. As a demonstration of validity, we describe the implementation and execution of a type 2 diabetes mellitus phenotype algorithm against an i2b2 data repository. PMID:27570665

  10. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2009

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2009 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  11. Doc2b synchronizes secretion from chromaffin cells by stimulating fast and inhibiting sustained release

    DEFF Research Database (Denmark)

    da Silva Pinheiro, Paulo César; de Wit, Heidi; Walter, Alexander M;

    2013-01-01

    is still high. We conclude that Doc2b acts to inhibit vesicle priming during prolonged calcium elevations, thus protecting unprimed vesicles from fusing prematurely, and redirecting them to refill the readily releasable pool after relaxation of the calcium signal. In sum, Doc2b favors fast, synchronized...

  12. Valores humanos y voluntariado: Un estudio en personas mayores

    Directory of Open Access Journals (Sweden)

    Antonio Ariza-Montes

    2017-02-01

    Diseño/metodología: Tras un análisis exploratorio inicial, se plantea un modelo de regresión logística para determinar en qué medida el catálogo de valores personales que posee un individuo ayuda a explicar la actividad de voluntariado entre las personas mayores. Aportaciones y resultados: Los resultados del modelo permiten afirmar que el hecho de que una persona mayor done o no tiempo a actividades de voluntariado puede ser satisfactoriamente explicado por el conjunto de valores humanos. Los resultados obtenidos revelan que los voluntarios jubilados presentan mayor sentido de la autotrascendencia y predisposición hacia el cambio, a la vez que denotan más aversión hacia la autopromoción y la conservación. Implicaciones prácticas: Para mejorar el nivel de compromiso y la motivación de los voluntarios mayores jubilados, y afrontar con firmeza los retos que amenazan al sector no lucrativo, los responsables de los recursos humanos de las entidades del tercer sector deberán buscar la coherencia entre los valores individuales y la naturaleza de la actividad que va a desempeñar el voluntario, incrementando de este modo el grado de identificación de estas personas. Valor añadido: A pesar de la abundante literatura que relaciona el voluntariado en personas mayores con el bienestar, tanto en términos de salud como de beneficios socioemocionales, y con las motivaciones de este colectivo a la hora de ejercer el voluntariado, no es frecuente hallar investigaciones que adopten como foco de análisis el perfil de los valores personales que incitan a estos individuos a colaborar con causas altruistas.

  13. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama The role of estrogen receptor alpha in breast cancer cell proliferation mediated by progestins

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.In C4-HD murine mammary carcinomas and in human breast cancer T47D cells, we showed that medroxyprogesterone acetate (MPA induces a nuclear physical association between estrogen receptor alpha (ERa and progesterone receptors (PR. The blockade of ERa inhibits cell proliferation mediated by progestins. We hypothesized that this nuclear association between ERa/PR is necessary to trigger progestin-induced cell proliferation and tumor growth. We demonstrated that fulvestrant (FUL, ICI182.780 induced complete regression of C4-HD tumors growing with progestins. MPA treatment induced an early increase in both CCND1 and MYC expression in T47D cells. The blockade of ERa

  14. XO-2b: a Prograde Planet with a Negligible Eccentricity, and an Additional Radial Velocity Variation

    CERN Document Server

    Narita, Norio; Sato, Bun'ei; Harakawa, Hiroki; Fukui, Akihiko; Aoki, Wako; Tamura, Motohide

    2011-01-01

    We present precise radial velocities of XO-2 taken with the Subaru HDS, covering two transits of XO-2b with an interval of nearly two years. The data suggest that the orbital eccentricity of XO-2b is consistent with zero within 2$\\sigma$ ($e=0.045\\pm0.024$) and the orbit of XO-2b is prograde (the sky-projected spin-orbit alignment angle $\\lambda=10^{\\circ}\\pm72^{\\circ}$). The poor constraint of $\\lambda$ is due to a small impact parameter (the orbital inclination of XO-2b is almost 90$^{\\circ}$). The data also provide an improved estimate of the mass of XO-2b as $0.62\\pm0.02$ $M_{\\rm Jup}$. We also find a long-term radial velocity variation in this system. Further radial velocity measurements are necessary to specify the cause of this additional variation.

