
Sample records for alfa 1 antitripsina

  1. Deficiência de alfa-1 antitripsina: diagnóstico e tratamento



    A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que de...

  2. Deficiência de alfa-1-antitripsina na doença pulmonar obstrutiva crónica



    Introdução – A deficiência de alfa-1-antitripsina é uma das alterações genéticas graves encontradas por todo o mundo. Porém, permanece subdiagnosticada, apesar da forte predisposição à doença pulmonar obstrutiva crónica que condiciona. Objectivos – Os objectivos deste artigo de revisão incluem o estudo e avaliação das implicações da deficiência de alfa-1-antitripsina em indivíduos com doença pulmonar obstrutiva crónica, a apresentação dos esquemas de diagnóstico e terapêuticos mais utiliza...

  3. Tratamento de reposição na deficiência de alfa-1-antitripsina em doentes com enfisema pulmonar



    A doença pulmonar obstrutiva crónica é uma das principais causas de incapacidade respiratória e a quarta causa de morte em todo o Mundo, sendo mais frequente no sexo masculino. A exposição ao fumo do tabaco é considerada o principal fator de risco ambiental, no entanto, existem outros fatores igualmente importantes como, por exemplo, a deficiência de alfa-1-antitripsina, a única desordem genética conhecida associada a esta patologia até aos dias de hoje. Esta enzima é maioritariamente produzi...

  4. Analise dos alelos S e Z da alfa 1 antitripsina em uma amostra de pacientes fibrocisticos



    A fibrose cística é uma alteração genética que cursa principalmente com manifestações pulmonares e pancreáticas. A correlação genótipo-fenótipo da fibrose cística é motivo de árduos estudos. Somente a correlação com a insuficiência pancreática foi encontrada. Percebeu-se, também, que o curso e a severidade da manifestação pulmonar não estão correlacionados com o genótipo CFTR. A alfaI antitripsina inibe as proteases que desencadeiam as reações inflamatórias do plasma. Seu papel inibitório mai...

  5. Deficiência de alfa-1 antitripsina: diagnóstico e tratamento Alpha-1 antitrypsin deficiency: diagnosis and treatment

    Directory of Open Access Journals (Sweden)

    Aquiles A Camelier


    Full Text Available A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que determina polimerização e acúmulo dentro dos hepatócitos. O acúmulo e a conseqüente redução dos níveis séricos de alfa-1 antitripsina determinam, respectivamente, doença hepática e pulmonar, sendo que esta se manifesta principalmente sob a forma de enfisema de aparecimento precoce, habitualmente com predomínio basal. O diagnóstico envolve a detecção de níveis séricos reduzidos de alfa-1 antitripsina e a confirmação fenotípica. Além do tratamento usual para doença pulmonar obstrutiva crônica, existe atualmente uma terapia específica com infusão de concentrados de alfa-1 antitripsina. Essa terapia de reposição, aparentemente segura, ainda não teve a eficácia clínica definitivamente comprovada, e o custo-efetividade também é um tema controverso e ainda pouco abordado. Apesar da sua importância, não existem dados epidemiológicos brasileiros a respeito da prevalência da doença ou da freqüência de ocorrência dos alelos deficientes. O subdiagnóstico também tem sido uma importante limitação tanto para o estudo da doença quanto para o tratamento adequado dos pacientes. Espera-se que a criação do Registro Internacional de Alfa-1 venha a resolver essas e outras importantes questões.Alpha-1 antitrypsin deficiency is a recently identified genetic disease that occurs almost as frequently as cystic fibrosis. It is caused by various mutations in the SERPINA1 gene, and has numerous clinical

  6. Associação entre deficiência de alfa-1-antitripsina e a gravidade da fibrose cística



    OBJETIVO: Verificar a distribuição dos genótipos da alfa-1-antitripsina e correlacionar com a gravidade da doença pulmonar em pacientes fibrocísticos. MÉTODO: Estudo clínico-laboratorial de corte transversal, com 70 pacientes fibrocísticos do Hospital Universitário da UNICAMP. Os fibrocísticos tiveram diagnóstico confirmado clínica e laboratorialmente. A gravidade da fibrose cística foi avaliada pelo escore de Shwachman. Todos os pacientes foram analisados para os alelos S e Z de alfa-1-antit...

  7. Conocimiento del déficit Alfa1-antitripsina y de la discinesia ciliar primaria por estudiantes de medicina y profesionales sanitarios


    Requena Fernández, MªÁngeles


    El déficit de alfa-1-antitripsina (DAAT) y la discinesia ciliar primaria (DCP), se engloban dentro de las enfermedades raras, siendo sin embargo trastornos genéticos y hereditarios con una prevalencia nada desdeñable. En ellas, el infradiagnóstico y el retraso diagnóstico son una constante y característica común. Dado que una de las posibles causas de este problema puede ser el bajo grado de conocimiento de ambas enfermedades por parte de los profesionales que atienden a este tipo de pac...

  8. Estudio de la utilidad clínica del perfil de estrés oxidativo en pacientes con déficit de alfa-1 antitripsina


    Castillo Corullón, Silvia


    Introducción: Investigaciones recientes en modelos animales sugieren la participación del estrés oxidativo y el daño de oxidativo en la patogénesis del déficit de alfa 1 antitripsina (DAAT). Sin embargo, no hay datos disponibles sobre el estado de estrés oxidativo y la actividad de los enzimas antioxidantes en estos pacientes. Se sabe que el estrés oxidativo está implicado en la patogénesis de enfermedades en otros organismos (aterosclesosis, enfermedades neurodegenerativas, diabetes mel...

  9. Associação entre deficiência de alfa-1-antitripsina e a gravidade da fibrose cística Association between alpha 1 antitrypsin deficiency and cystic fibrosis severity



    OBJETIVO: Verificar a distribuição dos genótipos da alfa-1-antitripsina e correlacionar com a gravidade da doença pulmonar em pacientes fibrocísticos. MÉTODO: Estudo clínico-laboratorial de corte transversal, com 70 pacientes fibrocísticos do Hospital Universitário da UNICAMP. Os fibrocísticos tiveram diagnóstico confirmado clínica e laboratorialmente. A gravidade da fibrose cística foi avaliada pelo escore de Shwachman. Todos os pacientes foram analisados para os alelos S e Z de alfa-1-antit...

  10. Deficiência de alfa-1 antitripsina num grupo de crianças com patologia respiratória: experiência da consulta de Pediatria/Alergologia do hospital de Vila Real



    Introdução: A deficiência de alfa-1 antitripsina (AAT) é uma doença genética frequente mas subdiagnosticada. Em Portugal não existem dados consistentes de prevalência da doença. O objectivo é a determinação da frequência e a caracterização do fenótipo de deficiência de AAT numa população pediátrica.Métodos: Foram incluídas todas as crianças e adolescentes referenciados à consulta de Pediatria/Alergologia com patologia respiratória baixa entre Julho de 2004 e Julho de 2009. Em todos os doentes...

  11. Evaluación del efecto de la ingesta de una alta carga de ácidos grasos saturados sobre los niveles séricos de la proteína C reactiva, alfa1-antitripsina, fibrinógeno y alfa1-glicoproteína ácida en mujeres obesas Effect of a high saturated fatty acids load on serum concentrations of C-reactive protein, alpha1-antitrypsin, fibrinogen and alpha1-acid glycoprotein in obese women

    Directory of Open Access Journals (Sweden)

    M.ª M. Ramírez Alvarado


    Full Text Available La obesidad está asociada con un estado inflamatorio. La proteína C reactiva (PCR y las proteínas plasmáticas sensibles a inflamación (ISPs son marcadores de inflamación. El proceso proinflamatorio podría ser influenciado por la ingesta de altas cantidades de ácidos grasos saturados. Objetivo: evaluar el efecto de la ingesta de una alta carga de ácidos grasos saturados sobre los niveles séricos de PCR y de ISPs (alfa1-antitripsina, alfa1-glicoproteína ácida y fibrinógeno en mujeres obesas. Metodología: la población estuvo conformada por 15 mujeres obesas (edad = 31,7 ± 4,5 años, IMC = 37,9 ± 7,3 kg/m² y 15 mujeres normopeso (edad = 30,6 ± 4,6 años, IMC = 20,6 ± 2,6 kg/m². Los sujetos en ayuno se sometieron a la ingesta de 75 g de grasa (100% ácidos grasos saturados, 0% de colesterol, 5 g de carbohidratos y 6 g de proteína por m² de superficie corporal. Se midió los niveles en ayuno y postprandiales de PCR y de ISPs. Los parámetros antropométricos y bioquímicos se midieron en ambos grupos. Resultados: las mujeres obesas presentaron mayores niveles séricos de PCR (p = 0,013 y de fibrinógeno (p = 0,04 que las mujeres normopeso. Los niveles séricos de PCR y fibrinógeno se correlacionaron positivamente con el índice de masa corporal (IMC en el grupo obeso. No se observó diferencias en los niveles de alfa1-antitripsina (p = 0,40 ni de alfa1-glicoproteína ácida (p = 0,28 en ayuno en mujeres obesas en comparación con mujeres normopeso. Los niveles séricos de PCR, alfa1-antitripsina, alfa1-glicoproteína ácida y fibrinógeno no cambiaron luego de la ingestión de la cargalipídica (p = > 0,05 diferencia con el nivel preprandial. Conclusión: la ingesta de una alta carga de ácidos grasos saturados no tiene ningún efecto sobre los niveles séricos de PCR, alfa1-antitripsina, alfa1-glicoproteína ácida y fibrinógeno. Los niveles séricos de alfa1-antitripsina y alfa1-glicoproteína ácida no están incrementados

  12. Avaliação da concentração de alfa 1-antitripsina e da presença dos alelos S e Z em uma população de indivíduos sintomáticos respiratórios crônicos Determination of alpha 1-antitrypsin levels and of the presence of S and Z alleles in a population of patients with chronic respiratory symptoms

    Directory of Open Access Journals (Sweden)

    Heliane Guerra Serra


    Full Text Available OBJETIVO: Determinar a concentração de alfa 1-antitripsina (AAT e a prevalência dos alelos S e Z em indivíduos sintomáticos respiratórios crônicos. MÉTODOS: Pacientes com tosse crônica e dispnéia foram submetidos à avaliação clínica, espirometria, tomografia computadorizada de tórax, dosagem de AAT por nefelometria e pesquisa das mutações S e Z por reação em cadeia da polimerase. Foram consideradas como variáveis dependentes a concentração de AAT e o tabagismo. RESULTADOS: Dos 89 pacientes incluídos no estudo (44 mulheres; idade média, 51,3 ± 18,2 anos, os alelos S e Z foram detectados em 33,3% e 5,7%, respectivamente, com freqüência gênica dos alelos S e Z de 0,16 e 0,028. Dois pacientes tinham genótipo SZ (AAT 141 mg/dL (normal, Grupo 2, n = 57. A freqüência de fumantes foi igual nos dois grupos, com carga tabágica maior no Grupo 2. O alelo S estava presente em 13 e 14 pacientes dos Grupos 1 e 2, respectivamente, enquanto que o alelo Z estava presente em 2 e 1 paciente dos mesmos grupos. Não houve diferença nos testes de função pulmonar, nem na freqüência de bronquiectasias ou enfisema entre os dois grupos. Os valores espirométricos e as concentrações de AAT foram similares entre fumantes e não-fumantes. Bronquiectasias foram mais freqüentes entre os não fumantes, e enfisema foi mais freqüente entre os fumantes. CONCLUSÕES: Trinta pacientes apresentaram níveis de AAT abaixo da média esperada para os genótipos MM e MS, e este fato não pode ser explicado por uma freqüência maior dos alelos S e Z.OBJECTIVE: To determine the levels of alpha-1 antitrypsin (AAT and the presence of S and Z alleles in patients with chronic respiratory symptoms. METHODS: Patients with chronic cough and dyspnea were submitted to clinical evaluation, pulmonary function tests, high-resolution computed tomography, nephelometric determination of AAT and determination of S and Z alleles by polymerase chain reaction. Smoking

  13. Evaluación del efecto de la ingesta de una sobrecarga de glucosa sobre los niveles séricos de la proteína C reactiva y de la α1-antitripsina en mujeres obesas


    M.ª M. Ramírez A.; M. Andreína Medina; M. Querales C.; B. E. Millán; C. O. Sánchez R.


    La obesidad está asociada con un estado inflamatorio. La proteína C reactiva (PCR) es una molécula proinflamatoria y la α1-antitripsina es una proteína plasmática sensible a inflamación. El proceso proinflamatorio puede ser influenciado por la hiperglicemia postprandial. Objetivo: Evaluar el efecto de la ingesta de una sobrecarga de glucosa sobre los niveles séricos de PCR y de α1-antitripsina en mujeres obesas con tolerancia normal a la glucosa. Metodología: La población estuvo conformada po...

  14. Evaluación del efecto de la ingesta de una sobrecarga de glucosa sobre los niveles séricos de la proteína C reactiva y de la α1-antitripsina en mujeres obesas

    Directory of Open Access Journals (Sweden)

    M.ª M. Ramírez A.


    Full Text Available La obesidad está asociada con un estado inflamatorio. La proteína C reactiva (PCR es una molécula proinflamatoria y la α1-antitripsina es una proteína plasmática sensible a inflamación. El proceso proinflamatorio puede ser influenciado por la hiperglicemia postprandial. Objetivo: Evaluar el efecto de la ingesta de una sobrecarga de glucosa sobre los niveles séricos de PCR y de α1-antitripsina en mujeres obesas con tolerancia normal a la glucosa. Metodología: La población estuvo conformada por 15 mujeres obesas (edad = 34,4 ± 4,3 años, IMC = 35,3 ± 5,3 kg/m² y 15 mujeres normopeso (edad = 33,9 ± 2,9 años, IMC = 21,8 ± 1,9 kg/m². Los sujetos en ayuno se sometieron a una prueba de tolerancia oral a la glucosa (75 g y 2 h. Se midió los niveles pre y postprandiales de PCR y de α1-antitripsina. Los parámetros antropométricos y bioquímicos se midieron en ambos grupos. Resultados: Las mujeres obesas presentaron mayores niveles de PCR en ayuno (P = 0,05 diferencia con el nivel preprandial. Los niveles séricos de PCR se correlacionaron positivamente con el índice de masa corporal (IMC en el grupo obeso. Los niveles séricos de α1-antitripsina no se correlacionaron con el IMC en ninguno de los dos grupos estudio. Conclusión: La ingesta de una sobrecarga de glucosa no tiene ningún efecto sobre los niveles séricos de PCR y α1-antitripsina. Los niveles séricos de α1-antitripsina no están incrementados en mujeres obesas. Los niveles séricos de PCR están incrementados en mujeres obesas y se correlacionan positivamente con el IMC.

  15. Alpha-1 antitrypsin deficiency: diagnosis and treatment



    A deficiência de alfa-1 antitripsina é um distúrbio genético de descoberta recente e que ocorre com freqüência comparável à da fibrose cística. Resulta de diferentes mutações no gene SERPINA1 e tem diversas implicações clínicas. A alfa-1 antitripsina é produzida principalmente no fígado e atua como uma antiprotease. Tem como principal função inativar a elastase neutrofílica, impedindo a ocorrência de dano tecidual. A mutação mais freqüentemente relacionada à doença clínica é o alelo Z, que de...

  16. Instilación intratraqueal de elastasa en la rata: Cambios electroforéticos de la α1-AT-antitripsina en el lavado broncoalveolar Intratracheal instillation of elastase in the rat: Electrophoretical changes of alphal-antitrypsin in bronchoalveolar lavage fluid

    Directory of Open Access Journals (Sweden)



    Full Text Available Introducción: la antiproteasa alfa 1-antitripsina ( α1-AT constituye el principal inhibidor endógeno de la elastasa instilada por vía intratraqueal en modelos experimentales. Objetivo: Evaluar mediante electroforesis e inmunodetección por western blot, las distintas formas en que se encuentra la α1-AT en el lavado broncoalveolar (IBA de ratas Sprague Dawley después de la instilación de elastasa, con la hipótesis de que el aumento en la actividad antielastasa previamente encontrada se acompaña de niveles altos de α1-AT activa. Resultados: En las primeras horas post-elastasa la concentración de α1-AT en el IBA aumenta más de 7 veces, debido al aumento de la permeabilidad alvéolo-capilar, encontrándose tanto como proteína nativa (~ 52 kDa, como parte de complejos de mayor tamaño (> 75 kDa y > 100 kDa y como producto de proteólisis (α1-AT inactiva formando complejos, el aumento de la permeabilidad alvéolo-capilar contribuye a mantener niveles altos de α1-AT activa. Estos resultados podrían ser extrapolables a distintos procesos inflamatorios pulmonaresIntroduction: Endogenous alphal-antitrypsin ( α1-AT is the main inhibitor of the intratracheally instilled elastase in experimental animals. Objective: To evaluate by electrophoresis and immunodetection using western blot analysis, the different forms of α1-AT in bronchoalveolar lavage fluid (BALF of Sprague Dawley rats after intratracheal instillation of elastase, with the hypothesis that the previously observed increment in antielastase activity is due to high levels of active α1-AT. Results: In the first hours after elastase instillation the concentration of α1-AT increases more than seven times due to an increase in alveolar-capillary permeability. α1-AT in BAIF is found as the native protein (~ 52 kDa, as complexes of different molecular sizes (> 75 kDa and > 100 kDa and as a proteolytic product (α1-AT in the inactive form as part of different complexes, the increase

  17. Evaluación del efecto de la ingesta de una sobrecarga de glucosa sobre los niveles séricos de la proteína C reactiva y de la α1-antitripsina en mujeres obesas Effect of a high glucose load on serum concentrations of C-reactive protein and α1-antitrypsin in obese women

    Directory of Open Access Journals (Sweden)

    M.ª M. Ramírez A.


    Full Text Available La obesidad está asociada con un estado inflamatorio. La proteína C reactiva (PCR es una molécula proinflamatoria y la α1-antitripsina es una proteína plasmática sensible a inflamación. El proceso proinflamatorio puede ser influenciado por la hiperglicemia postprandial. Objetivo: Evaluar el efecto de la ingesta de una sobrecarga de glucosa sobre los niveles séricos de PCR y de α1-antitripsina en mujeres obesas con tolerancia normal a la glucosa. Metodología: La población estuvo conformada por 15 mujeres obesas (edad = 34,4 ± 4,3 años, IMC = 35,3 ± 5,3 kg/m² y 15 mujeres normopeso (edad = 33,9 ± 2,9 años, IMC = 21,8 ± 1,9 kg/m². Los sujetos en ayuno se sometieron a una prueba de tolerancia oral a la glucosa (75 g y 2 h. Se midió los niveles pre y postprandiales de PCR y de α1-antitripsina. Los parámetros antropométricos y bioquímicos se midieron en ambos grupos. Resultados: Las mujeres obesas presentaron mayores niveles de PCR en ayuno (P = 0,05 diferencia con el nivel preprandial. Los niveles séricos de PCR se correlacionaron positivamente con el índice de masa corporal (IMC en el grupo obeso. Los niveles séricos de α1-antitripsina no se correlacionaron con el IMC en ninguno de los dos grupos estudio. Conclusión: La ingesta de una sobrecarga de glucosa no tiene ningún efecto sobre los niveles séricos de PCR y α1-antitripsina. Los niveles séricos de α1-antitripsina no están incrementados en mujeres obesas. Los niveles séricos de PCR están incrementados en mujeres obesas y se correlacionan positivamente con el IMC.Obesity is associated with increased inflammation. C-reactive protein (CRP is a proinflammatory molecule, and α1-antitrypsin is an inflammation-sensitive plasma protein. Proinflammatory process may be influenced by postprandial hyperglycemia. Objective: The aim of the present study was to evaluate the role of high-glucose load on postprandial circulating levels of PCR and α1-antitrypsin in obese

  18. A Randomized Study of Peginterferon Lambda-1a Compared to Peginterferon Alfa-2a in Combination with Ribavirin and Telaprevir in Patients with Genotype-1 Chronic Hepatitis C (United States)

    Flisiak, Robert; Shiffman, Mitchell; Arenas, Juan; Cheinquer, Hugo; Nikitin, Igor; Dong, Yuping; Rana, Khurram; Srinivasan, Subasree


    Background A randomized, double-blind, multinational, phase 3 study was conducted comparing the efficacy and safety of peginterferon lambda-1a (Lambda)/ribavirin (RBV)/telaprevir (TVR) vs. peginterferon alfa-2a (Alfa)/RBV/TVR in patients with chronic hepatitis C virus (HCV) genotype-1 (GT-1) infection. Methods Patients (treatment-naïve or relapsers on prior Alfa/RBV treatment) were randomly assigned in a 2:1 ratio to receive Lambda/RBV/TVR or Alfa/RBV/TVR. Total duration of treatment was either 24 or 48 weeks (response-guided treatment), with TVR administered for the first 12 weeks. The primary endpoint was the proportion of patients who achieved a sustained virologic response at post treatment week 12 (SVR12), which was tested for noninferiority of Lambda/RBV/TVR. Results A total of 838 patients were enrolled, and 617 were treated; 411 and 206 patients received Lambda/RBV/TVR and Alfa/RBV/TVR, respectively. The majority of patients were treatment-naïve, with HCV GT-1b and a high baseline viral load (≥800,000 IU/mL). Less than 10% of patients had cirrhosis (Lambda, 7.5%; Alfa, 6.8%). Lambda/RBV/TVR did not meet the criterion for noninferiority (lower bound of the treatment difference interval was -12.3%); the SVR12 in all patients (modified intent-to-treat) was 76.2% in the Lambda arm and 82.0% in the Alfa arm. Overall, the frequency of adverse events in each arm was comparable (Lambda, 91.7%; Alfa, 97.1%). As expected based on the safety profile of the 2 interferons, there were more hepatobiliary events observed in the Lambda arm and more hematologic events in the Alfa arm. Conclusions In this comparison of Lambda/RBV/TVR and Alfa/RBV/TVR in patients who were treatment-naïve or had relapsed on prior Alfa/RBV treatment, Lambda failed to demonstrate noninferiority based on SVR12 results. Treatment with Lambda/RBV/TVR was associated with a higher incidence of relapse. More patients discontinued Lambda/RBV/TVR treatment during the first 4 weeks of study treatment

  19. Determinação sérica de haptoglobina, ceruloplasmina, α1-glicoproteína ácida, transferrina e α1-antitripsina, em equinos com cólica Determination of serum haptoglobin, ceruloplasmin, α1-acid glycoprotein, transferrin and α1-antitrypsin in colic horses

    Directory of Open Access Journals (Sweden)

    Paula Alessandra Di Filippo


    Full Text Available Foram examinados 46 equinos adultos, 6 hígidos (G1 e 40 com cólica, submetidos à laparotomia. Vinte apresentavam lesões no intestino grosso (G2 e 20 no intestino delgado (G3. Avaliaram-se os teores séricos das proteínas de fase aguda: haptoglobina, ceruloplasmina, antitripsina, transferrina e glicoproteína ácida, antes e até sete dias após a laparotomia. Após centrifugação e fracionamento das amostras, as proteínas de fase aguda foram separadas por eletroforese em gel de poliacrilamida contendo SDS-PAGE, e suas concentrações determinadas por densitometria computadorizada. Constatou-se elevação dos valores das proteínas de fase aguda nos animais com cólica, antes e após laparotomia, porém com valores mais elevados, precoces e persistentes nos animais do G3. Os resultados deveram-se ao processo inflamatório intestinal, desencadeado pela lesão entérica e indicam que o proteinograma sérico pode auxiliar na identificação do segmento intestinal obstruído e, consequentemente, na elaboração do prognóstico de equinos com cólica.Forty six equines were examined, 6 were healthy (G1 and 40 with colic, submitted to laparotomy. Twenty were showing lesions on the large intestine (G2 and 20 lesions on the small intestine (G3. The serum concentrations of acute phase proteins: haptoglobin, ceruloplasmin, antitrypsin, transferrin, and - acid glycoprotein before and until 7 days after laparotomy. After centrifugation and fractioning of the samples, the acute phase proteins were individualized by electrophoresis on polyacrylamide gel containing SDS-PAGE, and the concentrations were determined by computerized densitometry. The increase was verified on the levels of acute phase proteins from animals with colic, before and after laparotomy, however with higher levels, premature and persistent on animals from G3. The results were due to the process of intestinal inflammation, caused by enteric injury and indicate that the serum protein

  20. Mucoproteína versus alfa-1-glicoproteína ácida: o que quantificar?

    Directory of Open Access Journals (Sweden)

    Picheth Geraldo


    Full Text Available A quantificação sérica da alfa-1-glicoproteína (GPA ácida é útil no diagnóstico e no acompanhamento dos processos agudos resultantes de múltiplas causas. Esta proteína também pode ser estimada pela quantificação da mucoproteína (Muco, ensaio que reflete as glicoproteínas com elevado teor de açúcar, entre as quais a GPA é majoritária. O objetivo deste trabalho é verificar a correlação e a performance analítica das determinações de mucoproteína (Muco e alfa-1-glicoproteína ácida (GPA, propondo uma equação de regressão linear. Amostras de soros de 540 pacientes, com idades entre 10 e 79 anos (média de 34,6, predominando mulheres (71,3%, foram analisadas simultaneamente para Muco (Winzler, manual com reagentes próprios e GPA (imunoturbidimetria automatizada, Roche; Cobas mira. A análise de regressão, fixando a Muco como variável dependente, apresentou Muco (mg/dl em tirosina = 0,031 x GPA (mg/dl + 0,8 (r = 0,91; e, fixando o intercepto em zero, Muco = 0,039 x GPA (r = 0,98. A imprecisão interensaio foi de 23,4% e 5,2% (coeficiente de variação, respectivamente, para Muco e GPA. Conclusão: a elevada variabilidade analítica da quantificação da mucoproteína pelo método de Winzler recomenda que este ensaio seja substituído pela dosagem da alfa-1-glicoproteína ácida. Quando necessário, recomendamos estimar a mucoproteína, quantificando a alfa-1-glicoproteína ácida com ensaios de mesmo desempenho que o do utilizado neste trabalho, e usar a equação de regressão AGP (mg/dl x 0,039 = Muco (mg/dl em tirosina.

  1. Daclatasvir plus peginterferon alfa and ribavirin for treatment-naive chronic hepatitis C genotype 1 or 4 infection

    DEFF Research Database (Denmark)

    Hézode, Christophe; Hirschfield, Gideon M; Ghesquiere, Wayne


    undetectable HCV-RNA at Weeks 4 and 12 (extended rapid virologic response, eRVR) and at 24 weeks post-treatment (sustained virologic response, SVR24) among genotype 1-infected patients. RESULTS: Overall, eRVR was achieved by 54.4% (80/147) of genotype 1-infected patients receiving daclatasvir 20 mg, 54.1% (79......OBJECTIVE: To evaluate the safety and efficacy of daclatasvir, an HCV NS5A inhibitor with pangenotypic activity, administered with peginterferon-alfa-2a/ribavirin. DESIGN: In this Phase 2b double-blind, placebo-controlled study, treatment-naive adults with HCV genotype 1 (N=365) or 4 (N=30......) infection were randomly assigned (2:2:1) to daclatasvir 20 mg or 60 mg, or placebo once daily plus weekly peginterferon-alfa-2a and twice-daily ribavirin. Daclatasvir recipients achieving protocol-defined response (PDR; HCV-RNA

  2. Daclatasvir vs telaprevir plus peginterferon alfa/ribavirin for hepatitis C virus genotype 1 (United States)

    Jacobson, Ira; Zeuzem, Stefan; Flisiak, Robert; Knysz, Brygida; Lueth, Stefan; Zarebska-Michaluk, Dorota; Janczewska, Ewa; Ferenci, Peter; Diago, Moises; Zignego, Anna Linda; Safadi, Rifaat; Baruch, Yaacov; Abdurakhmanov, Dzhamal; Shafran, Stephen; Thabut, Dominique; Bruck, Rafael; Gadano, Adrian; Thompson, Alexander James; Kopit, Justin; McPhee, Fiona; Michener, Tracy; Hughes, Eric A; Yin, Philip D; Noviello, Stephanie


    AIM: To evaluate daclatasvir vs telaprevir, each combined with peginterferon alfa-2a/ribavirin (pegIFN/RBV), in treatment-naive hepatitis C virus (HCV) genotype (GT) 1-infected patients. METHODS: In this phase 3, randomized, open-label, noninferiority study, 602 patients were randomly assigned (2:1) to daclatasvir vs telaprevir, stratified by IL28B rs12979860 host genotype (CC vs non-CC), cirrhosis status (compensated cirrhosis vs no cirrhosis), and HCV GT1 subtype (GT1a vs GT1b). Patients were selected by study inclusion criteria from a total of 793 enrolled patients. Patients received daclatasvir 60 mg once daily or telaprevir 750 mg 3 times daily plus pegIFN/RBV. Daclatasvir recipients received 24 wk of daclatasvir plus pegIFN/RBV; those without an extended rapid virologic response (eRVR; undetectable HCV-RNA at weeks 4 and 12) received an additional 24 wk of pegIFN/RBV. Telaprevir-treated patients received 12 wk of telaprevir plus pegIFN/RBV followed by 12 (with eRVR) or 36 (no eRVR) wk of pegIFN/RBV. The primary objective was to compare for noninferiority of sustained virologic response rates at posttreatment week 12 (SVR12) in GT1b-infected patients. Key secondary objectives were to demonstrate that the rates of anemia (hemoglobin < 10 g/dL) and rash-related events, through week 12, were lower with daclatasvir + pegIFN/RBV than with telaprevir + pegIFN/RBV among GT1b-infected patients. Resistance testing was performed using population-based sequencing of the NS5A region for all patients at baseline, and for patients with virologic failure or relapse and HCV-RNA ≥ 1000 IU/mL, to investigate any link between NS5A polymorphisms associated with daclatasvir resistance and virologic outcome. RESULTS: Patient demographics and disease characteristics were generally balanced across treatment arms; however, there was a higher proportion of black/African Americans in the daclatasvir groups (6.0% and 8.2% in the GT1b and GT1a groups, respectively) than in the

  3. Stability is maintained in adults with Gaucher disease type 1 switched from velaglucerase alfa to eliglustat or imiglucerase: A sub-analysis of the eliglustat ENCORE trial. (United States)

    Pleat, Rebecca; Cox, Timothy M; Burrow, T Andrew; Giraldo, Pilar; Goker-Alpan, Ozlem; Rosenbloom, Barry E; Croal, Laura R; Underhill, Lisa H; Gaemers, Sebastiaan J M; Peterschmitt, M Judith


    Gaucher disease type 1 is an autosomal recessive disorder caused by deficient activity of the lysosomal enzyme acid β-glucosidase resulting in accumulation of glucosylceramide and clinical manifestations of anemia, thrombocytopenia, hepatosplenomegaly, and skeletal disease. The historic standard of care is intravenous recombinant enzyme therapy with imiglucerase. Eliglustat, an oral substrate reduction therapy, is a first-line treatment for adults with Gaucher disease type 1 who have a compatible CYP2D6-metabolizer phenotype (≈ 95% of patients). The 12-month ENCORE trial (NCT00943111) found eliglustat non-inferior to imiglucerase in maintaining stability in adult Gaucher patients previously stabilized after ≥ 3 years of enzyme therapy (imiglucerase or velaglucerase alfa). This post-hoc analysis examined safety and efficacy in the 30 ENCORE patients who were receiving velaglucerase alfa at study entry and were randomized to eliglustat (n = 22) or imiglucerase (n = 8). Efficacy and safety in velaglucerase alfa-transitioned patients were consistent with the full ENCORE trial population; 90% of patients switched to eliglustat and 88% of patients switched to imiglucerase met the composite endpoint (stable hemoglobin concentration, platelet count, spleen volume, and liver volume). Clinical stability was maintained for 12 months in Gaucher disease type 1 patients in the ENCORE trial who switched from velaglucerase alfa to either eliglustat or imiglucerase.

  4. The ALFA Trigger Simulator

    CERN Document Server

    Dziedzic B


    The paper presents basic information about ALFA detectors used in the ATLAS experiment, and the structure of currently developed device used to test a new ALFA trigger interface. It discusses the block diagram of the device, principle of its operation, implementation details and future plans for developing the Simulator.

  5. ALFA Detector Control System

    CERN Document Server

    Oleiro Seabra, Luis Filipe; The ATLAS collaboration


    ALFA (Absolute Luminosity For ATLAS) is one of the sub-detectors of ATLAS (A Toroidal LHC Apparatus). The ALFA system is composed by four stations installed in the LHC tunnel 240 m away from the ATLAS interaction point. Each station has a vacuum and ventilation system, movement control and all the required electronics for signal processing. The Detector Control System (DCS) provides control and monitoring of several components and ensures the safe operation of the detector contributing to good Data Quality. This paper describes the ALFA DCS system including a detector overview, operation aspects and hardware control through a SCADA system, WinCC OA.

  6. ALFA Detector Control System

    CERN Document Server

    Oleiro Seabra, Luis Filipe; The ATLAS collaboration


    ALFA (Absolute Luminosity For ATLAS) is one of the sub-detectors of ATLAS/LHC. The ALFA system is composed by two stations installed in the LHC tunnel 240 m away from each side of the ATLAS interaction point. Each station has a vacuum and ventilation system, movement control and all the required electronic for signal processing. The Detector Control System (DCS) provides control and monitoring of several components and ensures the safe operation of the detector contributing to good Data Quality. This paper describes the ALFA DCS system including a detector overview, operation aspects and hardware control through a SCADA system, WinCC OA.

  7. Administration of follitropin alfa and lutropin alfa combined in a single injection: a feasibility assessment

    Directory of Open Access Journals (Sweden)

    Agostinetto Rita


    Full Text Available Abstract Background Gonadotrophins are routinely administered in assisted reproductive technology (ART treatment protocols. Recombinant human follicle-stimulating hormone (r-hFSH; follitropin alfa and recombinant human luteinizing hormone (r-hLH; lutropin alfa can be administered individually or in a fixed combination. The ability to vary the FSH to LH dose ratio in a single injection without compromising the bioactivity of either gonadotrophin or generating losses of active principle is important for physicians and patients alike. Methods This study investigated whether follitropin alfa (GONAL-f (R, as lyophilized powder for reconstitution or solution from the GONAL-f (R (filled-by-mass [FbM] Prefilled Pen, could be used to reconstitute Pergoveris TM (follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder. In Ratio Groups 1 and 2, the r-hFSH:r-hLH ratio was 3:1; in Ratio Groups 3 and 4, the ratios of r-hFSH:r-hLH were 5:1 and 8:1, respectively. The protein content and bioactivity of each mixed solution were evaluated. The r-hFSH and r-hLH content was determined using reverse-phase high performance liquid chromatography. The biological activity of r-hFSH and r-hLH was assessed using the Steelman-Pohley and Van Hell in vivo bioassays in rats, respectively. Results Follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder could be successfully mixed with follitropin alfa 75 IU FbM solution that was either reconstituted from lyophilized powder or injected directly from the prefilled pen to create solutions with ratios of r-hFSH and r-hLH from 3:1 to 8:1. The measured content of r-hFSH and r-hLH corresponded favourably with the target protein content in Ratio Groups 1–4. The in vivo target and measured bioactivity of r-hFSH and r-hLH were also closely matched in all Ratio Groups. Conclusion Follitropin alfa lyophilized powder or solution can be accurately mixed with follitropin alfa/lutropin alfa 150 IU/75 IU lyophilized powder to

  8. ALFA detector upgrade before LHC Run 2

    CERN Document Server

    Vorobel, Vit; The ATLAS collaboration


    The operation experience with ATLAS ALFA detectors in the LHC environment during the Run1 period has shown significant beam-induced heating. Subsequent comprehensive studies revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosities in the LHC Run2. During the first LHC long shutdown (LS1) all ALFA detectors have been removed from the LHC tunnel and their covers - Roman Pots - underwent a geometry upgrade to minimize the impedance losses. It will be shown that this modification together with a system improving the internal heat transfer and an air cooling system, significantly shifted the temperatures of ALFA detectors away from the critical limits throughout the LHC Run2. Also ALFA trigger system was considerably upgraded to keep measured data safely inside the Run2 ATLAS latency budget and to minimize dead time. The needed hardware changes of the trigger system will be presented in the second part of the talk.

  9. ALFA detector before LHC Run 2

    CERN Document Server

    Vorobel, Vit; The ATLAS collaboration


    The operation experience with ATLAS ALFA detectors in the LHC environment during the Run1 period has shown significant beam-induced heating. Subsequent comprehensive studies revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosities in the LHC Run2. During the first LHC long shutdown (LS1) all ALFA detectors have been removed from the LHC tunnel and their covers - Roman Pots - underwent a geometry upgrade to minimize the impedance losses. It will be shown that this modification together with a system improving the internal heat transfer and an air cooling system, significantly shifted the temperatures of ALFA detectors away from the critical limits throughout the LHC Run2. Also ALFA trigger system was considerably upgraded to keep measured data safely inside the Run2 ATLAS latency budget and to minimize dead time. The needed hardware changes of the trigger system are also described

  10. Epoetin Alfa Injection (United States)

    ... a medication used to treat human immunodeficiency virus (HIV). Epoetin alfa injection is also used before and ... record book.If you are being treated with dialysis (treatment to remove waste from the blood when ...

  11. ALFA beam halo

    CERN Document Server

    Komarek, Tomas


    This note serves as a final report about CERN Summer Student Programme 2014 project. The beam halo is an undesired phenomenon for physics analyses on particle accelerators. It surrounds the beam core and constitutes an important part of background for signal measurements on some detectors, eg. in the forward region. In this study, the data from the ALFA detector were used, specifically from the run 191373 ($\\beta^*=90\\unit{m}$) and the run 213268 ($\\beta^*=1\\unit{km}$). Using the ROOT framework, a software for beam halo events selection was created and beam halo properties were examined. In the run 213268, excessive beam halo is suspected to be the reason for multiple beam scrapings that occurred. A kinematic reconstruction of beam halo particles is attempted in order to understand beam halo properties in the interaction point. Some further simulations are employed to find constraints for beam halo particles in order to survive in the accelerator for a longer time/many revolutions. This work represents a st...

  12. Interferon Alfa-2b Injection (United States)

    Interferon alfa-2b injection is used to treat a number of conditions.Interferon alfa-2b injection is used alone or in ... Hodgkin's lymphoma (NHL; a slow-growing blood cancer). Interferon alfa-2b is in a class of medications ...

  13. Stock footage ATLAS-ALFA experiment September 2016

    CERN Multimedia


    Stock footage of the ATLAS- ALFA subdetector in the LHC tunnel at IP1 taken during the LHC technical shut-down in September 2016. The ATLAS/ALFA experiment and studies the elastic scattering of protons, which are not observable in normal operation runs. In the elastic scattering process, the two protons survive their encounter intact and only change directions by exchanging momentum.

  14. Estudio epidemiológico y anatómico del Síndrome de iris flácido intraoperatorio en pacientes con tratamiento con bloqueantes alfa 1 adrenérgicos



    El Síndrome de iris flácido intraoperatorio (IFIS), descrito por Chang y Campbell en 2005, acontece durante la microcirugía de cataratas mediante facoemulsificación ultrasónica en pacientes que están en tratamiento con bloqueantes alfa-1 adrenérgicos (bloq-alfa1A). Está compuesto por una triada clínica: iris flácido atónico que se ondula en respuesta a la irrigación intraocular propia de la fluídica perioperatoria, tendencia iridiana a prolapsarse hacia la punta del facoemulsificador y las in...

  15. Elosulfase alfa: first global approval. (United States)

    Sanford, Mark; Lo, Jin Han


    Elosulfase alfa (Vimizim™) is a recombinant form of N-acetylgalactosamine-6-sulfatase (GALNS) that was developed by BioMarin Pharmaceutical Inc. as an enzyme replacement therapy for patients with mucopolysaccharidosis type IVA (MPS IVA), also known as Morquio A syndrome. Patients with MPS IVA have a GALNS deficiency, which results in serious musculoskeletal, cardiorespiratory and other system disturbances. Elosulfase alfa was approved by the US FDA on 14 February 2014 for the treatment of MPS IVA. The European Medicines Agency Committee for Medicinal Products for Human Use (CHMP) has recently recommended that elosulfase alfa be approved for use in the EU in the same indication. Within the last year, the manufacturer has also filed applications for approval for the use of elosulfase alfa in MPS IVA in Brazil, Australia, Canada and Mexico. This article summarizes the milestones in the development of elosulfase alfa leading to its first global approval in MPS IVA.

  16. Asfotase alfa therapy for children with hypophosphatasia (United States)

    Madson, Katherine L.; Phillips, Dawn; Reeves, Amy L.; McAlister, William H.; Yakimoski, Amy; Mack, Karen E.; Hamilton, Kim; Kagan, Kori; Fujita, Kenji P.; Thompson, David D.; Moseley, Scott; Odrljin, Tatjana; Rockman-Greenberg, Cheryl


    Background. Hypophosphatasia (HPP) is caused by loss-of-function mutation(s) of the gene that encodes the tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). Consequently, cell-surface deficiency of TNSALP phosphohydrolase activity leads to extracellular accumulation of inorganic pyrophosphate, a natural substrate of TNSALP and inhibitor of mineralization. Children with HPP can manifest rickets, skeletal pain, deformity, fracture, muscle weakness, and premature deciduous tooth loss. Asfotase alfa is a recombinant, bone-targeted, human TNSALP injected s.c. to treat HPP. In 2012, we detailed the 1-year efficacy of asfotase alfa therapy for the life-threatening perinatal and infantile forms of HPP. Methods. Here, we evaluated the efficacy and safety of asfotase alfa treatment administered to children 6–12 years of age at baseline who were substantially impaired by HPP. Two radiographic scales quantitated HPP skeletal disease, including comparisons to serial radiographs from similarly affected historical control patients. Results. Twelve children receiving treatment were studied for 5 years. The 6-month primary endpoint was met, showing significant radiographic improvement. Additional significant improvements included patient growth, strength, motor function, agility, and quality of life, which for most patients meant achieving normal values for age- and sex-matched peers that were sustained at 5 years of treatment. For most, pain and disability resolved. Mild to moderate injection-site reactions were common and were sometimes associated with lipohypertrophy. Low anti–asfotase alfa antibody titers were noted in all patients. No evidence emerged for clinically important ectopic calcification or treatment resistance. Conclusions. Asfotase alfa enzyme replacement therapy has substantial and sustained efficacy with a good safety profile for children suffering from HPP. Trial Registration. NCT00952484 (

  17. Asfotase alfa therapy for children with hypophosphatasia. (United States)

    Whyte, Michael P; Madson, Katherine L; Phillips, Dawn; Reeves, Amy L; McAlister, William H; Yakimoski, Amy; Mack, Karen E; Hamilton, Kim; Kagan, Kori; Fujita, Kenji P; Thompson, David D; Moseley, Scott; Odrljin, Tatjana; Rockman-Greenberg, Cheryl


    Background. Hypophosphatasia (HPP) is caused by loss-of-function mutation(s) of the gene that encodes the tissue-nonspecific isoenzyme of alkaline phosphatase (TNSALP). Consequently, cell-surface deficiency of TNSALP phosphohydrolase activity leads to extracellular accumulation of inorganic pyrophosphate, a natural substrate of TNSALP and inhibitor of mineralization. Children with HPP can manifest rickets, skeletal pain, deformity, fracture, muscle weakness, and premature deciduous tooth loss. Asfotase alfa is a recombinant, bone-targeted, human TNSALP injected s.c. to treat HPP. In 2012, we detailed the 1-year efficacy of asfotase alfa therapy for the life-threatening perinatal and infantile forms of HPP. Methods. Here, we evaluated the efficacy and safety of asfotase alfa treatment administered to children 6-12 years of age at baseline who were substantially impaired by HPP. Two radiographic scales quantitated HPP skeletal disease, including comparisons to serial radiographs from similarly affected historical control patients. Results. Twelve children receiving treatment were studied for 5 years. The 6-month primary endpoint was met, showing significant radiographic improvement. Additional significant improvements included patient growth, strength, motor function, agility, and quality of life, which for most patients meant achieving normal values for age- and sex-matched peers that were sustained at 5 years of treatment. For most, pain and disability resolved. Mild to moderate injection-site reactions were common and were sometimes associated with lipohypertrophy. Low anti-asfotase alfa antibody titers were noted in all patients. No evidence emerged for clinically important ectopic calcification or treatment resistance. Conclusions. Asfotase alfa enzyme replacement therapy has substantial and sustained efficacy with a good safety profile for children suffering from HPP. Trial Registration. NCT00952484 (

  18. Arecibo Pulsar and Transient Surveys Using ALFA (United States)

    Cordes, J. M.