  15. Global view of transcriptome in the brains of aged NR2B transgenic mice*****

    Institute of Scientific and Technical Information of China (English)

    Chunxia Li; Men Su; Huimin Wang; Yinghe Hu

    2013-01-01

    NR2B subunits are involved in regulating aging, in particular, age-related learning and memory deficits. We examined 19-month-old NR2B transgenic mice and their littermate controls. First, we detected expression of the NR2B subunit gene, Grin2b, in the neocortex of transgenic mice using real-time PCR. Next, we used microarrays to examine differences in neocortical gene expression. Pathway and signal-net analyses identified multiple pathways altered in the transgenic mice, in-cluding the P53, Jak-STAT, Wnt, and Notch pathways, as wel as regulation of the actin cytoskeleton and neuroactive ligand-receptor interactions. Further signal-net analysis highlighted the P53 and insulin-like growth factor pathways as key regulatory pathways. Our results provide new insight into understanding the molecular mechanisms of NR2B regulated age-related memory storage, normal organismal aging and age-related disease.

  16. RET(MEN 2B) is active in the endoplasmic reticulum before reaching the cell surface.

    Science.gov (United States)

    Runeberg-Roos, P; Virtanen, H; Saarma, M

    2007-12-13

    MEN 2B (multiple endocrine neoplasia type 2B) is an autosomal dominant cancer syndrome caused by an oncogenic form of the receptor tyrosine kinase REarranged during transfection (RET). The MEN 2B syndrome is associated with an abnormal autophosphorylation of the mutated receptor even without ligand-stimulation. Here, we characterize the activation of a RET(MEN 2B) variant carrying the point mutation Met918Thr, and show that the 150 kDa precursor of RET(MEN 2B) becomes phosphorylated already during synthesis in the endoplasmic reticulum (ER). At least three different tyrosine residues (Tyr905, Tyr1062, Tyr1096) of the RET(MEN 2B) precursor are phosphorylated before the oncogenic receptor reaches the cell surface. We also demonstrate that the precursor of RET(MEN 2B) interacts with both growth factor receptor-bound protein and Src homology 2 domain-containing already in the ER, and that this interaction is dependent on the kinase activity of RET. With the aid of two RET mutants (RET(MEN 2B/S32L) and RET(MEN 2B/F393L)), which accumulate in the ER, we show that the oncogenic precursor of the receptor has the capacity to activate AKT, extracellular signal-regulated kinase and signal transducer and activator of transcription 3 from the ER. Taken together, our data demonstrate that the oncogenic precursor of RET(MEN 2B) is phosphorylated, interacts with adapter proteins and induces downstream signalling from the ER.

  17. Interferon-alpha-2b induces autophagy in hepatocellular carcinoma cells through Beclin1 pathway

    Institute of Scientific and Technical Information of China (English)

    Jun Zhao; Ming-Li Wang; Zeng Li; Dong-Mei Gao; Yu Cai; Jun Chang; Shi-Ping Wang

    2014-01-01

    Objective:To determine whether Interferon-alpha-2b (IFN-α2b) can modulate the autophagic response in hepatocellular carcinoma cells. Methods:Hepatocellular carcinoma cells were treated with IFN-α2b. Autophagy was assessed by acridine orange staining, GFP-LC3 dotted assay, transmission electron microscopy and immunoblotting. Results:Acridine orange staining showed that IFN-α2b triggered the accumulation of acidic vesicular and autolysosomes in HepG2 cells. hTe acridine orange HepG2 cell ratios were (4.3±1.0)%, (6.9±1.4)%, and (13.1±2.3)%, respectively, atfer treatment with 100, 1,000, and 10,000 IU/mL IFN-α2b for 48 h. A markedly punctate pattern was observed in HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h, but only diffuse and weakly lfuorescent GFP-LC3 puncta was observed in control cells. HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h developed autophagosome-like characteristics, including single-or double-membrane vacuoles containing intact and degraded cellular debris. The Beclin1 and LC3-II protein expression was up-regulated by IFN-α2b treatment. Conclusion:Autophagy can be induced in a dose-dependent manner by treatment with IFN-α2b in HepG2 cells, and the Beclin1 signaling pathway was stimulated by IFN-α2b.

  18. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida.

    Directory of Open Access Journals (Sweden)

    Jael R Malenke

    Full Text Available Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida, we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B. We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma or creosote bush (Larrea tridentata, plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a

  19. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida).

    Science.gov (United States)

    Malenke, Jael R; Magnanou, Elodie; Thomas, Kirk; Dearing, M Denise

    2012-01-01

    Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida), we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B). We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma) or creosote bush (Larrea tridentata), plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a wild mammalian

  20. Elementos regulatórios responsáveis pelo controle da estabilidade do mRNA de alfa tubulina de Trypanosoma cruzi

    OpenAIRE

    Patricia Rosa de Araujo

    2007-01-01

    Um mecanismo de auto-regulação dos mRNAs de alfa e beta tubulina em Trypanosoma cruzi afeta a meia vida desses transcritos ao longo do ciclo de vida do parasita. Enquanto epimastigotas apresentam altos níveis dos mRNAs de tubulina, um excesso da proteína não polimerizada em amastigotas está relacionada com o decréscimo dos níveis dos seus mRNAs. Esta diminuição não é resultado de mudanças na transcrição e sim devido a redução da meia vida dos mRNAs de alfa e beta tubulina. Através do tratamen...

  1. Migrantes deportados: entre la concepción de los desechos humanos y la de los derechos humanos

    OpenAIRE

    Joaquín A. Mejía R.

    2011-01-01

    La crisis económica mundial está provocando una crisis de los valores democráticos en las sociedades del Norte cuando se trata de abordar el fenómeno migratorio.Cada vez más los Estados de Europa y Estados Unidos ven en la migración un asunto que se desecha cuando ya no es útil ni rentable y los derechos humanos de los inmigrantes son sacrificados en el altar de la seguridad nacional, del orden público y de la recesión económica. De esta manera, en nombre de su soberanía, los Estadosaplican p...

  2. Assessment of the Results of the Multicenter Randomized Acute Leukemia French Association (ALFA) 9803 Trial%法国急性白血病协会(ALFA)9803多中心随机临床试验结果的评价

    Institute of Scientific and Technical Information of China (English)

    江滨; 凌伟

    2009-01-01

    @@ 1文献来源 Gardin C, Turlure P, Fagot T, et al. Postremission treatment of elderly patients with acute myeloid leukemia in first complete remission after intensive induction chemotherapy: Results of the multicenter randomized Acute Leukemia French Association (ALFA) 9803 trial [J]. Blood, 2007, 109(12) : 5129-5135.

  3. Characterization of the A2B adenosine receptor from mouse, rabbit, and dog.

    Science.gov (United States)

    Auchampach, John A; Kreckler, Laura M; Wan, Tina C; Maas, Jason E; van der Hoeven, Dharini; Gizewski, Elizabeth; Narayanan, Jayashree; Maas, Garren E