    A large scale survey for pulsars and transients is being conducted at the Arecibo Observatory using the Arecibo L-band Feed Array (ALFA). Data acquisition so far has been with correlation spectrometers that analyze a 0.1 GHz bandwidth at 1.4 GHz. The 256 frequency channels limit dispersion smearing to 1.2 ms at DMmax = 103 pc cm-3 while the sampling interval of 64 μs equals the dispersion smearing at DM~54 pc cm-3, providing high sensitivity to millisecond pulsars with standard periods out to implied distances of several kpc at low Galactic latitudes. In early 2008, we will use a new set of polyphase filter bank systems that provide the same time and frequency resolutions but over ALFA's full 0.3 GHz bandwidth. Currently the survey covers sky positions within 5° of the Galactic plane that are reachable with Arecibo. Preliminary results are given for some of the discoveries made so far, which include millisecond pulsars, a relativistic binary pulsar, a likely counterpart of a Compton GRO/EGRET gamma-ray source, and transient pulsars (including `RRATs''). We discuss the methodology of the survey, which includes archival of raw survey data at the Cornell Center for Advanced Computing and processing at distributed sites. The survey and follow up observations, which include timing observations, multiwavelength searches for orbital companions in the case of binary pulsars, etc. are organized through the Pulsar-ALFA (PALFA) Consortium. We expect the Galactic plane survey to continue until at least 2010, most likely involving multiple passes on each sky position to optimize detection of variable sources. The ALFA system will also be used to survey intermediate Galactic latitudes for millisecond pulsars, relativistic binaries with large systemic velocities, and runaway pulsars that will escape the Galaxy.

  19. Mericitabine and Either Boceprevir or Telaprevir in Combination with Peginterferon Alfa-2a plus Ribavirin for Patients with Chronic Hepatitis C Genotype 1 Infection and Prior Null Response: The Randomized DYNAMO 1 and DYNAMO 2 Studies.

    Directory of Open Access Journals (Sweden)

    Heiner Wedemeyer

    Full Text Available Most patients with chronic hepatitis C virus (HCV genotype 1 infection who have had a previous null response (<2-log10 reduction in HCV RNA by treatment week 12 to peginterferon/ribavirin (PegIFN/RBV do not achieve a sustained virological response (SVR when re-treated with a first-generation HCV protease inhibitor (PI administered in combination with PegIFN/RBV. We studied the incremental benefits associated with adding mericitabine (nucleoside analog inhibitor of HCV polymerase to PI plus PegIFN alfa-2a/RBV-based therapy in two double-blind randomized multicenter phase 2 trials (with boceprevir in DYNAMO 1, and with telaprevir in DYNAMO 2. The primary endpoint in both trials was SVR, defined as HCV RNA <25 IU/mL 12 weeks after the end of treatment (SVR12. Overall, the addition of mericitabine to PI plus PegIFN alfa-2a/RBV therapy resulted in SVR12 rates of 60-70% in DYNAMO 1 and of 71-96% in DYNAMO 2. SVR12 rates were similar in patients infected with HCV genotype 1a and 1b in both trials. The placebo control arms in both studies were stopped because of high rates of virological failure. Numerically lower relapse rates were associated with longer treatment with mericitabine (24 versus 12 weeks, telaprevir-containing regimens, and regimens that included 48 weeks of PegIFN alfa-2a/RBV therapy. No mericitabine resistance mutations were identified in any patient in either trial. The addition of mericitabine did not add to the safety burden associated with either telaprevir or boceprevir-based regimens. These studies demonstrate increased SVR rates and reduced relapse rates in difficult-to-treat patients when a nucleoside polymerase inhibitor with intermediate antiviral potency is added to regimens containing a first-generation NCT01482403 and NCT01482390.



    Bademci, Vahit


    ÖzetÖlçümlerin güvenirliğini kestirmek için değişik yöntemler vardır. Bunlardan biriside Cronbach'ın alfa katsayısı yöntemidir. Cronbach'ın alfa katsayısı ile ilgili olarak da, bukatsayının sadece ağırlıklı ölçümlenmiş (Örneğin, 1,2,3,4,5 gibi) maddelerlekullanılabileceği şeklinde bir görüş vardır. Ancak, bazı bilim adamlarınca ileri sürülen bugörüş doğru değildir. Çünkü, Cronbach'...

  1. Neuregulinas 1-alfa e 1-beta na regeneração de nervos periféricos Neuregulins 1-alpha and 1-beta on the regeneration the peripheral nerves

    Directory of Open Access Journals (Sweden)

    Fabiano Inácio de Souza


    Full Text Available OBJETIVO: Avaliar o efeito das neuregulinas 1-alfa e 1-beta na regeneração de nervos ciáticos de camundongos C57BL/6J, adultos, machos, através da técnica de tubulização. MÉTODOS: Utilizaram-se 18 animais, divididos em 3 grupos, implantando-se prótese de polietileno em falhas de 4,0 mm no nervo ciático esquerdo: grupo 1 contendo apenas colágeno purificado (Vitrogen®; grupo 2, colágeno associado a neuregulina 1-alfa; grupo 3 com colágeno e neuregulina 1-beta. O grupo controle foi formado por 6 segmentos de nervos ciáticos direitos. Após 4 semanas, os animais foram sacrificados; extraiu-se segmento do ponto médio do nervo regenerado no interior das próteses, padronizaram-se cortes histológicos e confecção das lâminas para análise histomorfométrica. Confrontaram-se os resultados estatisticamente. RESULTADOS: Os animais tratados com neuregulinas tiveram maior número de axônios mielinizados, com diferença estatisticamente significante quando comparados ao grupo colágeno. Não houve diferença estatística entre os grupos de neuregulinas 1-alfa e 1-beta. CONCLUSÃO: a adição de neuregulinas proporcionou aumento significativo do número de fibras mielinizadas.OBJECTIVE: to evaluate the effect of the neuregulins 1-alpha and 1-beta on the regeneration the sciatic nerves of male adult C57BL/6J mice, using the tubulization technique. METHODS: eighteen animals were used, divided into three groups. A polyethylene prosthesis was implanted in a 4.0 mm defect of the left sciatic nerve, as follows: group 1 containing only purified collagen (Vitrogen®; group 2, collagen with neuregulin 1-alpha; group 3, collagen with neuregulin 1-beta. The control group consisted of six segments of right sciatic nerves. After four weeks, the animals were sacrificed. A segment from the midpoint of the nerve regenerated inside the prostheses was extracted; histological sections were standardized, and slides were made up for histomorphometric analysis

  2. The ALFA ZOA Deep Survey: First Results (United States)

    McIntyre, T. P.; Henning, P. A.; Minchin, R. F.; Momjian, E.; Butcher, Z.


    The Arecibo L-band Feed Array Zone of Avoidance (ALFA ZOA) Deep Survey is the deepest and most sensitive blind H i survey undertaken in the ZOA. ALFA ZOA Deep will cover about 300 square degrees of sky behind the Galactic Plane in both the inner (30^\\circ ≤slant l≤slant 75^\\circ ;b≤slant | 2^\\circ | ) and outer (175^\\circ ≤slant l≤slant 207^\\circ ;-2^\\circ ≤slant b≤slant +1^\\circ ) Galaxy, using the Arecibo Radio Telescope. First results from the survey have found 61 galaxies within a 15 square degree area centered on l=192^\\circ and b = -2°. The survey reached its expected sensitivity of rms = 1 mJy at 9 km s-1 channel resolution, and is shown to be complete above integrated flux, FHi = 0.5 Jy km s-1. The positional accuracy of the survey is 28″ and detections are found out to a recessional velocity of nearly 19,000 km s-1. The survey confirms the extent of the Orion and Abell 539 clusters behind the plane of the Milky Way and discovers expansive voids, at 10,000 and 18,000 km s-1. Twenty-six detections (43%) have a counterpart in the literature, but only two of these have known redshifts. Counterparts are 20% less common beyond vhel = 10,000 km s-1 and 33% less common at extinctions higher than AB = 3.5 mag. The ALFA ZOA Deep survey is able to probe large scale structure beyond redshifts that even the most modern wide-angle surveys have been able to detect in the ZOA at any wavelength.

  3. Gaucher disease: transcriptome analyses using microarray or mRNA sequencing in a Gba1 mutant mouse model treated with velaglucerase alfa or imiglucerase.

    Directory of Open Access Journals (Sweden)

    Nupur Dasgupta

    Full Text Available Gaucher disease type 1, an inherited lysosomal storage disorder, is caused by mutations in GBA1 leading to defective glucocerebrosidase (GCase function and consequent excess accumulation of glucosylceramide/glucosylsphingosine in visceral organs. Enzyme replacement therapy (ERT with the biosimilars, imiglucerase (imig or velaglucerase alfa (vela improves/reverses the visceral disease. Comparative transcriptomic effects (microarray and mRNA-Seq of no ERT and ERT (imig or vela were done with liver, lung, and spleen from mice having Gba1 mutant alleles, termed D409V/null. Disease-related molecular effects, dynamic ranges, and sensitivities were compared between mRNA-Seq and microarrays and their respective analytic tools, i.e. Mixed Model ANOVA (microarray, and DESeq and edgeR (mRNA-Seq. While similar gene expression patterns were observed with both platforms, mRNA-Seq identified more differentially expressed genes (DEGs (∼3-fold than the microarrays. Among the three analytic tools, DESeq identified the maximum number of DEGs for all tissues and treatments. DESeq and edgeR comparisons revealed differences in DEGs identified. In 9V/null liver, spleen and lung, post-therapy transcriptomes approximated WT, were partially reverted, and had little change, respectively, and were concordant with the corresponding histological and biochemical findings. DEG overlaps were only 8-20% between mRNA-Seq and microarray, but the biological pathways were similar. Cell growth and proliferation, cell cycle, heme metabolism, and mitochondrial dysfunction were most altered with the Gaucher disease process. Imig and vela differentially affected specific disease pathways. Differential molecular responses were observed in direct transcriptome comparisons from imig- and vela-treated tissues. These results provide cross-validation for the mRNA-Seq and microarray platforms, and show differences between the molecular effects of two highly structurally similar ERT

  4. Conestat alfa for the treatment of angioedema attacks

    Directory of Open Access Journals (Sweden)

    Davis B


    Full Text Available Benjamin Davis, Jonathan A BernsteinUniversity of Cincinnati College of Medicine, Department of Internal Medicine, Division of Immunology/Allergy Section, Cincinnati, OH, USAAbstract: Recently, multiple C1 inhibitor (C1-INH replacement products have been approved for the treatment of hereditary angioedema (HAE. This review summarizes HAE and its current treatment modalities and focuses on findings from bench to bedside trials of a new C1-INH replacement, conestat alfa. Conestat alfa is unique among the other C1-INH replacement products because it is produced from transgenic rabbits rather than derived from human plasma donors, which can potentially allow an unlimited source of drug without any concern of infectious transmission. The clinical trial data generated to date indicate that conestat alfa is safe and effective for the treatment of acute HAE attacks.Keywords: androgens, adverse events, patients, HAE attacks 

  5. Thalidomide with peginterferon alfa-2b and ribavirin in the treatment of non-responders genotype 1 chronic hepatitis C patients: proof of concept Talidomida, peginterferón alfa-2b y ribavirina en el tratamiento de pacientes no respondedores con hepatitis crónica C genotipo 1: estudio piloto

    Directory of Open Access Journals (Sweden)

    Benjamín Pardo-Yules


    Full Text Available Background: fewer than half of patients infected with hepatitis C virus (HCV achieve sustained viral clearance after peginterferon alfa/ribavirin (Peg-IFN/RBV therapy. Aims: thalidomide posses anti-inflammatory and immunomodulatory properties through inhibition of tumor necrosis factor and costimulatory effect on human CD8+ T cells. Methods: we started a prospective, open label trial of retreatment of very-difficult-to-treat genotype 1 chronic hepatitis C patients (CHC patients, who had failed to respond to the (Peg-IFN/RBV, with a triple therapy consisting in these same antivirals plus thalidomide 200 mg/day (the TRITAL study. Results: none of the eleven patients fulfilling the inclusion criteria and included in the trial reached complete early virological response or sustained virological response. Viral load decline after 12 weeks of triple therapy thalidomide-based retreatment did not differ from viral dynamics during the first course. The triple therapy was well tolerated and only one patient developed mild bilateral neuropathy. Conclusions: thalidomide addition to standard therapy is tolerated and did not increase the SVR rate in very-difficult-to-treat genotype 1 CHC patients. Different schedules are warranted to improve attempting retreatment of non responder CHC patients.Antecedentes: menos de la mitad de los pacientes con hepatitis C logra eliminar el virus de manera sostenida después de la terapia con peginterferón alfa y ribavirina (Peg-IFN/RBV. Objetivos: la talidomida posee propiedades antiinflamatorias e inmunomoduladoras a través de la inhibición del TNF-α y al efecto estimulador sobre las células T CD8+. Métodos: se inició un estudio prospectivo y abierto de re-tratamiento de pacientes con hepatitis crónica C genotipo 1, no respondedores al tratamiento con Peg-IFN/RBV, mediante triple terapia añadiendo a los mismos antivirales 200 mg/día de talidomida. Resultados: ninguno de los once pacientes que fueron incluidos en

  6. Investigación y desarrollo de abaperidona, nuevo antipsicótico 5HT2A/D2 y alfa1-adrenérgico. Modelos "in vitro" e "in vivo" predictivos de eficacia y efectos adversos


    Príncep Mota, Marta


    La esquizofrenia es una enfermedad altamente prevalente, cerca del 1% de la población, en la que se distinguen tres grandes tipos de sintomatología, los déficits cognitivos, los síntomas positivos y los síntomas negativos, con distinta respuesta a los tratamientos actuales.Abaperidona, es una nueva entidad química investigada y desarrollada como potencial antipsicótico atípico, con un favorable perfil 5HT2/D2 y elevada afinidad por el receptor alfa1-adrenérgico. Abaperidona también mostró afi...

  7. The ALFA ZOA Deep Survey: First Results

    CERN Document Server

    McIntyre, Travis P; Minchin, Robert F; Momjian, Emmanuel; Butcher, Zhon


    The Arecibo L-Band Feed Array Zone of Avoidance (ALFA ZOA) Deep Survey is the deepest and most sensitive blind Hi survey undertaken in the ZOA. ALFA ZOA Deep will cover about 300 square degrees of sky behind the Galactic plane in both the inner (30 deg < l < 75 deg; b < |2 deg|) and outer (175 deg < l < 207 deg; -2 deg < b < +1 deg) Galaxy, using the Arecibo Radio Telescope. First results from the survey have found 61 galaxies within a 15 square degree area centered on l = 192 deg and b = -2 deg. The survey reached its expected sensitivity of rms = 1 mJy at 9 km/s channel resolution, and is shown to be complete above integrated flux, F_HI = 0.5 Jy km/s. The positional accuracy of the survey is 28 arcsec and detections are found out to a recessional velocity of nearly 19,000 km/s. The survey confirms the extent of the Orion and Abell 539 clusters behind the plane of the Milky Way and discovers expansive voids, at 10,000 km/s and 18,000 km/s. 26 detections (43%) have a counterpart in the li...

  8. AFP and ALFA detectors as a momentum spectrometer system - feasibility study

    CERN Document Server



    We consider a possibility to measure a leading proton momentum using simultaneously the AFP and ALFA detectors. The idea is based on the simple fact that the proton trajectory through the magnetic field between the AFP and ALFA$_{1}$ detectors, depends on the proton's momentum loss $\\xi$. The feasibility of the proton momentum measurement is directly related to the availability of the magnetic fields and their configuration, the overlap between ALFA and AFP detectors and their resolutions as well as energy losses and the multiple scattering effect that could wash away little actions from the magnets on the proton.

  9. Investigation of Mechanical Behavior of Alfa and Gamma Nano- Alumina/ Epoxy Composite Made By Vartm

    Directory of Open Access Journals (Sweden)

    P. Ghabezi


    Full Text Available In this paper, the mechanical properties (flexural and tensional modulus and strength are investigated by manufacturing Epoxy/Glass Nano-composite samples with different Nano-particle wt% (Nano-Alumina to find optimum conditions. The alpha and Gamma grade of Nano alumina were added to the epoxy system with the weight percentage of 1, 2, 3, 4, 5 and 6. The experimental results show that the maximum flexural stiffness in Alfa and Gamma Nano-alumina composite is related to 6 wt% and 4 wt% samples, respectively. And the highest tensional stiffness in Alfa and Gamma Nano-alumina composite is related to 4 wt% and 5 wt% samples, respectively. Also the highest toughness for Alfa and Gamma Nano-composites is observed for 4 wt% and 3 wt% samples and in the same way Nano-alumina in grade Alfa with 1 wt% and Gamma with 3 wt% have highest failure strain.

  10. "Alfa" i "Võmpel" bez maski / Andrei Sharov

    Index Scriptorium Estoniae

    Sharov, Andrei


    Venemaa FSB keskuse, mille koosseisu kuuluvad ka eriüksused Alfa ja Võmpel, töötajad osalevad terroristide neutraliseerimise ja pantvangide vabastamise erioperatsioonides. Intervjuu keskuse staabi uue juhiga

  11. Methotrexate, Doxorubicin, and Cisplatin (MAP) Plus Maintenance Pegylated Interferon Alfa-2b Versus MAP Alone in Patients With Resectable High-Grade Osteosarcoma and Good Histologic Response to Preoperative MAP: First Results of the EURAMOS-1 Good Response Randomized Controlled Trial

    NARCIS (Netherlands)

    Bielack, S.S.; Smeland, S.; Whelan, J.S.; Marina, N.; Jovic, G.; Hook, J.M.; Krailo, M.D.; Gebhardt, M.; Papai, Z.; Meyer, J.; Nadel, H.; Randall, R.L.; Deffenbaugh, C.; Nagarajan, R.; Brennan, B.; Letson, G.D.; Teot, L.A.; Goorin, A.; Baumhoer, D.; Kager, L.; Werner, M.; Lau, C.C.; Hall, K.; Gelderblom, H.; Meyers, P.; Gorlick, R.; Windhager, R.; Helmke, K.; Eriksson, M.; Hoogerbrugge, P.M.; Schomberg, P.; Tunn, P.U.; Kuhne, T.; Jurgens, H.; Berg, H. van den; Bohling, T.; Picton, S.; Renard, M.; Reichardt, P.; Gerss, J.; Butterfass-Bahloul, T.; Morris, C.; Hogendoorn, P.C.; Seddon, B.; Calaminus, G.; Michelagnoli, M.; Dhooge, C.; Sydes, M.R.; Bernstein, M.


    PURPOSE: EURAMOS-1, an international randomized controlled trial, investigated maintenance therapy with pegylated interferon alfa-2b (IFN-alpha-2b) in patients whose osteosarcoma showed good histologic response (good response) to induction chemotherapy. PATIENTS AND METHODS: At diagnosis, patients a

  12. Simulation of the ATLAS ALFA detector in comparison with testbeam data

    CERN Document Server

    Pfeiffer, Felix-Fabian; Stenzel, H


    ALFA (Absolute Luminosity for ATLAS) is a scintillating fiber detector for the determination of the absolute luminosity. ALFA con- sists of eight Roman Pots, four on each side of ATLAS at a distance of 240 m. Each detector is made of scintillating fibers with quadratic cross section, glued in UV geometry on ten double sided layers. The detectors are mounted in moveable Roman Pots and can approach the LHC beam up to 1.5 mm, to determine the luminosity from the differential t spectrum of elastically scattered protons using the optical theorem. This is done in special LHC calibration runs with large β ∗ , special focusing and low instant luminosity. The results of ALFA are needed for the calibration of ATLAS luminosity monitors like LUCID. This diploma thesis deals with the simulation of ALFA and the most recent testbeam campaign. A special focus is put on the comparison of results from simulation and testbeam.

  13. Upgrade of ATLAS-ALFA for Run2

    CERN Document Server

    Jakobsen, Sune; The ATLAS collaboration


    Early experience with the operation of the ALFA detectors in the LHC environment has shown significant beam-induced heating. Comprehensive studies on the effects of heating with a spare detector module have furthermore revealed that heating effects could be disastrous in the case of the larger beam intensities foreseen for higher luminosity. A temporary solution was implemented and kept the detectors below the critical temperature in 2012. In LS1 all ALFA stations have been removed from LHC and are undergoing an upgrade of the geometry of Roman Pots to minimize the impedance losses. When the stations were re-installed ~4 m distance was added between them to gain level arm in the angular measurement between the stations. The updated geometry of the Roman Pot, together with a system to improve the internal heat transfer and an air cooling system, is expected to keep the temperatures of ALFA detectors below critical limits throughout the LHC Run2 and first results from the performance in 2016 will be presented. ...

  14. Psychiatric side effects of pegylated interferon alfa-2b as compared to conventional interferon alfa-2b in patients with chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    Michael R Kraus; Arne Sch(a)fer; Herbert Csef; Michael Scheurlen


    AIM: To assess systematically the spectrum and extent of depressive symptoms comparing patient groups receiving peginterferon or conventional interferon.METHODS: Ninety-eight patients with chronic hepatitis C and interferon-based therapy (+ribavirin) were consecutively enrolled in a longitudinal study. Patients were treated with conventional interferon alfa-2b (48/98patients; 5 MIU interferon alfa-2b thrice weekly) or peginterferon alfa-2b (50/98 patients; 80-150 μgpeginterferon alfa-2b) in combination with weight-adapted ribavirin (800-1 200 mg/d). Repeated psychometric testing was performed before, three times during and once after antiviral therapy: Depression was evaluated by the Hospital Anxiety and Depression Scale (HADS), anger/hostility by the Symptom Checklist-90 Items Revised (SCL-90-R).RESULTS: Therapy with pegylated interferon alfa-2bproduces comparable scores for depression (ANOVA:P = 0.875) as compared to conventional interferon.Maximums of depression scores were even higher and cases of clinically relevant depression were frequent during therapy with peginterferon. Scores for anger/hostility were comparable for both therapy subgroups.CONCLUSION: Our findings suggest that the extent and frequency of depressive symptoms in total are not reduced by peginterferon. Monitoring and management of neuropsychiatric toxicity especially depression have to be considered as much as in antiviral therapy with unmodified interferon.

  15. Interferon alfa with or without ribavirin for chronic hepatitis C

    DEFF Research Database (Denmark)

    Kjaergard, L L; Krogsgaard, K; Gluud, C


    To assess the efficacy and safety of interferon alfa with or without ribavirin for treatment of chronic hepatitis C.......To assess the efficacy and safety of interferon alfa with or without ribavirin for treatment of chronic hepatitis C....

  16. Interferon-alfa treatment of facial infantile haemangiomas

    DEFF Research Database (Denmark)

    Fledelius, Hans C.; Illum, N.; Jensen, H.;


    ophthalmology, haemangiomas of the face, infancy, Interferon alfa, eye at risk, amblyopia, induced refractive change, ultrasound imaging......ophthalmology, haemangiomas of the face, infancy, Interferon alfa, eye at risk, amblyopia, induced refractive change, ultrasound imaging...

  17. ALFA: an automated line fitting algorithm

    CERN Document Server

    Wesson, Roger


    I present the Automated Line Fitting Algorithm, ALFA, a new code which can fit emission line spectra of arbitrary wavelength coverage and resolution, fully automatically. In contrast to traditional emission line fitting methods which require the identification of spectral features suspected to be emission lines, ALFA instead uses a list of lines which are expected to be present to construct a synthetic spectrum. The parameters used to construct the synthetic spectrum are optimised by means of a genetic algorithm. Uncertainties are estimated using the noise structure of the residuals. An emission line spectrum containing several hundred lines can be fitted in a few seconds using a single processor of a typical contemporary desktop or laptop PC. I show that the results are in excellent agreement with those measured manually for a number of spectra. Where discrepancies exist, the manually measured fluxes are found to be less accurate than those returned by ALFA. Together with the code NEAT (Wesson et al. 2012), ...

  18. Taliglucerase alfa: an enzyme replacement therapy using plant cell expression technology. (United States)

    Grabowski, Gregory A; Golembo, Myriam; Shaaltiel, Yoseph


    Gaucher disease (GD) is a rare, genetic lysosomal storage disorder caused by functional defects of acid β-glucosidase that results in multiple organ dysfunction. Glycosylation of recombinant acid human β-glucosidase and exposure of terminal mannose residues are critical to the success of enzyme replacement therapy (ERT) for the treatment of visceral and hematologic manifestations in GD. Three commercially available ERT products for treatment of GD type 1 (GD1) include imiglucerase, velaglucerase alfa, and taliglucerase alfa. Imiglucerase and velaglucerase alfa are produced in different mammalian cell systems and require production glycosylation modifications to expose terminal α-mannose residues, which are needed for mannose receptor-mediated uptake by target macrophages. Such modifications add to production costs. Taliglucerase alfa is a plant cell-expressed acid β-glucosidase approved in the United States and other countries for ERT in adults with GD1. A plant-based expression system, using carrot root cell cultures, was developed for production of taliglucerase alfa and does not require additional processing for postproduction glycosidic modifications. Clinical trials have demonstrated that taliglucerase alfa is efficacious, with a well-established safety profile in adult, ERT-naïve patients with symptomatic GD1, and for such patients previously treated with imiglucerase. These included significant improvements in organomegaly and hematologic parameters as early as 6months, and maintenance of achieved therapeutic values in previously treated patients. Ongoing clinical trials will further characterize the long-term efficacy and safety of taliglucerase alfa in more diverse patient populations, and may help to guide clinical decisions for achieving optimal outcomes for patients with GD1.

  19. Distribución mundial de los alelos deficitarios PI*Z and PI*S usando un método de interpolación IDW (inverse distance weighting)


    Blanco, Ignacio; Lara, B; Miravitlles, M; Fernández-Bustillo, E.


    Oficina de Investigación Biosanitaria-FICYT. 44 Congreso Nacional SEPAR Actualmente existe una carencia significativa de datos epidemiológicos sobre déficit alfa-1-antitripsina en extensas áreas geográficas del mundo. Desarrollar mapas detallados de frecuencias de los principales alelos deficitarios de alfa-1-antitripsina (PI*S and PI*Z ) mediante un programa matemático (ArcMap) que forma parte del ESRI's ArcGIS Geographical Information System (GIS), de Microsoft Windows, que se basa e...

  20. Home infusion program for Fabry disease: experience with agalsidase alfa in Argentina

    Directory of Open Access Journals (Sweden)

    Isaac Kisinovsky


    Full Text Available Fabry disease is an X-linked lysosomal storage disorder caused by inherited deficiency of the enzyme α-galactosidase A. Enzyme replacement treatment using agalsidase alfa significantly reduces pain, improves cardiac function and quality of life, and slows renal deterioration. Nevertheless, it is a life-long treatment which requires regular intravenous infusions and entails a great burden for patients. Our objective was to evaluate retrospectively the safety and tolerability of the home infusion of agalsidase alfa in patients with Fabry disease in Argentina. We evaluated all the patients with Fabry disease who received home infusion with agalsidase alfa 0.2 mg/kg between January 2005 and June 2011. The program included 87 patients; 51 males (mean age: 30 years and 36 females (mean age: 34 years. A total of 5229 infusions (mean: 59 per patient; range: 1-150 were administered. A total of 5 adverse reactions were seen in 5 patients (5.7% of patients and 0.9% of the total number of infusions. All were mild in severity and resolved by reducing the rate of infusion and by using antihistaminics. All these 5 patients were positive for IgG antibodies, but none of them presented IgE antibodies and none suffered an anaphylactic shock. In our group 18 patients were switched from agalsidase beta to agalsidase alfa without complications. Home infusion with agalsidase alfa is safe, well tolerated and is associated to high compliance.

  1. Combination of "low-dose" ribavirin and interferon alfa-2a therapy followed by interferon alfa-2a monotherapy in chronic HCV-infected non-responders and relapsers after interferon alfa-2a monotherapy

    Institute of Scientific and Technical Information of China (English)

    Perdita Wietzke-Braun; Volker Meier; Felix Braun; Giuliano Ramadori


    AIM To report on the efficacy, safety and tolerability of interferon alfa-2a combined with a "low dose" of ribavirin for relapsers and non responders to alpha interferon monotherapy.METHODS Thirty-four chronic hepatitis C virus-infected non-responders to interferon alfa2a monotherapy (a course of at least 3 months treatment) and 13 relapsers to interferon alfa 2a monotherapy (a dose of 3 to 6 million units three times per week for at least 20 weeks but not more than 18 months) were treated with the same dose of interferon alfa-2a used before (3 to 6 million units three times per week) and ribavirin (10 mg/ kg daily) for 6 months. In complete responders, interferon alfa-2a was administered for further 6 months at the same dose used before as monotherapy.RESULTS Seven (20.6%) of 34 non-responders stopped the combined therapy due to adverse events, including two patients with histological and clinical Child A cirrhosis. In 17/27 (63%)non-responders, the combined therapy was stopped after three months because of non-response. Ten of the 27 non-responders completed the 1;2-month treatment course. At a mean follow up of 28 months (16- 37 months)after the treatment, 4/10 (15%) previous non-responders still remained complete responders,All 13 previous relapsers completed the 12-month treatment course. At a mean follow up of 22months (9 - 36 months) after treatment, 6/13(46%) the previous relapsers were stillsustained complete responders.CONCLUSION Our treatment schedule of the combined therapy for 6 months of interferon alfa2a with a low dose of ribavirin (10 mg/kg/day)followed by 6 months of interferon alfa-2amonotherapy is able to induce a sustainedcomplete response rate in 15% of non-responders and 46% of relapsers with chronic hepatitis C virus-related liver diseases comparable to those obtained with the standarddoses of ribavirin 1000 - 1200 mg/day.Randomized prospective controlled trials using lower total amounts of ribavirin in combination with interferon should be

  2. Measurement of elastic scattering with ALFA

    CERN Document Server

    Jakobsen, S; The ATLAS collaboration


    The principal of ALFA is presented and then a detailed description of the detector, installation, triggering and beam based alignment. All this was needed in 2011 before the special optics runs with beta* = 90 m which was used for measuring elastic scattering. The first analysis steps of seeing tack patterns, making a global alignment of the detectors and finding correlations are presented. The plans for upcoming runs in 2012 are briefly discussed.

  3. Alternative method for quantification of alfa-amylase activity

    Directory of Open Access Journals (Sweden)

    DF. Farias

    Full Text Available A modification of the sensitive agar diffusion method was developed for macro-scale determination of alfa-amylase. The proposed modifications lower costs with the utilisation of starch as substrate and agar as supporting medium. Thus, a standard curve was built using alfa-amylase solution from Aspergillus oryzae, with concentrations ranging from 2.4 to 7,500 U.mL-1. Clear radial diffusion zones were measured after 4 hours of incubation at 20 °C. A linear relationship between the logarithm of enzyme activities and the area of clear zones was obtained. The method was validated by testing α-amylase from barley at the concentrations of 2.4; 60; 300 and 1,500 U.mL-1. The proposed method turned out to be simpler, faster, less expensive and able to determine on a macro-scale α-amylase over a wide range (2.4 to 7,500 U.mL-1 in scientific investigation as well as in teaching laboratory activities.

  4. Stock footage ATLAS-ALFA experiment November 2016

    CERN Multimedia


    This footage shows an ALFA station of the ATLAS experiment in the LHC tunnel. This detector aims to measure the elastic proton scattering and to determine from these data the elastic and total cross sections, as well as the luminosity. Altogether there are two times two stations at both sides of ATLAS at Point 1 in a distance of about 240m. Each station consist of two Roman Pots which are equipped with scintillating fiber detectors. They are used under special beam conditions (high beta*) when the detectors are moved close to the circulating LHC beams (as close as 1mm). In standard high intensity LHC runs the Pots remain in parking position. The movie records the composition of an ALFA station at the C-side of ATLAS in the tunnel section *** 7L1. All stations are placed on the outgoing beams where scattered protons are expected. That's why the station mechanics is partly covered by the tubes of incoming beam lines. The stations are placed in between the large boxes with DQR resistors to absorb the magnet curr...

  5. The efficacy and safety of double (cepeginterferon alfa-2b and ribavirin and triple (simeprevir, cepeginterferon alfa 2b and ribavirin treatment regimens in chronic hepatitis C patients. The experience of everyday clinical practice

    Directory of Open Access Journals (Sweden)

    N. P. Blokhina


    Full Text Available The objective. To evaluate the efficacy, safety and tolerability of double (cepeginterferon alfa-2b and ribavirin and triple (simeprevir, cepeginterferon alfa 2b and ribavirin treatment regimens in chronic hepatitis C patients in everyday clinical practice of the Hepatology Center in Clinical Infectious Diseases Hospital in Moscow.Materials and methods. From 2013 to 2015 a total of 289 patients with chronic hepatitis C received antiviral therapy with cepeginterferon alfa 2b. 267 patients received combination of cepeginterferon alfa 2b and ribavirin. 22 patients received triple antiviral therapy with simeprevir, cepeginterferon alfa 2b and ribavirin. Treatment efficacy was assessed by the rate of sustained virologic response on 12/24 week after completion of antiviral therapy (SVR 12/24. In safety analysis all 289 patients were included. All cases of deterioration of the patient’s condition and laboratory abnormalities were registered throughout the treatment period and follow up.Results. 267 patients (74,5%, n=199, with 2/3 genotype, 25,5%, n = 68, with 1 genotype received cepeginterferon alfa 2b 1,5 µg/kg/week and ribavirin 800-1400 daily (weight based. 22 patients with genotype 1 (the majority of them had advanced fibrosis (F3-F4 underwent triple therapy with simeprevir 150 mg once daily in combination with cepeginterferon alfa 2b 1,5 µg/kg/week and ribavirin 800-1400 mg daily (weight based for 12 weeks, followed by cepeginterferon alfa 2b/ ribavirin therapy for 12-36 weeks. SVR was observed in 85,6% (n=113 of genotype 2/3 infected patients and in 64,6% (n=31 of genotype 1 infected patients. Among patients with mild or moderate fibrosis SVR rate was 90,7% in genotype 2/3 patients and 75% in genotype 1 patients. 21 patient completed the course of triple therapy. SVR was observed in 71,4% (n=15 of patients. Registered adverse reactions were common for interferon/ribavirin based therapy. In most cases adverse events were moderate and matched

  6. Analysis of the trigger system of the ALFA detectors

    CERN Document Server

    Guerrero Llorente, Alonso


    During the CERN Summer Student Programme 2015 two different projects were carried out. Both related with the ALFA subdetector in ATLAS and its trigger system. The frst, and main, project aimed to do an study of the trigger effciency of the ALFA detector at $\\sqrt{s}=8 TeV$ and $\\beta^* = 90m$. The results can be found fully explained in the ATLAS note: "Trigger effciency for the ALFA detector at $\\sqrt{s}=8 TeV$ and $\\beta^* = 90m$". A secondary task consisted on systematical tests of new chips for an update of the ALFA trigger system.

  7. 普通干扰素1b联合利巴韦林治疗非1b型慢性丙型肝炎患者临床观察%Combination of interferon alfa-1b and ribavirin in the treatment of patients with chronic hepatitis C of non-1b

    Institute of Scientific and Technical Information of China (English)

    雷华; 禹蔚琴; 田波; 戴静毅; 王晴晴; 柏保利; 庄林


    目的 探讨不同基因型HCV感染者对普通干扰素联合利巴韦林治疗的疗效.方法 应用型特异性探针杂交法检测106例慢性丙型肝炎患者HCV基因型.应用普通干扰素联合利巴韦林治疗,观察病毒学应答情况.结果 在106例患者中,以HCV 3b(45.3%)、1b(20.8%)和3a(18.9%)型为主,6a(9.4%)和2a(5.7%)型次之;在22例1b型感染者,只有9例接受本治疗方案,82例非1b型感染者完成治疗.非1b型患者的RVR和EVR分别为50%和86.6%;在1b型HCV感染者,22.2%(2/9)获得SVR,而非1b型HCV感染者,76.8%(63/82)获得SVR.结论 普通干扰素联合利巴韦林治疗非1b型慢性丙型肝炎患者疗效较好.%Objective To investigate the efficacies of interferon alfa-1b and ribavirin in treatment of patients with chronic hepatitis C of different genotypes. Methods The genotypes of hepatitis C virus in 106 patients with hepatitis C were detected by genotype-specific probes. The patients with hepatitis C were treated with interferon alfa-1b and ribavirin for 48 weeks. Results Out of 106 patients with hepatitis C,the HCV genotype 3b accounted for 45.3%,lb for 20.8%,and 3a for 18.9%,while we still detected some 6a(9.4%)and 2a(5.7%) positive;Nine out of 22 patients with hepatitis C of lb and other 82 with non-1b finished the regimen;the rapid virological response and early virological response in patient with non-1b were 50% and 86.6%,respectively;22.2%(2/9)of lb infected patients got sustained virological response ,while 76.8% (63/82)of non-1b got SVRO Conclusion Interferon alfa-1b and ribavirin regimen can be selected for hepatitis C patients with non-lb infection.

  8. Efeito da idade e da testosterona sobre a expressão fisiologica de adrenoceptores alfa-1 em ductos deferentes de ratos


    Jose Luiz Tatagiba Lamas


    Resumo: O objetivo deste trabalho é determinar o efeito do processo de desenvolvimento e envelhecimento e de uma dose de testosterona, administrada no 22° dia de vida sobre a resposta contrátil de ductos diferentes de ratos Wistar pré-púrberes (3semanas), jovens (3 meses) e senis (22 meses). Um grupo de ratos pré-púrberes foi tratado com testosterona (1mg/kg, SC) 24 horas antes do experimento. Foram obtida curvas concentração-efeito à noradrenalina em ductos diferentes submetidos a três condi...

  9. Sequential combination of glucocorticosteroids and alfa interferon versus alfa interferon alone for HBeAg-positive chronic hepatitis B

    DEFF Research Database (Denmark)

    Mellerup, M T; Krogsgaard, K; Mathurin, P;


    Chronic hepatitis B has serious effects on morbidity and mortality. Alfa interferon has been shown to increase the rates of HBeAg-clearance as well as seroconversion to anti-HBe, but response rates are unsatisfactory. Glucocorticosteroid pretreatment may increase the response to alfa interferon....

  10. Sequential combination of glucocorticosteroids and alfa interferon versus alfa interferon alone chronic hepatitis B. Protocol for a Cochrane Review

    DEFF Research Database (Denmark)

    Mellerup, M T; Krogsgaard, K; Mathurin, P;


    Chronic hepatitis B has serious effects on morbidity and mortality. Alfa interferon has been shown to increase the rates of HBeAg-clearance as well as seroconversion to anti-HBe, but response rates are unsatisfactory. Glucocorticosteroid pretreatment may increase the response to alfa interferon....

  11. Drotrecogin alfa (activated in severe sepsis: a systematic review and new cost-effectiveness analysis

    Directory of Open Access Journals (Sweden)

    Brophy James M


    Full Text Available Abstract Background Activated drotrecogin alfa (human activated protein C, rhAPC, is produced by recombinant DNA technology, and purports to improve clinical outcomes by counteracting the inflammatory and thrombotic consequences of severe sepsis. Controversy exists around the clinical benefits of this drug and an updated economic study that considers this variability is needed. Methods A systematic literature review was performed using Medline, Embase and the International Network of Agencies for Health Technology Assessment (INAHTA databases to determine efficacy, safety and previous economic studies. Our economic model was populated with systematic estimates of these parameters and with population life tables for longer term survival information. Monte Carlo simulations were used to estimate the incremental cost-effectiveness ratios (ICERs and variance for the decision analytic models. Results Two randomized clinical trials (RCTS of drotrecogin alfa in adults with severe sepsis and 8 previous economic studies were identified. Although associated with statistical heterogeneity, a pooled analysis of the RCTs did not show a statistically significant 28-day mortality benefit for drotrecogin alfa compared to placebo either for all patients (RR: 0.93, 95% CI: 0.69, 1.26 or those at highest risk as measured by APACHE II ≥ 25 (RR: 0.90, 95% CI: 0.54, 1.49. Our economic analysis based on the totality of the available clinical evidence suggests that the cost-effectiveness of drotrecogin alfa is uncertain ( Conclusion The evidence supporting the clinical and economic attractiveness of drotrecogin alfa is not conclusive and further research appears to be indicated.

  12. The pattern of immune cell infiltration in chromoblastomycosis: involvement of macrophage inflammatory protein-1 alpha/CCL3 and fungi persistence Padrão de infiltração de células do sistema imune na cromomicose: envolvimento de MIP-1 alfa da persistência fúngica

    Directory of Open Access Journals (Sweden)

    Vanuza Cristina Sá


    Full Text Available Chromoblastomycosis (CR is a subcutaneous chronic mycosis characterized by a granulomatous inflammatory response. However, little is known regarding the pattern of leukocyte subsets in CR and the pathways involved in their recruitment. The objective of this study was to assess the cellular subsets, chemokine, chemokine receptors and enzymes in CR. The inflammatory infiltrate was characterized by immunohistochemistry using antibodies against macrophages (CD68, Langerhans'cells (S100, lymphocytes (CD3, CD4, CD8, CD45RO, CD20 and CD56 and neutrophils (CD15. The expression of MIP-1alpha (Macrophage inflammatory protein-1alpha, chemokine receptors (CXCR3 and CCR1 and enzymes (superoxide dismutase-SOD and nitric oxide synthase-iNOS was also evaluated by the same method. We observed an increase in all populations evaluated when compared with the controls. Numbers of CD15+ and CD56+ were significantly lower than CD3+, CD4+, CD20+ and CD68+ cells. Statistical analysis revealed an association of fungi numbers with CD3, CD45RO and iNOS-positive cells. Furthermore, MIP-1alpha expression was associated with CD45RO, CD68, iNOS and CXCR3. Our results suggest a possible role of MIP-1alpha and fungi persistence in the cell infiltration in CR sites.A cromomicose é micose subcutânea crônica sistêmica caracterizada por resposta inflamatória crônica granulomatosa. No entanto, existem poucos dados a respeito do padrão de subtipos de leucócitos na cromomicose e sobre as vias envolvidas no recrutamento destas células. O objetivo deste trabalho foi avaliar os tipos celulares, bem como a expressão de quimiocinas, receptores de quimiocinas e enzimas em lesões de cromomicose. O infiltrado inflamatório foi caracterizado por meio de técnica imuno-histoquímica utilizando os seguintes marcadores CD68 (macrófagos, S100 (células de Langerhans, CD3, CD4, CD8, CD45RO, CD20 e CD56 (linfócitos e CD15 (neutrófilos. A expressão de MIP-1alfa (Proteína Inflamat

  13. Fast radio burst discovered in the Arecibo pulsar ALFA survey

    Energy Technology Data Exchange (ETDEWEB)

    Spitler, L. G.; Freire, P. C. C.; Lazarus, P.; Lee, K. J. [Max-Planck-Institut für Radioastronomie, D-53121 Bonn (Germany); Cordes, J. M.; Chatterjee, S.; Wharton, R. S.; Brazier, A. [Department of Astronomy and Space Sciences, Cornell University, Ithaca, NY 14853 (United States); Hessels, J. W. T. [ASTRON, Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Lorimer, D. R.; McLaughlin, M. A. [Department of Physics and Astronomy, West Virginia University, Morgantown, WV 26506 (United States); Crawford, F. [Department of Physics and Astronomy, Franklin and Marshall College, Lancaster, PA 17604-3003 (United States); Deneva, J. S. [Naval Research Laboratory, 4555 Overlook Ave SW, Washington, DC 20375 (United States); Kaspi, V. M.; Karako-Argaman, C. [Department of Physics, McGill University, Montreal, QC H3A 2T8 (Canada); Allen, B. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee, WI 53211 (United States); Bogdanov, S.; Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Jenet, F. A. [Center for Gravitational Wave Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); Knispel, B., E-mail: [Leibniz Universität, Hannover, D-30167 Hannover (Germany); and others


    Recent work has exploited pulsar survey data to identify temporally isolated, millisecond-duration radio bursts with large dispersion measures (DMs). These bursts have been interpreted as arising from a population of extragalactic sources, in which case they would provide unprecedented opportunities for probing the intergalactic medium; they may also be linked to new source classes. Until now, however, all so-called fast radio bursts (FRBs) have been detected with the Parkes radio telescope and its 13-beam receiver, casting some concern about the astrophysical nature of these signals. Here we present FRB 121102, the first FRB discovery from a geographic location other than Parkes. FRB 121102 was found in the Galactic anti-center region in the 1.4 GHz Pulsar Arecibo L-band Feed Array (ALFA) survey with the Arecibo Observatory with a DM = 557.4 ± 2.0 pc cm{sup –3}, pulse width of 3.0 ± 0.5 ms, and no evidence of interstellar scattering. The observed delay of the signal arrival time with frequency agrees precisely with the expectation of dispersion through an ionized medium. Despite its low Galactic latitude (b = –0.°2), the burst has three times the maximum Galactic DM expected along this particular line of sight, suggesting an extragalactic origin. A peculiar aspect of the signal is an inverted spectrum; we interpret this as a consequence of being detected in a sidelobe of the ALFA receiver. FRB 121102's brightness, duration, and the inferred event rate are all consistent with the properties of the previously detected Parkes bursts.