    2009-04-01

    We have cloned and pharmacologically characterized the A(2B) adenosine receptor (AR) from the dog, rabbit, and mouse. The full coding regions of the dog and mouse A(2B)AR were obtained by reverse transcriptase-polymerase chain reaction, and the rabbit A(2B)AR cDNA was obtained by screening a rabbit brain cDNA library. It is noteworthy that an additional clone was isolated by library screening that was identical in sequence to the full-length rabbit A(2B)AR, with the exception of a 27-base pair deletion in the region encoding amino acids 103 to 111 (A(2B)AR(103-111)). This 9 amino acid deletion is located in the second intracellular loop at the only known splice junction of the A(2B)AR and seems to result from the use of an additional 5' donor site found in the rabbit and dog but not in the human, rat, or mouse sequences. [(3)H]3-Isobutyl-8-pyrrolidinoxanthine and 8-[4-[((4-cyano-[2,6-(3)H]-phenyl)carbamoylmethyl)oxy]phenyl]-1,3-di(n-propyl)xanthine ([(3)H]MRS 1754) bound with high affinity to membranes prepared from human embryonic kidney (HEK) 293 cells expressing mouse, rabbit, and dog A(2B)ARs. Competition binding studies performed with a panel of agonist (adenosine and 2-amino-3,5-dicyano-4-phenylpyridine analogs) and antagonist ligands identified similar potency orders for the A(2B)AR orthologs, although most xanthine antagonists displayed lower binding affinity for the dog A(2B)AR compared with A(2B)ARs from rabbit and mouse. No specific binding could be detected with membranes prepared from HEK 293 cells expressing the rabbit A(2B)AR(103-111) variant. Furthermore, the variant failed to stimulate adenylyl cyclase or calcium mobilization. We conclude that significant differences in antagonist pharmacology of the A(2B)AR exist between species and that some species express nonfunctional variants of the A(2B)AR due to "leaky" splicing.

  4. Hermenéutica de los derechos humanos en la obra de Ana Luisa Guerrero

    Directory of Open Access Journals (Sweden)

    Orlando Inocencio Aguirre Martínez

    2015-06-01

    Full Text Available La obra de Ana Luisa Guerrero se caracteriza por su abordaje filosófico-político sobre los derechos humanos y su aplicación. Su hermenéutica intercultural, dirigida, principalmente, a los derechos humanos de tercera generación, identifica el componente de la intersubjetividad que encamina hacia la construcción de un diálogo intercultural. Este componente permite, además, discutir sobre los fundamentos de los derechos humanos colocando las percepciones individuales y colectivas del paradigma.

  5. Proyecto reencuentro : la educación ambiental, la ética y el desarrollo humano

    OpenAIRE

    2001-01-01

    Tésis de grado (Maestría en Pedagogías Activas y Desarrollo Humano). Centro Internacional de Educación y Desarrollo humano -Cinde-Universidad de Manizales. Facultad de Ciencias Sociales y Humanas, 2001. El mejoramiento de la calidad de la Educación Ambiental se cimenta en la construcción de una estrategia metodológica de planeamiento curricular, mediante un enfoque holístico, sistémico e interdisciplinario, encaminado al desarrollo humano integral para la formación en los individuos ...

  6. Teoría Socialista de los Derechos Humanos Socialist Theory of Human Rights

    OpenAIRE

    Antonio Salamanca Serrano

    2011-01-01

    Este artículo presenta los principales postulados de la Teoría Socialista de los Derechos Humanos (TSDH), aplicación al ámbito de los Derechos Humanos del trabajo Teoría Socialista del Derecho, 2 vols. (Quito: Editorial Jurídica del Ecuador, 2011). Postulados científicos de un nuevo paradigma en Teoría de los Derechos Humanos que se somete a probación y verificación  histórica. La TSDH es un paradigma iusmaterialista que tiene sus diferencias con el iusnaturalismo, con el socio-contractualism...

  7. Derechos humanos y criminología: un vínculo ignorado

    OpenAIRE

    2002-01-01

    Este trabajo busca analizar algunas contradicciones presentes en el discurso de los derechos humanos, y cuestionar la visión cronológica generalmente aceptada, que lleva a algunos autores a suponer que existe sólo un discurso sobre los derechos humanos. La breve revisión sobre la génesis y el desarrollo histórico de dicho discurso tiene por objeto discutir una nueva tipologia que permita distinguir y estudiar los diferentes discursos sobre derechos humanos que hoy se utiliz...