  14. Leucograma, proteína C reativa, alfa-1 glicoproteína ácida e velocidade de hemossedimentação na apendicite aguda Leucocyte count, C reactive protein, alpha-1 acid glycoprotein and erithrocyte sedimmentation rate in acute appendicitis

    Directory of Open Access Journals (Sweden)

    Bruno Ramalho de Carvalho


    Full Text Available RACIONAL: O diagnóstico da apendicite aguda é clínico, mas alguns indivíduos podem apresentar sinais e sintomas pouco característicos. As dificuldades diagnósticas ainda conduzem os cirurgiões à realização de laparotomias desnecessárias, que atingem índices de 15% a 40%. Os exames laboratoriais, assim, podem se tornar complementos úteis no diagnóstico da apendicite aguda. O leucograma parece ser o de maior valor, mas a dosagem das proteínas de fase aguda, em especial da proteína C reativa, é objeto de vários estudos. CASUÍSTICA E MÉTODO: Estudo longitudinal prospectivo, envolvendo 63 pacientes submetidos a apendicectomia por suspeita de apendicite aguda no Hospital das Clínicas da Universidade Federal de Uberlândia, MG, de cujas amostras de sangue foram feitas dosagens das proteínas de fase aguda e leucograma. RESULTADOS: Foram 44 pacientes do sexo masculino e a faixa etária predominante entre 11 e 30 anos. A apendicite aguda foi mais freqüente no sexo masculino (69,8% e na faixa etária entre 11 e 30 anos. O tipo flegmonoso foi mais freqüente (52,4%. O leucograma mostrou-se aumentado em 74,6% dos casos e a elevação da proteína C reativa foi observada em 88,9%. As dosagens de alfa-1 glicoproteína ácida e velocidade de hemossedimentação foram predominantemente normais. A proteína C reativa esteve aumentada em mais de 80% dos casos em todas as idades. O leucograma e a proteína C reativa alteraram-se em 80% dos pacientes com até 24 horas do início dos sintomas. Com tempo de evolução dos sintomas superior a 24 horas, o leucograma mostrou-se alterado em 69,7% dos casos e a proteína C reativa, em 97%. Sensibilidade e especificidade do leucograma foram de 88,7% e 20%. Para a proteína C reativa, foram de 88,9% e 10%, respectivamente. A dosagem da proteína C reativa apresentou maior sensibilidade (96,9% para os casos de evolução com mais de 24 horas, sem qualquer especificidade, entretanto, alfa-1 glicoprote

  15. JSC “ALFA-BANK” marketing policy. problems and perspectives


    Kirillov, A.; Kuznetcova, E.; Martirosian, M.


    The article is devoted to the results of JSC “Alfa-Bank” consumers’ segmentation and the following complex marketing research. The article suggests the ways of the bank’s marketing policy improvement.

  16. Treatment of anemia with darbepoetin alfa in systolic heart failure

    DEFF Research Database (Denmark)

    Swedberg, Karl; Young, James B; Anand, Inder S


    Patients with systolic heart failure and anemia have worse symptoms, functional capacity, and outcomes than those without anemia. We evaluated the effects of darbepoetin alfa on clinical outcomes in patients with systolic heart failure and anemia.......Patients with systolic heart failure and anemia have worse symptoms, functional capacity, and outcomes than those without anemia. We evaluated the effects of darbepoetin alfa on clinical outcomes in patients with systolic heart failure and anemia....

  17. Prospective surveillance study of haemophilia A patients switching from moroctocog alfa or other factor VIII products to moroctocog alfa albumin-free cell culture (AF-CC) in usual care settings. (United States)

    Parra Lopez, Rafael; Nemes, Laszlo; Jimenez-Yuste, Victor; Rusen, Luminita; Cid, Ana R; Charnigo, Robert J; Baumann, James A; Smith, Lynne; Korth-Bradley, Joan M; Rendo, Pablo


    This prospective, open-label, postauthorisation safety surveillance study assessed clinically significant inhibitor development in patients with severe haemophilia A transitioning from moroctocog alfa or other factor VIII (FVIII) replacement products to reformulated moroctocog alfa (AF-CC). Males aged ≥ 12 years with severe haemophilia A (FVIII:C) 150 exposure days (EDs) to recombinant or plasma-derived FVIII products, and no detectable inhibitor at screening were enrolled. Primary end point was the incidence of clinically significant FVIII inhibitor development. Secondary end points included annualised bleeding rate (ABR), less-than-expected therapeutic effect (LETE), and FVIII recovery. Patients were assigned to one of two cohorts based on whether they were transitioning to moroctocog alfa (AF-CC) from moroctocog alfa (cohort 1; n=146) or from another recombinant or plasma-derived FVIII product (cohort 2; n=62). Mean number of EDs on study was 94 (range, 1-139). Six positive FVIII inhibitor results, as determined by local laboratories, were reported in four patients; none were confirmed by a central laboratory, no inhibitor-related clinical manifestations were reported, and all anti-FVIII antibody assays were negative. Median ABRs were 23.4 and 3.4 in patients categorised at baseline as following on-demand and prophylactic regimens, respectively; 86.5% of bleeding episodes resolved after one infusion. LETE incidence was 0.06% and 0.19% in the on-demand and prophylaxis settings, respectively. FVIII recovery remained constant throughout the study. No new safety concerns were identified. This study found no increased risk of clinically significant FVIII inhibitor development in patients transitioning from moroctocog alfa or other FVIII replacement products to moroctocog alfa (AF-CC).

  18. Development of a detector (ALFA) to measure the absolute LHC luminosity at ATLAS

    CERN Document Server

    Mapelli, A; Ask, S; Barrillon, P; Blanchot, G; Blin, S; Braem, André; Cheiklali, C; de La Taille, C; Di Girolamo, B; Efthymiopoulos, I; Faustino, J; Fournier, D; Franz, S; Grafström, P; Gurriana, L; Haguenauer, M; Hedberg, V; Heller, M; Hoffmann, S; Iwanski, W; Joram, C; Kocnar, A; Lavigne, B; Lundberg, B; Maio, A; Maneira, M J P; Marques, C; Mjörnmark, U; Conde-Muíño, P; Puzo, P; Rijssenbeeck, M; Santos, J P; Saraiva, J G; Seguin-Moreau, N; Soares, S; Stenzel, H; Thioye, M; Valladolid-Gallego, E; Vorobel, V; 10th ICATPP Conference on Astroparticle, Particle, Space Physics, Detectors and Medical Physics Applications


    The ATLAS collaboration plans to determine the absolute luminosity of the CERN LHC at Interaction Point 1 by measuring the trajectory of protons elastically scattered at very small angles ($\\mu rad$). A scintillating fibre tracker system called ALFA (Absolute Luminosity For ATLAS) is proposed for this measurement. Detector modules will be placed above and below the LHC beam axis in roman pot units at a distance of 240 m on each side of the ATLAS interaction point. They allow the detectors to approach the beam axis to millimeter distance. Overlap detectors also based on the scintillating fibre technology, will measure the precise relative position of the two detector modules. Results obtained during beam tests at DESY and at CERN validate the detectors design and demonstrate the achievable resolution. We also report about radiation hardness studies of the scintillating fibres to estimate the lifetime of the ALFA system at different operating conditions of the LHC.

  19. Role of elosulfase alfa in mucopolysaccharidosis IVA. (United States)

    Regier, Debra S; Tanpaiboon, Pranoot


    Mucopolysaccharidosis type IVA (MPS IVA or Morquio A) is an autosomal recessive lysosomal storage disease which results in a striking skeletal phenotype, but does not negatively impact the intellect of the patient. MPS IVA has a phenotypic continuum that ranges from a severe and rapidly progressing form to a slowly progressive form. The clinical diagnosis is often made in the preschool years based on abnormal bone findings on physical examination and dysplasia on radiographic imaging. Supportive care has been the mainstay in caring for patients. Orthopedic physicians often form the core of the care team due to the early and severe skeletal abnormalities; however, systemic disease is common and requires aggressive monitoring and management. Interdisciplinary care teams often consist of medical geneticists, cardiologists, pulmonary specialists, gastroenterologists, otolaryngologists, audiologists, and ophthalmologists. With the US Food and Drug Administration's approval of elosulfase alfa, patients >5 years of age now have access to this medication from the time of diagnosis. The clinical trial with once weekly intravenous dosing (2.0 mg/kg per week) showed improvement in the 6-minute walk test. The composite end point analysis to evaluate the combining changes from baseline in 6-minute walk test, 3-minute stair climb test, and respiratory function showed that at a dose of 2.0 mg/kg per week, subjects performed better when compared to placebo. This indication was clinically meaningful in the treatment group. The treatment was generally well tolerated, and the uncommon infusion reactions responded well to traditional enzyme replacement therapy infusion reaction management algorithms. Currently, clinical trials are underway to determine the efficacy and safety in MPS IVA patients <5 years of age.

  20. Epoetin alfa ja namaluva nefrotoksicnosta inducirana so cisplatin kaj staorci

    Directory of Open Access Journals (Sweden)

    Dimce Zafirov


    Full Text Available Klinickata efikasnost na cisplatin kako antitumorski lek e nesomnena, no dozno-limitiracki faktor za negova upotreba pretstavuva izrazitata nefrotoksicnost. Najnovite istrazuvawa pokazuvaat deka epoetin alfa moze da ima znacajna uloga ne samo vo terapiski celi za korekcija na razni vidovi na anemii, tuku istiot moze da bide efikasen i kako nevroprotektiv, hepatoprotektiv, kardioprotektiv i osobeno znacajno kako nefroprotektiv kaj nefrotoksicnost inducirana od preparati na baza na platina. Glavna cel na ovaa studija bese da se utvrdi efektot na epoetin alfa vo prevencijata na nefrotoksicnost eksperimentalno inducirana so dolgotrajna administracija na cisplatin vo doza od 2 mg/kg/t.t./nedela vo tek na 8 nedeli, kaj Wistar staorci. Dobienite rezultati od ovaa studija pokazuvaat deka epoetin alfa signifikantno gi ublazuva funkcionalnite bubrezni poremetuvawa inducirani so dolgotrajna administracija na cisplatin, ja podobruva opstata sostojba i go namaluva mortalitetot kaj ispituvanite zivotni.

  1. Fast Radio Burst Discovered in the Arecibo Pulsar ALFA Survey

    CERN Document Server

    Spitler, L G; Hessels, J W T; Lorimer, D R; McLaughlin, M A; Chatterjee, S; Crawford, F; Deneva, J S; Kaspi, V M; Wharton, R S; Allen, B; Bogdanov, S; Brazier, A; Camilo, F; Freire, P C C; Jenet, F A; Karako-Argaman, C; Knispel, B; Lazarus, P; Lee, K J; van Leeuwen, J; Lynch, R; Lyne, A G; Ransom, S M; Scholz, P; Siemens, X; Stairs, I H; Stovall, K; Swiggum, J K; Venkataraman, A; Zhu, W W; Aulbert, C; Fehrmann, H


    Recent work has exploited pulsar survey data to identify temporally isolated, millisecond-duration radio bursts with large dispersion measures (DMs). These bursts have been interpreted as arising from a population of extragalactic sources, in which case they would provide unprecedented opportunities for probing the intergalactic medium; they may also be linked to new source classes. Until now, however, all so-called fast radio bursts (FRBs) have been detected with the Parkes radio telescope and its 13-beam receiver, casting some concern about the astrophysical nature of these signals. Here we present FRB 121102, the first FRB discovery from a geographic location other than Parkes. FRB 121102 was found in the Galactic anti-center region in the 1.4-GHz Pulsar ALFA survey with the Arecibo Observatory with a DM = 557.4 $\\pm$ 3 pc cm$^{-3}$, pulse width of $3\\; \\pm 0.5$ ms, and no evidence of interstellar scattering. The observed delay of the signal arrival time with frequency agrees precisely with the expectation...

  2. Resolution and t-spectrum for the ALFA detector

    CERN Document Server

    Guergouri, Hichem


    My report as Summer Student is in two parts. In the first part I report about my attendance to the run of the ALFA detector to test different collimation schemas and find a new way to get rid of the background. The second part is about the measurement of the resolution of the ALFA detector and comparing the real data with the Monte-Carlo (MC) simulations. First of all I tried to be more familiar with ROOT, worked on understanding the code used to access to the data in the trees inside the Ntuples, plotting histograms,… This was done using old Ntuples which contain MC data.

  3. Rayleigh scattering and laser spot elongation problems at ALFA

    CERN Document Server

    Viard, E; Hubin, N; Ageorges, N; Davies, R


    This paper describes the qualitative effects of LGS spot elongation and Rayleigh scattering on ALFA wavefront sensor images. An analytical model of Rayleigh scattering and a numerical model of laser plume generation at the altitude of the Na-layer were developed. These models, integrated into a general AO simulation, provide the sensor sub-aperture images. It is shown that the centroid measurement accuracy is affected by these phenomena. The simulation was made both for the ALFA system and for the VLT Nasmyth Adaptive Optics System (NAOS).

  4. Darbepoetin alfa once every 2 weeks for treatment of anemia in dialysis patients

    DEFF Research Database (Denmark)

    Mann, J; Kessler, M; Villa, Giulio Palludan


    AIM: Darbepoetin alfa has a longer half-life than epoetin-(EPO) alfa or beta, allowing administration at less frequent intervals for the treatment of renal anemia. The aim of the present analysis was to evaluate the efficacy and tolerability of an every-2-week (Q2W) schedule of darbepoetin alfa...

  5. Physics prospects with the ALFA and AFP detectors

    CERN Document Server

    Hamal, Petr; The ATLAS collaboration


    The ATLAS ALFA and AFP detectors - the experimental challenge of measuring forward protons at the LHC. We will describe the experimental challenge presented by the measurement of the forward protons at the LHC. The ATLAS ALFA and AFP projects involve the deployment of detectors capable of detecting protons that emerge intact from the interaction with very small scattering angles. In the case of the ALFA detector, located at ±240m from the ATLAS interaction point, this measurement has to be performed using special high \\beta* beam optics. The detector chosen for the task is a nearly edgeless scintillating fibre tracker capable of making measurements at very low t – below 10-3 GeV2 – in the Nuclear Coulomb interference region. In order to reach these very small t-values we need to deploy the detector very near to the beam line utilizing Roman Pots. The main purpose of the ALFA detector is to measure the total p-p cross-section, a fundamental quantity in hadronic physics of importance to particle and to cos...

  6. Astronaut Scott Carpenter practices in the ALFA trainer at Langley (United States)


    Project Mercury Astronaut M. Scott Carpenter practices in the Air Lubricated Free Attitude (ALFA) trainer located at NASA's Manned Spacecraft Center at Langley AFB, Virginia. This trainer allows the astronaut to see the image of the earth's surface at his feet while manually controlling the spacecraft.

  7. Drotrecogin alfa (activated) in adults with septic shock.

    NARCIS (Netherlands)

    Ranieri, V.M.; Thompson, B.T.; Barie, P.S.; Dhainaut, J.F.; Douglas, I.S.; Finfer, S.; Gardlund, B.; Marshall, J.C.; Rhodes, A.; Artigas, A.; Payen, D.; Tenhunen, J.; Al-Khalidi, H.R.; Thompson, V.; Janes, J.; Macias, W.L.; Vangerow, B.; Williams, M.D.; Pickkers, P.; Raemaekers, J.M.


    BACKGROUND: There have been conflicting reports on the efficacy of recombinant human activated protein C, or drotrecogin alfa (activated) (DrotAA), for the treatment of patients with septic shock. METHODS: In this randomized, double-blind, placebo-controlled, multicenter trial, we assigned 1697 pati

  8. Estudios sobre alfa-amilasa en saliva como marcador de estrés en la especie humana y otras especies animales= Studies on salivary alpha-amylase as a maker of stress in human and different animal species


    Fuentes Rubio, María


    OBJETIVOS 1. Evaluar el uso de la alfa amilasa salivar como marcador de estrés usando técnicas tradicionales (ensayos enzimáticos) en humana, usando como modelo experimental a estudiantes de veterinaria que tenían que realizar una presentación oral de un trabajo en lengua extranjera. 2. Evaluar el uso de la alfa amilasa salivar como marcador de estrés usando técnicas tradicionales (ensayos enzimáticos) en cerdos. 3. Implementar nuevos enfoques para la medición de la alfa-amilasa e...

  9. Efficacy and safety of peginterferon alfa-2a and ribavirin treatment of chronic hepatitis C in the Republic of Serbia

    Directory of Open Access Journals (Sweden)

    Božić Milena


    Full Text Available Introduction. Hepatitis C virus (HCV infection is one of the main causes of chronic liver disease worldwide. Pegylated interferon alfa-2a or 2b (PEG IFN alfa-2a or 2b and ribavirin (RBV represent a standard treatment of chronic hepatitis C (CHC. Sustained virological response (SVR, defined as continued undetectable HCV RNA 24 weeks after completion of treatment, is universally considered as an indicator of treatment efficacy. Objective. The aim of this study was to determine efficacy and safety of PEG IFN alfa-2a and RBV treatment in patients with CHC in Serbia. Methods. One hundred seventy-six patients with CHC were included in this multicenter trial from 8 reference centers in Serbia. The patients were treated with standard PEG IFN alfa- 2a and RBV protocol. We performed the following virological testing: anti-HCV (ELISA, HCV RNK (quantitative PCR, HCV genotype (type-specific PCR, HBsAg, anti-HBs, anti-HBc and anti-HIV (ELISA. Histological activity and the degree of fibrosis were determined according to the Metavir scoring system. Potential predictors for achieving SVR were evaluated using multivariable logistic regression analysis. Results. Of the treated patients with CHC 65.9% were male, and 60.2% of them aged over 40 years. Of the treated patients 68.2% had infection over 5 years, 63% had HCV RNA >400.000 IU/mL, 76.1% had HCV G1/4, and 60.1% had a mild to moderate liver fibrosis. SVR was achieved in 78.9% of patients (G1/4 79.1%; G2/3 78.1%. The factors that indicated a poorer efficacy of the treatment were age >40 (p<0.05, high basal viremia (p=0.013, and the reduction of PEG IFN alfa-2a and RBV doses, with interruption of therapy (p<0.001. Of the treated patients 45.9% had adverse affects (G1/4 50.8%; G2/3 29.7%. Conclusion. Treatment of CHC with PEG IFN alfa-2a and RBV was efficient in 78.9% of patients. The safety profile of therapy was satisfactory. Longer therapy increases the possibility of the development of adverse affects. No

  10. Effect of acupuncture on TNF-alpha, IL-1b and IL-10 concentrations in the peritoneal exudates of carrageenan-induced peritonitis in rats Efeito da acupuntura sobre a concentração de TNF-alfa, IL-1b e IL-10 no exsudato peritoneal de ratos com peritonite induzida por carragenina

    Directory of Open Access Journals (Sweden)

    Márcia Valéria Rizzo Scognamillo-Szabó


    Full Text Available Acupuncture is an ancient and empirical therapeutic procedure known by its efficacy in the treatment of pain. However, the influence of acupuncture on inflammatory process is still poorly understood and additional research is needed. In this work, we investigated the mechanism of action of manual acupuncture on the inhibition of neutrophil migration to the peritoneal cavity induced by the inflammatory stimulus carrageenan in Wistar rats. Previous results from our laboratory showed that this anti-inflammatory effect is not due to endogenous corticoid release. Furthermore, the concentration of IL-1b, but not of TNF-alpha or IL-10 in the carrageenan-induced exudates was reduced in the acupuncture group. Further research will be needed to elucidate the mechanisms involved in the anti-inflammatory action of acupuncture as described here.A acupuntura é método terapêutico milenar reconhecido por sua eficácia no tratamento da dor, porém seu efeito sobre processos inflamatórios é ainda pouco conhecido e maiores estudos são necessários. Neste trabalho, é investigado o mecanismo de ação da acupuntura manual sobre a inibição na migração de neutrófilos para a cavidade peritoneal induzida por carragenina em ratos Wistar. Resultados prévios indicam que esse efeito antiinflamatório não depende de hormônios corticóides. Entretanto, as concentrações de IL-1b no exsudato induzido por carragenina foram reduzidas pelo tratamento com acupuntura. Por outro lado os níveis de TNF-alfa e IL-10 não foram afetados pelo tratamento. Mais pesquisas poderão elucidar os mecanismos envolvidos na ação antiinflamatória da acupuntura.

  11. Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy was underpowered

    Directory of Open Access Journals (Sweden)

    Ortiz A


    Full Text Available Alberto Ortiz,1,2 Maria Dolores Sanchez-Niño1,2 1Department of Nephrology, IIS-Fundacion Jimenez Diaz, School of Medicine, Universidad Autónoma de Madrid, 2Department of Nephrology, Instituto Reina Sofia de Investigación Nefrológica, Madrid, Spain We read with interest the report by Goláň et al on the “Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy in adults with Fabry disease”.1 Based on the reported results, the authors conclude that no efficacy or safety differences were found when the approved every-other-week (EOW dosage of agalsidase alfa was increased to weekly administration. However, the key question is whether the study, as designed and performed, could have had a different outcome. View original article by Goláň et al.

  12. Structural Analysis Of Alfa Fibers After Chemical Treatment

    Directory of Open Access Journals (Sweden)

    Zakaria Mouallif


    Full Text Available Nowadays, natural fibers are used as reinforcement in composite materials. The Alfa fibers have undergone an alkaline treatment with sodium hydroxide NaOH at a concentration of 10%, during an immersion period of two days. After drying, the Fourier transform infrared spectroscopy by attenuated total reflection (FTIR-ATR and X-ray diffraction (XRD were used for the analysis of the chemical properties of these fibers which were extracted from the plant Alfa of the region Al Haouz (Morocco in order to study the modifications resulting from the alkaline treatment. The results proved the presence of the cellulose, with an increase in its proportion in those fibers which have undergone an alkaline treatment with NaOH, the presence of lignin and pectin, as well as their disappearance after the alkaline extraction.

  13. Pathophysiology of hypophosphatasia and the potential role of asfotase alfa

    Directory of Open Access Journals (Sweden)

    Orimo H


    Full Text Available Hideo Orimo Division of Metabolism and Nutrition, Department of Biochemistry and Molecular Biology, Nippon Medical School, Tokyo, Japan Abstract: Hypophosphatasia (HPP is an inherited systemic bone disease that is characterized by bone hypomineralization. HPP is classified into six forms according to the age of onset and severity as perinatal (lethal, perinatal benign, infantile, childhood, adult, and odontohypophosphatasia. The causative gene of the disease is the ALPL gene that encodes tissue-nonspecific alkaline phosphatase (TNAP. TNAP is expressed ubiquitously, and its physiological role is apparent in bone mineralization. A defect in bone mineralization can manifest in several ways, including rickets or osteomalacia in HPP patients. Patients with severe forms suffer from respiratory failure because of hypoplastic chest, which is the main cause of death. They sometimes present with seizures due to a defect in vitamin B6 metabolism resulting from the lack of alkaline phosphatase activity in neuronal cells, which is also lethal. Patients with a mild form of the disease exhibit rickets or osteomalacia and a functional defect of exercise. Odontohypophosphatasia shows only dental manifestations. To date, 302 mutations in the ALPL gene have been reported, mainly single-nucleotide substitutions, and the relationships between phenotype and genotype have been partially elucidated. An established treatment for HPP was not available until the recent development of enzyme replacement therapy. The first successful enzyme replacement therapy in model mice using a modified human TNAP protein (asfotase alfa was reported in 2008, and subsequently success in patients with severe form of the disease was reported in 2012. In 2015, asfotase alfa was approved in Japan in July, followed by in the EU and Canada in August, and then by the US Food and Drug Administration in the USA in October. It is expected that therapy with asfotase alfa will drastically change

  14. Physics prospects with the ALFA and AFP detectors

    CERN Document Server

    Hamal, P; The ATLAS collaboration


    We will describe the experimental challenge presented by the measurement of the forward protons at the LHC. The ATLAS ALFA and AFP projects involve the deployment of detectors capable of detecting protons that emerge intact from the interaction with very small scattering angles. In the case of the ALFA detector, located at $\\pm${240}~m from the ATLAS interaction point, this measurement has to be performed using special high $\\beta^*$ beam optics. The detector chosen for the task is a nearly edgeless scintillating fibre tracker capable of making measurements at very low $t$ - below $10^{-3} \\text{GeV}^2$ - in the Nuclear Coulomb interference region. In order to reach these very small $t$ values we need to deploy the detector very near to the beam line utilizing Roman Pots. The main purpose of the ALFA detector is to measure the total p-p cross-section, a fundamental quantity in hadronic physics of importance to particle and to cosmic ray physicists and to provide absolute measurement of luminosity which includ...

  15. Reassessment of plutonium by alpha spectrometry planchets Aridus-DF-ICP-MS and 1 MV compact AMS; Reevaluacion de plutonio en planchetas de espectrometria alfa mediante ARIDUS-DF-ICP-MS y AMS compacto de 1 MV

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez Mendoza, H.; Chamizo Calvo, E.; Yllera de Llano, A.


    The aim of this study was to develop and validate, for the first time in Spain, an analytical method for the reevaluation of planchets containing small amounts of 239Pu (between 8 and 40 fg) using two mass spectrometric techniques: mass spectrometry dual approach with inductively coupled plasma source and de solvated Aridus (Aridus-DF-ICP-MS) and accelerator mass spectrometry compact 1 MV (AMS).

  16. Evidencia de la eficacia de los fármacos anti-TNF Alfa en el tratamiento de la espondilitis anquilosante


    Montilla Salas, Juan Manuel


    OBJETIVO Establecer la evidencia de los estudios clínicos sobre la eficacia de las terapias anti-TNF alfa para el tratamiento de la espondilitis anquilosante (EA). MÉTODOS Se realizó una búsqueda con los diferentes fármacos anti-NTF alfa actualmente utilizados en terapia de la espondilitis anquilosante (Infiximab, Etanercept y Adalimumab). La revisión bibliográfica se realizó en Medline, Embase y la librería Cochrane para los estudios controlados y randomizados publicados hasta 1-enero-2005. ...

  17. Fe3O4/Au magnetic nanoparticle amplification strategies for ultrasensitive electrochemical immunoassay of alfa-fetoprotein

    Directory of Open Access Journals (Sweden)

    Gan N


    Full Text Available Ning Gan1*, Haijuan Jin1*, Tianhua Li1, Lei Zheng21The State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Material Science and Chemical Engineering, Ningbo University, Ningbo, 2Department of Laboratory Medicine, Nanfang Hospital, Southern Medical University, Guangzhou, People's Republic of China *Both authors contributed equally to this workBackground: The purpose of this study was to devise a novel electrochemical immunosensor for ultrasensitive detection of alfa-fetoprotein based on Fe3O4/Au nanoparticles as a carrier using a multienzyme amplification strategy.Methods and results: Greatly enhanced sensitivity was achieved using bioconjugates containing horseradish peroxidase (HRP and a secondary antibody (Ab2 linked to Fe3O4/Au nanoparticles (Fe3O4/Au-HRP-Ab2 at a high HRP/Ab2 ratio. After a sandwich immunoreaction, the Fe3O4/Au-HRP-Ab2 captured on the electrode surface produced an amplified electrocatalytic response by reduction of enzymatically oxidized hydroquinone in the presence of hydrogen peroxide. The high content of HRP in the Fe3O4/Au-HRP-Ab2 could greatly amplify the electrochemical signal. Under optimal conditions, the reduction current increased with increasing alfa-fetoprotein concentration in the sample, and exhibited a dynamic range of 0.005–10 ng/mL with a detection limit of 3 pg/mL.Conclusion: The amplified immunoassay developed in this work shows good precision, acceptable stability, and reproducibility, and can be used for detection of alfa-fetoprotein in real samples, so provides a potential alternative tool for detection of protein in the laboratory. Furthermore, this immunosensor could be regenerated by simply using an external magnetic field.Keywords: Fe3O4/Au nanoparticles, alfa-fetoprotein, sandwich immunoassay, electrochemical immunosensor

  18. De-squeeze the beams: the TOTEM and ATLAS/ALFA experiments

    CERN Multimedia

    Stefania Pandolfi


    A special week-long proton–proton run with larger beam sizes at the interaction point is intended to probe the p-p elastic scattering regime at small angles.   Nicola Turini, deputy spokesperson for TOTEM, in front of one of the experiment’s ‘Roman Pot’ detectors in the LHC tunnel. (Photo: Maximilien Brice/CERN) Usually, the motto of the LHC is “maximum luminosity”. But for a few days per year, the LHC ignores its motto to run at very low luminosity for the forward experiments. This week, the LHC will provide the TOTEM and ATLAS/ALFA experiments with data for a broad physics programme. The TOTEM experiment at Point 5 and the ATLAS/ALFA experiment at Point 1 study the elastic scattering of protons, which are not observable in normal operation runs. In the elastic scattering process, the two protons survive their encounter intact and only change directions by exchanging momentum. To allow this special run, the operators play with the so-c...

  19. Long-term results of the randomized phase III trial EORTC 18991 of adjuvant therapy with pegylated interferon alfa-2b versus observation in resected stage III melanoma

    NARCIS (Netherlands)

    A.M.M. Eggermont (Alexander); S. Suciu (Stefan); A. Testori (Alessandro); M. Santinami (Mario); W.H.J. Kruit (Wim); J. Marsden; C.J.A. Punt (Cornelis); F. Salès (François); R. Dummer (Reinhard); C. Robert (Caroline); D. Schadendorf (Dirk); P. Patel (Poulam); G. de Schaetzen (Gaetan); A. Spatz (Alan); U. Keilholz (Ulrich)


    textabstractPurpose: Adjuvant pegylated interferon alfa-2b (PEG-IFN-α-2b) was approved for treatment of resected stage III melanoma in 2011. Here, we present long-term follow-up results of this pivotal trial. Patients and Methods: In all, 1,256 patients with resected stage III melanoma were randomly

  20. Pharmacokinetics of Novel Plant Cell-Expressed Taliglucerase Alfa in Adult and Pediatric Patients with Gaucher Disease.

    Directory of Open Access Journals (Sweden)

    Richat Abbas

    Full Text Available Taliglucerase alfa is a beta-glucocerebrosidase enzyme replacement therapy approved in the United States, Israel, and other countries for treatment of Type 1 Gaucher disease in adults, and is the first approved plant cell--expressed recombinant protein. In this report, taliglucerase alfa pharmacokinetics were assessed in adult and pediatric patients with Gaucher disease from separate multicenter trials of 30 Units/kg and 60 Units/kg doses infused every 2 weeks. Serial blood samples were obtained from adult patients following single-dose administration on day 1 (n = 26 and multiple doses at week 38 (n = 29, and from pediatric patients following administration of multiple doses of taliglucerase alfa for 10-27 months (n = 10. In both adult and pediatric patients, maximum plasma concentration (Cmax, area under the plasma concentration-time curve from time zero to last measureable concentration (AUC0-t, and from time zero to infinity (AUC0-∞ were higher after 60 Units/kg dose than 30 Units/kg dose. No tendency for accumulation or change in taliglucerase alfa pharmacokinetic parameters over time from day 1 to week 38 was observed with repeated doses of 30 or 60 Units/kg in adults. After multiple doses, mean (range dose-normalized pharmacokinetic parameters were similar for adult versus pediatric patients receiving 60 Units/kg: Cmax expressed in ng/mL/mg was 42.4 (14.5-95.4 in adults and 46.6 (34.4-68.4 in pediatric patients, AUC0 t expressed in ng • h/mL/mg was 63.4 (26.3-156 in adults and 63.9 (39.8-85.1 in pediatric patients, t1/2 expressed in minutes was 34.8 (11.3-104 in adults and 31.5 (18.0-42.9 in pediatric patients and total body clearance expressed in L/h was 19.9 (6.25-37.9 in adults and 17.0 (11.7-24.9 in pediatric patients. These pharmacokinetic data extend the findings of taliglucerase alfa in adult and pediatric NCT00376168 (in adults; NCT01411228 (in children.

  1. Pathophysiology of hypophosphatasia and the potential role of asfotase alfa (United States)

    Orimo, Hideo


    Hypophosphatasia (HPP) is an inherited systemic bone disease that is characterized by bone hypomineralization. HPP is classified into six forms according to the age of onset and severity as perinatal (lethal), perinatal benign, infantile, childhood, adult, and odontohypophosphatasia. The causative gene of the disease is the ALPL gene that encodes tissue-nonspecific alkaline phosphatase (TNAP). TNAP is expressed ubiquitously, and its physiological role is apparent in bone mineralization. A defect in bone mineralization can manifest in several ways, including rickets or osteomalacia in HPP patients. Patients with severe forms suffer from respiratory failure because of hypoplastic chest, which is the main cause of death. They sometimes present with seizures due to a defect in vitamin B6 metabolism resulting from the lack of alkaline phosphatase activity in neuronal cells, which is also lethal. Patients with a mild form of the disease exhibit rickets or osteomalacia and a functional defect of exercise. Odontohypophosphatasia shows only dental manifestations. To date, 302 mutations in the ALPL gene have been reported, mainly single-nucleotide substitutions, and the relationships between phenotype and genotype have been partially elucidated. An established treatment for HPP was not available until the recent development of enzyme replacement therapy. The first successful enzyme replacement therapy in model mice using a modified human TNAP protein (asfotase alfa) was reported in 2008, and subsequently success in patients with severe form of the disease was reported in 2012. In 2015, asfotase alfa was approved in Japan in July, followed by in the EU and Canada in August, and then by the US Food and Drug Administration in the USA in October. It is expected that therapy with asfotase alfa will drastically change treatments and prognosis of HPP. PMID:27274262

  2. Atividade inflamatória em mucosa de reservatório ileal na polipose adenomatosa familiar e retocolite ulcerativa inespecífica: avaliação da expressão de TNF-alfa e IL-1beta, e da ativação NF- kapaB Inflammatory activity in pelvic ileal pouches for familial adenomatous polyposis and ulcerative colitis: expression of TNF-alpha, IL-1beta and the activation of NF- kappaB

    Directory of Open Access Journals (Sweden)

    Raquel Franco Leal


    Full Text Available A ileíte do reservatório pós retocolectomia total constitui uma das complicações mais comuns nos doentes com RCUI, apresentando pequena freqüência nos doentes com PAF. OBJETIVO: Avaliar a atividade inflamatória em mucosa de reservatórios ileais endoscopicamente normais, através da expressão de TNF-alfa, NF-kapaB e IL-1beta. CASUÍSTICA E MÉTODOS: Selecionaram-se 20 doentes submetidos à retocolectomia total com reservatório ileal em "J" pelo Grupo de Coloproctologia da UNICAMP, sendo 10 doentes com RCUI e 10 com PAF. O grupo controle foi constituído por íleo terminal de intestino normal. Realizadas biópsias da mucosa do reservatório ileal e do íleo terminal normal, e congeladas em nitrogênio líquido. A expressão de TNF-alfa e IL-1beta foi analisada por extrato total e de NF-kB por meio de imunoprecipitado. A separação protéica foi feita por eletroforese em gel de poliacrilamida. RESULTADOS: Expressão de TNF-alfa e IL-1beta apresentaram níveis maiores nos doentes com RCUI, quando comparados àqueles com PAF (p0.1 e IL-1beta (p > 0.05 sem diferença estatística em relação aos demais grupos. CONCLUSÃO: Os doentes com RCUI apresentaram maiores níveis de expressão das citocinas estudadas, mesmo sem evidência clínica e endoscópica de ileíte do reservatório, podendo justificar maior suscetibilidade dos doentes com RCUI a esta complicação.Pouchitis after total retocolectomy is one of the most common complication of patients with ulcerative colitis (UC, while its frequency is quite rare in familial adenomatous polyposis (FAP. PURPOSE: To evaluate the inflammatory activity in endoscopicaly normal mucosa of the ileal pouch, by determining the expression of TNF-alpha and IL-1beta, and the activation of NF-kappaB. METHODS AND PATIENTS: Twenty patients with "J" pouch after total retocolectomy were studied, being 10 patients with UC and 10 with FAP. The control group was constituted by biopsies from terminal ileum take

  3. Reconocimiento de expresiones faciales empleando memorias asociativas Alfa-Beta


    Márquez Olivera, Moisés Vicente


    El presente trabajo de tesis orienta su atención en la compleja tarea del reconocimiento automático de las expresiones faciales, el propósito principal es probar la asertividad y competitividad de las memorias asociativas de tipo Alfa-Beta en el reconocimiento automático de expresiones faciales. La primera parte de la tesis brinda una breve introducción, la cual enfatiza la importancia de las expresiones faciales en la comunicación humana, incluyendo los estudios más relevantes dedicados a...

  4. Desarrollo de un sitio web para el proyecto Alfa Gaviota


    Trelles Labairu, Hilton


    Este proyecto muestra todos los pasos a seguir para recolectar, organizar, tratar y construir un portal web para el grupo de universidades partícipes en el proyecto Alfa Gaviota III utilizando un sistema gestor de contenidos. Se parte de una base de información recopilada en unas cuántas páginas html realizadas con la tecnología de google docs. Es un requisito indispensable conseguir una forma de almacenar toda la información del proyecto consumiendo el mínimo espacio y recurso...

  5. 意大利精灵——Alfa Romeo MITO

    Institute of Scientific and Technical Information of China (English)



    Alfa Romeo 是一个对激情执着的品牌,即便是对于MITO这样一部掀背小车也不例外,这部意大利制造的Alfa Romeo MITO上,会让你感受到一种热辣奔放的别样风情。

  6. De radioimmunochemische bepaling van de prostaglandines E2 en F2alfa

    NARCIS (Netherlands)

    Elvers LH; Smit PJ; Loeber JG


    In het kader van het onderzoek naar het werkingsmechanisme van de tumorpromotor activiteit van chemische stoffen (LCM, project 658113) werden radioimmunochemische bepalingsmethoden (RIA) voor de prostaglandines E2 (PGE2) en F2alfa (PGF2alfa) ontwikkeld. Het onderzoeksmateriaal, celextracten en medi

  7. Peginterferon alfa-2a for AIDS-associated Kaposi sarcoma: experience with 10 patients. (United States)

    Rokx, Casper; van der Ende, Marchina E; Verbon, Annelies; Rijnders, Bart J A


    In this observational cohort study, 10 patients with extensive or treatment-refractory AIDS-associated Kaposi sarcoma were treated with peginterferon alfa-2a. Tumor responses were observed in 9 patients with a median progression-free survival of 645 days. Peginterferon alfa-2a could be an effective therapy for extensive or treatment-resistant Kaposi sarcoma.

  8. Therapeutic efficacy of a biosimilar epoetin alfa in hemodialysis patients

    Directory of Open Access Journals (Sweden)

    Amel Harzallah


    Full Text Available Anemia is a frequent complication in patients with chronic kidney disease. However, human recombinant erythropoietin (rHu-EPO has revolutionized the management of anemia in chronically dialyzed patients. Epomax ® is a new rHu-EPO alfa manufactured in Tunisia (Medis Laboratories. The aim of this study was to evaluate the efficacy and tolerance of Epomax ® in chronic hemodialysis (HD patients in a phase-III, multicenter, clinical trial. Fiftythree HD patients (mean age 47.7 ± 13 years who received a stable dose of rHu-EPO (Hemax ® , a rHu-EPO alfa manufactured by Biosidus Laboratories subcutaneously were switched to Epomax ® via the same route of administration. At baseline, the mean systolic pressure was 132 ± 18 mm Hg and the mean diastolic pressure was 79 ± 8 mm Hg. The mean blood hemoglobin was 10.2 g/dL and the median ferritin level was 667 ng/mL. After a follow-up of 43 days, the mean blood hemoglobin was 10.5 g/dL under the effect of Epomax ® . There was no significant difference in the mean hemoglobin levels between the treatments with both drugs. Few adverse events were reported during the study. We conclude that Epomax ® was effective at maintaining the hemoglobin levels at target concentrations and was well tolerated in HD patients.

  9. Sintese de alfa-oxo-o-metiloximas e redução enantiosseletiva com fermento de pão. Obtenção de intermediarios para a preparação de 1,2-aminoalcoois quirais


    Olyr Celestino Kreutz


    Resumo: Neste trabalho foram desenvolvidas metodologias de redução assimétrica de alfa-oxo oximas do tipo ArC(O)C(NOR)R, utilizando Fermento de Pão como agente de redução assimétrica. Sintetizou-se várias alfa-oxo oximas (64 a 96% de rendimento) com o objetivo de estudar a influência dos grupos Ar, R e R (Ar = Bn, Furil, Naftil, 3,4-metilenodioxifenil, R = R = H = alquil ou aril) na enantiosseletividade da redução da função cetônica pelo Fermento de Pão (Saccharomyces cerevisiae). Os resultad...

  10. Assessment of the Results of the Multicenter Randomized Acute Leukemia French Association (ALFA) 9803 Trial%法国急性白血病协会(ALFA)9803多中心随机临床试验结果的评价

    Institute of Scientific and Technical Information of China (English)

    江滨; 凌伟


    @@ 1文献来源 Gardin C, Turlure P, Fagot T, et al. Postremission treatment of elderly patients with acute myeloid leukemia in first complete remission after intensive induction chemotherapy: Results of the multicenter randomized Acute Leukemia French Association (ALFA) 9803 trial [J]. Blood, 2007, 109(12) : 5129-5135.

  11. Nebulised dornase alfa versus placebo or hypertonic saline in adult critically ill patients

    DEFF Research Database (Denmark)

    Claudius, Casper; Perner, Anders; Møller, Morten Hylander


    BACKGROUND: Nebulised dornase alfa is used off-label in critically ill patients. We aimed to assess the benefits and harms of nebulised dornase alfa versus placebo, no prophylaxis, or hypertonic saline on patient-important outcome measures in adult critically ill patients. METHODS: We performed...... a systematic review with meta-analysis and trial sequential analysis (TSA) using the Cochrane Collaboration methodology. Eligible trials were randomised clinical trials comparing nebulised dornase alfa with placebo, no prophylaxis, or hypertonic saline. The predefined outcome measures were all-cause mortality...

  12. Measurement of the total cross section with ALFA Detector at ATLAS

    CERN Document Server

    Trzebinski, M; The ATLAS collaboration


    The main goals of the Absolute Luminosity For ATLAS (ALFA) detector is to provide an absolute luminosity and total cross section measurement. The measurement method used, the detector alignment and the quality of the collected data are discussed.

  13. Alfa tahab TeliaSonerat Türgis üle pakkuda / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-


    TeliaSoneraga, kellele kuulub 37 protsenti Türgi operaatorfirma Turkcell aktsiatest, konkureerib täiendava 27 protsendise aktsiapaki ostmises Venemaa operaatorfirmaga Alfa Telecom. Lisa: Kaasosanike huvid põrkuvad. Diagramm: Konkurendid Vene MegaFonis

  14. Elosulfase Alfa: a review of its use in patients with mucopolysaccharidosis type IVA (Morquio A syndrome). (United States)

    Lyseng-Williamson, Katherine A


    Elosulfase alfa (Vimizim(®)) is a recombinant form of the human lysosomal enzyme N-acetylgalactosamine-6-sulfatase (GALNS) that is lacking in patients with mucopolysaccharidosis type IVA (MPS IVA; Morquio A syndrome). It is the first, and currently only, disease-specific treatment option for this very rare, progressively degenerative, autosomal-recessive lysosomal storage disorder. Enzyme replacement therapy with elosulfase alfa aims to restore GALNS activity, thereby preventing the accumulation of keratan sulfate (KS) and chondroitin-6-sulfate in lysosomal compartments of cells that results in the clinical manifestations of MPS IVA. In clinical trials in children and adults with MPS IVA, intravenous elosulfase alfa 2 mg/kg/week provided significant and sustained improvements in urinary levels of KS (a pharmacodynamic biomarker for the disease). In the key placebo-controlled, 24-week, phase 3 trial in patients with MPS IVA aged ≥5 years, elosulfase alfa 2 mg/kg/week significantly improved endurance [least squares mean placebo-adjusted change from baseline in 6-min walk test distance 22.5 m (95 % CI 4.0-40.9)]. Infusion-associated reactions, the primary tolerability issue associated with elosulfase alfa, are generally mild to moderate in severity, self-limiting, and manageable. In the absence of a cure, GALNS enzyme replacement therapy with elosulfase alfa is an important achievement in the treatment of MPS IVA.