  8. Impacto del Capital Humano en la Distribución del Ingreso

    OpenAIRE

    2005-01-01

    El siguiente trabajo investigó el impacto del capital humano en la distribución del ingreso. El capital humano se mide a partir de su distribución y de su desviación estándar, es decir, a partir de su medida relativa y absoluta. Partiendo del modelo teórico del capital humano desarrollado por Gary Becker (1966), a medida que varía la desigualdad de la educación y su distribución, su impacto en la distribución del ingreso no será necesariamente un impacto negativo. Se enco...

  9. La seguridad en la aviación depende de los factores humanos

    Directory of Open Access Journals (Sweden)

    Esperanza Lozano Alvernia

    2008-01-01

    Full Text Available En este articulo se hace un abordaje se.ncil lo de lo que significan los factores humanos para la seguridad en la aviación visto desde la ca lidad integral, de ahí que se hace una reflexión de lo que implica la calidad en las instituciones para partir de este concepto y desarrollar los aspectos de los factores humanos, de las disciplinas que orientan el estudio de los factores huma.nos, y el entrenamiento que debe recibir la tripulación de vuelo según la OACI.

  10. ESTRATEGIA PARA INTEGRAR LA GESTIÓN DEL CAPITAL HUMANO A LA GESTIÓN EMPRESARIAL

    OpenAIRE

    Margarita Rodríguez Ariosa; Diana Salazar Fernández; Ileana Hernández Darias; Maria Sonia Fleitas Triana

    2010-01-01

    El artículo presenta el diseño e implementación de una estrategia para la integración de la gestión del capital humano a la estrategia empresarial, aplicada en el Grupo de la Construcción de Varadero y sus diez empresas en perfeccionamiento. La estrategia de gestión del capital humano parte de determinar fundamentos metodológicos que permitan desprender la concepción utilitaria de la gestión y responder a la interrogante de cómo perfeccionar la gestión del capital humano para que se integre m...

  11. La solución amistosa en el marco del Sistema Interamericano de Derechos Humanos

    OpenAIRE

    María Carolina Estepa

    2011-01-01

    En el Sistema Interamericano de Protección de los Derechos Humanos, se prevé que los litigios entre los Estados y las víctimas de violaciones de derechos humanos o sus representantes puedan resolverse a través de un acuerdo amistoso. En este arreglo, llevado a cabo ante los órganos regionales de protección de los derechos humanos, el Estado se somete por voluntad propia a un proceso de solución amistosa, que no implica per se un reconocimiento de responsabilidad internacional por parte suya, ...

  12. El administrador de recursos humanos como gestor de talento humano. Sus competencias y la relación de las prácticas de administración de recursos humanos

    OpenAIRE

    Ma. del Carmen Liquidano Rodríguez

    2006-01-01

    El objetivo general de este estudio fue identificar si el actual administrador de recursos humanos es un gestor del talento; asimismo, identificar las competencias y rasgos personales de su perfi, así como conocer si existe relación entre sus competencias cognitivas, conductuales y técnicas, y rasgos personales predominantes con las prácticas que aplica de la administración de recursos humanos; para llevar a cabo lo anterior, se analizan 28 prácticas. Este trabajo aporta al con...

  13. Impact of elosulfase alfa in patients with morquio A syndrome who have limited ambulation: An open-label, phase 2 study.

    Science.gov (United States)

    Harmatz, Paul R; Mengel, Eugen; Geberhiwot, Tarekegn; Muschol, Nicole; Hendriksz, Christian J; Burton, Barbara K; Jameson, Elisabeth; Berger, Kenneth I; Jester, Andrea; Treadwell, Marsha; Sisic, Zlatko; Decker, Celeste

    2017-02-01

    Efficacy and safety of elosulfase alfa enzyme replacement therapy (ERT) were assessed in an open-label, phase 2, multi-national study in Morquio A patients aged ≥5 years unable to walk ≥30 meters in the 6-min walk test. Patients received elosulfase alfa 2.0 mg/kg/week intravenously for 48 weeks. Efficacy measures were functional dexterity, pinch/grip strength, mobility in a modified timed 25-foot walk, pain, quality of life, respiratory function, and urine keratan sulfate (KS). Safety/tolerability was also assessed. Fifteen patients received elosulfase alfa, three patients discontinued ERT due to adverse events (two were grade 3 drug-related adverse events, the other was not drug-related), and two patients missed >20% of planned infusions; 10 completed treatment through 48 weeks and received ≥80% of planned infusions (Modified Per Protocol [MPP] population). The study population had more advanced disease than that enrolled in other trials. From baseline to week 48, MPP data showed biochemical efficacy (urine KS decreased 52.4%). The remaining efficacy results were highly variable due to challenges in test execution because of severe skeletal and joint abnormalities, small sample sizes, and clinical heterogeneity among patients. Eight patients showed improvements in one or more outcome measures; several patients indicated improvements not captured by the study assessments (e.g., increased energy, functional ability). The nature of adverse events was similar to other elosulfase alfa studies. This study illustrates the considerable challenges in objectively measuring impact of ERT in very disabled Morquio A patients and highlights the need to examine results on an individual basis. © 2016 The Authors. American Journal of Medical Genetics Part A Published by Wiley Periodicals, Inc.

  14. A cost-effectiveness evaluation comparing originator follitropin alfa to the biosimilar for the treatment of infertility

    Directory of Open Access Journals (Sweden)

    Gizzo S

    2016-12-01

    Full Text Available Salvatore Gizzo,1 Juan A Garcia-Velasco,2 Franca Heiman,3 Claudio Ripellino,3 Klaus Bühler4 1Department of Woman and Child Health, University of Padua, Padua, Italy; 2Department of Obstetrics and Gynecology, Rey Juan Carlos University Madrid, Madrid, Spain; 3IMS Health Information Solutions Italy Srl, Milan, Italy; 4Centre for Gynaecology, Endocrinology, and Reproductive Medicine, Ulm and Stuttgart, Germany Objectives: To perform a cost-effectiveness evaluation comparing the originator follitropin alfa (Gonal-f® to the biosimilar (Bemfola® in the Italian and Spanish contexts, with an assessment of the German and UK backgrounds. Methods: Starting from the study by Rettenbacher et al, a cost-effectiveness model was developed in the Italian and Spanish contexts. Clinical data on subjects, doses of gonadotropin, pregnancies, live-born children, and ovarian hyperstimulation syndrome were used to feed the model. Costs related to drugs, hospitalizations, specialist visits, and examinations were retrieved from Italian and Spanish tariffs. Gonadotropin acquisition costs for Germany and the UK were also taken into account to expand the economical assessment to the other countries. The evaluation was done based on the National Health Service perspective. Sensitivity analyses, both univariate and probabilistic, as long as scenario analyses, tested the robustness of the model. Results: Originator follicle-stimulating hormone (FSH costs were €3,663 and €6,387 in Italy and Spain, respectively, whereas biosimilar FSH costs were €3,483 and €6,342. The efficacy was found to be 0.52 for the originator and 0.47 for the biosimilar. The average cost per live birth was estimated to be €7,044 and €12,283 for the originator FSH and €7,411 and €13,494 for the biosimilar for Italy and Spain, respectively. Furthermore, the originator FSH generated an incremental cost-effectiveness ratio of €3,600 for Italy and €900 for Spain compared to the

  15. The influence of VO2(B nanobelts on thermal decomposition of ammonium perchlorate

    Directory of Open Access Journals (Sweden)