  15. Factor de necrosis tumoral alfa en pacientes con preeclampsia a término y pretérmino

    Directory of Open Access Journals (Sweden)

    Eduardo Reyna Villasmil


    Full Text Available El objetivo de la investigación fue identificar y comparar las concentraciones de factor de necrosis tumoral alfa en pacientes con preeclampsia a término y pre-término. Se seleccionó un total de 50 pacientes. Se incluyeron a 20 pacientes preeclámpticas pre-término (grupo A y 30 preeclámpticas a término (grupo B. Las muestras de sangre para la determinación de factor de necrosis tumoral alfa se recolectaron en todas las pacientes antes del parto e inmediatamente después del diagnóstico de preeclampsia. No se encontraron diferencias significativas con relación a la edad materna e Índice de masa corporal al momento de la toma de la muestra. Se observaron diferencias estadísticamente significativas entre los grupos con respecto a la edad gestacional (p < 0,0001. El valor promedio de la presión arterial sistólica en el grupo A fue de 149,4 ± 11,3 mmHg mientras que en las pacientes del grupo B fue de 148,1 ± 12,3 mmHg (p = 0,7071 y el valor promedio de presión arterial diastólica en el grupo A fue de 103,8 ± 8,6 mmHg y en el grupo B fue de 102,7 ± 7,9 mmHg (p = 0,6436. Las concentraciones de factor de necrosis tumoral alfa fueron similares en el grupo de preeclámpticas pre-término (98,2 ± 45,1 pg/mL comparado con el grupo de preeclámpticas a término (96,6 ± 48,7 pg/mL; p = 0,9072. Al realizar la correlación entre los valores de factor de necrosis tumoral alfa con los valores de presión arterial se observó que no existía correlación con la presión arterial sistólica (r = 0,129; p = 0,374 ni con la de presión arterial diastólica (r = 0,158, p = 0,273. Se concluye que las concentraciones sanguíneas del factor de necrosis tumoral alfa resultaron similares en las pacientes preeclámpticas con embarazo pretérmino y a término. La correlación de las concentraciones de factor de necrosis tumoral alfa con los valores de presión arterial sistólica y diastólica resultó no significativa. Palabras clave:Factor de

  16. Performance evaluation and optimization of the luminosity detector ALFA

    CERN Document Server

    Jakobsen, Sune; Grafström, P; Joram, C


    The startup of the LHC (Large Hadron Collider) has initialized a new era in particle physics. The standard model of particle physics has for the last 40 years with tremendous success described all measurements with phenomenal precision. The experiments at the LHC will test the standard model in a new energy regime. To normalize the measurements and understand the potential discoveries of the LHC experiments it is often crucial to know the interaction rate - the absolute luminosity. The ATLAS (A Toroidal LHC ApparatuS) detector will measure luminosity by numerous methods. But for most of the methods only the relative luminosity is measured with good precision. The absolute scale has to be provided from elsewhere. Therefore ATLAS plans to measure the flux of protons scattered under very small angles as this flux relates directly and with good precision to the absolute luminosity. This will be done by the ALFA (Absolute Luminosity For ATLAS) detector. The detectors will be positioned about 240 m from the interac...

  17. Baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) (United States)

    McMurray, John J.V.; Anand, Inder S.; Diaz, Rafael; Maggioni, Aldo P.; O'Connor, Christopher; Pfeffer, Marc A.; Solomon, Scott D.; Tendera, Michal; van Veldhuisen, Dirk J.; Albizem, Moetaz; Cheng, Sunfa; Scarlata, Debra; Swedberg, Karl; Young, James B.; Amuchastegui, M.; Belziti, C.; Bluguermann, J.; Caccavo, M.; Cartasegna, L.; Colque, R.; Cuneo, C.; Fernandez, A.; Gabito, A.; Goicochea, R.; Gonzalez, M.; Gorosito, V.; Grinfeld, L.; Hominal, M.; Kevorkian, R.; Litvak Bruno, M.; Llanos, J.; Mackinnon, I.; Manuale, O.; Marzetti, E.; Nul, D.; Perna, E.; Riccitelli, M.; Sanchez, A.; Santos, D.; Schygiel, P.; Toblli, J.; Vogel, D.; Aggarwal, A.; Amerena, J.; De Looze, F.; Fletcher, P.; Hare, D.; Ireland, M.; Krum, H.; Lattimore, J.; Marwick, T.; Sindone, A.; Thompson, P.; Waites, J.; Altenberger, J.; Ebner, C.; Lenz, K.; Pacher, R.; Poelzl, G.; Charlier, F.; de Ceuninck, M.; De Keulenaer, G.; Dendale, P.; Maréchal, P.; Mullens, W.; Thoeng, J.; Vanderheyden, M.; Vanhaecke, J.; Weytjens, C.; Wollaert, B.; Albuquerque, D.; Almeida, D.; Aspe y Rosas, J.; Bocchi, E.; Bordignon, S.; Clausell, N.; Kaiser, S.; Leaes, P.; Martins Alves, S.; Montera, M.; Moura, L.; Pereira de Castro, R.; Rassi, S.; Reis, A.; Saraiva, J.; Simões, M.; Souza Neto, J.; Teixeira, M.; Benov, H.; Chompalova, B.; Donova, T.; Georgiev, P.; Gotchev, D.; Goudev, A.; Grigorov, M.; Guenova, D.; Hergeldjieva, V.; Ivanov, D.; Kostova, E.; Manolova, A.; Marchev, S.; Nikolov, F.; Popov, A.; Raev, D.; Tzekova, M.; Czarnecki, W.; Giannetti, N.; Haddad, H.; Heath, J.; Huynh, T.; Lepage, S.; Liu, P.; Lonn, E.; Ma, P.; Manyari, D.; Moe, G.; Parker, J.; Pesant, Y.; Rajda, M.; Ricci, J.; Roth, S.; Sestier, F.; Sluzar, V.; Sussex, B.; Vizel, S.; Antezana, G.; Bugueno, C.; Castro, P.; Conejeros, C.; Manriquez, L.; Martinez, D.; Potthoff, S.; Stockins, B.; Vukasovic, J.; Gregor, P.; Herold, M.; Jerabek, O.; Jirmar, R.; Kuchar, R.; Linhart, A.; Podzemska, B.; Soucek, M.; Spac, J.; Spacek, R.; Vodnansky, P.; Bronnum-Schou, J.; Clemmensen, K.; Egstrup, K.; Jensen, G.; Kjoller-Hansen, L.; Kober, L.; Markenvard, J.; Rokkedal, J.; Skagen, K.; Torp-Pedersen, C.; Tuxen, C.; Videbak, L.; Laks, T.; Vahula, V.; Harjola, V.; Kettunen, R.; Kotila, M.; Bauer, F.; Cohen Solal, A.; Coisne, D.; Davy, J.; De Groote, P.; Dos Santos, P.; Funck, F.; Galinier, M.; Gibelin, P.; Isnard, R.; Neuder, Y.; Roul, G.; Sabatier, R.; Trochu, J.; Anker, S.; Denny, S.; Dreykluft, T.; Flesch, M.; Genth-Zotz, S.; Hambrecht, R.; Hein, J.; Jeserich, M.; John, M.; Kreider-Stempfle, H.; Laufs, U.; Muellerleile, K.; Natour, M.; Sandri, M.; Schäufele, T.; von Hodenberg, E.; Weyland, K.; Winkelmann, B.; Tse, H.; Yan, B.; Barsi, B.; Csikasz, J.; Dezsi, C.; Edes, I.; Forster, T.; Karpati, P.; Kerekes, C.; Kis, E.; Kosa, I.; Lupkovics, G.; Nagy, A.; Preda, I.; Ronaszeki, A.; Tomcsanyi, J.; Zamolyi, K.; Agarwal, D.; Bahl, V.; Bordoloi, A.; Chockalingam, K.; Chopda, M.; Chopra, V.; Dugal, J.; Ghaisas, N.; Ghosh, S.; Grant, P.; Hiremath, S.; Iyengar, S.; Jagadeesa Subramania, B.; Jain, P.; Joshi, A.; Khan, A.; Mullasari, A.; Naik, S.; Oomman, A.; Pai, V.; Pareppally Gopal, R.; Parikh, K.; Patel, T.; Prakash, V.; Sastry, B.; Sathe, S.; Sinha, N.; Srikanthan, V.; Subburamakrishnan, P.; Thacker, H.; Wander, G.; Admon, D.; Katz, A.; Klainman, E.; Lewis, B.; Marmor, A.; Moriel, M.; Mosseri, M.; Shotan, A.; Weinstein, J.; Zimlichman, R.; Agostoni, P.; Albanese, M.; Alunni, G.; Bini, R.; Boccanelli, A.; Bolognese, L.; Campana, C.; Carbonieri, E.; Carpino, C.; Checco, L.; Cosmi, F.; D'Angelo, G.; De Cristofaro, M.; Floresta, A.; Fucili, A.; Galvani, M.; Ivleva, A.; Marra, S.; Musca, G.; Peccerillo, N.; Perrone Filardi, P.; Picchio, E.; Russo, T.; Scelsi, L.; Senni, M.; Tavazzi, L.; Erglis, A.; Jasinkevica, I.; Kakurina, N.; Veze, I.; Volans, E.; Bagdonas, A.; Berukstis, E.; Celutkiene, J.; Dambrauskaite, A.; Jarasuniene, D.; Luksiene, D.; Rudys, A.; Sakalyte, G.; Sliaziene, S.; Aguilar-Romero, R.; Cardona-Muñoz, E.; Castro-Jimenez, J.; Chavez-Herrera, J.; Chuquiure Valenzuela, E.; De la Pena, G.; Herrera, E.; Leiva-Pons, J.; Lopez Alvarado, A.; Mendez Machado, G.; Ramos-Lopez, G.; Basart, D.; Buijs, E.; Cornel, J.; de Leeuw, M.; Dijkgraaf, R.; Dunselman, P.; Freericks, M.; Hamraoui, K.; Lenderlink, T.; Linssen, G.; Lodewick, P.; Lodewijks, C.; Lok, D.; Nierop, P.; Ronner, E.; Somsen, A.; van Dantzig, J.; van der Burgh, P.; van Kempen, L.; van Vlies, B.; Voors, A.; Wardeh, A.; Willems, F.; Dickstein, K.; Gundersen, T.; Hole, T.; Thalamus, J.; Westheim, A.; Dabrowski, M.; Gorski, J.; Korewicki, J.; Kuc, K.; Miekus, P.; Musial, W.; Niegowska, J.; Piotrowski, W.; Podolec, P.; Polonski, L.; Ponikowski, P.; Rynkiewicz, A.; Szelemej, R.; Trusz-Gluza, M.; Ujda, M.; Wojciechowski, D; Wysokinski, A.; Camacho, A.; Fonseca, C.; Monteiro, P.; Apetrei, E.; Bruckner, I.; Carasca, E.; Coman, I.; Datcu, M.; Dragulescu, S.; Ionescu, P.; Iordachescu-Petica, D.; Manitiu, I.; Popa, V.; Pop-Moldovan, A.; Radoi, M.; Stamate, S.; Tomescu, M.; Vita, I.; Aroutiounov, G.; Ballyuzek, M.; Bart, B.; Churina, S.; Glezer, M.; Goloshchekin, B.; Ivleva, A.; Kobalava, Z.; Kostenko, V.; Lopatin, Y.; Martynov, A.; Orlov, V.; Semernin, E.; Shogenov, Z.; Sidorenko, B.; Skvortsov, A.; Storzhakov, G.; Sulimov, V.; Talibov, O.; Tereshenko, S.; Tsyrline, V.; Zadionchenko, V.; Zateyshchikov, D.; Dzupina, A.; Hranai, M.; Kmec, J.; Micko, K.; Murin, J.; Pella, D.; Sojka, G.; Spisak, V.; Vahala, P.; Vinanska, D.; Badat, A.; Bayat, J.; Dawood, S.; Delport, E.; Ellis, G.; Garda, R.; Klug, E.; Mabin, T.; Naidoo, D.; Pretorius, M.; Ranjith, N.; Van Zyl, L.; Weich, H.; Anguita, M.; Berrazueta, J.; Bruguera i Cortada, J.; de Teresa, E.; Gómez Sánchez, M.; González Juanatey, J.; Gonzalez-Maqueda, I.; Jordana, R.; Lupon, J.; Manzano, L.; Pascual Figal, D.; Pulpón, L.; Recio, J.; Ridocci Soriano, F.; Rodríguez Lambert, J.; Roig Minguell, E.; Roig Minguell, E.; Romero, J.; Valdovinos, P.; Klintberg, L.; Kronvall, T.; Lycksell, M.; Morner, S.; Rydberg, E.; Swedberg, K.; Timberg, I.; Wikstrom, G.; Moccetti, T.4; Ashok, J.; Banerjee, P.; Carr-White, G.; Cleland, J.; Connolly, E.; Francis, M.; Greenbaum, R.; Kadr, H.; Lindsay, S.; McMurray, J.; Megarry, S.; Memon, A.; Murdoch, D.; Senior, R.; Squire, I.; Tan, L.; Witte, K.; Adams, K.; Adamson, P.; Adler, A.; Altschul, L.; Altschuller, A.; Amirani, H.; Anand, I.; Andreou, C.; Ansari, M.; Antonishen, M.; Banchs, H.; Banerjee, S.; Banish, D.; Bank, A.; Barbagelata, A.; Barnard, D.; Bellinger, R.; Benn, A.; Berk, M.; Berry, B.; Bethala, V.; Bilazarian, S.; Bisognano, J.; Bleyer, F.; Blum, M.; Boehmer, J.; Bouchard, A.; Boyle, A.; Bozkurt, B.; Brown, C.; Burlew, B.; Burnham, K.; Butler, J.; Call, J.; Cambier, P.; Cappola, T.; Carlson, R.; Chandler, B.; Chandra, R.; Chandraratna, P.; Chernick, R.; Colan, D.; Colfer, H.; Colucci, W.; Connelly, T.; Costantini, O.; Dadkhah, S.; Dauber, I.; Davis, J.; Davis, S.; Denning, S.; Drazner, M.; Dunlap, S.; Egbujiobi, L.; Elkayam, U.; Elliott, J.; El-Shahawy, M.; Essandoh, L.; Ewald, G.; Fang, J.; Farhoud, H.; Felker, G.; Fernandez, J.; Festin, R.; Fishbein, G.; Florea, V.; Flores, E.; Floro, J.; Gabris, M.; Garg, M.; Gatewood, R.; Geller, M.; Ghali, J.; Ghumman, W.; Gibbs, G.; Gillespie, E.; Gilmore, R.; Gogia, H.; Goldberg, L.; Gradus-Pizlo, I.; Grainger, T.; Gudmundsson, G.; Gunawardena, D.; Gupta, D.; Hack, T.; Hall, S.; Hamroff, G.; Hankins, S.; Hanna, M.; Hargrove, J.; Haught, W.; Hauptman, P.; Hazelrigg, M.; Herzog, C.; Heywood, J.; Hill, T.; Hilton, T.; Hirsch, H.; Hunter, J.; Ibrahim, H.; Imburgia, M.; Iteld, B.; Jackson, B.; Jaffrani, N.; Jain, D.; Jain, A.; James, M.; Jimenez, J.; Johnson, E.; Kale, P.; Kaneshige, A.; Kapadia, S.; Karia, D.; Karlsberg, R.; Katholi, R.; Kerut, E.; Khoury, W.; Kipperman, R.; Klapholz, M.; Kosinski, E.; Kozinn, M.; Kraus, D.; Krueger, S.; Krum, H.; Kumar, S.; Lader, E.; Lee, C.; Levy, W.; Lewis, E.; Light-McGroary, K.; Loh, I.; Lombardi, W.; Machado, C.; Maislos, F.; Mancini, D.; Markus, T.; Mather, P.; McCants, K.; McGrew, F.; McLaurin, B.; McMillan, E.; McNamara, D.; Meyer, T.; Meymandi, S.; Miller, A.; Minami, E.; Modi, M.; Mody, F.; Mohanty, P.; Moscoso, R.; Moskowitz, R.; Moustafa, M.; Mullen, M.; Naz, T.; Noonan, T.; O'Brien, T.; Oellerich, W.; Oren, R.; Pamboukian, S.; Pereira, N.; Pitt, W.; Porter, C.; Prabhu, S.; Promisloff, S.; Ratkovec, R.; Richardson, R.; Ross, A.; Saleh, N.; Saltzberg, M.; Sarkar, S.; Schmedtje, J.; Schneider, R.; Schuyler, G.; Shanes, J.; Sharma, A.; Siegel, C.; Siegel, R.; Silber, D.; Singh, V.; Singh, N.; Singh, J.; Sklar, J.; Small, R.; Smith, A.; Smith, E.; Smith, E.; Smull, D.; Sotolongo, R.; Staniloae, C.; Stapleton, D.; Steele, P.; Stehlik, J.; Stein, M.; Tang, W.; Thadani, U.; Torre-Amoine, G.; Trichon, B.; Tsai, C.; Tummala, R.; Van Bakel, A.; Vicari, R.; Vijay, N.; Vijayaraghavan, K.; Vittorio, T.; Vossler, M.; Wagoner, L.; Wallis, D.; Ward, N.; Widmer, M.; Wight, J.; Wilkins, C.; Williams, C.; Williams, G.; Winchester, M.; Winkel, E.; Wittmer, B.; Wood, D.; Wormer, D.; Wright, R.; Xu, Z.; Yasin, M.; Zolty, R.


    Aims This report describes the baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) which is testing the hypothesis that anaemia correction with darbepoetin alfa will reduce the composite endpoint of death from any cause or hospital admission for worsening heart failure, and improve other outcomes. Methods and results Key demographic, clinical, and laboratory findings, along with baseline treatment, are reported and compared with those of patients in other recent clinical trials in heart failure. Compared with other recent trials, RED-HF enrolled more elderly [mean age 70 (SD 11.4) years], female (41%), and black (9%) patients. RED-HF patients more often had diabetes (46%) and renal impairment (72% had an estimated glomerular filtration rate <60 mL/min/1.73 m2). Patients in RED-HF had heart failure of longer duration [5.3 (5.4) years], worse NYHA class (35% II, 63% III, and 2% IV), and more signs of congestion. Mean EF was 30% (6.8%). RED-HF patients were well treated at randomization, and pharmacological therapy at baseline was broadly similar to that of other recent trials, taking account of study-specific inclusion/exclusion criteria. Median (interquartile range) haemoglobin at baseline was 112 (106–117) g/L. Conclusion The anaemic patients enrolled in RED-HF were older, moderately to markedly symptomatic, and had extensive co-morbidity. PMID:23329651

  18. Estudo da coerência do eletrencefalograma na banda de frequência alfa em indivíduos adultos normais: resultados preliminares em 10 casos EEG alpha band coherence analysis in healthy adults: preliminary results

    Directory of Open Access Journals (Sweden)

    Renato Anghinah


    Full Text Available A coerência espectral inter-hemisférica do eletrencefalograma da região occipital do escalpo (eletrodos O1 e O2 foi estimada usando a transformada rápida de Fourier. As médias de coerências na banda de freqüência alfa (alfa1 - 8,0 a 10,0 Hz e alfa2 -10,1 a 12,5 Hz em indivíduos normais com mais de 50 anos foram comparadas com as obtidas em adultos jovens com idade inferior a 50 anos. Nossos resultados mostraram que não há diferença significativa dos níveis de coerência na banda alfa entre indivíduos em faixas etárias mais avançadas comparados aos adultos jovens.We studied the occipital inter-hemispheric coherence of Electroencephalogram (electrodes O1-O2 for alpha band (alpha1 - 8,0 to 10,0 Hz and alpha2 - 10,1 to 12,5 Hz in two groups of healthy individuals (young adults and subjects older than 50 years-old, to assess if there is significant difference between this two age groups. No significant difference in alpha band coherences was found between these two age groups.

  19. Effects of MAPP Compatibilization and Acetylation Treatment Followed by Hydrothermal Aging on Polypropylene Alfa Fiber Composites

    Directory of Open Access Journals (Sweden)

    Noura Hamour


    Full Text Available This work investigates the effect of hydrothermal aging on the properties of polypropylene/alfa fiber composites. Hydrothermal aging was induced in an environmental testing chamber at 65°C and 75% relative humidity (RH over a 1000 h period. At the beginning (t=0 h, the results showed that Young’s moduli of the untreated alfa fibers and the acetylation-treated fibers increased by 21% and 36%, respectively, compared with the virgin polypropylene (PP. Additionally, Young’s moduli decreased by 7% for the compatibilized composites composed of maleic anhydride grafted polypropylene (MAPP. After 1000 h of aging, Young’s moduli decreased by 36% for untreated alfa fibers and 29% for the acetylation-treated alfa fibers and the compatibilized composites. Significant degradation was observed in the untreated alfa fiber samples. The Fourier transformed infrared (FTIR allows us to distinguish the characteristic absorption bands of the main chemical functions present in the composite material before and after aging. The thermal properties showed that the thermal stability and the degree of crystallinity of the composites decreased after hydrothermal aging; this result was corroborated by the dynamical mechanical analysis (DMA results.

  20. Estudo da coerência do eletrencefalograma para a banda de frequência alfa em indivíduos adultos normais e com provável demência do tipo Alzheimer

    Directory of Open Access Journals (Sweden)



    Full Text Available Estudamos a coerência inter-hemisférica do espectro do eletrencefalograma (EEG obtido pela transformada rápida de Fourier, da região occipital do escalpo (eletrodos O1 e O2 para a banda de frequência alfa (alfa1 - 8,0 a 10,0 Hz e alfa2 -10,1 a 12,5 Hz em indivíduos normais maiores de 50 anos e pacientes com diagnóstico provável de demência do tipo Alzheimer (DTA, no intuíto de observar se há diferenças entre estes parâmetros que contribuam com o diagnóstico desta enfermidade. Encontramos diminuição na coerência inter-hemisférica dos indivíduos com DTA para ambas as sub-bandas do ritmo alfa. Acreditamos que a análise de coerência do EEG possa ser um método de grande auxílio no diagnóstico de DTA

  1. Dificuldades na identificação laboratorial da talassemia alfa


    Dias-Penna,Karlla Greick Batista; Melo-Reis,Paulo Roberto de; Mesquita, Mauro Meira de; Silva, Jairo Batista da; Bataus,Luiz Artur Mendes


    Introdução: Talassemia alfa é uma síndrome associada à redução da síntese de cadeias de globina do tipo alfa. A gravidade das manifestações clínicas está relacionada com a quantidade de globinas produzida e a estabilidade das cadeias beta presentes em excesso. A talassemia alfa mínima resulta da deleção de apenas um dos quatro genes a (-α/αα). Clinicamente apresenta anemia leve com microcitose ou ausência de anemia, sendo o diagnóstico realizado por meio de visualização da hemo...

  2. Design and Manufacture of the Irradiation Complex "Alfa" for Track Membranes Production

    CERN Document Server

    Alenitsky, Yu G; Vylov, T D; Glazov, A A; Danilov, V I; Denisov, Yu N; Dmitrievsky, V P; Dolya, S N; Zaplatin, N L; Ivashkevich, S A; Kadyshevskij, V G; Kalinichenko, V V; Karamysheva, G A; Klimkin, I P; Kochkin, V A; Morozov, N A; Novikov, D L; Smolkov, A V; Tolstoy, N S; Tychkov, Yu I; Utkin, V A; Fedorenko, S B; Chesnov, A F


    The film irradiation complex "Alfa" intended for exposing the polymer films used in the track membranes production was designed and manufactured at the Joint Institute for Nuclear Research for "Trackpore Technology" holding company. The complex consists of the isochronous cyclotron with external injection of ions, the extraction system, the beam transport of accelerated ions and the film irradiation chamber. The complex "Alfa" produces polyethylene terephthalate track membranes with less than 25 {\\mu}m thickness and less than 40 cm width. The film irradiation complex "Alfa" started working in August 2002. Argon ions were accelerated to the project energy - 2.4 MeV/nucleon, extracted beam intensity was about 200 nA, extraction efficiency totaled \\sim 50 %.

  3. Baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF)

    NARCIS (Netherlands)

    McMurray, John J. V.; Anand, Inder S.; Diaz, Rafael; Maggioni, Aldo P.; O'Connor, Christopher; Pfeffer, Marc A.; Solomon, Scott D.; Tendera, Michal; van Veldhuisen, Dirk J.; Albizem, Moetaz; Cheng, Sunfa; Scarlata, Debra; Swedberg, Karl; Young, James B.


    Aims This report describes the baseline characteristics of patients in the Reduction of Events with Darbepoetin alfa in Heart Failure trial (RED-HF) which is testing the hypothesis that anaemia correction with darbepoetin alfa will reduce the composite endpoint of death from any cause or hospital ad

  4. Peg-Interferon Alfa 2-b Related Cellulitis in a 40 Years Man

    Directory of Open Access Journals (Sweden)

    Shahnaaz Sali


    Full Text Available Background: Pegylated interferon and ribavirin are currently one of the accepted treatment for chronic Hepatitis C. Dermatologic complications of interferon have been reported, but to date a few cases of bacterial cellulitis; a rare and severe complication, have been published. Cellulitis is a common infectious process affecting the skin and subcutaneous tissues which results in significant morbidity and holds considerable healthcare costs.Cases Report: Herein, we report a case of chronic hepatitis C genotype 1a who was on medication since 8 weeks prior to developing leg cellulitis, an uncommon pegylated interferon injection site. Considering no other possible risk factors were found to be in favor of bacterial cellulitis, our case is unique in its kind. Some reports reveal necrotizing vasculitis as basis for cutaneous lesions, which could be due to the high concentrations of drug at the injection site, a toxic effect of the diluents, or an immunological reaction.Conclusion: According to the latter mechanism patients could develop bacterial cellulitis in their different organs. Conclusively, we propose the hypothesis of a possible association between cellulitis to occur at any site as the complication of pegylated interferon Alfa 2b and would highlight the role of a careful skin examination that could be an asset in preventing local skin infections.

  5. Effect of wool and thermo-binder fibers on adhesion of alfa fibers in polyester composite (United States)

    Omri, Med. Amin; Triki, A.; Guicha, M.; Hassen, Med. Ben; Arous, M.; Ahmed El Hamzaoui, H.; Bulou, A.


    Dielectric study was investigated in order to probe the interfacial region fibers/matrix of the polyester composite reinforced with alfa/wool/thermo-binder fibers. Dielectric spectra were measured in the frequency range from 10-1 Hz to 106 Hz, and temperature interval from 40 °C to 150 °C. This study revealed the presence of two dielectric relaxations in the composite. While the first one was attributed to the α mode relaxation associated with the glass transition of the matrix, the second was associated with the conductivity resulting from the carriers' charges diffusion noted for high temperature above glass transition and low frequencies. As this study did not show the presence of the interfacial polarization effect in the composite, it was accomplished with the vibrational study using the FT-IR and Raman techniques. A great compatibility between fibers and matrix was proven by a less hydrophilic character of the reinforcement giving rise to additional valence vibrations from wool fibers and hydrogen bonds.

  6. Arecibo Pulsar Survey Using ALFA. III. Precursor Survey and Population Synthesis

    CERN Document Server

    Swiggum, J K; McLaughlin, M A; Bates, S D; Champion, D J; Ransom, S M; Lazarus, P; Brazier, A; Hessels, J W T; Nice, D J; Ellis, J; Senty, T R; Allen, B; Bhat, N D R; Bogdanov, S; Camilo, F; Chatterjee, S; Cordes, J M; Crawford, F; Deneva, J S; Freire, P C C; Jenet, F A; Karako-Argaman, C; Kaspi, V M; Knispel, B; Lee, K J; Van Leeuwen, J; Lynch, R; Lyne, A G; Scholz, P; Siemens, X; Stairs, I H; Stappers, B W; Stovall, K; Venkataraman, A; Zhu, W W


    The Pulsar Arecibo L-band Feed Array (PALFA) Survey uses the ALFA 7-beam receiver to search both inner and outer Galactic sectors visible from Arecibo ($32^{\\circ}\\lesssim \\ell \\lesssim 77^{\\circ}$ and $168^{\\circ}\\lesssim \\ell \\lesssim 214^{\\circ}$) close to the Galactic plane ($|b|\\lesssim5^{\\circ}$) for pulsars. In this paper we detail a precursor survey of this region with PALFA, which observed a subset of the full region (slightly more restrictive in $\\ell$ and $|b|\\lesssim1^{\\circ}$) and detected 45 pulsars. For both Galactic millisecond and normal pulsar populations, we compare the survey's detections with simulations to model these populations and, in particular, to estimate the number of observable pulsars in the Galaxy. We place 95\\% confidence intervals of 82,000 to 143,000 on the number of detectable normal pulsars and 9,000 to 100,000 on the number of detectable millisecond pulsars in the Galactic disk. These are consistent with previous estimates. Given the most likely population size in each ca...

  7. Reversing anticoagulant effects of novel oral anticoagulants: role of ciraparantag, andexanet alfa, and idarucizumab

    Directory of Open Access Journals (Sweden)

    Hu TY


    Full Text Available Tiffany Y Hu,1 Vaibhav R Vaidya,2 Samuel J Asirvatham2,31Mayo Medical School, 2Division of Cardiovascular Diseases, Department of Internal Medicine, 3Department of Pediatrics and Adolescent Medicine, Mayo Clinic, Rochester, MN, USAAbstract: Novel oral anticoagulants (NOACs are increasingly used in clinical practice, but lack of commercially available reversal agents is a major barrier for mainstream use of these therapies. Specific antidotes to NOACs are under development. Idarucizumab (aDabi-Fab, BI 655075 is a novel humanized mouse monoclonal antibody that binds dabigatran and reverses its anticoagulant effect. In a recent Phase III study (Reversal Effects of Idarucizumab on Active Dabigatran, a 5 g intravenous infusion of idarucizumab resulted in the normalization of dilute thrombin time in 98% and 93% of the two groups studied, with normalization of ecarin-clotting time in 89% and 88% patients. Two other antidotes, andexanet alfa (PRT064445 and ciraparantag (PER977 are also under development for reversal of NOACs. In this review, we discuss commonly encountered management issues with NOACs such as periprocedural management, laboratory monitoring of anticoagulation, and management of bleeding. We review currently available data regarding specific antidotes to NOACs with respect to pharmacology and clinical trials.Keywords: novel oral anticoagulant, dabigatran, idarucizumab, reversal

  8. LHC Report: special run with de-squeezed beams for ATLAS/ALFA and TOTEM

    CERN Multimedia

    Helmut Burkhardt for the LHC team


    The main high-luminosity proton-proton run of the LHC is complemented by one week per year of special proton-proton runs. The special runs are performed with larger beam sizes at the interaction points to allow the forward physics experiments, TOTEM and ATLAS/ALFA, the chance to make precise measurements of protons as they emerge from collisions at small angles.   In standard high-luminosity operation, the beams are squeezed to give small beam sizes at the interaction points to maximise the collision rates. The “squeeze” takes place at top energy and the beam size at the centre of ATLAS (IP1) and CMS (IP5) is reduced from 66 micrometres at the top of the ramp to 18 micrometres before colliding beams are established. Protons that avoid the fate of an inelastic collision but yet still interact – in elastic or diffractive events – are scattered and emerge in the forward direction. The reduction in beam size has a side effect of increasing the an...

  9. Agregación de alfa-sinucleína y degeneración Parkinsoniana


    Fernández-Espejo, Emilio


    La alfa-sinucleína es la proteína principal de los cuerpos de Lewy, marcador anatomopatológico de la enfermedad de Parkinson. Dicha proteína puede ver alterada su conformación y adquirir capacidad autoagregante, lo que se relaciona con el depósito de agregados proteináceos en las neuronas y podría constituir un factor fisiopatológico importante en dicha enfermedad. Los agregados poseen fibrillas de alfa-sinucleína alterada, y las moléculas se encuentran unidas entre sí por enlaces no...

  10. The ATLAS ALFA and AFP detectors - the experimental challenge of measuring forward protons at the LHC

    CERN Document Server

    Trzebinski, M; The ATLAS collaboration


    The Absolute Luminosity For ATLAS (ALFA) and ATLAS Forward Protons (AFP) detectors are introduced. The forward proton trajectories are shown. The similarities and differences between these two detector systems are described. Finally, the physics possible to be done in these forward detectors is discussed. In particular, in case of ALFA the elastic scattering and exclusive di-pion production are described. In case of AFP, the hard diffractive processes like: Single Diffractive Jet, Double Pomeron Exchange Jet, Exclusive Jet and anomalous coupling production are described.


    Directory of Open Access Journals (Sweden)

    Alberto Albis


    Full Text Available En este trabajo se presenta un estudio sistemático sobre el efecto de las soluciones acuosas de eritritol, xilitol, sorbitol e inositol con diferentes concentraciones, sobre la estabilidad térmica de la holo- alfa-lactoalbúmina bovina con pH 6,5 usando espectroscopia UV-VIS. Los resultados obtenidos muestran que los polioles usados estabilizan la holo-alfa-lactoalbúmina en un grado significativamente menor al reportado para otras proteínas. Se sugiere que este menor efecto de estabilización ocurre debido a que esta proteína presenta un estado desnaturalizado parcialmente desdoblado.

  12. VizieR Online Data Catalog: Arecibo Pulsar-ALFA (PALFA) survey. IV. (Lazarus+, 2015) (United States)

    Lazarus, P.; Brazier, A.; Hessels, J. W. T.; Karako-Argaman, C.; Kaspi, V. M.; Lynch, R.; Madsen, E.; Patel, C.; Ransom, S. M.; Scholz, P.; Swiggum, J.; Zhu, W. W.; Allen, B.; Bogdanov, S.; Camilo, F.; Cardoso, F.; Chatterjee, S.; Cordes, J. M.; Crawford, F.; Deneva, J. S.; Ferdman, R.; Freire, P. C. C.; Jenet, F. A.; Knispel, B.; Lee, K. J.; van Leeuwen, J.; Lorimer, D. R.; Lyne, A. G.; McLaughlin, M. A.; Siemens, X.; Spitler, L. G.; Stairs, I. H.; Stovall, K.; Venkataraman, A.


    The Arecibo Pulsar-ALFA (PALFA) survey observations have been restricted to the two regions of the Galactic plane (|b|<5°) visible from the Arecibo observatory, the inner Galaxy (32°<~l<~77°), and the outer Galaxy (168°<~l<~214°). Integration times are 268s and 180s for inner and outer Galaxy observations, respectively. Observations conducted with the 7-beam Arecibo L-band Feed Array (ALFA) receiver of the Arecibo Observatory William E. Gordon 305m Telescope have a bandwidth of 322MHz centered at 1375MHz. PALFA survey data have been recorded with the Mock spectrometers since 2009. (2 data files).

  13. Hemoglobinas AS/alfa talassemia: importância diagnóstica Hemoglobins AS/alpha thalassemia: diagnostic importance

    Directory of Open Access Journals (Sweden)

    Renata Tomé-Alves


    Full Text Available Portadores de traço falciforme (hemoglobina AS associados a talassemia alfa apresentam alterações na morfologia dos eritrócitos, normalmente ausentes nos heterozigotos para esta variante de hemoglobina. A interação entre hemoglobina S e talassemia alfa tem sido descrita como um dos fatores responsáveis pela melhora no quadro clínico de portadores homozigotos de hemoglobina S (anemia falciforme, diminuindo os episódios de crises de falcização. Os mecanismos genéticos desta influência são avaliados em análises moleculares dos genes da globina humana. Com o objetivo de verificar a presença de talassemia alfa em portadores de hemoglobina S em heterozigose, com presença de anemia, encaminhados ao Laboratório de Hemoglobinas do Departamento de Biologia da UNESP, de São José do Rio Preto, analisamos 1.002 amostras de sangue com traço falciforme, no período de 1990 a 1998. As amostras foram colhidas com EDTA como anticoagulante, após prévia autorização dos portadores. Para o diagnóstico laboratorial as amostras de sangue foram submetidas a procedimentos eletroforéticos em pH alcalino e ácido e pesquisa citológica de hemoglobina H. Os procedimentos eletroforéticos confirmaram a presença de hemoglobina AS. A pesquisa citológica evidenciou a presença de talassemia alfa. Deste total analisado, 16 (1,59 % amostras de sangue apresentaram a associação entre hemoglobina AS e alfa talassemia, sendo que duas eram de indivíduos de uma mesma família. Os resultados obtidos nos direcionaram a sugerir aos laboratórios de rotina que realizem a pesquisa de alfa talassemia entre os portadores de hemoglobina AS, com presença de anemia, para verificar a interação com talassemia alfa, fornecendo assim aos portadores informação importante sobre seu perfil hematológico.Sickle Cell disease is a generic term for a group of genetic disorders characterized by the predominance of hemoglobin S. These disorders include Sickle Cell anemia

  14. The Synchrony and Diachrony of Bosnian-Croatian-Serbian Adjectival Long-Form Allomorphy (ALFA) (United States)

    Pennington, James Joshua


    In Bosnian-Croatian-Serbian (BCS), the gentive (G) and dative/locative (DL) cases exhibit adjectival long-form allomorphy (ALFA). The genitive -"og" -"oga" and the DL -"om" -"ome" -"omu" stand in free variation, inasmuch as when one form is substituted for another the truth value of an utterance…

  15. A Trial of Darbepoetin Alfa in Type 2 Diabetes and Chronic Kidney Disease

    NARCIS (Netherlands)

    Pfeffer, Marc A.; Burdmann, Emmanuel A.; Chen, Chao-Yin; Cooper, Mark E.; de Zeeuw, Dick; Eckardt, Kai-Uwe; Feyzi, Jan M.; Ivanovich, Peter; Kewalramani, Reshma; Levey, Andrew S.; Lewis, Eldrin F.; McGill, Janet B.; McMurray, John J. V.; Parfrey, Patrick; Parving, Hans-Henrik; Remuzzi, Giuseppe; Singh, Ajay K.; Solomon, Scott D.; Toto, Robert


    BACKGROUND Anemia is associated with an increased risk of cardiovascular and renal events among patients with type 2 diabetes and chronic kidney disease. Although darbepoetin alfa can effectively increase hemoglobin levels, its effect on clinical outcomes in these patients has not been adequately te

  16. A trial of darbepoetin alfa in type 2 diabetes and chronic kidney disease

    DEFF Research Database (Denmark)

    Pfeffer, Marc A; Burdmann, Emmanuel A; Chen, Chao-Yin


    BACKGROUND: Anemia is associated with an increased risk of cardiovascular and renal events among patients with type 2 diabetes and chronic kidney disease. Although darbepoetin alfa can effectively increase hemoglobin levels, its effect on clinical outcomes in these patients has not been adequatel...

  17. Artur Gas, editor de Josep Pla: breu història d'Ediciones Alfa


    Pla, Xavier


    Repàs de la trajectòria professional com a editor, començant com a editor de caire socialista i acabant col·laborant amb la dictadura de Primo de Rivera. Es fa especial menció al seu paper com a editor de Josep Pla i a la seva editorial, Ediciones Alfa

  18. High antibody titer in an adult with Pompe disease affects treatment with alglucosidase alfa. (United States)

    de Vries, Juna M; van der Beek, Nadine A M E; Kroos, Marian A; Ozkan, Lale; van Doorn, Pieter A; Richards, Susan M; Sung, Crystal C C; Brugma, Jan-Dietert C; Zandbergen, Adrienne A M; van der Ploeg, Ans T; Reuser, Arnold J J


    Clinical trials have demonstrated beneficial effects of enzyme replacement therapy (ERT) with alglucosidase alfa in infants, children and adults with Pompe disease. Recent studies have shown that high antibody titers can occur in patients receiving ERT and counteract the effect of treatment. This particularly occurs in those patients with classic-infantile Pompe disease that do not produce any endogenous acid α-glucosidase (CRIM-negative). It is still unclear to what extent antibody formation affects the outcome of ERT in adults with residual enzyme activity. We present the case of a patient with adult-onset Pompe disease. He was diagnosed at the age of 39years by enzymatic testing (10.7% residual activity in fibroblasts) and DNA analysis (genotype: c.-32-13T>G/p.Trp516X). Infusion-associated reactions occurred during ERT and the patient's disease progressed. Concurrently, the antibody titer rose to a similarly high level as reported for some CRIM-negative patients with classic-infantile Pompe disease. Using newly developed immunologic-assays we could calculate that approximately 40% of the administered alglucosidase alfa was captured by circulating antibodies. Further, we could demonstrate that uptake of alglucosidase alfa by cultured fibroblasts was inhibited by admixture of the patient's serum. This case demonstrates that also patients with an appreciable amount of properly folded and catalytically active endogenous acid α-glucosidase can develop antibodies against alglucosidase alfa that affect the response to ERT.

  19. Diagnóstico molecular da talassemia ALFA+ (DELEÇÃO -3.7) em indivíduos com microcitose e/ou hipocromia


    Bezerra, Christiane Medeiros


    A talassemia alfa, uma das doenças monogênicas mais comuns no mundo, resulta de um desequilíbrio na síntese das cadeias alfa da hemoglobina devido, principalmente, à deleção de um ou ambos os genes da globina alfa, sendo a deleção - a mais freqüente. A talassemia alfa, juntamente com a deficiência de ferro e a talassemia beta, representa uma importante causa de microcitose e hipocromia. Com o objetivo de diagnosticar e verificar a prevalência da talassemia alfa (-3.7) em indivíduos co...

  20. Effects of alfa-hydroxy-isocaproic acid on body composition, DOMS and performance in athletes

    Directory of Open Access Journals (Sweden)

    Karila Tuomo AM


    Full Text Available Abstract Background Alfa-Hydroxy-isocaproic acid (HICA is an end product of leucine metabolism in human tissues such as muscle and connective tissue. According to the clinical and experimental studies, HICA can be considered as an anti-catabolic substance. The present study investigated the effects of HICA supplementation on body composition, delayed onset of muscle soreness (DOMS and physical performance of athletes during a training period. Methods Fifteen healthy male soccer players (age 22.1+/-3.9 yr volunteered for the 4-week double-blind study during an intensive training period. The subjects in the group HICA (n = 8 received 583 mg of sodium salt of HICA (corresponding 500 mg of HICA mixed with liquid three times a day for 4 weeks, and those in the group PLACEBO (n = 7 received 650 mg of maltodextrin mixed with liquid three times a day for the same period. According to a weekly training schedule, they practiced soccer 3 - 4 times a week, had strength training 1 - 2 times a week, and had one soccer game during the study. The subjects were required to keep diaries on training, nutrition, and symptoms of DOMS. Body composition was evaluated with a dual-energy X-ray absorptiometry (DXA before and after the 4-week period. Muscle strength and running velocity were measured with field tests. Results As compared to placebo, the HICA supplementation increased significantly body weight (p th week of the treatment (p Conclusion Already a 4-week HICA supplementation of 1.5 g a day leads to small increases in muscle mass during an intensive training period in soccer athletes.

  1. Peginterferon alfa-2a is associated with elevations in alanine aminotransferase at the end of treatment in chronic hepatitis C patients with sustained virologic response.

    Directory of Open Access Journals (Sweden)

    Chih-Wei Tseng

    Full Text Available The purpose of this study was to investigate the incidence and demographic/clinical factors of alanine aminotransferase (ALT abnormalities at the end of treatment (EOT in chronic hepatitis C (CHC patients with sustained virologic response (SVR.Seven hundred naïve CHC patients who underwent combination treatment between January 2003 and December 2010 were included in the study. The patients with SVR and serum ALT>upper limit of normal (ULN at the EOT were further analyzed. The effects of clinical characteristics, treatment regimen, and virologic variables were evaluated by logistic regression. Of the 700 included patients, 488 (69.7% achieved an SVR after treatment, and 235 (33.6% had serum ALT levels>ULN at the EOT. Of those 488 patients, 137 (28.1% had abnormal ALT values at the EOT. A multivariate analysis showed that the occurrence of ALT abnormalities at the EOT was significantly associated with pegylated interferon (PEG-IFN alfa-2a (odds ratio [OR], 2.24; 95% confidence interval [CI], 1.45-3.45; P<0.001, baseline fatty liver (OR, 1.76; 95% CI, 1.16-2.76; P = 0.007, and baseline liver cirrhosis (OR, 2.35; 95% CI, 1.35-4.09; P = 0.002.Use of PEG-IFN-alfa-2a, fatty liver, and cirrhosis are important factors associated with EOT-ALT abnormality in CHC patients receiving combination therapy that achieve an SVR. PEG-IFN-alfa-2a-related EOT-ALT elevation will become normal at the end of follow-up, but fatty liver and cirrhosis-related ALT elevation will not be resolved.