    Zhang Yifu

    2015-09-01

    Full Text Available The influence of vanadium dioxide VO2(B on thermal decomposition of ammonium perchlorate (AP has not been reported before. In this contribution, the effect of VO2(B nanobelts on the thermal decomposition of AP was investigated by the Thermo- Gravimetric Analysis and Differential Thermal Analysis (TG/DTA. VO2(B nanobelts were hydrothermally prepared using peroxovanadium (V complexes, ethanol and water as starting materials. The thermal decomposition temperatures of AP in the presence of I wt.%, 3 wt.% and 6 wt.% of as-obtained VO2<B nanobelts were reduced by 39 °C. 62 °C and 74 °C, respectively. The results indicated that VO2(B nanobelts had a great influence on the thermal decomposition temperature of AP Furthermore, the influence of the corresponding V2Os, which was obtained by thermal treatment of VO2(B nanobelts, on the thermal decomposition of AP was also investigated. The resufs showed that VO2(B nanobelts had a greater influence on the thermal decomposition temperature of AP than that of V2Os.

  16. Differential role of SH2-B and APS in regulating energy and glucose homeostasis.

    Science.gov (United States)

    Li, Minghua; Ren, Decheng; Iseki, Masanori; Takaki, Satoshi; Rui, Liangyou

    2006-05-01

    SH2-B and APS, two members of a pleckstrin homology and SH2 domain-containing adaptor family, promote both insulin and leptin signaling in a similar fashion in cultured cells. In addition, APS mediates insulin-stimulated activation of the c-Cbl/CAP/TC10 pathway in cultured adipocytes. Here we characterized genetically modified mice lacking SH2-B, APS, or both to determine the physiological roles of these two proteins in animals. Disruption of the SH2-B gene resulted in obesity, hyperglycemia, hyperinsulinemia, and glucose intolerance. Conversely, deletion of the APS gene did not alter adiposity, energy balance, and glucose metabolism. Energy intake, energy expenditure, fat content, body weight, and plasma insulin, leptin, glucose, and lipid levels were similar between APS(-/-) and WT littermates fed either normal chow or a high-fat diet. Moreover, deletion of APS failed to alter insulin and glucose tolerance. APS(-/-)/SH2-B(-/-) double knockout mice also developed energy imbalance, obesity, hyperleptinemia, hyperinsulinemia, hyperglycemia, and glucose intolerance; however, plasma leptin and insulin levels were significantly lower in APS(-/-)/SH2-B(-/-) than in SH2-B(-/-) mice. These results suggest that SH2-B, but not APS, is a key positive regulator of energy and glucose metabolism in mice.

  17. Structural characterization and antiviral effect of a novel polysaccharide PSP-2B from Prunellae Spica.

    Science.gov (United States)

    Ma, Feng-Wei; Kong, Si-Yuan; Tan, Hong-Sheng; Wu, Rong; Xia, Bing; Zhou, Yan; Xu, Hong-Xi

    2016-11-05

    In the present study, a novel polysaccharide, PSP-2B, was isolated from aqueous extracts of Prunellae Spica by direct ultrafiltration membrane separation and gel chromatography purification. PSP-2B is a partially sulphated polysaccharide with a molecular weight of approximately 32kDa. Its sulfate content is 10.59% by elemental analysis. The major sugars comprising PSP-2B are arabinose, galactose and mannose, in addition to small amounts of glucose and uronic acids. The framework of PSP-2B is speculated to be a branched arabinogalactomannan, and the side chains are terminated primarily by the Araf residues. PSP-2B also contains 2.98% protein. PSP-2B exhibits activity against herpes simplex virus (HSV), with a half maximal inhibitory concentration (IC50) of approximately 69μg/mL for HSV-1 and 49μg/mL for HSV-2. However, PSP-2B demonstrated no cytotoxicity even when its concentration was increased to 1600μg/mL, suggesting that it has potential as an anti-HSV drug candidate.

  18. The A2B adenosine receptor modulates pulmonary hypertension associated with interstitial lung disease.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Zhong, Hongyan; Acero, Luis; Weng, Tingting; Melicoff, Ernestina; West, James D; Hemnes, Anna; Grenz, Almut; Eltzschig, Holger K; Blackwell, Timothy S; Xia, Yang; Johnston, Richard A; Zeng, Dewan; Belardinelli, Luiz; Blackburn, Michael R

    2012-06-01

    Development of pulmonary hypertension is a common and deadly complication of interstitial lung disease. Little is known regarding the cellular and molecular mechanisms that lead to pulmonary hypertension in patients with interstitial lung disease, and effective treatment options are lacking. The purpose of this study was to examine the adenosine 2B receptor (A(2B)R) as a regulator of vascular remodeling and pulmonary hypertension secondary to pulmonary fibrosis. To accomplish this, cellular and molecular changes in vascular remodeling were monitored in mice exposed to bleomycin in conjunction with genetic removal of the A(2B)R or treatment with the A(2B)R antagonist GS-6201. Results demonstrated that GS-6201 treatment or genetic removal of the A(2B)R attenuated vascular remodeling and hypertension in our model. Furthermore, direct A(2B)R activation on vascular cells promoted interleukin-6 and endothelin-1 release. These studies identify a novel mechanism of disease progression to pulmonary hypertension and support the development of A(2B)R antagonists for the treatment of pulmonary hypertension secondary to interstitial lung disease.

  19. Neutron diffraction studies of magnetic ordering in superconducting ErNi2B2C and TmNi2B2C in an applied magnetic field

    DEFF Research Database (Denmark)

    Toft, Katrine Nørgaard

    along [110], the magnetic structure rotates a small angle of 0.5 degrees away from the symmetrydirection. TmNi2B2C: A magnetic field applied in the [100] direction suppresses the zero field magnetic structure QF = (0.094,0.094,0) (TN = 1.6 K), in favor of the Fermi surface nesting structure QN = (0......The field-induced magnetic structures of ErNi2B2C and TmNi2B2C in are especially interesting because the field suppresses the superconducting order parameter and therefore the magnetic properties can be studied while varying the strength ofsuperconductivity. ErNi2B2C: For magnetic fields along all...... three symmetry directions, the observed magnetic structures have a period corresponding to the Fermi surface nesting structure. The phase diagrams present all the observed magnetic structures.Two results remain unresolved: 1. When applying the magnetic field along [010], the minority domain (QNB = (0,Q...

  20. Influence of wool and thermo-binder fibers relative fractions on the adhesion of non-woven Alfa fibers reinforced unsaturated polyester hybrid composites

    Science.gov (United States)

    Amin Omri, Med; Triki, A.; Ben Hassen, Med; Arous, M.; Bulou, A.

    2016-10-01

    Alfa/wool/thermo-binder fibers hybrid composites were investigated in order to analyze adhesion state. Bearing in mind the chemical structure of wool and thermo-binder fibers, this study revealed a good compatibility between the reinforcement and the matrix. Dielectric measurements revealed the presence of two dielectric relaxations in the composite. The first relaxation was attributed to the α mode relaxation and the second one was associated with the conductivity noted for high temperature. This study allowed the analysis of the interfacial polarization effect using the Havrilliak-Negami model in the electric modulus formalism. The lowness of this relaxation intensity revealed a good adhesion of the fibers in the matrix. Differential Scanning Calorimetry (DSC) showed a slow decrease of the Tg glass transition temperature compared to the matrix, which could be explained by the existence of interactions between the fibers and the matrix. Vibrational analysis, based on FTIR measurements, showed a less hydrophilic character of Alfa fibers owing to a basic dissociation that occurs between the wool fibers and the water molecules associated with Alfa fibers. Furthermore, adhesion mechanism in the composite material was established by covalent and hydrogen bonds. Tensile testing performed on this composite confirmed that such adhesion was improved by increasing the thermo-binder fibers relative fraction.