  2. O papel do Fator de Necrose Tumoral Alfa (TNF-alfa no processo de erosão óssea presente no colesteatoma adquirido da orelha média The role of Tumor Necrosis Factor -Alpha (TNF- alpha in bone resorption present in middle ear cholesteatoma

    Directory of Open Access Journals (Sweden)

    Rodrigo Faller Vitale


    Full Text Available O colesteatoma adquirido da orelha média causa erosão óssea, com altas taxas de morbidade e mortalidade. O TNF-alfa (TNF-alfa lambda uma das principais citocinas envolvidas neste processo. OBJETIVO: Avaliar o papel do TNF-alfa na reabsorsão óssea e a ação dele no colesteatoma. MATERIAL E MÉTODOS: Foi realizado um levantamento e uma revisão crítica da literatura. RESULTADOS: Todos os autores estudados concordam com a importância do TNF-alfa no processo de reabsorção óssea presente no colesteatoma e com o grau de destruição observado. Diferentes trabalhos demonstraram que o TNF-alfa é capaz de provocar erosão óssea, através de diferentes vias de ação. Ele pode estimular a diferenciação e a maturação dos osteoclastos ou, ainda, agir na matriz óssea expondo-a à ação dos osteoclastos. Existe a possibilidade de inibir a ação do TNF-alfa, diminuindo seus efeitos e prevenindo a perda óssea em doenças como a artrite reumatóide. Não existe, entretanto, trabalhos específicos em colesteatoma. Não existe consenso sobre a sua localização. Estas diferenças, provavelmente, ocorrem devido à distribuição dos receptores. CONCLUSÃO: O TNF-alfa, presente no colesteatoma promove a reabsorsão óssea, juntamente com outras citocinas (RANKL e IL-1, estando relacionado com a presença de complicações.Cholesteatoma may cause bone erosion, with high morbidity and mortality rates. Tumor Necrosis Factor -Alpha (TNF-a is one of the main cytokines involved in this process. Our goal was to evaluate the role of TNF-a in Bone Resorption and its effect on cholesteatoma. MATERIAL AND METHODS: analysis and critical literature review. RESULTS: Different studies have demonstrated that TNF-a is capable of causing bone erosion. It may stimulate the differentiation and maturation of osteoclasts or it may act on the bone matrix, exposing it to the action of the osteoclasts. It is possible to inhibit TNF-a, reducing its effects and prevent

  3. Stroke in patients with type 2 diabetes mellitus, chronic kidney disease, and anemia treated with Darbepoetin Alfa

    DEFF Research Database (Denmark)

    Skali, Hicham; Parving, Hans-Henrik; Parfrey, Patrick S


    More strokes were observed in the Trial to Reduce Cardiovascular Events With Aranesp Therapy (TREAT) among patients assigned to darbepoetin alfa. We sought to identify baseline characteristics and postrandomization factors that might explain this association....

  4. Darbepoietin-alfa has comparable erythropoietic stimulatory effects to recombinant erythropoietin whilst preserving the bone marrow microenvironment. (United States)

    Dewamitta, Sita R; Russell, Megan R; Nandurkar, Harshal; Walkley, Carl R


    Erythropoiesis stimulating agents are widely used for the treatment of anemia. Recently, we reported erythroid expansion with impaired B lymphopoiesis and loss of trabecular bone in C57BL/6 mice following ten days of treatment with low-dose short acting recombinant human erythropoietin. We have assessed erythropoietin against longer-acting darbepoietin-alfa at a comparable erythroid stimulatory dosage regime. Darbepoietin-alfa and erythropoietin induced similar in vivo erythropoietic expansion. Both agents induced an expansion of the colony-forming unit-erythroid populations. However, unlike erythropoietin, darbepoietin-alfa did not impair bone marrow B lymphopoiesis. Strikingly the bone loss observed with erythropoietin was not apparent following darbepoietin-alfa treatment. This analysis demonstrates that whilst darbepoietin-alfa has similar in vivo erythropoietic potency to erythropoietin, it preserves the bone marrow microenvironment. Thus erythropoietin and darbepoietin-alfa manifest different action showing that erythropoiesis stimulating agents have differential non-erythroid effects dependent on their duration of action.

  5. The Arecibo Legacy Fast ALFA Survey: II. Results of Precursor Observations

    CERN Document Server

    Giovanelli, R; Kent, B R; Perillat, P; Catinella, B; Hoffman, G L; Momjian, E; Rosenberg, J L; Saintonge, A; Spekkens, K; Stierwalt, S; Brosch, N; Masters, K L; Springob, C M; Karachentsev, I D; Karachentseva, V E; Koopmann, R A; Müller, E; Van Driel, W; Van Zee, L; Giovanelli, Riccardo; Haynes, Martha P.; Kent, Brian R.; Perillat, Philip; Catinella, Barbara; Momjian, Emmanuel; Rosenberg, Jessica L.; Saintonge, Amelie; Spekkens, Kristine; Stierwalt, Sabrina; Brosch, Noah; Masters, Karen L.; Springob, Christopher M.; Karachentsev, Igor D.; Karachentseva, Valentina E.; Koopmann, Rebecca A.; Muller, Erik; Driel, Wim van; Zee, Liese van


    In preparation for the full Arecibo Legacy Fast ALFA extragalactic HI survey, precursor observations were carried out in Aug--Sep 2004 with the 7-beam Arecibo L-band feed array (ALFA) receiver system and the WAPP spectral processors. While these observations were geared mainly at testing and debugging survey strategy, hardware and software, approximately 36 hours of telescope time yielded science--quality data. From those observations, an initial list of 730 tentative detections of varying degree of reliability was extracted. Ninety--eight high signal-to-noise candidates were deemed to be bona fide HI line detections. To test our ability to discriminate cosmic signals from RFI and noise, 165 candidates ranging in reliability likelihood were re--observed with the single beam L--band wide system at Arecibo in Jan--Feb 2005. Of those, 41% were confirmed as real. We present the results of both the ALFA and single beam observations for the sample of 166 confirmed HI sources, as well as our assessment of their opti...

  6. Preparation And Properties Of Bionanocomposite Films Reinforced With Nanocellulose Isolated From Moroccan Alfa Fibres

    Directory of Open Access Journals (Sweden)

    Youssef Benyoussif


    Full Text Available Nanocellulose (NC were extracted from the Moroccan Alfa plant (Stipa tenacissima L. and characterised. These Alfa cellulosic nanoparticles were used as reinforcing phase to prepare bionanocomposite films using carboxymethyl cellulose as matrix. These films were obtained by the casting/evaporation method. The crystallinity of NC was analysed by X-ray diffraction, the dimension of NC by atomic force microscopy, molecular interactions due to incorporation of NC in carboxymethyl cellulose (CMC matrix were supported by Fourier transforms infrared (FTIR spectroscopy. The properties of the ensuing bionanocomposite films were investigated using tensile tests, water vapour permeability (WVP study and thermogravimetric analysis. With the progress of purification treatment of cellulose, the crystallinity is improved compared to the untreated fibres; this can be explained by the disappearance of the amorphous areas in cellulose chain of the plant. Consequently, the tensile modulus and tensile strength of CMC film increased by 60 and 47%, respectively, in the bionanocomposite films with 10 wt% of NC, and decrease by 8.6% for WVP with the same content of NC. The NC obtained from the Moroccan Alfa fibres can be used as a reinforcing agent for the preparation of bionanocomposites, and they have a high potential for the development of completely biodegradable food packaging materials.

  7. Impact of epoetin alfa on left ventricular structure, function, and pressure volume relations as assessed by cardiac magnetic resonance: the heart failure preserved ejection fraction (HFPEF) anemia trial. (United States)

    Green, Philip; Babu, Benson A; Teruya, Sergio; Helmke, Stephen; Prince, Martin; Maurer, Mathew S


    Anemia, a common comorbidity in older adults with heart failure and a preserved ejection fraction (HFPEF), is associated with worse outcomes. The authors quantified the effect of anemia treatment on left ventricular (LV) structure and function as measured by cardiac magnetic resonance (CMR) imaging. A prospective, randomized single-blind clinical trial (NCT NCT00286182) comparing the safety and efficacy of epoetin alfa vs placebo for 24 weeks in which a subgroup (n=22) had cardiac magnetic resonance imaging (MRI) at baseline and after 3 and 6 months to evaluate changes in cardiac structure and function. Pressure volume (PV) indices were derived from MRI measures of ventricular volume coupled with sphygmomanometer-measured pressure and Doppler estimates of filling pressure. The end-systolic and end-diastolic PV relations and the area between them as a function of end-diastolic pressure, the isovolumic PV area (PVAiso), were calculated. Patients (75±10 years, 64% women) with HFPEF (EF=63%±15%) with an average hemoglobin of 10.3±1.1 gm/dL were treated with epoetin alfa using a dose-adjusted algorithm that increased hemoglobin compared with placebo (PHFPEF resulted in a significant increase in hemoglobin, without evident change in LV structure, function, or pressure volume relationships as measured quantitatively using CMR imaging.

  8. A randomized controlled clinical study of lower-dose peginterferon alfa-2b in combination with ribavirin in the treatment of chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)



    Objective To compare the efficacy and safety of lower-dose peginterferon alfa-2b plus ribavirin versus standard interferon alfa-2b plus ribavirin for treatment of chronic hepatitis C in China. Methods 192 patients with chronic hepatitis C were assigned peginterferon alfa-2b 0.5μg/kg each week plus ribavirin 750~1050 mg/d or standard interferon alfa-2b 3 MIU TIW plus ribavirin 750~1050 mg/d for 48-week treatment and 24-week fellow

  9. Arecibo pulsar survey using ALFA. III. Precursor survey and population synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Swiggum, J. K.; Lorimer, D. R.; McLaughlin, M. A.; Bates, S. D.; Senty, T. R. [Department of Physics and Astronomy, West Virginia University, Morgantown, WV 26506 (United States); Champion, D. J.; Lazarus, P. [Max-Planck-Institut für Radioastronomie, D-53121 Bonn (Germany); Ransom, S. M. [NRAO, Charlottesville, VA 22903 (United States); Brazier, A.; Chatterjee, S.; Cordes, J. M. [Astronomy Department, Cornell University, Ithaca, NY 14853 (United States); Hessels, J. W. T. [ASTRON, Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Nice, D. J. [Department of Physics, Lafayette College, Easton, PA 18042 (United States); Ellis, J.; Allen, B. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee WI 53211 (United States); Bhat, N. D. R. [Center for Astrophysics and Supercomputing, Swinburne University, Hawthorn, Victoria 3122 (Australia); Bogdanov, S.; Camilo, F. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Crawford, F. [Department of Physics and Astronomy, Franklin and Marshall College, Lancaster, PA 17604-3003 (United States); Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); and others


    The Pulsar Arecibo L-band Feed Array (PALFA) Survey uses the ALFA 7-beam receiver to search both inner and outer Galactic sectors visible from Arecibo (32° ≲ ℓ ≲ 77° and 168° ≲ ℓ ≲ 214°) close to the Galactic plane (|b| ≲ 5°) for pulsars. The PALFA survey is sensitive to sources fainter and more distant than have previously been seen because of Arecibo's unrivaled sensitivity. In this paper we detail a precursor survey of this region with PALFA, which observed a subset of the full region (slightly more restrictive in ℓ and |b| ≲ 1°) and detected 45 pulsars. Detections included 1 known millisecond pulsar and 11 previously unknown, long-period pulsars. In the surveyed part of the sky that overlaps with the Parkes Multibeam Pulsar Survey (36° ≲ ℓ ≲ 50°), PALFA is probing deeper than the Parkes survey, with four discoveries in this region. For both Galactic millisecond and normal pulsar populations, we compare the survey's detections with simulations to model these populations and, in particular, to estimate the number of observable pulsars in the Galaxy. We place 95% confidence intervals of 82,000 to 143,000 on the number of detectable normal pulsars and 9000 to 100,000 on the number of detectable millisecond pulsars in the Galactic disk. These are consistent with previous estimates. Given the most likely population size in each case (107,000 and 15,000 for normal and millisecond pulsars, respectively), we extend survey detection simulations to predict that, when complete, the full PALFA survey should have detected 1000{sub −230}{sup +330} normal pulsars and 30{sub −20}{sup +200} millisecond pulsars. Identical estimation techniques predict that 490{sub −115}{sup +160} normal pulsars and 12{sub −5}{sup +70} millisecond pulsars would be detected by the beginning of 2014; at the time, the PALFA survey had detected 283 normal pulsars and 31 millisecond pulsars, respectively. We attribute the deficiency in normal pulsar

  10. Diversidade alfa e beta no cerrado sensu strictu da Chapada Pratinha, Brasil Alfa and Beta diversity in the cerrado sensu stricto

    Directory of Open Access Journals (Sweden)

    Maria Cristina Felfili


    Full Text Available O bioma cerrado possui uma das mais ricas floras dentre as savanas mundiais com mais de 6000 espécies, abrange uma vasta extensão territorial, contém as três maiores bacias hidrográficas sul americanas, e se destaca pela elevada biodiversidade. O objetivo deste trabalho, que faz parte do Projeto Biogeografia do Bioma Cerrado, foi analisar as diversidades alfa e beta em comunidades de cerrado sensu stricto. Foram amostrados o Parque Nacional de Brasília, a Estação Ecológica de Águas Emendadas, a Area de Proteção Ambiental (APA Gama-Cabeça de Veado, Silvânia-GO, Paracatu-MG e Patrocínio-MG. A amostragem foi aleatória com 10 parcelas de 20x50m em cada área de estudo. Foram incluídas plantas lenhosas, exceto lianas, que tivessem no mínimo 5cm de diâmetro. Foi calculada a diversidade alfa pelo teste de Shannon & Wienner e o de Simpson. A diversidade beta foi calculada pelo índice de Whittaker que mede a mudança ou taxa de substituição na composição de espécies de um local para outro. Foi efetuada a curva espécie-área para as 60 parcelas amostradas e efetuada a classificação por TWINSPAN. O cerrado sensu stricto da Chapada Pratinha pode ser diferenciado em duas zonas fitogeográficas: Distrito Federal-Silvânia e Paracatu-Patrocínio. Estas coincidem com um zoneamento por sistemas de terra que classifica a primeira zona como terras altas em contraposição à segunda.The cerrado flora is one of the richest among the world's savannas with more than 6000 species. The cerrado covers a large territory, contains the three most important hydrographycal basins in South America and a high diversity. The objective of this work, that is part of the project Biogeography of the Cerrado Biome, was to analyse alfa and beta diversity in the cerrado sensu stricto. The sampled places were: Brasília National Park -- DF, Águas Emendadas Ecological Station -- DF, Environmentally protected Area of Gama-Cabeça de Veado -- DF, Silv

  11. A cost-effectiveness evaluation comparing originator follitropin alfa to the biosimilar for the treatment of infertility

    Directory of Open Access Journals (Sweden)

    Gizzo S


    Full Text Available Salvatore Gizzo,1 Juan A Garcia-Velasco,2 Franca Heiman,3 Claudio Ripellino,3 Klaus Bühler4 1Department of Woman and Child Health, University of Padua, Padua, Italy; 2Department of Obstetrics and Gynecology, Rey Juan Carlos University Madrid, Madrid, Spain; 3IMS Health Information Solutions Italy Srl, Milan, Italy; 4Centre for Gynaecology, Endocrinology, and Reproductive Medicine, Ulm and Stuttgart, Germany Objectives: To perform a cost-effectiveness evaluation comparing the originator follitropin alfa (Gonal-f® to the biosimilar (Bemfola® in the Italian and Spanish contexts, with an assessment of the German and UK backgrounds. Methods: Starting from the study by Rettenbacher et al, a cost-effectiveness model was developed in the Italian and Spanish contexts. Clinical data on subjects, doses of gonadotropin, pregnancies, live-born children, and ovarian hyperstimulation syndrome were used to feed the model. Costs related to drugs, hospitalizations, specialist visits, and examinations were retrieved from Italian and Spanish tariffs. Gonadotropin acquisition costs for Germany and the UK were also taken into account to expand the economical assessment to the other countries. The evaluation was done based on the National Health Service perspective. Sensitivity analyses, both univariate and probabilistic, as long as scenario analyses, tested the robustness of the model. Results: Originator follicle-stimulating hormone (FSH costs were €3,663 and €6,387 in Italy and Spain, respectively, whereas biosimilar FSH costs were €3,483 and €6,342. The efficacy was found to be 0.52 for the originator and 0.47 for the biosimilar. The average cost per live birth was estimated to be €7,044 and €12,283 for the originator FSH and €7,411 and €13,494 for the biosimilar for Italy and Spain, respectively. Furthermore, the originator FSH generated an incremental cost-effectiveness ratio of €3,600 for Italy and €900 for Spain compared to the


    Directory of Open Access Journals (Sweden)



    Full Text Available In this paper we determined the influence of associated supplement of alfa amylase and xylanase on the rheology of dough concearning its constitographical parameters : maximum pressure (Pr max, (mb and the absorbed water (Wa, %. The analysis on the consistograph were conducted for constant hydration at the consistency of 500 UF. Determinations were made on 4 types of flour and optimal dosages were found for each enzyme, after which we prepared the optimal dosage of the enzymes in the compund for flour F1 and F2 : P1-840000 U. SKB/100 kg flour +8100 U. FXU /100 kg flour, P2-840000 U. SKB/100 kg flour+16200 U. FXU, /100 kg flour , P3-840000 U. SKB/100 kg flour+24300 U. FXU/100 kg flour , and for F3 and F4 thus: P1-280000 U. SKB/100 kg flour +8100 U. FXU /100 kg flour, P2- 280000 U. SKB/100 kg flour+16200 U. FXU/100 kg flour, P3-280000 U. SKB/100 kg flour+24300 U. FXU/100 kg flour. Fungous α-amylase and xylanase were used in these concentrations to establish which one is more apropriate to be added in flour to obtain superior quality of bread: finer texture of the crumb, prolongation of the freashness of the bread, improvind the colour and flavour, emproving the slicing ability.

  13. Homeopathic dilutions of TNF-alfa in psoriasis and rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Ioana Cridon


    Full Text Available Aim: Clinical and biological studies in the past years underlined the proinflammatory action of the citokine Tumoral Necrosis Factor in the pathophysiolology of psoriasis, psoriatic arthritis, rheumatoid arthritis. Knowing that the high dilution of substances can have an inverted effect, our hypotesis was that dillution made of TNF-alfa can decrease the clinical manifestation of such diseases. Materials and method: We included as a pilot group 10 patients presented in Lotus Life Integrative Medicine Center or Profamilia Medical Center Iasi with psoriasis and rheumatoid arthritis previously diagnosed by specialists, under speciality treatment with insufficient results and patients who deliberately expressed their preference for alternative treatment. We decided to exclude the patients which during the study could present aggravation of symptoms. The treatment protocol consisted in the administration under the tongue of the dilution of TNF-alfa 9CH in liquid form, 12 drops twice a day for at least 3 months. This was prepared diluting from Guna TNF-alfa 4CH in distiled water, completing with 30% of alcohol in the last solution. Patients under other medications continued to take their previous treatment unchanged. We called the patients for follow-up after 3 months. We took the written consent from the patients and the approval of the Ethical Committee of the University of Medicine and Pharmacy "Gr. T. Popa" of Iasi. Results: To analize the results we followed the subjective evolution of the patients, the total surface and thickness of eruptions in psoriasis patients and the pain intensity and stiffness in arthritis patients. Under this conditions, all the patients showed amelioration, with 2 out of 6 psoriasis patients showing complete clearance of eruptions. No patient reported adverse reactions during the treatment Conclusions: Even though the group of patients was small and not appropriate for statistical data the presence of a clinical

  14. Interferón alfa-2b tópico como primera opción en las neoplasias intraepiteliales corneoconjuntivales Topical interferon alfa-2b for primary treatment of conjunctiva-cornea intraepithelial neoplasia

    Directory of Open Access Journals (Sweden)

    M. Pérez de Arcelus


    Full Text Available Se describen dos casos de neoplasia intraepitlelial corneo-conjuntival (CIN tratados con interferón alfa-2b (IFN alfa-2b tópico como primera elección. El tratamiento clásico de los CIN ha sido tradicionalmente la resección completa con márgenes de seguridad seguida de crioterapia en el lecho quirúrgico. No obstante, y puesto que la tasa de recidivas puede alcanzar el 50% han sido propuestos coadyuvantes como la mitomicina C y el 5 fluoracilo, con el consiguiente riesgo de toxicidad corneal y límbica. El IFN alfa-2b presenta una eficacia similar a la cirugía en la erradicación completa de la masa tumoral como primera opción, con escasos efectos secundarios y nulo potencial carcinogénico, incluso en casos de recurrencia a terapia con mitomicina C, lesiones quirúrgicas residuales y formas difusas.We describe two cases of conjunctival-cornea intraepithelial neoplasia (CIN, treated with topical IFN alfa 2b. The traditional treatment for CIN is surgical excision usually with adjunctive cryotherapy. However, residual tumour may remain, which can lead to recurrence rates of more than 50%. 5-Fluorouracil, mitomicyn C and interferon alfa 2b are new pharmacological agents that have proved their efficacy in the treatment of CIN. As side effects are common, we present IFN alfa 2b as a single therapeutic agent as an effective and optimal treatment for presumed recurrent corneal and conjunctival intraepithelial neoplasia. It offers the benefits of topical therapy and avoids the risks of surgical or other interventions - specifically, ocular surface toxicity, cicatricial conjunctival changes, and limbal stem cell deficiency.

  15. Expressão local do fator de necrose tumoral alfa na ruptura prematura de membranas


    Roveran,Valquíria; SILVA, Maria Antonieta Longo Galvão; Yamano,Lucia; Rodrigues,Lilian de Paiva; Vasquez,Mônica Lopez; Piato, Sebastião


    OBJETIVO: comparar a expressão do fator de necrose tumoral alfa (TNF-α) em membranas ovulares com ruptura prematura (RPM) e com ruptura oportuna das mesmas; verificar a associação entre a expressão do TNF-α em membranas ovulares e o grau de corioamnionite das mesmas e correlacionar a expressão do TNF-α e o tempo de ruptura das membranas. MÉTODOS: foram analisadas as membranas ovulares de 31 parturientes com RPM, com idade gestacional acima de 34 semanas, e de 14 parturientes co...

  16. Interferón alfa-2b tópico como primera opción en las neoplasias intraepiteliales corneoconjuntivales Topical interferon alfa-2b for primary treatment of conjunctiva-cornea intraepithelial neoplasia


    M. Pérez de Arcelus; Aranguren, M.; J. Andonegui


    Se describen dos casos de neoplasia intraepitlelial corneo-conjuntival (CIN) tratados con interferón alfa-2b (IFN alfa-2b) tópico como primera elección. El tratamiento clásico de los CIN ha sido tradicionalmente la resección completa con márgenes de seguridad seguida de crioterapia en el lecho quirúrgico. No obstante, y puesto que la tasa de recidivas puede alcanzar el 50% han sido propuestos coadyuvantes como la mitomicina C y el 5 fluoracilo, con el consiguiente riesgo de toxicidad corneal ...

  17. Corifollitropin alfa followed by rFSH in a GnRH antagonist protocol for poor ovarian responder patients

    DEFF Research Database (Denmark)

    Polyzos, Nikolaos P; Devos, Michel; Humaidan, Peter;


    OBJECTIVE: To identify whether women with poor ovarian response may benefit from treatment with corifollitropin alfa in a GnRH antagonist protocol. DESIGN: Retrospective pilot study. SETTING: University-based tertiary care center. PATIENT(S): Poor ovarian responders fulfilling the Bologna criteria...... developed by European Society for Human Reproduction and Embryology Consensus Group. INTERVENTION(S): Corifollitropin alfa (150 μg) followed by 300 IU rFSH in a GnRH antagonist protocol. MAIN OUTCOME MEASURE(S): Endocrinologic profile and ongoing pregnancy rates. RESULT(S): Among 43 women treated...... compared with a cohort of patients treated during 2011 with the standard protocol for poor responders in our center (short agonist-hMG) (7% vs. 6.3%). CONCLUSION(S): Treatment of poor ovarian responders, as described by the Bologna criteria, with corifollitropin alfa in a GnRH antagonist protocol results...

  18. Mapping Hydrogen in the Galaxy, Galactic Halo, and Local Group with ALFA: The GALFA-HI Survey Starting with TOGS

    CERN Document Server

    Gibson, S J; Heiles, C; Korpela, E J; Peek, J E G; Putman, M E; Stanimirović, S


    Radio observations of gas in the Milky Way and Local Group are vital for understanding how galaxies function as systems. The unique sensitivity of Arecibo's 305m dish, coupled with the 7-beam Arecibo L-Band Feed Array (ALFA), provides an unparalleled tool for investigating the full range of interstellar phenomena traced by the HI 21cm line. The GALFA (Galactic ALFA) HI Survey is mapping the entire Arecibo sky over a velocity range of -700 to +700 km/s with 0.2 km/s velocity channels and an angular resolution of 3.4 arcminutes. We present highlights from the TOGS (Turn on GALFA Survey) portion of GALFA-HI, which is covering thousands of square degrees in commensal drift scan observations with the ALFALFA and AGES extragalactic ALFA surveys. This work is supported in part by the National Astronomy and Ionosphere Center, operated by Cornell University under cooperative agreement with the National Science Foundation.

  19. GSI Helmholz Centre for Heavy Ion Research - ALFA: Next generation concurrent framework for ALICE and FAIR experiments

    CERN Document Server

    CERN. Geneva


    FAIR is a new, unique international accelerator facility for the research with antiprotons and ions. It is being built at the GSI Darmstadt in Hesse, Germany. The commonalities between the ALICE and FAIR experiments and their computing requirements led to the development of a common software framework in an experiment independent way; ALFA (ALICE-FAIR framework). ALFA is designed for high quality parallel data processing and reconstruction on heterogeneous computing systems. It provides a data transport layer and the capability to coordinate multiple data processing components. ALFA is a flexible, elastic system which balances reliability and ease of development with performance by using a message based multi-processing in addition to multi-threading. The framework allows for usage of heterogeneous computing architectures by offloading (portions of code are accelerated on the device) or natively (where the full program is executed on the device ).

  20. Neuropharmacological effects of alfa-cypermethrin in rats

    Directory of Open Access Journals (Sweden)

    Manna S


    Full Text Available OBJECTIVE: To study the effect of α-cypermethrin (α-CP on some neuropharmacological paradigms like motor coordination, pentobarbitone-induced sleeping time and pentylenetetrazole-induced (PTZ convulsion as well as γ-aminobutyric acid (GABA level in rat brain. MATERIALS AND METHODS: Albino Wistar rats were the experimental animals. Different neuropharmacological paradigms like motor coordination (determined by rotarod, pentobarbitone-induced sleeping time and PTZ-induced convulsion were carried out following oral administration of α-CP at two dose levels i.e., 145 mg/kg (LD50 and 14.5 mg/kg (1/10LD50, while the level of GABA in the brain of rats was estimated by HPLC after single-dose oral administration of α-CP at 145 mg/kg. RESULTS: α-CP induced significant motor incoordination, decreased the time of onset and increased the duration of sleeping time induced by pentobarbitone; and also decreased the time of onset and increased the duration of convulsion induced by PTZ at the dose levels of 145 mg/kg (LD50 and 14.5 mg/kg (1/10 LD50 respectively. Further α-CP decreased brain GABA levels in the cerebellum and in whole brain (except cerebellum significantly at LD50 dose level. CONCLUSION: A correlation between the effect of α-CP on central GABA levels and its neuropharmacological effects can be hypothesized.

  1. Drotrecogin alfa (activated)...a sad final fizzle to a roller-coaster party. (United States)

    Angus, Derek C


    Following the failure of PROWESS-SHOCK to demonstrate efficacy, Eli Lilly and Company withdrew drotrecogin alfa (activated) from the worldwide market. Drotrecogin was initially approved after the original trial, PROWESS, was stopped early for overwhelming efficacy. These events prompt consideration of both the initial approval decision and the later decision to withdraw. It is regrettable that the initial decision was made largely on a single trial that was stopped early. However, the decision to approve was within the bounds of normal regulatory practice and was made by many approval bodies around the world. Furthermore, the overall withdrawal rate of approved drugs remains very low. The decision to withdraw was a voluntary decision by Eli Lilly and Company and likely reflected key business considerations. Drotrecogin does have important biologic effects, and it is probable that we do not know how best to select patients who would benefit. Overall, there may still be a small advantage to drotrecogin alfa, even used non-selectively, but the costs of determining such an effect with adequate certainty are likely prohibitive, and the point is now moot. In the future, we should consider ways to make clinical trials easier and quicker so that more information can be available in a timely manner when considering regulatory approval. At the same time, more sophisticated selection of patients seems key if we are to most wisely test agents designed to manipulate the septic host response.

  2. Mango resistance to fruit flies. II - resistance of the alfa cultivar

    Energy Technology Data Exchange (ETDEWEB)

    Rossetto, C.J.; Bortoletto, N., E-mail: [Agencia Paulista de Tecnologia dos Agronegocios (APTA), Votuporanga, SP (Brazil). Polo Regional do Noroeste Paulista; Walder, J.M.M.; Mastrangelo, T. de A., E-mail: jmwalder@cena.usp.b [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil); Carvalho, C.R.L.; Castro, J.V. de, E-mail:, E-mail: [Instituto Agronomico de Campinas, SP (Brazil); Pinto, A.C. de Q. [EMBRAPA, Brasilia, DF (Brazil); Cortelazzo, A.L., E-mail: angelo@unicamp.b [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Inst. de Biologia


    The percentage of infested mango fruits of five selected mango varieties was evaluated during three years under field conditions. Three varieties with field resistance to fruit flies had less then 10% of fruits infested. Tommy Atkins, the susceptible commercial check, had 42,9% and the susceptible check had 98.9 % of infested fruits. The three field resistant varieties plus the susceptible commercial check, Tommy Atkins, were further tested in laboratory, under caged conditions, with artificial infestation of Anastrepha obliqua. The attempts of oviposition and the number of pupae developed from each fruit were evaluated. Under caged conditions, the cultivar Alfa maintained its field resistance and Espada Stahl and IAC 111 lost the field resistance and were as susceptible as Tommy Atkins. The attempts of oviposition were positively and highly correlated with the number of pupae developed in the fruits. Non preference for oviposition was confirmed as the main mechanism of resistance of mango fruits to fruit flies. In the absence of a more susceptible variety (no choice test) the cultivar Alfa has kept the resistance (author)

  3. FTIR spectroscopy and X-ray powder diffraction characterization of microcrystalline cellulose obtained from alfa fibers

    Directory of Open Access Journals (Sweden)

    Trache D.


    Full Text Available Many cereal straws have been used as raw materials for the preparation of microcrystalline cellulose (MCC. These raw materials were gradually replaced with wood products; nevertheless about 10% of the world overall pulp production is obtained from non-wood raw material. The main interest in pulp made from straw is that it provides excellent fibres for different industries with special properties, and that it is the major available source of fibrous raw material in some geographical areas. The aim of the present work was to characterize microcrystalline cellulose prepared from alfa fibers using the hydrolysis process. The products obtained are characterized with FTIR spectroscopy and X-ray powder diffraction. As a result, FTIR spectroscopy is an appropriate technique for studying changes occurred by any chemical treatment. The spectrum of alfa grass stems shows the presence of lignin and hemicelluloses. However, the cellulose spectrum indicates that the extraction of lignin and hemicellulose was effective. The X-ray analysis indicates that the microcrystalline cellulose is more crystalline than the source material.

  4. Papel de la IL-6 y TNF-alfa en la enfermedad periodontal

    Directory of Open Access Journals (Sweden)

    A. Carrillo de Albornoz Sainz

    Full Text Available La periodontitis se inicia por una serie de patógenos que inducen una cascada inflamatoria que estimula la destrucción de los tejidos mediada por el huésped. Están implicados un gran número de mediadores inflamatorios, entre los que destacan IL-6 y TNF-alfa. La IL-6 es una citoquina pleiotrópica de compleja actividad biológica, cuya función principal vinculada a la periodontitis es la inducción de la reabsorción ósea. TNF-alfa es una citoquina proinflamatoria cuya función más destacada es el reclutamiento y estimulación de neutrófilos y monocitos. Su papel en la periodontitis es diverso, ya que promueve tanto la inflamación, como la pérdida ósea y la destrucción del tejido conectivo, a la vez que limita la capacidad de reparación del periodonto.

  5. A Predictive Model for Selecting Patients with HCV Genotype 3 Chronic Infection with a High Probability of Sustained Virological Response to Peginterferon Alfa-2a/Ribavirin.

    Directory of Open Access Journals (Sweden)

    Tarik Asselah

    Full Text Available Access to direct-acting antiviral agents (DAAs is restricted in some settings; thus, the European Association for the Study of the Liver recommends dual peginterferon/ribavirin (PegIFN/RBV therapy wherever DAAs are unavailable. HCV genotype (GT 3 infection is now the most difficult genotype to eradicate and PegIFN/RBV remains an effective option. The goal of this study was to devise a simple predictive score to identify GT3 patients with a high probability of achieving a sustained virologic response (SVR with PegIFN alfa-2a/RBV therapy.Relationships between baseline characteristics and SVR were explored by multiple logistic regression models and used to develop a simple scoring system to predict SVR using data from 1239 treatment-naive GT3 patients who received PegIFN alfa-2a/RBV for 24 weeks in two large observational cohort studies.The score was validated using a database of 473 patients. Scores were assigned for six factors as follows: age (years (≤40: 2 points; >40 but ≤55: 1; bodyweight (kg (200: 2; ≥100 but <200: 1; HCV RNA (<400,000 IU/mL: 1. The points are summed to arrive at a score ranging from 0‒10 where higher scores indicate higher chances of SVR; 141, 123, 203, 249, 232, and 218 patients had total scores of 0‒4, 5, 6, 7, 8, and 9-10, respectively, among whom SVR rates were 45%, 62%, 72%, 76%, 84%, and 89%. Among 622 patients who had scores of 6‒10 and HCV RNA <50 IU/mL by treatment week 4 the SVR rate was 86% (532/622.A simple baseline scoring system involving age, bodyweight, cirrhosis status, ALT level, platelet count and HCV RNA level can be used to identify treatment-naive Caucasian patients with HCV GT3 infection with a high probability of SVR with PegIFN alfa-2a/RBV therapy.

  6. Interferon alfa-2a versus combination therapy with interferon alfa-2a, interleukin-2, and fluorouracil in patients with untreated metastatic renal cell carcinoma (MRC RE04/EORTC GU 30012): an open-label randomised trial.

    NARCIS (Netherlands)

    Gore, M.E.; Griffin, C.L.; Hancock, B.; Patel, P.M.; Pyle, L.; Aitchison, M.; James, N.; Oliver, R.T.D.; Mardiak, J.; Hussain, T.; Sylvester, R.; Parmar, M.K.; Royston, P.; Mulders, P.F.A.


    BACKGROUND: In metastatic renal cell carcinoma combinations of interferon alfa-2a, interleukin-2, and fluorouracil produce higher response rates and longer progression-free survival than do single agents. We aimed to compare overall survival in patients receiving combination treatment or interferon

  7. A first-year dornase alfa treatment impact on clinical parameters of patients with cystic fibrosis: the Brazilian cystic fibrosis multicenter study

    Directory of Open Access Journals (Sweden)

    Tatiana Rozov


    Full Text Available OBJECTIVE: To describe the clinical impact of the first year treatment with dornase alfa, according to age groups, in a cohort of Brazilian Cystic Fibrosis (CF patients. METHODS: The data on 152 eligible patients, from 16 CF reference centers, that answered the medical questionnaires and performed laboratory tests at baseline (T0, and at six (T2 and 12 (T4 months after dornase alfa initiation, were analyzed. Three age groups were assessed: six to 11, 12 to 13, and >14 years. Pulmonary tests, airway microbiology, emergency room visits, hospitalizations, emergency and routine treatments were evaluated. Student's t-test, chi-square test and analysis of variance were used when appropriated. RESULTS: Routine treatments were based on respiratory physical therapy, regular exercises, pancreatic enzymes, vitamins, bronchodilators, corticosteroids, and antibiotics. In the six months prior the study (T0 phase, hospitalizations for pulmonary exacerbations occurred in 38.0, 10.0 and 61.4% in the three age groups, respectively. After one year of intervention, there was a significant reduction in the number of emergency room visits in the six to 11 years group. There were no significant changes in forced expiratory volume in one second (VEF1, in forced vital capacity (FVC, in oxygen saturation (SpO2, and in Tiffenau index for all age groups. A significant improvement in Shwachman-Kulczychi score was observed in the older group. In the last six months of therapy, chronic or intermittent colonization by P. aeruginosa was detected in 75.0, 71.4 and 62.5% of the studied groups, respectively, while S. aureus colonization was identified in 68.6, 66.6 and 41.9% of the cases. CONCLUSIONS: The treatment with dornase alfa promoted the maintenance of pulmonary function parameters and was associated with a significant reduction of emergency room visits due to pulmonary exacerbations in the six to 11 years age group, with better clinical scores in the >14 age group, one


    Directory of Open Access Journals (Sweden)

    Esperanza Espinel


    Full Text Available Este estudio reporta la purificación y caracterización parcial de una alfa-amilasa producida por Penicillium commune mediante fermentación en fase sólida, empleandoyuca blanca colombiana (Manihot esculenta Crantz como soporte. La enzima fue purificada por precipitación fraccionada con sulfato de amonio, cromatografía de intercambio aniónico (DEAE-Sephadex A-50, cromatografía de filtración por gel (Sephadex G-75 y cromatografía de intercambio catiónico (CM-Sephadex C-50 obteniendo una actividad específica final de 314,82 U/mg, un grado de purificación del orden de 62 y un rendimiento de 9%. La purificación hasta la homogeneidad fue confirmada por SDS-PAGE. El peso molecular estimado fue 35 kDa. La enzima mostró máxima actividad de hidrólisis de almidón soluble con pH 6,0, y estabilidad en un intervalo de pH de 5,0-7,0. La estabilidad térmica de la enzima se presentó en el intervalo de temperatura 0-50 °C y su temperatura óptima fue 70 °C. Los iones Ca2+,Ba2+ y Ag+ aumentaron significativamente la actividad de la enzima, siendo el ión Ca2+ el que tuvo el más alto poder activador. Cu2+ no alteró significativamente la actividad de la enzima, mientras que Li+ y Fe3+ la disminuyeron ligeramente (13%, y Co2+ y Hg2+ la disminuyeron 25% y 40% respectivamente. Los valores de Km y Vmáx fueron calculados usando la linealización de Lineweaver- Burk, con el resultado Km= 0,48 mg/mL y Vmáx = 5,85 micromol glucosa/min. Entre los principales productos de hidrólisis del almidón de yuca se encuentran la maltosa y la glucosa, este resultado proporciona evidencia de que la enzima es capaz de romper los enlaces glicosídicos alfa-1,4 del almidón, comportamiento característico de una alfa-amilasa.

  9. Molecular design and downstream processing of turoctocog alfa (NovoEight), a B-domain truncated factor VIII molecule. (United States)

    Ahmadian, Haleh; Hansen, Ernst B; Faber, Johan H; Sejergaard, Lars; Karlsson, Johan; Bolt, Gert; Hansen, Jens J; Thim, Lars


    Turoctocog alfa (NovoEight) is a third-generation recombinant factor VIII (rFVIII) with a truncated B-domain that is manufactured in Chinese hamster ovary cells. No human or animal-derived materials are used in the process. The aim of this study is to describe the molecular design and purification process for turoctocog alfa. A five-step purification process is applied to turoctocog alfa: protein capture on mixed-mode resin; immunoaffinity chromatography using a unique, recombinantly produced anti-FVIII mAb; anion exchange chromatography; nanofiltration and size exclusion chromatography. This process enabled reduction of impurities such as host cell proteins (HCPs) and high molecular weight proteins (HMWPs) to a very low level. The immunoaffinity step is very important for the removal of FVIII-related degradation products. Manufacturing scale data shown in this article confirmed the robustness of the purification process and a reliable and consistent reduction of the impurities. The contribution of each step to the final product purity is described and shown for three manufacturing batches. Turoctocog alfa, a third-generation B-domain truncated rFVIII product is manufactured in Chinese hamster ovary cells without the use of animal or human-derived proteins. The five-step purification process results in a homogenous, highly purified rFVIII product.

  10. alfa-Deuterium kinetic isotope effects in reactions of methyllithium. Is better aggregation the cause of lower reactivity?

    DEFF Research Database (Denmark)

    Holm, Torkil


    The value of kH/kD for alfa deuterium kinetic isotope effects for the reaction of methyllithium and methylmagnesium iodid with a series of substrates are consistently ca. 10-15 % higher for the lithium reagent. This may indicate a pre-equilibrium...

  11. Benefit of adjuvant interferon alfa-2b (IFN-α) therapy in melanoma patients with high serum MMP-8 levels

    DEFF Research Database (Denmark)

    Vihinen, Pia; Tervahartiala, Taina; Sorsa, Timo;


    Matrix metalloproteinases (MMPs) are important enzymes in tissue turnover and various inflammatory processes. In this study, it was evaluated whether serum MMP-8 can predict the response to adjuvant interferon alfa-2b (IFN-α) therapy in patients with operated high-risk cutaneous melanoma. Pre...

  12. Comprehensive safety analysis of concomitant drotrecogin alfa (activated) and prophylactic heparin use in patients with severe sepsis

    NARCIS (Netherlands)

    M. Levy; M. Levi; M.D. Williams; M. Antonelli; D. Wang; M.A. Mignini


    Purpose: The safety of using heparin concomitantly with drotrecogin alfa (activated) {DrotAA} was explored in the XPRESS study. No heparin effect on mortality was observed. Safety results from that study are explored in more detail. Methods: A randomized, double-blind trial of prophylactic heparin v

  13. Il trattamento di pazienti con sepsi grave mediante drotrecogin alfa: una valutazione economica con riferimento all’Italia

    Directory of Open Access Journals (Sweden)

    Carlo Lucioni


    Full Text Available Sepsis can be defined as a spectrum of clinical conditions caused by the immune response of a host to infection or trauma and characterized by systemic inflammation and coagulation. Particularly in elderly, immunocompromised and critically ill patients, sepsis is a major cause of morbidity and mortality in intensive care units (ICUs worldwide. In the US, sepsis is the leading cause of death in noncoronary ICU patients. Drotrecogin alfa, or recombinant human activated protein C, has antithrombotic, antiinflammatory, and profibrinolytic properties. Recently in a phase III trial (PROWESS, Drotrecogin alfa demonstrated significantly reduced mortality in severe sepsis patients at 28 days. In this trial important value factors for the assessment of costs and outcomes of severe sepsis were also considered. The purpose of the present study is to determine the economic burden of the treatment with Drotrecogin alfa, according to a cost-effectiveness analysis based on the data of the PROWESS trial. The study has been adapted to the italian health environment. As regards to the costs per surviving patient and costs per QALY (Quality Adjusted Life Year, the predicted cost-effectiveness ratio of drotrecogin alfa in severe sepsis patients is much lower than the standard values considered as acceptable in the international litterature.

  14. The Arecibo Legacy Fast ALFA Survey : X. The HI Mass Function and Omega_HI From the 40% ALFALFA Survey

    NARCIS (Netherlands)

    Martin, Ann M.; Papastergis, Emmanouil; Giovanelli, Riccardo; Haynes, Martha P.; Springob, Christopher M.; Stierwalt, Sabrina


    The Arecibo Legacy Fast ALFA (ALFALFA) survey has completed source extraction for 40% of its total sky area, resulting in the largest sample of HI-selected galaxies to date. We measure the HI mass function from a sample of 10,119 galaxies with 6.2

  15. Accurate Learning with Few Atlases (ALFA): an algorithm for MRI neonatal brain extraction and comparison with 11 publicly available methods (United States)

    Serag, Ahmed; Blesa, Manuel; Moore, Emma J.; Pataky, Rozalia; Sparrow, Sarah A.; Wilkinson, A. G.; MacNaught, Gillian; Semple, Scott I.; Boardman, James P.


    Accurate whole-brain segmentation, or brain extraction, of magnetic resonance imaging (MRI) is a critical first step in most neuroimage analysis pipelines. The majority of brain extraction algorithms have been developed and evaluated for adult data and their validity for neonatal brain extraction, which presents age-specific challenges for this task, has not been established. We developed a novel method for brain extraction of multi-modal neonatal brain MR images, named ALFA (Accurate Learning with Few Atlases). The method uses a new sparsity-based atlas selection strategy that requires a very limited number of atlases ‘uniformly’ distributed in the low-dimensional data space, combined with a machine learning based label fusion technique. The performance of the method for brain extraction from multi-modal data of 50 newborns is evaluated and compared with results obtained using eleven publicly available brain extraction methods. ALFA outperformed the eleven compared methods providing robust and accurate brain extraction results across different modalities. As ALFA can learn from partially labelled datasets, it can be used to segment large-scale datasets efficiently. ALFA could also be applied to other imaging modalities and other stages across the life course.

  16. Randomized, controlled, open-label, non-inferiority study of the CONSORT algorithm for individualized dosing of follitropin alfa

    NARCIS (Netherlands)

    Olivennes, F.; Trew, G.; Borini, A.; Broekmans, F.; Arriagada, P.; Warne, D. W.; Howles, C. M.


    In this randomized, controlled, open-label, phase IV study, ovarian response after a follitropin alfa starting dose determined by the CONSORT calculator was compared with a standard dose (150 IU). Normo-ovulatory women (aged 18-34 years) eligible for assisted reproductive techniques were recruited (

  17. Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy in adults with Fabry disease (United States)

    Goláň, Lubor; Goker-Alpan, Ozlem; Holida, Myrl; Kantola, Ikka; Klopotowski, Mariusz; Kuusisto, Johanna; Linhart, Aleš; Musial, Jacek; Nicholls, Kathleen; Gonzalez-Rodriguez, Derlis; Sharma, Reena; Vujkovac, Bojan; Chang, Peter; Wijatyk, Anna


    Purpose Efficacy and safety of agalsidase alfa at 0.2 mg/kg weekly were compared with 0.2 mg/kg every other week (EOW). Exploratory analyses were performed for 0.4 mg/kg weekly. Patients and methods This was a 53-week, Phase III/IV, multicenter, open-label study (NCT01124643) in treatment-naïve adults (≥18 years) with Fabry disease. Inclusion criteria were left ventricular hypertrophy at baseline, defined as left ventricular mass indexed to height >50 g/m2.7 for males and >47 g/m2.7 for females. Primary endpoint was reduction of left ventricular mass indexed to height as assessed by echocardiography. Secondary endpoints included cardiac (peak oxygen consumption, 6-minute walk test, Minnesota Living with Heart Failure Questionnaire, New York Heart Association classification), renal (Modification of Diet in Renal Disease, estimated glomerular filtration rate), and biomarker (plasma globotriaosylceramide) assessments. Safety endpoints were adverse events and anti–agalsidase alfa antibodies. Results Twenty patients were randomized to 0.2 mg/kg EOW (mean age, 50.3 years; 70% male), 19 to 0.2 mg/kg weekly (51.8 years; 53% male), and 5 to 0.4 mg/kg weekly (49.4 years; 40% male). The mean change in left ventricular mass indexed to height by Week 53 in the 0.2-mg/kg EOW and weekly groups was 3.2 g/m2.7 and 0.5 g/m2.7, with no significant difference between groups. No clinically meaningful changes by Week 53 were found within or between the 0.2-mg/kg groups for peak oxygen consumption, 6-minute walk test, or Minnesota Living with Heart Failure Questionnaire. Two patients in each group improved by ≥1 New York Heart Association classification. No significant differences were found between 0.2 mg/kg EOW and weekly for mean change in estimated glomerular filtration rate (−1.21 mL/min/1.73 m2 vs −3.32 mL/min/1.73 m2) or plasma globotriaosylceramide (−1.05 nmol/mL vs −2.13 nmol/mL), respectively. Infusion-related adverse events were experienced by 25% and 21% in the

  18. Dificuldades na identificação laboratorial da talassemia alfa Difficulty on laboratory identification of alpha thalassemia

    Directory of Open Access Journals (Sweden)

    Karlla Greick Batista Dias-Penna


    Full Text Available Introdução: Talassemia alfa é uma síndrome associada à redução da síntese de cadeias de globina do tipo alfa. A gravidade das manifestações clínicas está relacionada com a quantidade de globinas produzida e a estabilidade das cadeias beta presentes em excesso. A talassemia alfa mínima resulta da deleção de apenas um dos quatro genes a (-α/αα. Clinicamente apresenta anemia leve com microcitose ou ausência de anemia, sendo o diagnóstico realizado por meio de visualização da hemoglobina (Hb H por eletroforese alcalina em acetato de celulose ou por identificação de inclusões celulares de Hb H coradas pelo azul de crezil brilhante. Objetivo: Avaliar portadores de talassemia alfa e seus respectivos progenitores, correlacionando perfil hematológico e presença de Hb H, utilizando procedimentos laboratoriais clássicos em três diferentes amostragens. Discussão e conclusão: Os dados obtidos mostram que a presença de Hb H, indicativo de talassemia alfa, pode não ser confirmada em uma análise posterior. Entre os fatores que podem influenciar no não aparecimento de Hb H em pessoa comprovadamente com talassemia alfa está a deficiência de ferro. A talassemia alfa está associada a defeitos envolvendo os genes codificadores da cadeia alfa, mas também pode estar relacionada com desbalanciamento temporário na expressão dos genes globina, diminuição de alfa ou aumento de beta, o que poderia explicar o aparecimento de tetrâmeros de cadeia beta (Hb H, sugerindo diagnóstico de talassemia alfa mínima.Introduction: Alpha thalassemia is a syndrome with associated with the reduction of alpha globin chain synthesis. The severity of clinical manifestations is related to the amount of globins produced and the stability of beta chains that are present in excess. Alpha thalassemia minor is caused by the deletion of one of the four genes a (-α/αα. Clinically, it presents mild anemia with microcytosis or absence of anemia. The

  19. Unidades fototérmicas e temperatura-base inferior de frutos de Mangueira Alfa, na Baixada Cuiabana Photothermal units and lower base temperature for alfa mango fruit on the Baixada Cuiabana

    Directory of Open Access Journals (Sweden)

    Marcelo Paes de Barros


    Full Text Available O objetivo deste trabalho foi determinar a temperatura-base inferior (Tb a partir da unidade fototérmica (UF para o cultivo experimental de manga Alfa sob condições de cerrado. Foram utilizados dados diários da temperatura do ar disponibilizados pela Estação Agrometeorológica Padre Ricardo Remetter, localizada em Santo Antônio do Leverger-MT (15,8° S e 56,1° W, 140 m, e avaliação sensorial do estádio de maturação dos frutos de manga. A Tb foi determinada pelo método da menor variabilidade das unidades fototérmicas (UF acumuladas do período da floração à colheita dos frutos, variabilidade avaliada pelo coeficiente de variação (cv simulado para diferentes valores da Tb. De julho a novembro de 2007, em três plantas de um pomar demonstrativo irrigado, foram identificados 82 frutos para o acompanhamento do crescimento e maturação. Entre esses frutos, em meados de dezembro de 2007, foi possível identificar 13 frutos que atingiram a maturidade fisiológica, após um período médio de observação de 112 dias. Para exigência fototérmica de 1.878.166,1 UF, encontrou-se Tb de 10 °C, valor consistente com os apresentados na literatura para a cultivar de manga, o que comprova a eficiência do método que combina a ação da temperatura e do fotoperíodo sobre a maturação dos frutos e que confere um caráter mais racional que o método tradicional da soma térmica.In this study was to determine the lower base temperature (Tb for Alfa mango fruit, using the photothermal units (PTU method in cerrado conditions. The meteorological data for the study were acquired from "Padre Ricardo Remetter" meteorological station located at Santo Antonio do Leverger, MT, Brazil (15,8° S and 56,1° W, 140 m, and the fruit data was acquired by sensorial evaluation of mango fruit maturation state. The Tb was determined by less variability of the coefficient of variation (cv method applied to the PTU sum, from flowering to harvest, simulated for

  20. Management of anaemia in oncohaematological patients treated with biosimilar epoetin alfa: results of an Italian observational, retrospective study (United States)

    Rosti, Giovanni; Petrini, Mario; Bosi, Alberto; Galieni, Piero; Bernardi, Daniele; Giglio, Gianfranco; Dorotea, Laura; Falini, Brunangelo; Scelzi, Elvira; Veltri, Enzo; Castelli, Roberto; Longagnani, Chiara; Raggi, Tommaso; Simonetti, Federico


    Background: Many patients with solid tumours or nonmyeloid haematopoietic tumours develop symptomatic anaemia, which has a major impact on quality of life (QoL). The efficacy of erythropoiesis-stimulating agents (ESAs) in improving QoL and reducing blood transfusions has been widely demonstrated. Binocrit® (biosimilar epoetin alfa) is an ESA indicated in the European Union for treating chemotherapy-induced anaemia. The aim of this study was to investigate the effect of Binocrit® on haemoglobin (Hb) levels in anaemic cancer patients in Italian clinical practice. Methods: The ANEMONE study was a national, longitudinal, retrospective, multicentre observational study. Patients had to be 18 years or older, with a solid tumour or non-Hodgkin’s lymphoma, Hodgkin’s disease or multiple myeloma, receiving chemotherapy, and treated with Binocrit® to manage chemotherapy-induced anaemia. The primary outcomes were the proportion of patients with a Hb increase ⩾1 g/dl during the first 4 weeks and with a Hb increase ⩾2 g/dl during the first 12 weeks. Results: A total of 245 patients were enrolled and 215 patients were evaluable for statistical analysis. In the first 4 weeks, 49.3% of patients showed an increase in Hb of ⩾1 g/dl: 45.5% in patients with solid tumours and 52.1% in patients with haematological malignancies. In the first 12 weeks, 51.6% of patients showed an increase in Hb of ⩾2 g/dl (48.4% solid tumours, 54.2% haematological diseases). Treatment with Binocrit® was well tolerated. Conclusions: These results confirm the effectiveness and safety of Binocrit® for chemotherapy-induced anaemia in routine practice in patients with solid tumours, lymphoma and myeloma. PMID:28203295

  1. The ATLAS Forward Detectors - LUCID, ALFA and AFP: Past, Present and Future

    CERN Document Server

    Caforio, D; The ATLAS collaboration


    LUCID is a gas Cerenkov detector deployed near to the beam‐pipe at 17 m either side of the ATLAS Intersection point. The LUCID detector ‐ when calibrated via a Van der Meer scan – is now measuring absolute luminosity on a bunch‐by‐bunch basis. It is now measuring integrated luminosity up to high luminosity with a precision of around 3%. The technical challenges that had to faced to make this measurement as well as upgrade plans for LUCID will be presented. In addition to LUCID, we will discuss that ALFA detector (Absolute Luminosity for ATLAS) and its status as well as the progress on the ATLAS Forward Protons project (AFP) that plans to deploy detectors to tag and measure, with 3‐D silicon detectors, both protons in exclusive central diffractive processes.

  2. Arecibo Pulsar Survey Using ALFA. III. Probing Radio Pulsar Intermittency and Transients

    CERN Document Server

    Deneva, J S; McLaughlin, M A; Nice, D J; Lorimer, D R; Crawford, F; Bhat, N D R; Camilo, F; Champion, D J; Freire, P C C; Edel, S; Kondratiev, V I; Hessels, J W T; Jenet, F A; Kasian, L; Kaspi, V M; Krämer, M; Lazarus, P; Van Leeuwen, J; Ransom, S M; Stairs, I H; Stappers, B W; Brazier, A; Venkataraman, A; Zollweg, J A


    We present radio transient search algorithms, results, and statistics from the ongoing Arecibo Pulsar ALFA (PALFA) Survey of the Galactic plane. We have discovered seven objects by detecting isolated dispersed pulses and one of the new discoveries has a duty cycle of 0.01%, the smallest known. The impact of selection effects on the detectability and classification of intermittent sources is discussed, and the relative efficiencies of periodicity vs. single pulse searches are compared for various pulsar classes. We find that scintillation, off-axis detection and few rotation periods within an observation may misrepresent normal periodic pulsars as intermittent sources. Finally, we derive constraints on transient pulse rate and flux density from the PALFA survey parameters and results.

  3. Recombinant interferon alfa-2a, an active agent in advanced cutaneous T-cell lymphomas. (United States)

    Bunn, P A; Ihde, D C; Foon, K A


    The cutaneous T-cell lymphomas including mycosis fungoides and the Sézary syndrome, are indolent lymphomas with early systemic dissemination. Like the indolent B-cell lymphomas, they cannot be cured by currently available systemic chemotherapy so new systemic therapies need to be developed. A study of very high-dose recombinant interferon alfa-2a was, therefore, initiated in 20 patients with advanced cutaneous T-cell lymphoma (5 in stage II, 2 in stage III and 13 in stage IV). All patients were refractory to at least 2 standard therapies, including topical nitrogen mustard (18 patients), psoralens and ultraviolet A light (12 patients), total skin electron irradiation (14 patients) and systemic chemotherapy (16 patients). Nine out of 20 patients (45%; 95% confidence interval 25-69%) had either objective partial or complete responses within 3 months of starting treatment. Maximal response, however, often did not occur for at least one year. The median duration of response was 5.5 months and all complete responses lasted more than 2 years. Response frequencies were equal at both cutaneous and extracutaneous sites and in patients with or without prior chemotherapy. Toxicity was exhibited primarily as a flu-like syndrome consisting of fever, malaise, fatigue, anorexia and weight loss which necessitated dose reductions in all patients. Transient elevations in liver function and decreases in renal function and granulocyte counts occurred in some patients. It is concluded that interferon alfa-2a is highly active against advanced cutaneous T-cell lymphomas and that it should be studied in its early stages. It should also be evaluated in combination with other biological agents and with chemotherapy.

  4. Properties of Cold HI Emission Clouds in the Inner-Galaxy ALFA Survey (United States)

    Hughes, James Marcus; Gibson, Steven J.; Noriega-Crespo, Alberto; Newton, Jonathan; Koo, Bon-Chul; Douglas, Kevin A.; Peek, Joshua Eli Goldston; Park, Geumsook; Kang, Ji-hyun; Korpela, Eric J.; Heiles, Carl E.; Dame, Thomas M.


    Star formation, a critical process within galaxies, occurs in the coldest, densest interstellar clouds, whose gas and dust content are observed primarily at radio and infrared wavelengths. The formation of molecular hydrogen (H2) from neutral atomic hydrogen (HI) is an essential early step in the condensation of these clouds from the ambient interstellar medium, but it is not yet completely understood, e.g., what is the predominant trigger? Even more troubling, the abundance of H2 may be severely underestimated by standard tracers like CO, implying significant "dark" H2, and the quantity of HI may also be in error if opacity effects are neglected. We have developed an automated method to account for both HI and H2 in cold, diffuse clouds traced by narrow-line HI 21-cm emission in the Arecibo Inner-Galaxy ALFA (I-GALFA) survey. Our algorithm fits narrow (2-5 km/s), isolated HI line profiles to determine their spin temperature, optical depth, and true column density. We then estimate the "visible" H2 column in the same clouds with CfA and Planck CO data and the total gas column from dust emission measured by Planck, IRAS, and other surveys. Together, these provide constraints on the dark H2 abundance, which we examine in relation to other cloud properties and stages of development. Our aim is to build a database of H2-forming regions with significant dark gas to aid future analyses of coalescing interstellar clouds. We acknowledge support from NSF, NASA, Western Kentucky University, and Williams College. I-GALFA is a GALFA-HI survey observed with the 7-beam ALFA receiver on the 305-meter William E. Gordon Telescope. The Arecibo Observatory is a U.S. National Science Foundation facility operated under sequential cooperative agreements with Cornell University and SRI International, the latter in alliance with the Ana G. Mendez-Universidad Metropolitana and the Universities Space Research Association.

  5. Therapeutic and routine prophylactic properties of rFactor VIII Fc (efraloctocog alfa, Eloctate®) in hemophilia A (United States)

    Chowdary, Pratima; Fosbury, Emma; Riddell, Anne; Mathias, Mary


    rFVIIIFc (efraloctocog alfa, Eloctate®) is an extended half-life (EHL) factor VIII licensed for use in patients with hemophilia A for prophylaxis and treatment of bleeding and surgical episodes. Pharmacokinetic studies in adults have shown a mean 1.5-fold increase in half-life compared to full-length factor VIII. When compared to adults, the half-life is decreased by 8% in adolescents between 12 and 17 years, by 18% in children 6 to <12 years, and by 33% in children between the ages of 2 and <6 years. There is a considerable interindividual variation in the prolongation of the half-life particularly in children and across the age groups, the range extending from no increase to a 2.5-fold increase. In addition to age, von willebrand factor (VWF) antigen level has demonstrated a significant impact on rFVIIIFc half-life, with higher VWF levels associated with greater prolongation of half-life. The pivotal and pediatric clinical trials have demonstrated the efficacy and safety of rFVIIIFc for use in regular prophylaxis and in management of bleeds and surgery. In these studies, just under half the participants showed a zero annualized bleed rate (ABR), and the median ABR (1.6 in the pivotal study for the individualized prophylaxis arm) showed a further decrease in the extension study. On average, the patients required fewer infusions (reduced by at least a third), and the mean weekly consumption seems to be in keeping with standard recombinant factor VIII. EHL rFVIIIFc has made decreased infusion frequency a possibility. However, the interindividual variability in dose and infusion frequency highlights the need for a personalized approach based on individual patient’s half-life and/or response to treatment. PMID:27695377

  6. Propiedades electrofisiológicas de las variantes normales de actividad alfa en el continuo vigilia-sueño

    Directory of Open Access Journals (Sweden)

    José Luis Cantero


    Full Text Available El estudio de los ritmos cerebrales puede ser abordado mediante el análisis de sus propiedades electrofisiológicas usando técnicas de EEG cuantitativo. En aquellos casos donde una misma actividad aparece espontáneamente en diferentes estados de activación cerebral, el estudio de estas propiedades ayudaría a establecer diferencias funcionales asociadas a cada uno de estos estados. El presente trabajo revisa aquellos estudios que han determinado las propiedades electrofisiológicas de las diferentes variantes normales de alfa que aparecen en el continuo vigilia-sueño, más concretamente en vigilia relajada, somnolencia y durante la fase REM del sueño. Los resultados indican que cada variante normal de alfa, aun mostrando una distribución topográfica similar en cada uno de los estados cerebrales, presenta características diferenciales atendiendo a su composición espectral, relaciones funcionales entre regiones corticales, y micro-estados cerebrales subyacentes. De acuerdo con estos hallazgos, cada variante de alfa desempeñaría diferentes funciones cerebrales. El ritmo alfa de vigilia parece ser el resultado de una máxima sincronización neuronal como consecuencia de la ausencia de procesamiento sensorial, mientras que la presencia de actividad alfa durante la somnolencia estaría más asociada al procesamiento de las imágenes hipnagógicas que ocurren al comienzo del sueño. Los brotes de alfa de REM, sin embargo, constituirían un punto de contacto entre el cerebro dormido y el ambiente externo. Esta caracterización electrofisiológica encuentra su campo de aplicación más directo en el diseño de algoritmos para clasificar el sueño de forma automática, así como en el diagnóstico y evaluación de determinadas patologías donde pudieran verse afectados los mecanismos cerebrales de generación de esta actividad a lo largo del continuo vigilia-sueño.

  7. Avaliação do perfil hematológico de portadores de talassemia alfa provenientes das regiões Sudeste e Nordeste do Brasil Evaluation of alpha thalassemia carriers hematologic profile from Southeast and Northeast Brazilian regions

    Directory of Open Access Journals (Sweden)

    Gislane L. V. Oliveira


    Full Text Available A talassemia alfa é uma anemia hereditária resultante da síntese deficiente de cadeias alfa, provocando um excesso relativo de cadeias beta, que vão formar tetrâmeros identificados como hemoglobina H (Hb H no indivíduo adulto. Para direcionar o diagnóstico laboratorial desta anemia, a análise dos índices eritrocitários, a eletroforese em acetato de celulose em pH neutro e a pesquisa de corpos de inclusão de Hb H são essenciais. O objetivo deste estudo foi traçar o perfil hematológico, por meio dos índices eritrocitários, dos portadores de talassemia alfa das regiões Sudeste e Nordeste do Brasil. Foram analisadas 1.010 amostras de sangue periférico após consentimento informado. Os índices eritrocitários como contagem de glóbulos vermelhos (RBC, dosagem de hemoglobina (HGB, hematócrito (HCT, volume corpuscular médio (VCM, hemoglobina corpuscular média (HCM e concentração de hemoglobina corpuscular média (CHCM foram fornecidos por aparelhos automatizados com controle de qualidade interno e externo. Para o diagnóstico de talassemia alfa foram utilizados testes de triagem e complementares para talassemias, como eletroforese em pH neutro e pesquisa de corpos de inclusão de Hb H com coloração de azul cresil brilhante. Comparando-se os valores hematológicos observados nos dois grupos, notou-se que, em ambas as regiões, os índices com valores discrepantes foram os níveis de HGB e HCT, sendo a maior freqüência de variação observada entre as mulheres. Nos portadores do fenótipo alfa talassêmico da região Nordeste, todos os índices eritrocitários estavam abaixo dos valores de normalidade. Estes resultados evidenciam a necessidade de melhor avaliação do perfil hematológico de talassemia alfa em diferentes regiões, considerando-se os interferentes ambientais para um diagnóstico mais preciso.Alpha thalassemia is a hereditary anaemia resulting from deficient synthesis of the alpha chains, causing a relative

  8. Nanomedicines in the treatment of hepatitis C virus infection in Asian patients: optimizing use of peginterferon alfa

    Directory of Open Access Journals (Sweden)

    Liu CH


    Full Text Available Chen-Hua Liu,1–3 Jia-Horng Kao1–3 1Department of Internal Medicine, National Taiwan University Hospital, Taipei, Taiwan; 2Hepatitis Research Center, National Taiwan University Hospital, Taipei, Taiwan; 3Graduate Institute of Clinical Medicine, National Taiwan University College of Medicine, Taipei, Taiwan Abstract: Asia is endemic for hepatitis C virus (HCV infection, which is the leading cause of cirrhosis, hepatic decompensation, hepatocellular carcinoma , and liver transplantation worldwide. HCV has six major genotypes and each HCV genotype has its specific geographic distribution. HCV genotypes 1, 2, 3, and 6 are common in Asia. The aim of HCV treatment is to eradicate the virus by effective therapeutic agents; viral clearance is durable after long-term post-treatment follow-up. In most Asian countries, peginterferon alfa (PEG-IFN α in combination with ribavirin remains the standard of care, and the overall sustained viral response (SVR rate in Asian HCV patients is higher than that in Western patients. The differences are most significant in patients with HCV genotype 1 (HCV-1 infection, which is attributed to the higher frequency of IFN-responsive or favorable interleukin-28B (IL-28B genotype in Asian populations than in other ethnic populations. In addition, the introduction of response-guided therapy, where the optimized treatment duration is based on the early viral kinetics during the first 12 weeks of treatment, increases the SVR rate. Recently, telaprevir or boceprevir-based triple therapy was found to further improve the SVR rate in treated and untreated HCV-1 patients and has become the new standard of care in Western and some Asian countries. Many novel direct-acting antiviral agents, either in combination with PEG-IFN α plus ribavirin or used as IFN-free regimens are under active investigation. At the time of this writing, simeprevir and sofosbuvir have been approved in the US. Because the SVR rates in Asian HCV patients

  9. Detection of DNA-recombinant human epoetin-alfa as a pharmacological ergogenic aid. (United States)

    Wilber, Randall L


    The use of DNA-recombinant human epoetin-alfa (rhEPO) as a pharmacological ergogenic aid for the enhancement of aerobic performance is estimated to be practised by at least 3 to 7% of elite endurance sport athletes. rhEPO is synthesised from Chinese hamster ovary cells, and is nearly identical biochemically and immunologically to endogenous epoetin-alfa (EPO). In a clinical setting, rhEPO is used to stimulate erythrocyte production in patients with end-stage renal disease and anaemia. A limited number of human studies have suggested that rhEPO provides a significant erythropoietic and ergogenic benefit in trained individuals as evidenced by increments in haemoglobin, haematocrit, maximal oxygen uptake (VO2max) and exercise endurance time. The purpose of this review is to summarise the various technologies and methodologies currently available for the detection of illicit use of rhEPO in athletes. The International Olympic Committee (IOC) banned the use of rhEPO as an ergogenic aid in 1990. Since then a number of methods have been proposed as potential techniques for detecting the illegal use of rhEPO. Most of these techniques use indirect markers to detect rhEPO in blood samples. These indirect markers include macrocytic hypochromatic erythrocytes and serum soluble transferrin receptor (sTfr) concentration. Another indirect technique uses a combination of 5 markers of enhanced erythropoiesis (haematocrit, reticulocyte haematocrit, percentage of macrocytic red blood cells, serum EPO, sTfr) to detect rhEPO. The electrophoretic mobility technique provides a direct measurement of urine and serum levels of rhEPO, and is based on the principle that the rhEPO molecule is less negatively charged versus the endogenous EPO molecule. Isoelectric patterning/focusing has emerged recently as a potential method for the direct analysis of rhEPO in urine. Among these various methodologies, the indirect technique that utilises multiple markers of enhanced erythropoiesis appears to

  10. Assessment of Lifespan Functioning Attainment (ALFA) scale: A quantitative interview for self-reported current and functional decline in schizophrenia. (United States)

    Joseph, Jamie; Kremen, William S; Glatt, Stephen J; Franz, Carol E; Chandler, Sharon D; Liu, Xiaohua; Johnson, Barbara K; Tsuang, Ming T; Twamley, Elizabeth W


    Schizophrenia has been characterized as a disorder with poor outcomes across various functional domains, especially social and occupational functioning. Although these outcomes have been investigated based on patients' current functioning, few studies have considered the assessment of functional outcomes across the lifespan in schizophrenia. We developed a novel and brief scale of adulthood lifespan functioning, the Assessment of Lifespan Functioning Attainment (ALFA). We assessed current functioning and percentage of pre- and post-psychosis onset engagement for five functional domains including paid employment, living independently, romantic partnerships, close friendships, and recreational engagement with others. Pre-to post-psychosis functional decline was observed for all domains, with paid employment having the greatest decline (d = 2.68) and living independently having the least decline (d = .59). Our exploratory factor analysis suggests that a single factor accounted for the most variance in Pre-Psychosis Functioning in ALFA domains. Two factors explain the majority of variance in Post-Psychosis Functioning and Pre-to-Post Psychosis Decline: a sociability factor (close friendships and recreational engagement with others) and an independence factor (paid employment, living independently, romantic relationships). To our knowledge, this is the first study to report on a self-reported quantitative assessment of adult lifespan functioning in schizophrenia. The ALFA scale may be a useful tool for future research on functional outcomes in schizophrenia.

  11. The oxidation of methionine-54 of epoetinum alfa does not affect molecular structure or stability, but does decrease biological activity. (United States)

    Labrenz, Steven R; Calmann, Melissa A; Heavner, George A; Tolman, Glen


    Erythropoietin therapy is used to treat severe anemia in renal failure and chemotherapy patients. One of these therapies based on recombinant human erythropoietin is marketed under the trade name of EPREX and utilizes epoetinum alfa as the active pharmaceutical ingredient. The effect of oxidation of methionine-54 on the structure and stability of the erythropoietin molecule has not been directly tested. We have observed partial and full chemical oxidation of methionine-54 to methionine-54 sulfoxide, accomplished using tert-Butylhydroperoxide and hydrogen peroxide, respectively. A blue shift in the fluorescence center of spectral mass wavelength was observed as a linear response to the level of methionine sulfoxide in the epoetinum alfa molecule, presumably arising from a local change in the environment near tryptophan-51, as supported by potassium iodide quenching studies. Circular dichroism studies demonstrated no change in the folded structure of the molecule with methionine oxidation. The thermal unfolding profiles of partial and completely oxidized epoetinum alfa overlap, with a T(m) of 49.5 degrees C across all levels of methionine sulfoxide content. When the protein was tested for activity, a decrease in biological activity was observed, correlating with methionine sulfoxide levels. An allosteric effect between Met54, Trp51, and residues involved in receptor binding is proposed. These results indicate that methionine oxidation has no effect on the folded structure and global thermodynamic stability of the recombinant human erythropoietin molecule. Oxidation can affect potency, but only at levels significantly in excess of those seen in EPREX.

  12. [Intragenic deletions of NRXN1: three new case reports and a review of the phenotype]. (United States)

    Galán-Sánchez, Francisco; Esteban-Cantó, Vanessa; Blaya-Fernández, Pedro; Jadraque-Rodríguez, Rocío; Manchón-Trives, Irene; Alcaraz-Más, Luis


    Objetivo. Aportar datos sobre el fenotipo determinado por las microdeleciones de los exones alfa del gen NRXN1. Casos clinicos. Se estudian tres casos neuropediatricos con microdeleciones intragenicas NRXN1 alfa. El fenotipo en estos tres casos es inespecifico, con retraso mental leve-moderado, trastornos de comportamiento y escasos rasgos dismorficos o malformaciones. Conclusion. El fenotipo encontrado en las microdeleciones de los exones alfa del gen NRXN1 es claramente distinguible del fenotipo encontrado en las microdeleciones de los exones beta, con macrocefalia, epilepsia y retraso mental.

  13. [PROWESS, ENHANCE and ADDRESS: clinical implications for the treatment with drotrecogin alfa (activated)]. (United States)

    Cobas Meyer, M; Langenfeld, H; Rossaint, R; Sablotzki, A


    Drotrecogin alfa (activated) (DrotAA) represents a therapeutic advance in the treatment of severe sepsis. In the pivotal PROWESS trial DrotAA had demonstrated a significant decrease in 28-day mortality, most evident in the subgroup of patients at higher risk of death. Thus, DrotAA was licensed throughout Europe for treatment of adult patients with severe sepsis with multiple organ failure when added to best standard care. The ADDRESS trial was mandated by the FDA to investigate prospectively the treatment effect of DrotAA in patients at low risk of death, e.g. single organ failure. The trial was prematurely stopped due to futility, because no reduction in mortality was observed in this non-indicated patient population. The ENHANCE open-label trial enrolled similar patients to the PROWESS trial and the observed 28-day mortality was consistent with the results seen in the PROWESS trial. Survival rates for patients receiving DrotAA early within 24 h from the first sepsis-induced organ dysfunction were significantly higher than in patients treated later. In this overview we will discuss the results of the ENHANCE and ADDRESS trials in the context of the PROWESS study and clinical implications for the treatment with DrotAA.

  14. The Arecibo Legacy Fast ALFA Survey: VI. Second HI Source Catalog of the Virgo Cluster Region

    CERN Document Server

    Kent, Brian R; Haynes, Martha P; Martin, Ann M; Saintonge, Amélie; Stierwalt, Sabrina; Balonek, Thomas J; Brosch, Noah; Koopmann, Rebecca A


    We present the third installment of HI sources extracted from the Arecibo Legacy Fast ALFA extragalactic survey. This dataset continues the work of the Virgo ALFALFA catalog. The catalogs and spectra published here consist of data obtained during the 2005 and 2006 observing sessions of the survey. The catalog consists of 578 HI detections within the range 11h 36m 6.5; (b) high velocity clouds in the Milky Way or its periphery; and (c) signals of lower S/N which coincide spatially with an optical object and known redshift. 75% of the sources are newly published HI detections. Of particular note is a complex of HI clouds projected between M87 and M49 that do not coincide with any optical counterparts. Candidate objects without optical counterparts are few. The median redshift for this sample is 6500 km/s and the cz distribution exhibits the local large scale structure consisting of Virgo and the background void and the A1367-Coma supercluster regime at cz_sun ~7000 km/s. Position corrections for telescope poin...

  15. Endotoxemia por lipopolissacarídeo de Escherichia coli, em eqüinos: efeitos de antiinflamatórios nas concentrações sérica e peritoneal do fator de necrose tumoral alfa (TNF-alfa Escherichia coli lipopolisacharide (LPS induced endotoxemia in horses: effects of anti-inflammatory drugs on seric and peritoneal tumor necrosis factor alpha (TNF-alpha concentrations

    Directory of Open Access Journals (Sweden)

    R.C. Campebell


    Full Text Available Avaliou-se a inibição da produção do fator de necrose tumoral alfa (TNF-alfa devido ao pré-tratamento com antiinflamatório esteroidal (dexametasona e não esteroidal (diclofenaco sódico em eqüinos com endotoxemia induzida experimentalmente. Foram utilizados 15 cavalos machos não castrados, distribuídos em três grupos de cinco animais: controle (C, diclofenaco sódico (DS e dexametasona (DM. A endotoxemia subletal foi induzida pela infusão intravenosa (IV de 0,1mg/kg/pv de lipopolissacarídeo (LPS de Escherichia coli 055:B5, administrado em 250ml de solução estéril de cloreto de sódio a 0,9%, durante 15min. Os cavalos do grupo-controle foram tratados com solução de cloreto de sódio a 9% IV. Nos animais do grupo DS, administraram-se, por via oral, 2,2mg/kg de diclofenaco sódico e, nos do grupo DM, 1,1mg/kg de dexametasona IV, respectivamente, 60 e 30min antes da infusão da endotoxina. Mensurou-se, por meio de ensaio de toxicidade com células da linhagem L929, a concentração de TNF-alfa no soro e no líquido peritoneal às 0, 1¼, 3 e 6 horas após injeção do LPS. No grupo-controle, observou-se aumento significativo de TNF-alfa sérico, em relação ao valor basal e aos grupos DS e DM, 1,15 horas após a indução da endotoxemia. No líquido peritoneal, as concentrações observadas estavam abaixo daquelas da curva padrão de TNF-alfa, não havendo diferença entre os grupos (P>0,05.The inhibition of tumor necrosis factor alpha (TNF-alpha production due to pre-treatment with steroidal (dexamethazone and non-steroidal (sodium diclofenac anti-inflammatories was studied in horses under experimentally induced endotoxemy. Fifteen stallions were allotted into three groups of five animals each: control (C, sodium diclofenac (SD and dexamethazone (DM. Sublethal endotoxemy was induced with 0.1mg/kg/bw Escherichia coli 055:B5 lipopolysaccharide (LPS, IV, administrated in 250ml of 0.9% sterile sodium chloride, during 15 minutes

  16. Obtenção in situ do compósito alfa-SiAlON-SiC In situ preparation of alpha-SiAlON-SiC composite

    Directory of Open Access Journals (Sweden)

    C. Santos


    Full Text Available O objetivo desse trabalho foi a preparação in situ do compósito alfa-SiAlON-SiC com desenvolvimento de solução sólida de nitreto de silício (SiAlON durante a sinterização, utilizando o óxido misto de ítrio e terras raras (CRE2O3, fabricado na FAENQUIL, como estabilizador da fase alfa-Si3N4. Uma fração de 20% em volume da mistura AlN-CRE2O3, na proporção 9:1 (mol%, foi misturada a 80% em volume de Si3N4. A essa mistura (Si3N4-AlN-CRE2O3, foram adicionadas quantidades variadas de beta-SiC (entre 0 e 20 peso%. As misturas de pós foram moídas e, em seguida, compactadas por prensagem uniaxial e, subseqüente prensagem isostática a frio. Os compactos foram submetidos a sinterização a 1950 0C por 1 h e sob pressão de 1 MPa de N2. As amostras sinterizadas foram caracterizadas quanto às fases presentes, transformação Si3N4-SiAlON e aspectos microestruturais. Os resultados revelaram alfa-SiAlON e beta-SiC como únicas fases cristalinas. Além disso, não houve cristalização parcial da fase intergranular remanescente, e observou-se que variadas adições de SiC não interferiram na solubilidade e conseqüente formação de alfa-SiAlON, porém o crescimento de grãos alongados de alfa' é inibido em função da adição de quantidades maiores de SiC.The objective of this work is to obtain in situ alpha-SiAlON-SiC composites, by silicon nitride solid solution development, during sintering, using rare earth and yttrium oxide mixture (CRE3O3 as stabilizer of the alpha-Si3N4 phase. A fraction of 20 vol.% of AlN-CRE2O3 mixture was mixed to 80 vol.% of Si3N4. Different contents of beta-SiC powders were mixed to the Si3N4-AlN-CRE2O3 powder mixture. The powder mixtures were milled and compacted by uniaxial and cold isostatic pressing. The green bodies were sintered at 1950 °C during 1 h under 1 MPa of N2 pressure. The sintered samples were characterized by X-ray diffraction and scanning electron microscopy, in order to assess the

  17. Determination of the total cross section in proton-proton collisions at the LHC at √(s) = 8 from elastic scattering using the ALFA sub-detector of ATLAS

    Energy Technology Data Exchange (ETDEWEB)

    Heinz, Christian; Stenzel, Hasko; Dueren, Michael [2. Physikalisches Institut, Universitaet Giessen (Germany)


    The ALFA (Absolute Luminosity for ATLAS) Roman Pot detector system is part of the forward instrumentation of ATLAS located about 240 m away from the interaction point in the LHC tunnel in both directions. ALFA consists of a scintillating fibre tracker housed in vertical Roman Pots which enables the measurement of elastic proton-proton scattering at small scattering angles. In 2012 data were recorded at a centre-of-mass energy of √(s) = 8 TeV during a fill with special beam optics of the LHC with β* = 90 m and parallel-to-point focusing. The four-momentum transfer t is measured for elastically scattered protons and used to extract the differential elastic cross section. In this talk a preliminary determination of the total cross section and of the slope of the elastic cross section at small vertical stroke t vertical stroke obtained from a fit to the differential cross section using the optical theorem is reported. In addition a second run at √(s) = 8 TeV with a special beam optics of β* = 1 km, providing access to the Coulomb-nuclear interference region, is being analysed. Preliminary analysis results from this run are presented as well.

  18. Alfa-1-glicoproteina ??cida : valor diagn??stico en medicina interna


    G??lvez Bocanegra, Mar??a del Pilar


    Con este estudio nos proponemos introducir esta glicoproteina como par??metro diagnostico y pronostico para el control de las siguientes enfermedades: i) neumon??a bacteriana aguda 2) neoplasias g??stricas 3) infarto agudo de miocardio 4) diabetes mellitus y 5) hepatoatias cr??nicas el estudio se llevo a cabo en 210 sujetos, 20 controles y 190 pacientes distribuidos de la siguiente manera i) 14 pacientes 2) 40 pacientes 3)10 pacientes 4) 81 pacientes y 5) 45 pacientes. Para la determinaci??n ...

  19. Short versus standard treatment with pegylated interferon alfa-2A plus ribavirin in patients with hepatitis C virus genotype 2 or 3: the cleo trial

    Directory of Open Access Journals (Sweden)

    Picardi Antonio


    Full Text Available Abstract Background In patients with chronic hepatitis C virus (HCV genotype 2 or 3, 24 weeks' treatment with pegylated interferon alfa (PEG-IFN-alpha and ribavirin induces a sustained virological response (SVR in almost 80% of cases. Evidence suggests that a similar response rate may be obtained with shorter treatment periods, especially in patients with a rapid virological response (RVR. The aim of this study was to compare the efficacy of 12 or 24 weeks of treatment in patients with chronic HCV genotype 2 or 3 and to identify patients suitable for 12 weeks treatment. Methods Two hundred and ten patients received PEG-IFN-alpha-2a (180 ug/week and ribavirin (800-1200 mg/day for 4 weeks. Patients with a RVR (HCV RNA not detectable were randomized (1:1 to either 12 (group A1 or 24 (group A2 weeks of combination therapy. Patients without a RVR continued with 24-weeks' combination therapy (group B. HCV RNA was monitored at weeks 4, 8, 12, and 24, and at week 24 post-treatment. Results At study end, end of treatment response (ETR was observed in 62 (86% patients of group A1 and in 55 (77% patients of group A2 (p Conclusion In HCV patients with genotype 2 or 3, 12-week combination therapy is as efficacious as 24-week therapy and several independent covariates were predictive of SVR. Trial registration Trial number ISRCTN29259563

  20. Autoantibodies to alfa-fodrin in patients with Hashimoto thyroiditis and Sjögren's syndrome: possible markers for a common secretory disorder. (United States)

    Szanto, Antonia; Csipo, Istvan; Horvath, Ildiko; Biro, Edit; Szodoray, Peter; Zeher, Margit


    Presence of autoantibodies to alfa-fodrin was investigated in patients with Sjögren's syndrome (n = 61), Hashimoto thyroiditis (n = 27), Sjögren's syndrome associated with Hashimoto thyroiditis (n = 31) and in healthy persons (n = 77). In each group, level of alfa-fodrin antibodies was higher than in the controls. There was no significant difference in their presence either between patients with Hashimoto thyroiditis with or without Sjögren's syndrome, or-in IgA isotype-between Sjögren's and Hashimoto thyroiditis patients. Correlation was found between the level of IgG alfa-fodrin and anti-thyroglobulin antibodies. Based on these findings, fodrin can be associated with both endocrine and exocrine glandular secretion. Antibodies to alfa-fodrin might have a role in the pathogenesis of Hashimoto thyroiditis concerning the "final common effectory pathway", secretion. Alfa-fodrin antibodies can be good markers of secretory disorders. Assessment of these autoantibodies might help the diagnosis and follow-up of patients with impaired secretory capability of not only autoimmune origin.

  1. Análise comparativa do controle interno no contas a receber e a pagar nas empresas Beta Ltda e Alfa Ltda = A comparative internal control analysis of receivable and payable accounts in Beta and Alfa Ltd Companies

    Directory of Open Access Journals (Sweden)

    Cleyton de Oliveira Ritta


    Full Text Available A necessidade constante de um excelente desempenho empresarial leva à busca da qualidade e confiabilidade da informação para o auxílio na tomada de decisão. Neste contexto, a auditoria contábil tem um papel importante na análise das práticas administrativas adotadas pelas entidades. Desse modo, o objetivo deste artigo é comparar a estruturação dos controles internos no contas a receber e a pagar nas empresas Beta Ltda, a qual não contrata serviços de auditoria externa, e Alfa Ltda, que os contrata. Este estudo caracteriza-se como de caso comparativo de caráter descritivo por meio de questionário e entrevista. Os resultados apontam que a empresa Alfa Ltda tem melhores níveis de controle interno e, consequentemente, está menos exposta a erros e fraudes. Desse modo, entende-se que os seviços de auditoria atuam como um instrumento de auxílio para minimização dos riscos operacionais e servem de alerta aos gestores quanto à eficiência das transações. Contudo, percebe-se que a qualidade dos controles internos nas organizações depende diretamente da utilização de procedimentos de monitoramento.The constant need for excellent business performance triggers the quest for information quality and reliability to help in decision making. Considering this context, accounting auditing plays an important role in the analysis of administrative practices adopted by entities. Thus, the objective of this article is to compare the structure of the internal controls for receivable and payable accounts in Beta Ltd companies, which do not contract external auditing services, and Alfa Ltd, which does. This study is a descriptive comparative case study, carried out through questionnaire and interview. The results have showed that Alfa Ltd has better internal control levels and consequently is less exposed to errors and fraud. This way, auditing services are seen as auxiliary instruments to minimize operational risks and serve to alert

  2. Temperature rise after peginterferon alfa-2a injection in patients with chronic hepatitis C is associated with virological response and is modulated by IL28B genotype (United States)

    Han, Hwalih; Noureddin, Mazen; Witthaus, Michael; Park, Yoon J.; Hoofnagle, Jay H.; Liang, T. Jake; Rotman, Yaron


    Background & Aims Interferon treatment for chronic hepatitis C is associated with non-specific symptoms including fever. We aimed to determine the association of temperature changes with interferon antiviral activity. Methods 60 treatment-naïve patients with chronic hepatitis C (67% genotype 1/4/6, 33% genotype 2/3) were admitted to start peginterferon alfa-2a and ribavirin in a clinical trial. Temperature was measured at baseline and 3 times daily for the first 24 h and the maximal increase from baseline during that time (Δ Tmax) was determined. Serum HCV-RNA, interferon-gamma-inducible protein-10 (IP-10) and expression of interferon-stimulated genes (ISGs – CD274, ISG15, RSAD2, IRF7, CXCL10) in peripheral blood mononuclear cells (PBMCs) were measured at very early time points, and response kinetics calculated. The IL28B single nucleotide polymorphism, rs12979860, was genotyped. Results Temperatures rose by 1.2 ± 0.8 °C, peaking after 12.5 h. ΔTmax was strongly associated with 1st phase virological decline (r = 0.59, p Elsevier B.V. on behalf of the European Association for the Study of the Liver. PMID:23850879

  3. The Arecibo Legacy Fast ALFA Survey: IX. The Leo Region HI Catalog, Group Membership and the HI Mass Function for the Leo I Group

    CERN Document Server

    Stierwalt, S; Giovanelli, R; Kent, B R; Martin, A M; Saintonge, A; Karachentsev, I D; Karachentseva, V E


    We present the catalog of HI sources extracted from the ongoing Arecibo Legacy Fast ALFA (ALFALFA) extragalactic HI line survey, found within the sky region bounded by 9h36m < RA < 11h36m and +08deg < DEC < +12deg. The HI catalog presented here for this 118-deg^2 region is combined with ones derived from surrounding regions also covered by the ALFALFA survey to examine the large scale structure in the complex Leo region. Because of the combination of wide sky coverage and superior sensitivity, spatial and spectral resolution, the ALFALFA HI catalog of the Leo region improves significantly on the numbers of low HI mass sources as compared with those found in previous HI surveys. The HI mass function of the Leo I group presented here is dominated by low-mass objects: 45 of the 65 Leo I members have M_HI < 10^8 Msun, yielding tight constraints on the low-mass slope of the Leo I HI mass function. The best-fit slope is alpha < -1.41 + 0.2 - 0.1. A direct comparison between the ALFALFA HI line det...

  4. Evaluation of the efficacy and safety of three dosing regimens of agalsidase alfa enzyme replacement therapy in adults with Fabry disease

    Directory of Open Access Journals (Sweden)

    Goláň L


    Full Text Available Lubor Goláň,1 Ozlem Goker-Alpan,2 Myrl Holida,3 Ikka Kantola,4 Mariusz Klopotowski,5 Johanna Kuusisto,6 Aleš Linhart,1 Jacek Musial,7 Kathleen Nicholls,8 Derlis Gonzalez-Rodriguez,9 Reena Sharma,10 Bojan Vujkovac,11 Peter Chang,12 Anna Wijatyk12 1First Faculty of Medicine, Department of Cardiovascular Medicine, Charles University, Prague, Czech Republic; 2Lysosomal Research and Treatment Unit, Fairfax, VA, USA; 3Stead Family Department of Pediatrics, Division of Medical Genetics, University of Iowa Hospitals and Clinics, Iowa City, IA, USA; 4Division of Medicine, Turku University Hospital, Turku, Finland; 5Institute of Cardiology, Warsaw, Poland; 6Department of Medicine, Center for Medicine and Clinical Research, University of Eastern Finland and Kuopio University Hospital, Kuopio, Finland; 7Department of Internal Medicine, Jagiellonian University Medical College, Krakow, Poland; 8Department of Nephrology, Royal Melbourne Hospital and the University of Melbourne, VIC, Australia; 9Instituto Privado de Hematologia E Investigacion Clinica (IPHIC, Asuncion, Paraguay; 10Salford Royal NHS Foundation Trust, Salford, UK; 11General Hospital Slovenj Gradec, Slovenj Gradec, Slovenia; 12Shire, Lexington, MA, USA Purpose: Efficacy and safety of agalsidase alfa at 0.2 mg/kg weekly were compared with 0.2 mg/kg every other week (EOW. Exploratory analyses were performed for 0.4 mg/kg weekly.Patients and methods: This was a 53-week, Phase III/IV, multicenter, open-label study (NCT01124643 in treatment-naïve adults (≥18 years with Fabry disease. Inclusion criteria were left ventricular hypertrophy at baseline, defined as left ventricular mass indexed to height >50 g/m2.7 for males and >47 g/m2.7 for females. Primary endpoint was reduction of left ventricular mass indexed to height as assessed by echocardiography. Secondary endpoints included cardiac (peak oxygen consumption, 6-minute walk test, Minnesota Living with Heart Failure Questionnaire, New

  5. Secondary bronchiolitis obliterans organizing pneumonia during treatment of chronic hepatitis C: role of pegylated interferon alfa-2a

    Directory of Open Access Journals (Sweden)

    Ronaldo Soares Martins


    Full Text Available The treatment of chronic hepatitis C has frequent side effects such as cytopenias and neuropsychiatric symptoms. However, pulmonary toxicity associated with interferon is rarely described. This paper describes the clinical case of a 67-year-old female patient with chronic hepatitis C who presented an acute onset of dry cough, dyspnoea, and fever 36 weeks after the use of pegylated interferon alfa-2a and ribavirin. The lung biopsy confirmed the diagnosis of a bronchiolitis obliterans organizing pneumonia (BOOP. Corticotherapy was initiated, with clinical and radiological improvement. This paper aims to advise physicians to this occasional, though severe, adverse event related to hepatitis C virus (HCV treatment.

  6. Comportamiento de glicinina, beta-conglicinina y alfa-amilasa en semillas de soja deterioradas y no deterioradas



    El objetivo del trabajo fue estudiar el comportamiento de glicinina y beta-conglicinina y la actividad de alfa-amilasa en semillas deterioradas y no deterioradas de 10 cultivares de soja [Glycine max (L.) Merr.]. Las semillas se sometieron a dos tratamientos: deterioradas por envejecimiento acelerado y no deterioradas. Se determinó la presencia de las proteínas de reserva a partir de semillas con 0, 3 y 8 días de germinadas por electroforesis en geles de poliacrilamida (SDS-PAGE). La activida...

  7. Informe sobre el Proyecto Alfa Biblioteca de Babel: ¿Un atajo para la administración de bibliotecas universitarias? Biblioteca de Babel Alfa Project Report: A shortcut for the academic libraries management?

    Directory of Open Access Journals (Sweden)

    Liliana Laura Rega


    Full Text Available El Proyecto Alfa Biblioteca de Babel que reúne bibliotecas universitarias de América Latina y Europa comenzó en marzo de 2005 y prevé su conclusión en marzo de 2007. El presente trabajo intenta describir los objetivos y los resultados esperados, e informa las actividades realizadas por la Red Biblioteca de Babel. Finalmente se analizan las propuestas del proyecto en cuanto al rol de las bibliotecas universitarias, y su relación con la innovación en las prácticas pedagógicas.Biblioteca de Babel Alfa Project that assembles academic libraries from Latin America and Europe was approved on March, 2005 and its conclusion is foreseen on March, 2007. This article attempts to describe the aims and the expected results, and reports the activities of the Biblioteca de Babel Network. Finally it analizes the proposals of the project about the role of academic libraries and their relationship with innovations in pedagogical practices.

  8. Milhos com diferentes texturas de endosperma e adição de alfa-amilase na dieta de leitões The effect of corn kernel texture and alpha-amylase addition in performance and digestibility of diets for weaned pigs

    Directory of Open Access Journals (Sweden)

    Vanessa Piovesan


    Full Text Available Dois experimentos foram realizados para avaliar a influência de milhos com diferentes texturas de endosperma e adição de alfa amilase na digestibilidade de dietas e no desempenho de leitões na fase de creche. No ensaio de digestibilidade, foram usados 12 leitões castrados (7,96±0,31kg, alojados individualmente em gaiolas de metabolismo, enquanto no desempenho utilizaram-se 75 leitões (7,87±0,67kg distribuídos em 15 gaiolas de creche. Nos dois experimentos, os tratamentos consistiram de três dietas formuladas para serem isonutritivas, mas com milhos de diferentes texturas e adição ou não de alfa amilase, conforme descrito a seguir: 1. grãos de milho semi-dentado; 2. grãos de milho duro e; 3. grãos de milho duro + alfa-amilase. Os resultados de metabolismo mostraram que os valores de energia digestível (ED e metabolizável (EM das dietas foram influenciados pelos tipos de milho, sendo o semi-dentado superior (P0,05 entre os tratamentos no consumo de ração, ganho de peso e/ou conversão alimentar. Dietas com milho duro ou semi-dentado e adição de alfa-amilase não alteram o desempenho dos leitões. Por outro lado, dietas contendo milho semi-dentado apresentam maior energia digestível que dietas com milho duro e a adição de alfa-amilase aumenta a energia de dietas com milho duro.Two experiments were carried out to evaluate the effects of diets with different corn grain textures and amylase supplementation on nutrients digestibility and nursery piglets' performance. Twelve castrated piglets (7.96±0.31kg were individually housed in metabolic crates and 75 piglets (7.87±0.67kg penned in 15 nursery pens. In both experiments the treatments consisted of three isonutritive diets: 1. semi dent corn grain; 2. flint corn grain, and 3. flint corn grain + amylase. There was effect of treatments (P0.05 the performance characteristics studied. In conclusion, diets with flint or semi dent corns and amylase supplementation did not improve

  9. Treatment-naïve Gaucher disease patients achieve therapeutic goals and normalization with velaglucerase alfa by 4years in phase 3 trials. (United States)

    Zimran, Ari; Elstein, Deborah; Gonzalez, Derlis E; Lukina, Elena A; Qin, Yulin; Dinh, Quinn; Turkia, Hadhami Ben


    Gaucher disease is an inherited metabolic disease characterized by β-glucocerebrosidase deficiency and commonly treated with enzyme replacement therapy (ERT). The efficacy of ERT with velaglucerase alfa was assessed based on the achievement of published therapeutic goals and the normalization of disease parameters in 39 treatment-naïve patients with type 1 Gaucher disease, 6 to 62years of age, enrolled in phase 3 clinical trials. After 4years of ERT, therapeutic goals for thrombocytopenia and splenomegaly had been achieved in 100% of patients; goals for anemia and hepatomegaly had been achieved in 95% and 94% of patients, respectively. Consistent with the goal for bone mineral density, lumbar spine bone density improved in 87% of patients ≥18years of age. At year 4, compared with clinical ranges for healthy individuals, 86% of patients with a low baseline hemoglobin concentration had normalized, 60% with a low baseline platelet count had normalized, 67% with baseline splenomegaly had normalized, 58% with hepatomegaly had normalized, and lumbar spine bone density had normalized in 53% of adults. The decade-old therapeutic goals do not reflect the potential for normalization of clinical parameters in ERT-treated patients. Goals consistent with normalization or near-normalization should be considered. identifiers: NCT00430625, NCT00553631, NCT00635427.

  10. Uso de la tierra y diversidades alfa, beta y gamma de diplópodos en la cuenca del río Otún, Colombia



    Objetivo: Determinar la relación entre los cambios promovidos por la intervención humana en ecosistemas y grosistemas y la diversidad alfa, beta y gamma de Diplopoda de la cuenca media del río Otún. Materiales y métodos: Se utilizó un diseño sistemático estratificado con la selección de siete ventanas y 16 puntos de muestreo. Se separaron los diplópodos en familias y morfotipos para calcular la diversidad alfa, beta y gamma relacionada con la heterogeneidad de usos del terreno. Resultados: Se...

  11. Diagnóstico molecular da talassemia alfa+ (deleção–a3.7) em indivíduos com microcitose e/ou hipocromia atendidos no Hemocentro Dalton Barbosa Cunha em Natal, Rio Grande do Norte


    Bezerra, Christiane Medeiros


    A talassemia alfa, uma das doenças monogênicas mais comuns no mundo, resulta de um desequilíbrio na síntese das cadeias alfa da hemoglobina devido, principalmente, à deleção de um ou ambos os genes da globina alfa, sendo a deleção -α3.7 a mais freqüente. A talassemia alfa, juntamente com a deficiência de ferro e a talassemia beta, representa uma importante causa de microcitose e hipocromia. Com o objetivo de diagnosticar e verificar a prevalência da talassemia alfa (-α3.7) em indivíduos com m...

  12. Factor de necrosis tumoral alfa en una población infanto-juvenil con sobrepeso

    Directory of Open Access Journals (Sweden)

    Teresita del R. Carrizo


    Full Text Available El sobrepeso infantil está asociado a sobrepeso/obesidad en la edad adulta. El tejido adiposo en obesos produce una cantidad incrementada de citoquinas proinflamatorias como el factor de necrosis tumoral alfa (TNF-a, ejerciendo un efecto deletéreo sobre la función vascular. El objetivo de este trabajo fue evaluar niveles de TNF-a en una población infantojuvenil con sobrepeso y su relación con otras variables. Se estudiaron 30 niños con sobrepeso (12 varones de edades entre 8-13 años, se midió circunferencia de cintura (CC e índice de masa corporal (IMC y fueron comparados con 20 controles de edad y sexo semejantes. Se consideró criterio de inclusión un IMC = 85 < 95 percentilo para edad y sexo. En ambos grupos se determinó: glucemia en ayunas (método glucosa oxidasa, insulina plasmática (ECLIA, fibrinógeno (Fg, método de Clauss, proteína C reactiva ultrasensible (uPCR, método inmunoturbidimétrico, TNF-a (ELISA, perfil lipídico (métodos enzimáticos, eritrosedimentación y se calculó el índice HOMA. Los datos se expresaron como mediana y rango intercuartil y con el coeficiente de Spearman se investigaron las correlaciones entre variables, considerándose significativo un p < 0.05. Los niveles de TNF-a fueron mayores en los sujetos con sobrepeso [15.4 (13.2-24.0 vs. 12.7 (11.2-14.8 pg/ml; p = 0.028]. También resultaron más elevados los valores de Fg, insulina plasmática, índice HOMA, uPCR y triglicéridos. El TNF-a se correlacionó con la CC (r = 0.654; p = 0.021. Los niveles elevados de TNF-a, uPCR y Fg encontrados confirman un estado proinflamatorio asociado a obesidad abdominal en la población estudiada.

  13. Estimadores de consistencia interna en las investigaciones en salud: el uso del coeficiente alfa

    Directory of Open Access Journals (Sweden)

    Franciele Cascaes da Silva

    Full Text Available La producción académica ha aumentado en el área de la salud, exigiendo cada vez más calidad en las publicaciones de gran impacto. Una de las formas de considerar la calidad es por medio de procedimientos que aumentan la consistencia del análisis de los datos, como la confiabilidad, que dependiendo del tipo de datos, puede ser evaluada por diferentes coeficientes, en especial el coeficiente alfa. Basados en lo anterior, la presente revisión reúne sistemáticamente artículos científicos producidos en los últimos cinco años, que de manera metodológica hicieron uso psicométrico del coeficiente α como un estimador de consistencia interna y de confiabilidad en procesos de construcción, adaptación y validación de instrumentos. La identificación de los estudios fue realizada sistemáticamente en las bases de datos Biomed Central Journals, Google Scholar, Web of Science, Wiley Online Library, Medline via Pubmed, Scielo, Scopus, Journals@Ovid, BMJ y Springer por medio del Portal de Periódicos CAPES, utilizando criterios de inclusión y exclusión. El análisis de los datos fue realizado por medio de triangulación, análisis de contenido y análisis descriptivo. Se obtuvo que la mayoría de los estudios fueron realizados principalmente en Irán (f=3, España (f=2 y Brasil (f=2, estos estudios tuvieron como objetivo testar las propiedades psicométricas de instrumentos, siendo que ocho estudios utilizaron el coeficiente α para evaluar la confiabilidad y nueve para evaluar la consistencia interna. Todos los estudios fueron clasificados como investigaciones metodológicas al analizar sus objetivos. Adicionalmente, cuatro estudios también fueron clasificados como correlacionales y uno como descriptivo-correlacional. Se puede concluir que a pesar de que el coeficiente α es ampliamente utilizado como uno de los principales parámetros para la evaluación de consistencia interna de instrumentos de medición del tipo cuestionario en el

  14. Estimadores de consistencia interna en las investigaciones en salud: el uso del coeficiente alfa

    Directory of Open Access Journals (Sweden)

    Franciele Cascaes da Silva


    Full Text Available La producción académica ha aumentado en el área de la salud, exigiendo cada vez más calidad en las publicaciones de gran impacto. Una de las formas de considerar la calidad es por medio de procedimientos que aumentan la consistencia del análisis de los datos, como la confiabilidad, que dependiendo del tipo de datos, puede ser evaluada por diferentes coeficientes, en especial el coeficiente alfa. Basados en lo anterior, la presente revisión reúne sistemáticamente artículos científicos producidos en los últimos cinco años, que de manera metodológica hicieron uso psicométrico del coeficiente α como un estimador de consistencia interna y de confiabilidad en procesos de construcción, adaptación y validación de instrumentos. La identificación de los estudios fue realizada sistemáticamente en las bases de datos Biomed Central Journals, Google Scholar, Web of Science, Wiley Online Library, Medline via Pubmed, Scielo, Scopus, Journals@Ovid, BMJ y Springer por medio del Portal de Periódicos CAPES, utilizando criterios de inclusión y exclusión. El análisis de los datos fue realizado por medio de triangulación, análisis de contenido y análisis descriptivo. Se obtuvo que la mayoría de los estudios fueron realizados principalmente en Irán (f=3, España (f=2 y Brasil (f=2, estos estudios tuvieron como objetivo testar las propiedades psicométricas de instrumentos, siendo que ocho estudios utilizaron el coeficiente α para evaluar la confiabilidad y nueve para evaluar la consistencia interna. Todos los estudios fueron clasificados como investigaciones metodológicas al analizar sus objetivos. Adicionalmente, cuatro estudios también fueron clasificados como correlacionales y uno como descriptivo-correlacional. Se puede concluir que a pesar de que el coeficiente α es ampliamente utilizado como uno de los principales parámetros para la evaluación de consistencia interna de instrumentos de medición del tipo cuestionario en el

  15. Alfa247®: Un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking

    Directory of Open Access Journals (Sweden)

    Rodolfo Iván Martínez Lemos


    Full Text Available La técnica alfa y el método de los 7 pasos constituyen un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking (NW. NW consiste en caminar con bastones especialmente diseñados y utilizando una técnica precisa que moviliza una gran parte de la masa muscular total y tiene efectos beneficiosos probados sobre la salud. Alfa247® hace posible que cualquier persona, con independencia de su nivel de habilidad o condición física, pueda familiarizarse y aprender la técnica de caminar con bastones. Este nuevo concepto de movimiento saludable está todavía dando sus primeros pasos en España y es probable que en un futuro próximo pueda jugar un papel importante dentro del currículo de la Educación Física Escolar, como ya ha hecho en otros países del entorno.

  16. Curative Effect of Poractant Alfa in the Treatment of Newborn Respiratory Distress Syndrome%猪肺磷脂治疗新生儿呼吸窘迫综合征的临床研究

    Institute of Scientific and Technical Information of China (English)



    Objective To investigate the clinical effect of Poractant Alfa in the treatment of newborn respiratory dis-tress syndrome. Methods 2O children of respiratory distress syndrome in the hospital from March 2O12 to December 2O14, were randomly divided into observation group and control group,1O cases in each group. Control group was treaded with general treatment,observation group was treated with Poractant Alfa baseed on that;The clinical efficacy of two groups were compared. Results The total effective rate of observation group(8O. O% )was higher control group(6O. O% ),the difference was statisti-cally significant(P < O. O5). Conclusion The clinical effect of Poractant Alfa in the treatment of newborn respiratory distress syndrome is good,it is worthy of clinical promotion.%目的:探讨猪肺磷脂治疗新生儿呼吸窘迫综合征的临床疗效。方法选取2O12年3月-2O13年12月本院收治的2O 例呼吸窘迫综合征患儿,将患儿随机分为观察组和对照组,每组1O 例。对照组给予常规治疗,观察组在此基础上联合猪肺磷脂治疗;观察两组患儿的临床疗效。结果观察组总有效率(8O. O%)高于对照组(6O. O%),差异有统计学意义(P < O. O5)。结论猪肺磷脂治疗新生儿呼吸窘迫综合征的临床疗效良好,值得临床推广。

  17. Single-arm, observational study of the ease of use of a redesigned pen device to deliver recombinant human follicle-stimulating hormone (follitropin alfa for assisted reproductive technology treatment

    Directory of Open Access Journals (Sweden)

    Illingworth PJ


    Full Text Available Peter J Illingworth,1 Robert Lahoud,1 Frank Quinn,1 Kendal Chidwick,2 Claire Wilkinson,2 Gavin Sacks1 1IVFAustralia, Greenwich, Sydney, NSW, Australia; 2Scientific Affairs, Merck Serono Australia Pty Ltd, Frenchs Forest, Sydney, NSW, Australia Purpose: Evaluation of patients’ ease of use of the redesigned, disposable, ready-to-use ­follitropin alfa pen during controlled ovarian stimulation for assisted reproductive technology. Methods: This single-center, observational, open-label, single-arm study recruited infertile normo-ovulatory women (aged 18–45 years. Nurses trained patients to self-administer recombinant human follicle-stimulating hormone daily using the follitropin alfa pen (300 IU, 450 IU, and 900 IU. Before treatment, patients completed Questionnaire A. Following self-administered treatment, on stimulation days 5–6 and 7–8 (within a day of receiving recombinant human chorionic gonadotropin, patients completed Questionnaire B. Nurses completed an ease-of-learning/teaching questionnaire. The primary endpoint was proportion of patients rating the pen as “easy/very easy” to use (Questionnaire B on the final visit before recombinant human chorionic gonadotropin. Secondary endpoints included: proportion of patients rating the follitropin alfa pen as easy to learn, use, prepare, deliver, and dispose of (Questionnaires A and B. Proportions (95% confidence intervals [CIs] were provided for primary and secondary endpoints. Adverse events were reported descriptively. Results: Eighty-six patients received recombinant human follicle-stimulating hormone. Of the 72 patients who had completed the overall assessment questions, 66 (91.7%; 95% CI =82.7%–96.9% found the pen “easy” to use. Also, 70/86 (81.4% patients “strongly agreed/agreed” that, overall, it was easy to learn how to use the pen; 72/86 (83.7% “strongly agreed/agreed” that easily understandable, verbal information was provided; and 70/86

  18. Reduction of circulating regulatory T cells by intravenous high-dose interferon alfa-2b treatment in melanoma patients. (United States)

    Mozzillo, Nicola; Ascierto, Paolo


    High-dose interferon alfa-2b (IFNα-2b) is the only approved adjuvant systemic therapy for resected, high risk melanoma in the United States (Fecher and Flaherty, in Natl Compr Cancer Netw 7:295-304, 2009). Recently, two important meta-analyses of randomized trials (Wheatley et al., in J Clin Oncol, 2007; Mocellin et al. in J Natl Cancer Inst, 2010) investigating IFNα-2b versus observation in high risk melanoma patients, showed that adjuvant IFNα-2b has an impact both on relapse-free survival (RFS) and overall survival (OS) independently by dosage, duration and route compared with observation in high risk melanoma patients. Despite of an absolute benefits of 3 % (Wheatley et al., in J Clin Oncol, 2007), this treatment is associated with significant toxicity, which impacts on patient quality of life. A better understanding of the mechanism of action may help to potentiate the clinical efficacy and reduce the toxicity of IFNα-2b/Peg-IFNα-2b. Numerous studies suggest that interferon's mechanism of action in melanoma is primarily immunomodulatory (Table 1) (de La Salmoniere, in Clin Cancer Res 6:4713-4718, 2000; Stuckert, in J Clin Oncol 25:8506, 2007; Gogas et al., in N Engl J Med 354:709-718, 2006; Moschos et al., in J Clin Oncol 24:3164-3171, 2006; Ascierto and Kirkwood, in J Transl Med 6:62, 2008) Recent efforts to elucidate the mechanism of action for interferon have focused upon signal transducers and activators of transcription (STAT) (Simons et al., in J Transl Med 9:52, 2011) signaling and immunoregulatory responses mediated by regulatory T cells (Tregs) (Wang et al., in Clin Cancer Res 13:1523-1531, 2007; Clin Cancer Res 14:8314-8320, 2008). Tregs are a suppressive CD4+ T cell population that is present, along with primed effector T cells, in tumor and tumor-draining lymph nodes (Hiura et al. in J Immunol 175:5058-5066, 2005). Tregs express high levels of surface antigens such as CD25, cytotoxic T lymphocyte associated antigen 4 (CTLA-4), and

  19. Alfa Laval to meet the ballast water challenge%阿法拉伐应对压载水的挑战

    Institute of Scientific and Technical Information of China (English)


    Alfa Laval, the market leader in separation, heat transfer and freshwater generation, is widening its offering of solutions for environmental protection. The company hereby announces that a potent technology for dealing with unwanted organisms in ballast water will be commercially available as early as 2006.

  20. Pegylated interferon alfa-2b alone or in combination with lamivudine for HBeAg-positive chronic hepatitis B : a randomised trial

    NARCIS (Netherlands)

    Janssen, Harry L A; van Zonneveld, Monika; Senturk, Hakan; Zeuzem, Stefan; Akarca, Ulus S; Cakaloglu, Yilmaz; Simon, Christopher; So, Thomas M K; Gerken, Guido; de Man, Robert A; Niesters, Hubert G M; Zondervan, Pieter; Hansen, Bettina; Schalm, Solko W


    BACKGROUND: Treatment of HBeAg-positive patients with chronic hepatitis B is not effective in most. A combination of immunomodulatory pegylated interferon alfa-2b and antiviral lamivudine might improve the rate of sustained response. METHODS: 307 HBeAg-positive patients with chronic hepatitis B were

  1. Effectiveness of interferon alfa on incidence of hepatocellular carcinoma and decompensation in cirrhosis type C. European Concerted Action on Viral Hepatitis (EUROHEP)

    DEFF Research Database (Denmark)

    Fattovich, G; Giustina, G; Degos, F


    The role of interferon alfa treatment in improving morbidity endpoints in patients with chronic hepatitis C infection is currently under debate. The aim of this study was to evaluate the effectiveness of interferon in preventing hepatocellular carcinoma and decompensation in cirrhosis type C....

  2. O uso da drotrecogina alfa ativada na prática clínica e as atuais evidências Drotrecogin alfa activated in clinical practice and the current evidences

    Directory of Open Access Journals (Sweden)

    Márcio Soares


    Full Text Available JUSTIFICATIVA E OBJETIVOS: O debate sobre a segurança e eficácia da drotrecogina alfa (DrotAA encontra-se na ordem do dia, principalmente, em função dos resultados negativos observados em ensaios clínicos subseqüentes ao PROWESS e do impacto econômico no sistema de saúde relacionado ao custo elevado do fármaco. O objetivo deste estudo foi rever os principais estudos sobre a utilização da DrotAA em pacientes com sepse grave, com ênfase nas questões ligadas a sua eficácia e segurança. CONTEÚDO: Foram selecionados artigos sobre a utilização da DrotAA em pacientes com sepse publicados nos últimos dez anos no MedLine. Os seguintes unitermos foram utilizados: activated protein C; drotrecogin alfa; sepsis; septic shock; Xigris®. Estudos referenciados nos artigos selecionados na busca também foram utilizados. CONCLUSÕES: As taxas de letalidades e as complicações hemorrágicas associadas com o uso do fármaco foram maiores em grandes estudos observacionais do que aquelas descritas previamente nos ensaios clínicos. A luz dos resultados atualmente disponíveis, o uso da DrotAA deve ser reconsiderado até que novos ensaios clínicos possam subsidiar com informações adicionais sobre eficácia, segurança e na identificação dos subgrupos de pacientes com sepse grave que porventura possam ter benefício com o uso deste medicamento. A DrotAA deve servir de exemplo para que haja maior cautela com a rápida transposição de evidências ainda em construção para recomendações e diretrizes de tratamento de pacientes com sepse grave.BACKGROUND AND OBJECTIVES: The debate on efficacy and patient safety related to the use of drotrecogin alfa (DrotAA is timely, principally due to the negative results observed in clinical studies performed after the PROWESS study, and the economic cost-related impact of the drug on the healthcare system. The aim of this study was to review the main studies on the use of DrotAA in patients with severe

  3. Efeitos do alfa-tocoferol nas lesões de isquemia-reperfusão induzidas em pata direita de ratos

    Directory of Open Access Journals (Sweden)

    Bitu-Moreno José


    Full Text Available Recentes estudos demonstraram que os radicais livres de oxigênio parecem desempenhar papel importante nas lesões de isquemia-reperfusão. O alfa-tocoferol(AT age in vivo como um anti-oxidante. Nosso objetivo foi o de verificar se o AT atenuava as lesões de isquemia-reperfusão em pata direita de ratos. Os animais, randomizados, foram divididos nos seguintes grupos(G: G1-controle sem isquemia; G2 e G3 - quatro horas isquemia e duas reperfusão. Os animais do G2 foram tratados com salina e os do G3 com AT, 50mg/kg. Como parâmetros examinamos as alterações de volume e circunferência do pé direito ao longo do experimento, assim como a captação de 99mTc-pirofosfato e a microscopia eletrônica de transmissão do músculo soleus direito. Os aumentos de volume e circunferência do pé dos animais do G2 foram estatisticamente maiores quando comparados com o G1. As medidas do G3 não diferiram do G1. A captação de 99mTc-pirofosfato foi bem aumentada nos G2 e G3, quando comparados ao G1, porém sem diferenças entre os grupos isquêmicos. As lesões ao MET foram menos intensas em três animais do G3, quando comparados ao G2. Conclusão: O tratamento com AT diminuiu a formação do edema mas só protegeu parcialmente as células musculares contra as lesões de isquemia-reperfusão.

  4. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli


    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.

  5. Systemic lupus erythematosus following virological response to peginterferon alfa-2b in a transplanted patient with chronic hepatitis C recurrence

    Institute of Scientific and Technical Information of China (English)

    Francesca Lodato; Giuseppe Mazzella; Maria Rosa Tamé; Antonio Colecchia; Chiara Racchini; Francesco Azzaroli; Antonia D'Errico; Silvia Casanova; Antonio Pinna; Enrico Roda


    Autoimmune manifestations are common both in patients chronically infected by hepatitis C virus, and in patients transplanted for non-autoimmune diseases. A correlation between interferon based treatment and autoimmune diseases or the development of autoantibodies is well established in non-transplanted patients, but few data are available about transplanted patients. It is unclear whether interferon may increase the incidence of acute cellular rejection and there are few reports on the development of atypical autoimmune manifestations during post-liver transplantation interferon or pegylated interferon treatment. We describe a case of systemic lupus erythematosus following treatment with pegylated interferon alfa-2b in a transplanted patient with recurrence of chronic hepatitis C. Our experience suggest that pegylated interferon may induce autoimmune diseases in the immunosuppressed host, different from acute cellular rejection and call for a great attention to possible autoimmune disorders development during interferon based treatments in liver transplanted patients.

  6. Normal bone density in male pseudohermaphroditism due to 5alpha- reductase 2 deficiency Pseudohermafroditas masculinos por deficiência de 5alfa-redutase 2 apresentam densidade óssea normal

    Directory of Open Access Journals (Sweden)

    Elaine Maria Frade Costa


    Full Text Available Bone is an androgen-dependent tissue, but it is not clear whether the androgen action in bone depends on testosterone or on dihydrotestosterone. Patients with 5alpha-reductase 2 deficiency present normal levels of testosterone and low levels of dihydrotestosterone, providing an in vivo human model for the analysis of the effect of testosterone on bone. OBJECTIVE: To analyze bone mineral density in 4 adult patients with male pseudohermaphroditism due to 5alpha-reductase 2 deficiency. RESULTS: Three patients presented normal bone mineral density of the lumbar column (L1-L4 and femur neck, and the other patient presented a slight osteopenia in the lumbar column. CONCLUSION: Patients with dihydrotestosterone deficiency present normal bone mineral density, suggesting that dihydrotestosterone is not the main androgen acting in bone.O tecido ósseo é um tecido andrógeno-dependente porém não está claro se a ação androgênica depende da testosterona ou da diidrotestosterona. Os pacientes portadores de deficiência de 5alfa-redutase tipo 2, constituem um modelo natural para avaliar o efeito isolado da testosterona sobre a massa óssea. OBJETIVO: Avaliar a densidade mineral óssea em quatro pacientes adultos portadores de pseudohermafroditismo masculino por deficiência da 5alfa-redutase tipo 2. RESULTADOS: Três pacientes apresentaram densidade mineral óssea normal na coluna lombar e fêmur e o quarto paciente apresentou osteopenia leve em coluna lombar. CONCLUSÃO: Pacientes com deficiência de diidrotestosterona apresentam densidade mineral óssea normal sugerindo que a diidrotestosterona não é o andrógeno que age sobre o osso.

  7. Níveis de interleucina-6 e fator de necrose tumoral-alfa no liquor de recém-nascidos a termo com encefalopatia hipóxico-isquêmica Levels of interleukin-6 and tumor necrosis factor-alpha in the cerebrospinal fluid of full-term newborns with hypoxic-ischemic encephalopathy

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Silveira


    Full Text Available OBJETIVO: avaliar os níveis liquóricos de IL-6 e TNF-alfa em recém-nascidos a termo com encefalopatia hipóxico-isquêmica (EHI, comparando-os com os de recém-nascidos controles. METODOLOGIA: estudo caso-controle realizado no período de julho de 1999 a outubro de 2001, incluindo dois grupos de recém-nascidos a termo: controle, com 20 recém-nascidos sem sepse e/ou meningite e com escore de Apgar > 9 no primeiro e quinto minutos de vida; e casos, com 15 recém-nascidos asfixiados, caracterizados pelo escore de Apgar 3,0 mmol/l e necessidade de ventilação com pressão positiva pelo menos durante 2 minutos após o nascimento. Foram coletadas amostras de liquor nas primeiras 48 horas de vida, para determinação dos níveis de IL-6 e TNF-alfa pelo método de enzimoimunoensaio. RESULTADOS: os grupos não diferiram quanto ao peso de nascimento, idade gestacional, classificação quanto ao peso e idade gestacional, tipo de parto e tempo médio de obtenção do liquor; seus exames foram obtidos em média com 17 horas de vida. Nos recém-nascidos asfixiados, as medianas dos níveis liquóricos foram: 157,5 pg/ml para IL-6 e 14,7 pg/ml para TNF-alfa, significativamente mais elevadas que nos controles (IL-6: 4,1 pg/ml e TNF-alfa: 0,16 pg/ml. CONCLUSÕES: recém-nascidos a termo com EHI apresentaram níveis liquóricos de IL-6 e TNF-alfa mais elevados que controles, possivelmente devido à produção local cerebral dessas citocinas, especialmente o TNF-alfa. Estes achados estimulam estudos futuros, utilizando bloqueadores cerebrais das ações dessas citocinas como estratégia de neuroproteção.OBJECTIVE: to determine cerebrospinal fluid levels of interleukin-6 and tumor necrosis factor-alpha in full-term infants with hypoxic-ischemic encephalopathy, comparing with control infants. METHODS: controlled, prospective study, performed between July 1999 and October 2001 with two groups of full-term newborns: 20 controls with no sepsis and/or meningitis

  8. Health-related quality of life in patients with high-risk melanoma randomised in the Nordic phase 3 trial with adjuvant intermediate-dose interferon alfa-2b

    DEFF Research Database (Denmark)

    Brandberg, Y; Aamdal, S; Bastholt, Lars;


    To compare health-related quality of life (HRQoL) and side-effects in patients with high-risk melanoma participating in a randomised phase III trial of adjuvant interferon alfa-2b (IFN).......To compare health-related quality of life (HRQoL) and side-effects in patients with high-risk melanoma participating in a randomised phase III trial of adjuvant interferon alfa-2b (IFN)....

  9. Rat hepatocyte invasion by Listeria monocytogenes and analysis of TNF-alpha role in apoptosis Invasão de hepatócitos de rato por Listeria monocytogenes e análise do papel do TNF-alfa na apoptose

    Directory of Open Access Journals (Sweden)

    Sânia Alves dos Santos


    do hospedeiro e manipulação do citoesqueleto, resultando em morte celular. As interações entre células do hospedeiro e bactérias podem resultar em produção de citocinas como o Fator de Necrose Tumoral alfa (TNF-alfa. Hepatócitos têm potencial de produzir citocinas pro-inflamatórias como TNF-alfa, quando invadidos por bactérias. No presente trabalho demonstramos o comportamento dos hepatócitos invadidos por L. monocytogenes pela análise microscópica, determinação da produção de TNF-alfa por bioensaio e análise da apoptose pela técnica TUNEL. A presença da bactéria, na razão que variou de 5 a 50.000 bactérias por célula, induziu ruptura das monocamadas celulares. Observamos presença de bactérias internalizadas na 1ª hora de incubação por microscopia eletrônica. Os níveis de TNF-alfa aumentaram da 1ª hora de incubação até a 6ª hora, variando de 0 a 3749 pg/mL. Nas 7ª e 8ª horas de incubação, ocorreram quedas não significativas dos níveis de TNF-alfa, indicando possível saturação dos receptores celulares. A quantidade de TNF-alfa produzido por hepatócitos foi dependente do tempo de incubação, assim como da proporção entre bactérias e células. A taxa de apoptose aumentou diretamente com o tempo de incubação (1 h a 8 + 24 h, variando de 0 a 43%, assim como com a razão bactérias : células. Estes resultados mostram a habilidade de L. monocytogenes não-hemolítica em invadir os hepatócitos, e as principais conseqüências deste fenômeno são: liberação de TNF-alfa e indução de apoptose. Assim, podemos especular que hepatócitos usam apoptose induzida por TNF-alfa para liberar bactérias de seu interior, facilitando a destruição destas pelo sistema imune.

  10. Elementos regulatórios responsáveis pelo controle da estabilidade do mRNA de alfa tubulina de Trypanosoma cruzi


    Patricia Rosa de Araujo


    Um mecanismo de auto-regulação dos mRNAs de alfa e beta tubulina em Trypanosoma cruzi afeta a meia vida desses transcritos ao longo do ciclo de vida do parasita. Enquanto epimastigotas apresentam altos níveis dos mRNAs de tubulina, um excesso da proteína não polimerizada em amastigotas está relacionada com o decréscimo dos níveis dos seus mRNAs. Esta diminuição não é resultado de mudanças na transcrição e sim devido a redução da meia vida dos mRNAs de alfa e beta tubulina. Através do tratamen...

  11. Peginterferon alpha-2a is associated with higher sustained virological response than peginterferon alfa-2b in chronic hepatitis C: systematic review of randomized trials

    DEFF Research Database (Denmark)

    Awad, Tahany; Thorlund, Kristian; Hauser, Goran;


    A combination of weekly pegylated interferon (peginterferon) alpha and daily ribavirin represents the standard of care for the treatment of chronic hepatitis C according to current guidelines. It is not established which of the two licensed products (peginterferon alpha-2a or peginterferon alfa-2b......) is most effective. We performed a systematic review of head-to-head randomized trials to assess the benefits and harms of the two treatments. We searched the Cochrane Central Register of Controlled Trials, MEDLINE, EMBASE, and LILACS through July 2009. Using standardized forms, two reviewers independently......-2a is associated with higher SVR than peginterferon alfa-2b. However, the paucity of evidence on adverse events curbs the decision to definitively recommend one peginterferon over the other, because any potential benefit must outweigh the risk of harm....

  12. Impact of elosulfase alfa in patients with morquio A syndrome who have limited ambulation: An open-label, phase 2 study. (United States)

    Harmatz, Paul R; Mengel, Eugen; Geberhiwot, Tarekegn; Muschol, Nicole; Hendriksz, Christian J; Burton, Barbara K; Jameson, Elisabeth; Berger, Kenneth I; Jester, Andrea; Treadwell, Marsha; Sisic, Zlatko; Decker, Celeste


    Efficacy and safety of elosulfase alfa enzyme replacement therapy (ERT) were assessed in an open-label, phase 2, multi-national study in Morquio A patients aged ≥5 years unable to walk ≥30 meters in the 6-min walk test. Patients received elosulfase alfa 2.0 mg/kg/week intravenously for 48 weeks. Efficacy measures were functional dexterity, pinch/grip strength, mobility in a modified timed 25-foot walk, pain, quality of life, respiratory function, and urine keratan sulfate (KS). Safety/tolerability was also assessed. Fifteen patients received elosulfase alfa, three patients discontinued ERT due to adverse events (two were grade 3 drug-related adverse events, the other was not drug-related), and two patients missed >20% of planned infusions; 10 completed treatment through 48 weeks and received ≥80% of planned infusions (Modified Per Protocol [MPP] population). The study population had more advanced disease than that enrolled in other trials. From baseline to week 48, MPP data showed biochemical efficacy (urine KS decreased 52.4%). The remaining efficacy results were highly variable due to challenges in test execution because of severe skeletal and joint abnormalities, small sample sizes, and clinical heterogeneity among patients. Eight patients showed improvements in one or more outcome measures; several patients indicated improvements not captured by the study assessments (e.g., increased energy, functional ability). The nature of adverse events was similar to other elosulfase alfa studies. This study illustrates the considerable challenges in objectively measuring impact of ERT in very disabled Morquio A patients and highlights the need to examine results on an individual basis. © 2016 The Authors. American Journal of Medical Genetics Part A Published by Wiley Periodicals, Inc.

  13. Serum levels of interleukin-6, tumor necrosis factor-alpha and interferon-gama in infants with and without dengue Níveis séricos de interleucina-6, fator de necrose tumoral-alfa e interferon-gama em crianças menores de um ano com e sem dengue

    Directory of Open Access Journals (Sweden)

    Berta Nelly Restrepo


    Full Text Available This study compared the serum levels of IL-6, TNF-alpha and IFN-gamma, in children under 1 year of age with and without dengue. Sera were collected from a total of 41 children living in the Department of Antioquia, Colombia (27 patients with dengue and 14 controls. The results showed higher cytokine levels in children with dengue than without dengue, with statistically significant differences for IL-6 and IFN-gamma. No statistically significant differences were found between clinical forms, although IL-6 and IFN-gamma levels were higher in dengue fever cases than in dengue hemorrhagic fever cases. On the other hand, TNF-alpha levels were higher in dengue hemorrhagic fever than in dengue fever. The levels of IL-6 and TNF-alpha were higher in secondary infection than in primary infection, although IFN-gamma levels were higher in primary infection. These results suggest that IL-6, TNF-alpha and IFN-gamma are involved in dengue infection independently of the clinical form.Este estudo comparou os níveis séricos de IL-6, TNF-alfa e IFN-gama, em crianças menores de um ano com e sem dengue. Os soros foram coletados de um total de 41 crianças residentes no Departamento de Antioquia, Colômbia (27 pacientes com dengue e 14 controles. Os resultados mostraram níveis de citoquinas mais elevadas em crianças com dengue do que naquelas sem dengue, com diferenças estatisticamente significativas para IL-6 and IFN-gama. Não houve diferenças estatisticamente significativas entre formas clínicas, embora os níveis de IL-6 e IFN-gama estivessem mais elevados nos casos de febre do dengue que nos casos de febre hemorrágica do dengue. Por outro lado, os níveis de TNF-alfa estavam mais elevados na febre hemorrágica do dengue que na febre do dengue. Os níveis de IL-6 and TNF-alfa estavam mais elevados em infecções secundárias que em infecções primarias, embora os níveis de IFN-gama estivessem mais elevados em infecções primárias. Estes resultados

  14. Co-infection of SENV-D among chronic hepatitis C patients treated with combination therapy with high-dose interferon-alfa and ribavirin

    Institute of Scientific and Technical Information of China (English)

    Chia-Yen Dai; Liang-Yen Wang; Ming-Lung Yu; Wan-Long Chuang; Wen-Yu Chang; Shinn-Cherng Chen; Li-Po Lee; Ming-Yen Hsieh; Nei-Jen Hou; Zu-Yau Lin; Ming-Yuh Hsieh


    AIM: The clinical significance of co-infection of SENV-D among patients with chronic hepatitis C (CHC) and response of both viruses to combination therapy with high-dose interferon-alfa (IFN) plus ribavirin remain uncertain and are being investigated.METHODS: Total 164 (97 males and 67 females, the mean age 48.1±11.4 years, range: 20-73 years, 128histologically proved) naive CHC patients were enrolled in this study. SENV-D DNA was tested by PCR method.Detection of serum HCV RNA was performed using a standardized automated qualitative RT-PCR assay (COBAS AMPLICOR HCV Test, version 2.0). HCV genotypes 1a,1b, 2a, 2b, and 3a were determined by using genotypespecific primers. Pretreatment HCV RNA levels were determined by using the branched DNA assay (Quantiplex HCV RNA 3.0). There are 156 patients receiving combination therapy with IFN 6 MU plus ribavirin for 24 wk and the response to therapy is determined.RESULTS: Sixty-one (37.2%) patients were positive for SENV-D DNA and had higher mean age than those who were negative (50.7±10.6 years vs46.6±11.6 years,P = 0.026). The rate of sustained viral response (SVR)for HCV and SENV-D were 67.3% (105/156) and 56.3%(27/48), respectively. By univariate analysis, the higher rate of SVR was significantly related to HCV genotype non-1b (P<0.001), younger ages (P = 0.014), lower pretreatment levels of HCV RNA (P = 0.019) and higher histological activity index (HAI) score for intralobular regeneration and focal necrosis (P = 0.037). By multivariate analyses, HCV genotype non-1b, younger age and lower pretreatment HCV RNA levels were significantly associated with HCV SVR (odds ratio (OR)/95% confidence interval (CI): 12.098/0.02-0.19, 0.936/0.890-0.998, and 3.131/1.080-9.077, respectively). The SVR of SENV-D was higher among patients clearing SENV-D than those who had viremia at the end of therapy (P = 0.04).CONCLUSION: Coexistent SENV-D infection, apparently associated with higher ages, is found in more than onethird Taiwanese

  15. Influence of wool and thermo-binder fibers relative fractions on the adhesion of non-woven Alfa fibers reinforced unsaturated polyester hybrid composites (United States)

    Amin Omri, Med; Triki, A.; Ben Hassen, Med; Arous, M.; Bulou, A.


    Alfa/wool/thermo-binder fibers hybrid composites were investigated in order to analyze adhesion state. Bearing in mind the chemical structure of wool and thermo-binder fibers, this study revealed a good compatibility between the reinforcement and the matrix. Dielectric measurements revealed the presence of two dielectric relaxations in the composite. The first relaxation was attributed to the α mode relaxation and the second one was associated with the conductivity noted for high temperature. This study allowed the analysis of the interfacial polarization effect using the Havrilliak-Negami model in the electric modulus formalism. The lowness of this relaxation intensity revealed a good adhesion of the fibers in the matrix. Differential Scanning Calorimetry (DSC) showed a slow decrease of the Tg glass transition temperature compared to the matrix, which could be explained by the existence of interactions between the fibers and the matrix. Vibrational analysis, based on FTIR measurements, showed a less hydrophilic character of Alfa fibers owing to a basic dissociation that occurs between the wool fibers and the water molecules associated with Alfa fibers. Furthermore, adhesion mechanism in the composite material was established by covalent and hydrogen bonds. Tensile testing performed on this composite confirmed that such adhesion was improved by increasing the thermo-binder fibers relative fraction.

  16. Frutificação e crescimento de frutos em abóbora híbrida 'Tetsukabuto' tratada com alfa-naftalenoacetato de sódio Fruit set and fruit growth of 'Tetsukabuto' squash treated with the sodium salt of alfa-naphthaleneacetic acid

    Directory of Open Access Journals (Sweden)

    Cassandro V.T. do Amarante


    Full Text Available A abertura de flores femininas na abóbora híbrida 'Tetsukabuto' concentra-se num período de três a quatro semanas. Este curto período de florescimento indica que uma polinização deficiente pode ocasionar grande comprometimento da produção de frutos. Este trabalho foi conduzido com o objetivo de avaliar o efeito de concentrações do fitorregulador alfa-naftalenoacetato de sódio (ANA-Na, pulverizado em flores abertas femininas, na frutificação e crescimento de frutos da abóbora 'Tetsukabuto'. O experimento foi conduzido em Lages, SC, na safra 1992/1993, seguindo o delineamento em blocos casualizados, com três repetições. A parcela foi constituída de cinco covas de 'Tetsukabuto' e uma da polinizadora Cucurbita maxima, em espaçamento de 3 x 1 m, com duas plantas/cova. Os tratamentos utilizados foram testemunha (polinização natural e 150, 300, 450, 600 e 750 mg·L-1 de ANA-Na. Nos tratamentos com ANA-Na, evitou-se a polinização natural isolando-se as flores com sacos de papel. Avaliou-se percentagem de frutificação, peso, comprimento e diâmetro dos frutos e peso, espessura, rendimento e sólidos totais da polpa. Apenas a dose de 750 mg·L-1 do hormônio reduziu a percentagem de frutificação. Os frutos obtidos por tratamento com ANA-Na apresentaram crescimento similar ao dos frutos obtidos por polinização.Anthesis of female flowers of 'Tetsukabuto' squash occurs within three to four weeks. A deficient pollination during this short flowering period may reduce the yield. The sodium salt of alfa-naphthaleneacetic acid (Na-NAA can be used to improve fruit set when pollination is deficient. This work was conducted to investigate the effects of different concentrations of Na-NAA, sprayed in open female flowers on fruit set and fruit growth of 'Tetsukabuto' squash. The experiment was carried out in 1992-93, in South Brazil, in a randomized block design with three replicates. The plots had a proportion of five plants of

  17. Comparing effects of Beractant and Poractant alfa in decreasing mortality rate due to respiratory distress syndrome in premature infants

    Directory of Open Access Journals (Sweden)

    Saeidi R


    Full Text Available "nBackground: Exogenous natural and synthetic surfactants is a rescue treatment for respiratory distress syndrome (RDS. The goals of the study were to compare the clinical response and side-effects of two frequently used surfactants, poractant alfa (Curosurf and beractant (Survanta, for the treatment of respiratory distress syndrome in preterm infants."n "nMethods: This clinical trial study was performed during a two-year period in the Neonatal Intensive Care Unit of Ghaem Hospital in Mashhad, Iran. Sample size calculated by a 95% confidence and power of 80, included 104 premature neonates, 74 in survanta and 30 in curosurf groups. The level of statistical significance was considered to be < 0.05."n "nResults: There were no statistically significant differences between the infants treated by survanta or cursurf groups regarding their mean gestational age (30.58 Vs. 29.00 weeks and birth weight (1388 Vs. 1330 g, (p=0.3 There were also no significant differences between the two groups regarding incidences of broncho- pulmonary dysplasia (BPD (40.5% Vs. 40%, intraventricular hemorrhage (IVH grades III/IV (13.5% Vs. 13.3%, pneumothorax (both 20%, patent ductus arteriosus (PDA (28/3% Vs. 20% or death (28% Vs. 26.6% on the 28th day postpartum."n "nConclusion: This study showed that survanta and curosurf had similar therapeutic effects in the treatment of neonatal respiratory distress syndrome.

  18. Diferencias entre coeficientes alfa de Cronbach, con muestras y partes pequeñas: un programa VB

    Directory of Open Access Journals (Sweden)

    César Merino-Soto

    Full Text Available Se presenta un programa informático escrito en VB 6.0, para calcular la diferencia entre coeficientes de consistencia interna (alfa de Cronbach, obtenidos en muestras pequeñas independientes y/o con instrumentos que poseen un número también pequeño de partes o ítems. La comparación de coeficientes de fiabilidad permite identificar posibles diferencias en el tamaño del error de medición en los instrumentos comparados; esta metodología usa el enfoque de prueba de hipótesis, probando la hipótesis nula de igualdad de los coeficientes. Esta condición tiende a ser frecuente en la práctica clínica entre psicólogos y profesiones aliadas, e inclusive en las fases de construcción de instrumentos de medición, por ejemplo en muestras piloto. La técnica aplicada proviene del trabajo de Feldt y Kim (2006, y ofrece una viable e interesante propuesta metodológica que expande el análisis de la fiabilidad de instrumentos de medición psicológicos y educativos. Se presenta las características de su uso, y se discuten las condiciones apropiadas de aplicación.

  19. AlphaCI: un programa de cálculo de intervalos de confianza para el coeficiente alfa de Cronbach

    Directory of Open Access Journals (Sweden)

    Rubén Ledesma

    Full Text Available El coeficiente alfa de Cronbach es el modo más habitual de estimar la fiabilidad de pruebas basadas en Teoría Clásica de los Test. En dicha estimación, los investigadores usualmente omiten informar intervalos de confianza para el coeficiente, un aspecto no solo recomendado por los especialistas, sino también requerido explícitamente en las normas editoriales de algunas revistas especializadas. Esta situación puede atribuirse a que los métodos de estimación de intervalos de confianza son poco conocidos, además de no estar disponibles al usuario en los programas estadísticos más populares. Así, en este trabajo se presenta un programa desarrollado dentro del sistema estadístico ViSta que permite calcular intervalos de confianza basados en el enfoque clásico y mediante la técnica bootstrap. Se espera promover la inclusión de intervalos de confianza para medidas de fiabilidad, facilitando el acceso a las herramientas necesarias para su aplicación. El programa es gratuito y puede obtenerse enviando un mail de solicitud al autor del trabajo.

  20. Intensive Farmaco- Surveillance of Interferon Alpha 2b Recombinant in Multiple Sclerosis. Farmacovigilancia intensiva al interferón alfa 2b recombinante en la esclerosis múltiple.

    Directory of Open Access Journals (Sweden)

    Hailen Bobillo López

    Full Text Available

    1pt 7.0865pt; text-align: justify;">Background: The interferon alpha 2b recombinant, produced in Cuba, is used in the treatment of different illnesses, such as the multiple sclerosis. For its commercialization it is needed to know its safety scope. Objective: To assess the adverse reactions of interferon alpha 2b recombinant in the treatment of multiple sclerosis. Method: During the period between 1996 and 2006, 70 clinical histories and data collection notebooks of patients included in the randomized double blind national clinical trial phase IV were revised. This trial was developed in the Clinic of Multiple Sclerosis of the Hospital "Dr. Gustavo Aldereguía Lima" in Cienfuegos. With regard to the total of manifested adverse reactions we analyzed type, length, and use of a given treatment to counteract them, intensity level (light, moderate, serious or lethal and causality level (definitive, probable, possible, conditional or not related. Results: 53 patients out of the total presented 207 adverse reactions to interferon. The most frequent were: fever, migraine, chills, arthralgia, asthenia and myalgia, being most of them moderate collateral effects of definitive character. In 197 patients the outcome was favorable. Conclusion: The use of the interferon alpha 2b

  1. Clinical Experience of Interferon Alfa-2a Treatment for Refractory Uveitis in Behçet's Disease. (United States)

    Park, Ji-Youn; Chung, Yoo-Ri; Lee, Kihwang; Song, Ji Hun; Lee, Eun-So


    Behçet's disease (BD) involves multisystem vasculitis of unknown origin. Ocular manifestations of BD mostly include bilateral panuveitis and retinal vasculitis, which are very challenging to treat. Interferon alfa-2a (IFN) has been recently introduced for treating refractory Behçet uveitis, mainly in Germany and Turkey. Nonetheless, there is so far no consensus about the ideal treatment regimen of IFN for Behçet uveitis. We report our experience of IFN treatment in five Korean BD patients with refractory uveitis. All patients complained of oral ulcers; one patient had a positive pathergy test and 2 showed the presence of HLA-B51. Immunosuppressive agents used prior to IFN treatment included cyclosporine and methotrexate. The IFN treatment was commenced with a dose of 6-9 MIU/day for 7 days, adjusted according to individual ocular manifestations, tapered down to 3 MIU three times in a week, and then discontinued. All patients showed positive response to IFN treatment; 50% of them showed complete response without additional major ocular inflammation during the follow-up period. Other BD symptoms also improved after IFN treatment in most cases. After treatment, the relapse rate and the required dose of oral corticosteroid were decreased in most cases, showing a significant steroid-sparing effect. However, the visual acuity was not improved in most cases due to irreversible macular sequelae. Despite the small sample size of this study, we suggest that, in Korean patients, IFN is an effective treatment modality for BD uveitis as was observed in German and Turkish patients.

  2. Co-treatment with pegylated interferon alfa-2a and entecavir for hepatitis D: a randomized trial

    Institute of Scientific and Technical Information of China (English)

    Zaigham; Abbas; Mohammad; Sadik; Memon; Muhammad; Amir; Umer; Minaam; Abbas; Lubna; Shazi


    AIM: To investigate the efficacy of pegylated interferon alfa(PEG-IFNα) therapy with and without entecavir in patients with chronic hepatitis D. METHODS: Forty hepatitis D virus(HDV) RNA positive patients were randomized to receive either PEG-IFNα-2a 180 μg weekly in combination with entecavir 0.5 mg daily(n = 21) or PEG-IFNα alone(n =19). Patients who failed to show 2 log reduction in HDV RNA level at 24 wk of treatment, or had detectable HDV RNA at 48 wk of therapy were considered as treatment failure. Treatment was continued for 72 wk in the rest of the patients. All the patients were followed for 24 wk post treatment. Intention to treat analysis was performed.RESULTS: The mean age of the patients was 26.7 ± 6.8 years, 31 were male. Two log reduction in HDV RNA levels at 24 wk of therapy was achieved in 9(43%) patients receiving combination therapy and 12(63%) patients receiving PEG-IFNα alone(P = 0.199). Decline in hepatitis B surface antigen(HBs Ag) levels was insignificant. At the end of treatment, HDV RNA was negative in 8 patients(38%) receiving combination therapy and 10 patients(53%) receiving PEG-IFNα-2a alone. Virological response persisted in 7(33%) and 8(42%) patients, respectively at the end of the 24 wk follow-up period. One responder patient in the combination arm lost HBs Ag and became hepatitis B surface antibody positive. Six out of 14 baseline hepatitis B e antigen reactive patients seroconverted and four of these seroconverted patients had persistent HDV RNA clearance.CONCLUSION: Administration of PEG-IFNα-2a with or without entecavir, resulted in persistent HDV RNA clearance in 37% of patients. The addition of entecavir did not improve the overall response.

  3. An Alpha spectrometer for measuring radon daughter individual activity concentration; Spettrometro Alfa per la misura delle concentrazioni individuali in attivita' della progenie del radon

    Energy Technology Data Exchange (ETDEWEB)

    Berico, M.; Formignani, M. [ENEA, Div. Protezione dell' Uomo e degli Ecosistemi, Centro Ricerche E. Clementel, Bologna (Italy); Mariotti, F. [Bologna Univ., Bologna (Italy). Dipt. di Fisica


    In the frame of the program of the Institute for Radiation Protection of ENEA, related to the evaluation of dose from radon and thoron progeny, an alpha spectrometer for the continuous air monitoring (CAM type) of radon and thoron has been realized. The constructive characteristics of the device are here presented together with energy and efficiency calibration. The device allows, by means of a screen type diffusion battery and a filter, to determinate the single radioactivity of each radionuclide of the progeny selecting them in relation to their diffusive behaviour (dichotomous particle size selection). The three-count filter method has been employed to measure the concentrations of {sup 218}Po, {sup 214}Pb and {sup 214}Bi in air. Radon and thoron effective doses using a dosimetric, instead of an epidemiologic approach, will be then evaluated. [Italian] Presso l'Istituto per la Radioprotezione, nell'ambito del programma di valutazione di dose da radon e' stato progettato e realizzato uno spettrometro alfa per il monitoraggio continuo in aria (CAM) della progenie del radon e del toron. Le caratteristiche costruttive dello strumento permettono, tramite l'utilizzo di batterie a diffusione a reti, di determinare l'attivita' individuale della progenie per diverse dimensioni granulometriche in particolare per la frazione attaccata e non al particolato amosferico con un taglio granulometrico di qualche nanometro. E' stato inoltre applicato un metodo spettrometrico a tre conteggi per il calcolo delle concentrazioni individuali della progenie del radon, {sup 218}Po, {sup 214}Pb and {sup 214}Bi, effettuando un conteggio alfa di {sup 218}Po e due conteggi alfa di {sup 214}Po. Tale informazione consentira' una valutazione della dose di radon utilizzando il modello dosimetrico in alternativa a quello epidemiologico.

  4. Randomized comparison of low-dose versus high-dose interferon-alfa in chronic myeloid leukemia: prospective collaboration of 3 joint trials by the MRC and HOVON groups. (United States)

    Kluin-Nelemans, Hanneke C; Buck, Georgina; le Cessie, Saskia; Richards, Sue; Beverloo, H Berna; Falkenburg, J H Frederik; Littlewood, Tim; Muus, Petra; Bareford, David; van der Lelie, Hans; Green, Anthony R; Roozendaal, Klaas J; Milne, Alison E; Chapman, Claire S; Shepherd, Patricia


    The optimal dose of interferon-alfa (IFN) for chronic myeloid leukemia (CML) is unknown. Retrospective analyses suggest that low doses are as effective as high doses, with less toxicity and fewer patients abandoning the drug. The Dutch Hemato-Oncology Association (HOVON) and British Medical Research Council (MRC) cooperative groups jointly performed randomized trials in newly diagnosed CML patients, comparing high-dose IFN (5 MIU/m(2) daily) with low-dose (3 MIU, 5 times a week). Both arms allowed additional hydroxyurea to keep the white blood cell count lower than 5 x 10(9)/L. Quality of life data were collected in a subset of patients. Between 1993 and 2001, 407 patients were randomized. At a median follow-up of 53 months, there were no significant differences in overall survival (odds ratio = 1.09, 95% confidence interval, 0.81-1.46), progression-free survival, and complete hematologic or major cytogenetic responses. Fewer patients in the low-dose group abandoned IFN for reasons other than transplant or progressive disease (P =.002, 58% vs 72% at 5 years). Quality of life data showed comparable results in both arms for most factors. There is no evidence of benefit for high-dose IFN compared with low-dose for the treatment of CML. Therefore, when IFN is combined with other drugs, low-dose IFN is advised, to minimize toxicity and costs.

  5. Long-term outcome of hepatitis B e antigen-positive patients with compensated cirrhosis treated with interferon alfa. European Concerted Action on Viral Hepatitis (EUROHEP)

    DEFF Research Database (Denmark)

    Fattovich, G; Giustina, G; Realdi, G;


    The aim of this study was to evaluate whether interferon alfa (IFN-alpha) treatment-associated virological and biochemical remission improves survival in a cohort of 90 white patients with compensated cirrhosis caused by hepatitis B (Child A) followed for a mean period of 7 years. Inclusion...... criteria were biopsy-proven cirrhosis, hepatitis B e antigen (HBeAg) positivity, abnormal serum aminotransferase levels, exclusion of hepatitis delta virus, and absence of complications of cirrhosis. Of the 40 IFN-treated patients, 27 (67%) showed sustained HBeAg loss with alanine aminotransferase (ALT...


    Directory of Open Access Journals (Sweden)

    Nassima Tazrouti


    Full Text Available Activated lignin having a surface area of 1023 m2 g-1 has been prepared from sulfate lignin that was treated by 30% H2O2 and carbonized at 300 °C in order to test the chromium (VI adsorption from aqueous solution. The influence of contact time, pH, initial concentrations of adsorbent and adsorbate, and temperature on the adsorption capacity were investi-gated. The maximum removal of Cr(VI was found to be 92.36 % at pH=2 and a contact time of 80 min. Optimal concentration of lignin and Cr(VI were found to be 3.8 g L-1 and 180 mg L-1, respectively. The adsorption kinetics data fitted well with a pseudo-second-order equation, and the rate of removal of chromium was found to speed up with increasing temperature. Activation energy for the adsorption process was found to be 18.19 kJ mol-1. The Langmuir and Freundlich adsorption isotherm models were applied to describe the isotherm and isotherm constants for the adsorption of Cr (VI on lignin. These constants and correlation coefficients of the isotherm models were calculated and compared. Results indicated that Cr (VI uptake could be described by the Langmuir adsorption model. The maximum adsorption capacity (qm of Cr (VI on lignin was 75.75 mg g-1 at 40°C. The dimensionless equilibrium parameter (RL signified a favorable adsorption of Cr (VI on lignin and was found to be between 0.0601 and 0.818 (01. The thermodynamic parameters such as ΔG°, ΔS°, and ΔH° were calculated, and it was found that the reaction was spontaneous and endothermic in nature. This study indicates that lignin has the potential to become an effective and economical adsorbent for removal Cr (VI from waste water.

  7. AlphaCI: un programa de cálculo de intervalos de confianza para el coeficiente alfa de Cronbach AlphaCI: a computer program for computing confidence intervals around Cronbach's alfa coefficient

    Directory of Open Access Journals (Sweden)

    Rubén Ledesma


    Full Text Available El coeficiente alfa de Cronbach es el modo más habitual de estimar la fiabilidad de pruebas basadas en Teoría Clásica de los Test. En dicha estimación, los investigadores usualmente omiten informar intervalos de confianza para el coeficiente, un aspecto no solo recomendado por los especialistas, sino también requerido explícitamente en las normas editoriales de algunas revistas especializadas. Esta situación puede atribuirse a que los métodos de estimación de intervalos de confianza son poco conocidos, además de no estar disponibles al usuario en los programas estadísticos más populares. Así, en este trabajo se presenta un programa desarrollado dentro del sistema estadístico ViSta que permite calcular intervalos de confianza basados en el enfoque clásico y mediante la técnica bootstrap. Se espera promover la inclusión de intervalos de confianza para medidas de fiabilidad, facilitando el acceso a las herramientas necesarias para su aplicación. El programa es gratuito y puede obtenerse enviando un mail de solicitud al autor del trabajo.Cronbach's alpha coefficient is the most popular way of estimating reliability in measurement scales based on Classic Test Theory. When estimating it, researchers usually omit to report confidence intervals of this coefficient, as it is not only recommended by experts, but also required by some journal's guidelines. This situation is because the different methods of estimating confidence intervals are not well-known by researchers, as well as they are not being available among the most popular statistical packages. Therefore, this paper describes a computer program integrated into the ViSta statistical system, which allows computing confidence intervals based on the classical approach and using bootstrap technique. It is hoped that this work promotes the inclusion of confidence intervals of reliability measures, by increasing the availability of the required computer tools. The program is free and


    Directory of Open Access Journals (Sweden)

    Ferry P Gultom


    Full Text Available Talasemia is blood disorder which is characterized by anemia due to inherited haemoglobine disorder. The anemia is caused by a decreased flexibility of the erythrocyte results in decreased capability of required deformability to be able to across through capillary blood vessels. Free radicals with one or more unpaired electron on potential in destroying all the molecule exist in the body of living things like protein, carbohydrate and fat. Tocoferol or vitamin E is an antioxidant essential in eliminating free radicals in the cell membrane by inhibiting the peroxidation process of the cell membrane lipid. The objective of this study is to investigate the severity of the erythrocyte destruction either those with or without oxidative load from the environment. The results of this study showed that the level of malondialdehid in the control of erythrocyte was 1.85 ± 1.37 nmol in talasemia and 1.02 ± 0.64 nmol in normal (p<0.05. The addition of 2mM t-BHP resulted in increased malondialdehid level up to 19.59 ± 6.82 nmol in talasemia and 11.42 ± 3.49 nmol in normal erythrocytes (P<0.05. Oxidated erythrocyte with vitamin E supplement beforehand showed lower level of malondialdehid composed to those without vitamin E supplement (p<0.05. Conclusion: Additional vitamin E (tocoferol leads to decreased level of malondialdehid both in the normal and thalasemia erythrocytes.

  9. Establecimiento y validación de un ensayo inmunoenzimático tipo ELISA, empleado en el control de calidad del Interferón alfa 2b humano recombinante

    Directory of Open Access Journals (Sweden)

    Susset Valderrama


    Full Text Available Se estableció y validó un ELISA para la cuantificación del Interferón alfa 2b humano recombinante en el Ingrediente Farmacéutico Activo, definiéndose los criterios de validez del ensayo y basado en el cumplimiento de las Buenas Prácticas de Laboratorio. Se evaluaron los parámetros de: linealidad, especificidad, exactitud, rango, precisión y robustez. El ensayo establecido resultó específico, con una exactitud entre 84,3% y 102,4%, se demostró un ajuste cuadrático y un rango de trabajo entre 1 y 10 ng/mL; la repetibilidad y la precisión intermedia mostraron coeficientes de variación inferiores al 10% y 20% respectivamente, y se comprobó la robustez del método con respecto al efecto borde y la estabilidad de las soluciones.

  10. Anemia hemolítica microangiopática induzida por tacrolimus e ciclosporina A Microangiopathic hemolytic anemia induced by tacrolimus and ciclosporine A

    Directory of Open Access Journals (Sweden)

    Rafael S. Vasconcelos


    Full Text Available Relatamos caso raro de anemia hemolítica microangiopática em paciente após transplante hepático por cirrose Child B causada por deficiência de alfa1-antitripsina. Após análise clínica e laboratorial extensa, concluiu-se que o quadro de hemólise foi causado pela medicação imunossupressora utilizada após transplante. Inicialmente foi utilizado tacrolimus que, posteriormente, foi substituído por ciclosporina A, entretanto não houve melhora da hemólise. Após suspensão das duas drogas, houve melhora importante clínica do paciente, com normalização dos parâmetros hematológicos.We report a rare case of acute hemolysis in a patient after liver transplant for Child B cirrhosis caused by alfa1-antitripsine deficiency. History and laboratorial examinations indicated that the most probable cause of the hemolysis was the use of the immunosupressor tacrolimus and later Cyclosporine A. After the discontinuation of these drugs, there was improvement in the clinical condition of the patient, with a compensated hemolytic anemia.

  11. Hepatic inflammatory biomarkers and its link with obesity and chronic diseases. (United States)

    Pinheiro Volp, Ana Carolina; Santos Silva, Fernanda Cacilda; Bressan, Josefina


    Introdución: El bajo grado de inflamación y la resistencia a la insulina son dos eventos que podrían estar presentes en mayor o menor grado, en la obesidad y las enfermedades crónicas. El grado de inflamación subclínica se puede evaluar por medición de las concentraciones de algunos biomarcadores inflamatorios, incluyendo los de origen hepático. Algunos de estos biomarcadores son el ácido siálico, 1-antitripsina y el fragmento C-terminal de la alfa 1-antitripsina, ceruloplasmina, fibrinógeno, haptoglobina, la homocisteína y el inhibidor-1 del activador del plasminógeno. Objetivos: Evaluar la relación entre la obesidad y los marcadores de inflamación hepática, y las posibles asociaciones entre los biomarcadores inflamatorios hepáticos y la obesidad, así como su capacidad de predicción de las enfermedades crónicas como la diabetes tipo 2 y enfermedades cardiovasculares aterotromboticas. Métodos: Se utilizaron bases científicas electrónicas para selección de artículos, sin límite de año de publicación. Resultados: El ácido siálico predice el aumento de convertirse en diabéticos tipo 2 independientemente del IMC. Por otra parte, los biomarcadores 1-antitripsina, ceruloplasmina, fibrinógeno y haptoglobulina, parecen predecir el aumento de convertirse en diabético tipo 2, dependiente, de IMC. Por lo tanto, este proceso podría verse agravada por la obesidad. Las concentraciones de fibrinógeno, homocisteína y PAI-1 incrementam proporcionalmente a la insulinoresisténcia, mostrando su relación con el síndrome metabólico (estado de resistencia insulínica) y con la diabetes tipo 2. En relación con las enfermedades cardiovasculares, cada biomarcador informado en esta revisión parece aumentar el riesgo, llegando a ser muy útil en el complemento pronóstico.

  12. MICORRIZACIÓN In Vitro E In Vivo DE PLÁNTULAS DE PAPA (Solanum tuberosum var. Alfa

    Directory of Open Access Journals (Sweden)

    Kalyanne Fernández


    Full Text Available Las condiciones artificiales en las que se desarrollan las plantas obtenidas por micropropagación hacen que sean más susceptibles a la sequía durante el transplante. Los hongos micorrízicos arbusculares contribuyen a la supervivencia y el crecimiento de las plantas al reducir el estrés asociado con la nutrición, las relaciones con el agua, la estructura del suelo, el pH, las sales, los metales tóxicos y los patógenos, por lo que son considerados de extrema utilidad como inoculantes durante las diferentes fases de micropropagación de los cultivos. Teniendo en cuenta estos aspectos se realizó este trabajo, con el objetivo de evaluar la factibilidad de la inoculación micorrízica durante los estadios in vitro e in vivo del proceso de micropropagación del cultivo de la papa (Solanum tuberosum L var. Alfa. Para dar respuesta al trabajo, se estudió la inoculación micorrízica sobre plantas de papa en condiciones de crecimiento in vitro, empleando diferentes medios de cultivo (MS, M y un nuevo medio N, bajo un diseño completamente aleatorizado (DCA y la inoculación de plantas de papa durante el transplante a fase adaptativa empleando tres especies del género Glomus y dos concentrados de especies de HMA (selva y desierto sobre dos sustratos diferentes, utilizando un DCA bajo arreglo bifactorial. En el estudio in vitro se obtuvieron efectos positivos sobre las plantas inoculadas en el medio M, aun cuando quedó clara la necesidad de encontrar nuevos medios, nutricionalmente balanceados, que garanticen tanto el crecimiento de las plántulas como el establecimiento eficiente de la micorrización. Además, en la fase adaptativa se encontró una respuesta altamente positiva a la inoculación de las cepas, mostrando un comportamiento diferenciado en función de los sustratos, apreciable en todas las variables estudiadas (nutricionales, fúngicas y fisiológicas, lo cual demostró la factibilidad del uso de dichos microorganismos en este

  13. Tratamento da Doença de Pompe - deficiência da alfa-glicosidase ácida

    Directory of Open Access Journals (Sweden)

    Micaela Inês KUHN


    Full Text Available Este trabalho tem como objetivos descrever a patogênese e o tratamento da doença de Pompe. Foi realizado um estudo de revisão bibliográfica mediante busca de artigos científicos publicados entre 2004 e 2014. Portadores de deficiência na enzima alfa acido glicosidase, desenvolvem a doença de Pompe, que resulta em um acumulo de glicogênio dentro do lisossomo, originando danos e disfunções orgânicas no tecido muscular, ocasionando dificuldades na respiração, locomoção, fala e audição. A terapia de reposição enzimática é a alternativa de tratamento específica para Pompe, melhorando significativamente a função cardíaca e reduzindo a mortalidade. Contudo, a necessidade de injeção de altas doses da enzima, a perda de 80% da enzima por conta do metabolismo hepático e o alto custo do tratamento dificultam o seu uso. A dose que mostrou melhores resultados foi de 20 mg/kg da enzima a cada duas semanas. Todavia, apesar do alto custo do tratamento, os benefícios de diminuição de sintomas dos pacientes são importantes, como melhora na realização de atividades da vida diária, aumento da força muscular, redução da fadiga e incrementos na função pulmonar. Existem ainda, tratamentos alternativos, mas que ainda estão em fase de estudos. Dentre os tratamentos, aquele que possui um melhor prognóstico é a reposição com a enzima humana recombinante. A terapia de reposição enzimática trouxe sobrevida a diversos pacientes devido à diminuição da hipertrofia cardíaca e melhora nos sintomas motores.

  14. The Arecibo Legacy Fast ALFA Survey: The Galaxy Population Detected by ALFALFA

    CERN Document Server

    Huang, Shan; Giovanelli, Riccardo; Brinchmann, Jarle


    Making use of HI 21 cm line measurements from the ALFALFA survey (alpha.40) and photometry from the Sloan Digital Sky Survey (SDSS) and GALEX, we investigate the global scaling relations and fundamental planes linking stars and gas for a sample of 9417 common galaxies: the alpha.40-SDSS-GALEX sample. In addition to their HI properties derived from the ALFALFA dataset, stellar masses (M_*) and star formation rates (SFRs) are derived from fitting the UV-optical spectral energy distributions. 96% of the alpha.40-SDSS-GALEX galaxies belong to the blue cloud, with the average gas fraction f_HI = M_HI/M_* ~ 1.5. A transition in SF properties is found whereby below M_* ~ 10^9.5 M_sun, the slope of the star forming sequence changes, the dispersion in the specific star formation rate (SSFR) distribution increases and the star formation efficiency (SFE) mildly increases with M_*. The evolutionary track in the SSFR-M_* diagram, as well as that in the color magnitude diagram are linked to the HI content; below this trans...

  15. HI Absorption Lines Detected from the Arecibo Legacy Fast ALFA Survey Data (United States)

    Zhong-zu, Wu; Martha P, Haynes; Riccardo, Giovanelli; Ming, Zhu; Ru-rong, Chen


    We present some preliminary results of an on-going study of HI 21-cm absorption lines based on the 40% survey data released by the Arecibo Legacy Fast Arecibo L-band Feed Array (ALFALFA). (1) Ten HI candidate absorbers have been detected. Five of them are previously published in the literature, and the rest of them are new detections that need further confirmation. (2) For those sources with no detected absorptions, we have calculated the upper limit of their foreground HI column density NHI. The statistical result of the NHI distribution indicates that the ratio Ts/f between the averaged spin temperature and coverage factor for DLAs (the damped Lyα systems) might be larger than 500 K. The radio frequency interference (RFI) and standing wave are the main factors affecting the detection of HI absorption lines, which have been analyzed and discussed as well in order to find a method of solution. Our study can serve as a pathfinder for the future large-scale search of HI 21-cm absorption lines using the Five-Hundred-Meter Aperture Spherical Radio Telescope (FAST), which is an Arecibo-type radio telescope currently under construction in China with greatly increased sensitivity, bandwidth, and observational sky area. As prospects, we have discussed two types of observational studies of HI absorption lines toward extragalactic sources using the FAST telescope.

  16. Elaboration, analyse et modélisation mécanique numérique d’agro-composites à base de fibres courtes d’alfa

    Directory of Open Access Journals (Sweden)

    El-Abbassi Fatima-ezzahra


    Full Text Available Dans la présente étude, récemment réalisée au Laboratoire d’Ingénierie et Sciences des Matériaux, de l’Université de Reims Champagne-Ardenne, nous proposons de valoriser la plante végétale d’Alfa, sous forme de fibres courtes en vue de renforcer par extrusion dans une première étape, puis par injection, des matrices polymères, en l’occurrence le Polypropylène (PP. Une première étape consiste à élaborer, par traitement chimique et extraction, la fibre courte à utiliser comme renfort. Il s’en suit une extrusion de courte à utiliser comme renfort. Il s’en suit une extrusion de composés composites à base de matrice PP. L’objectif sera de développer par la suite une démarche Essai-Calcul, confrontant une caractérisation mécanique d’agrocomposites PP-Alfa injectés à deux types de modélisation comportementale, l’une micromécanique basée sur le modèle de Mori-Tanaka, et l’autre numérique utilisant une approche originale basée sur une technique dite de fibre projetée.


    Directory of Open Access Journals (Sweden)

    M. Plouzhnikov


    Full Text Available Abstract. Recurrent respiratory papillomatosis (RRP is the most frequently occurring tumour of the upper airways associated with a human papilloma virus (HPV. The aim of this study was to reveal some features of systemic and local immunity in RRP, to investigate clinical and immunological efficiency of local treatment with recombinant interferon-α (rIFNα, and to determine clinical and laboratory indications to it’s administration. The study included forty-one patients with confirmed RRP. Their examination included histological examination of papillomas, detection of HPV DNA in papilloma tissues using PCR technique, phenotyping of circulating lymphocytes (CD3+, CD4+, CD8+, CD25+, HLA-DR+ by means of flow cytometry. The levels of IFNγ, TNFα, GM-CSF, IL-2, IL-4, IL-5, IL-10, IL-12, IL-13 in laryngeal secretions were quantified by a multiplex immunoassay. In all cases, we revealed an initially decreased functional activity of Т-lymphocytes, as well as low contents of Т-killer and NK-cells. In laryngeal secretions, increased values of Th1-type-specific cytokines (IFNγ and TNFα were found. Besides that, high levels of local IL-4 were detected thus being typical to alternative Th2-type response. Single inhalations 1000 000 ME of «Interal» or «Roferon» preparations were administered daily (a total of 10-15 millions ME per therapeutic course. Thirteen patients received the treatment after surgery, as an adjuvant therapy, and eleven patients underwent monotherapy. Complete tumor regression of tumors following this monotherapy was observed in 45,5% of the patients, whereas partial regression was registered in 45%. The effect was mostly expressed in frequently recurring juvenile papillomatosis with aggressive course and histological pattern of actively proliferating papilloma. In the patients with complete tumor regression, high initial levels of TNFα and IL-4/IFNг ratios were revealed initially in laryngeal secretions. When rIFNб was

  18. Neutron-induced alpha radiography; Radiografia com particulas alfa induzida por neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, Marco Antonio Stanojev


    A new radiography technique to inspect thin samples was developed. Low energy alpha particles, generated by a boron based screen under thermal neutron irradiation, are used as penetrating radiation. The solid state nuclear track detector CR-39 has been used to register the image. The interaction of the {alpha} - particles with the CR-39 gives rise to damages which under an adequate chemical etching became tracks the basic units forming the image. A digital system was developed for data acquisition and data analysis as well as for image processing. The irradiation and etching conditions to obtain the best radiography are 1,3 hours and 25 minutes at 70 deg C respectively. For such conditions samples having 10 {mu}m in thickness can be inspected with a spatial resolution of 32 {mu}m. The use of the digital system has reduced the time spent for data acquisition and data analysis and has improved the radiography image visualization. Furthermore, by using the digital system, it was possible to study several new parameters regarding the tracks which are very important to understand and study the image formation theory in solid state nuclear track detectors, the one used in this thesis. Some radiography images are also shown which demonstrate the potential of the proposed radiography technique. When compared with the other radiography techniques already in use to inspect thin samples, the present one developed in the present paper allows a smaller time to obtain the image, it is not necessary to handle liquid radioactive substances, the detector is insensitive to {beta}, {gamma}, X-ray and visible light. (author)

  19. Cardiovascular effects of hemoglobin response in patients receiving epoetin alfa and oral iron in heart failure with a preserved ejection fraction

    Institute of Scientific and Technical Information of China (English)

    Sirish Vullaganti; Jeff Goldsmith; Sergio Teruya; Julissa Alvarez; Stephen Helmke; Mathew S.Maurer


    Background Previous data from a recently conducted prospective, single blind randomized clinical trial among community dwelling older patients with heart failure with a preserved ejection fraction (HFPEF) and anemia randomized to treatment with epoetin alfa (erythro-poiesis-stimulating agents, ESA) vs. placebo did not demonstrate significant benefits of therapy regarding left ventricular (LV) structure, functional capacity, or quality of life (QOL). However, several patients randomized to the treatment arm were non-responders with a subop-timal increase in hemoglobin. All patients in the trial also received oral ferrous gluconate, which could have contributed to increases in he-moglobin observed in those receiving placebo. Accordingly, we performed an analysis separating patients into responders vs. non-responders in order to determine if measured improvement in anemia would have any effect on clinical endpoints. Methods A total of 56 patients (age 77 ± 11 years, 68%female) were recruited who had anemia defined as a hemoglobin of≤12 g/dL (average, 10.4 ± 1 g/dL) with HFPEF defined as having NHANES-CHF (National Health And Nutrition Examination Survey:Congestive Heart Failure) criteria score of≥3 and an ejection fraction of>40%(average EF=63%±15%). Patients were randomly allocated to receive either ESA and ferrous gluconate or ferrous gluconate only. In this analysis, a responder was defined as a patient with an increase of 1 g/dL in the first 4 weeks of the trial. Re-sults Nineteen subjects were classified as responders compared to 33 non-responders. While the average hemoglobin increased signifi-cantly at the end of 6 months for responders (1.8 ± 0.3 vs. 0.8 ± 0.2 g/dL, P = 0.004), 50% of the subjects assigned to ESA were non-responders. Left ventricular function including ejection fraction (P=0.32) and end diastolic volume (P=0.59) was unchanged in res-ponders compared to non-responders. Responders also showed no significant improvements in New York

  20. Prediction of Ovarian Hyperstimulation Syndrome in Patients Treated with Corifollitropin alfa or rFSH in a GnRH Antagonist Protocol.

    Directory of Open Access Journals (Sweden)

    Georg Griesinger

    Full Text Available What is the threshold for the prediction of moderate to severe or severe ovarian hyperstimulation syndrome (OHSS based on the number of growing follicles ≥ 11 mm and/or estradiol (E2 levels?The optimal threshold of follicles ≥11 mm on the day of hCG to identify those at risk was 19 for both moderate to severe OHSS and for severe OHSS. Estradiol (E2 levels were less prognostic of OHSS than the number of follicles ≥ 11 mm.In comparison to long gonadotropin-releasing hormone (GnRH agonist protocols, the risk of severe OHSS is reduced by approximately 50% in a GnRH antagonist protocol for ovarian stimulation prior to in vitro fertilisation (IVF, while the two protocols provide equal chances of pregnancy per initiated cycle. Nevertheless, moderate to severe OHSS may still occur in GnRH antagonist protocols if human chorionic gonadotropin (hCG is administered to trigger final oocyte maturation, especially in high responder patients. Severe OHSS following hCG trigger may occur with an incidence of 1-2% in a relatively young (aged 18 to 36 years IVF population treated in a GnRH-antagonist protocol.From the Engage, Ensure and Trust trials, in total, 2,433 women who received hCG for oocyte maturation and for whom the number of follicles ≥ 11 mm and the level of E2 on the day of hCG administration were known were included in the analyses.The threshold for OHSS prediction of moderate and severe OHSS was assessed in women treated with corifollitropin alfa or daily recombinant follicle stimulation hormone (rFSH in a gonadotropin-releasing hormone (GnRH-antagonist protocol. Receiver operating characteristics curve analyses for moderate to severe OHSS and severe OHSS were performed on the combined dataset and the sensitivity and specificity for the optimal threshold of number of follicles ≥ 11 mm, E2 levels on the day of (hCG, and a combination of both, were determined.The optimal threshold of follicles ≥ 11 mm on the day of hCG to identify those at

  1. Two different durations of adjuvant therapy with intermediate-dose interferon alfa-2b in patients with high-risk melanoma (Nordic IFN trial): a randomised phase 3 trial

    DEFF Research Database (Denmark)

    Hansson, Johan; Aamdal, Steinar; Bastholt, Lars;


    Adjuvant high-dose interferon alfa-2b improves relapse-free survival (RFS) in patients with high-risk melanoma, although benefits in overall survival are uncertain. Because of the toxic effects of high-dose regimens, intermediate doses are being explored. We investigated whether adjuvant therapy ...

  2. A Phase 3, multicenter, open-label, switchover trial to assess the safety and efficacy of taliglucerase alfa, a plant cell-expressed recombinant human glucocerebrosidase, in adult and pediatric patients with Gaucher disease previously treated with imiglucerase. (United States)

    Pastores, Gregory M; Petakov, Milan; Giraldo, Pilar; Rosenbaum, Hanna; Szer, Jeffrey; Deegan, Patrick B; Amato, Dominick J; Mengel, Eugen; Tan, Ee Shien; Chertkoff, Raul; Brill-Almon, Einat; Zimran, Ari


    Taliglucerase alfa is a β-glucosidase enzyme replacement therapy (ERT) approved in the US and other countries for the treatment of Gaucher disease (GD) in adults and is approved in pediatric and adult patients in Australia and Canada. It is the first approved plant cell-expressed recombinant human protein. A Phase 3, multicenter, open-label, 9-month study assessed safety and efficacy of switching to taliglucerase alfa in adult and pediatric patients with GD treated with imiglucerase for at least the previous 2years. Patients with stable disease were offered taliglucerase alfa treatment using the same dose (9-60U/kg body weight) and regimen of administration (every 2weeks) as imiglucerase. This report summarizes results from 26 adult and 5 pediatric patients who participated in the trial. Disease parameters (spleen and liver volumes, hemoglobin concentration, platelet count, and biomarker levels) remained stable through 9months of treatment in adults and children following the switch from imiglucerase. All treatment-related adverse events were mild or moderate in severity and transient in nature. Exploratory parameters of linear growth and development showed positive outcomes in pediatric patients. These findings provide evidence of the efficacy and safety profile of taliglucerase alfa as an ERT for GD in patients previously treated with imiglucerase. This trial was registered at as # NCT00712348.

  3. Randomized comparison of low-dose versus high-dose interferon-alfa in chronic myeloid leukemia: prospective collaboration of 3 joint trials by the MRC and HOVON groups.

    NARCIS (Netherlands)

    Kluin-Nelemans, H.C.; Buck, G.; Cessie, S. le; Richards, S.; Beverloo, H.B.; Falkenburg, J.H.F.; Littlewood, T.; Muus, P.; Bareford, D.; Lelie, H. van der; Green, A.R.; Roozendaal, K.J.; Milne, A.E.; Chapman, C.S.; Shepherd, P.


    The optimal dose of interferon-alfa (IFN) for chronic myeloid leukemia (CML) is unknown. Retrospective analyses suggest that low doses are as effective as high doses, with less toxicity and fewer patients abandoning the drug. The Dutch Hemato-Oncology Association (HOVON) and British Medical Research

  4. Espectroscopia Mössbauer e refinamento estrutural no sistema cerâmico isomórfico (alfa-Fe2O3-(alfa-Al2O 3 Mössbauer spectroscopy and structural refinement in the isomorphic (alpha-Fe2O3-( alpha-Al2O3 ceramic system

    Directory of Open Access Journals (Sweden)

    J. A. Moreto


    Full Text Available Os multiferróicos são materiais em que duas ou três propriedades tais como ferroeletricidade, ferromagnetismo e ferroelasticidade são observadas em uma mesma fase. Em particular, os multiferróicos magnetoelétricos representam os materiais que são simultaneamente (antiferromagnéticos e ferroelétricos, com ou sem ferroelasticidade. Especificamente, o sistema hematita (alfa-Fe2O3-alumina (alfa-Al2O3 tem sido estudado, principalmente devido às suas potencialidades para aplicações em metalurgia e como catalisador na síntese de amônia. Contudo, compostos deste sistema também podem apresentar efeitos magnetoelétricos. Neste trabalho um estudo estrutural do composto (alfa-Fe2O30,25(alfa-Al2O 30,75 submetido à moagem em altas energias e tratamento térmico pós-moagem é apresentado. As amostras foram caracterizadas por difração de raios X, refinamento estrutural Rietveld e espectroscopia Mössbauer. A determinação e identificação das fases cristalográficas, parâmetros de rede e volume de celas unitárias nas amostras moída e tratada termicamente permitiu verificar as mudanças dos parâmetros, a formação de espinélios e possíveis deformações relativas advindas do processo de moagem em altas energias.Multiferroics are materials in which two or all three of the properties, ferroelectricity, ferromagnetism, and ferroelasticity occur in the same phase. In particular, multiferroic magnetoelectrics represent the materials that are simultaneously ferromagnetic and ferroelectric, with or without ferroelasticity. Specifically, the hematite (alpha-Fe2O3-alumina (alpha-Al2O3 system has been studied, mainly due to its potential applications in metallurgy and as catalyst of ammonia synthesis. However, compounds of this system also may present magnetoelectric effects. In this work, a structural study of the high-energy ball milled and annealed (alpha-Fe2O3 0.25(alpha-Al2O30.75 compound was carefully conducted. The samples were

  5. Relato do primeiro paciente brasileiro com a forma infantil da doença de Pompe tratado com alfa-glicosidase recombinante humana



    Objetivo: Relatar o primeiro caso de forma infantil da doença de Pompe tratado no Brasil. Descrição: Trata-se de doença de depósito lisossomal que se caracteriza por defeitos da enzima alfa-glicosidase ácida, com acúmulo intracelular de glicogênio, principalmente nos músculos. São descritas a forma infantil e tardia. Desde 2006, está disponível tratamento com enzima recombinante humana. Descreve-se o primeiro caso de forma infantil da doença tratado no Brasil. Trata-se de menina com 2,5 meses...

  6. Elaboration, analyse et modélisation mécanique numérique d’agro-composites à base de fibres courtes d’alfa


    El-Abbassi Fatima-ezzahra; Ayad Rezak; lamdouara Nouzha; Kebir H.; Sabhi Hamid; Buet Stephane; Assarar Mustapha


    Dans la présente étude, récemment réalisée au Laboratoire d’Ingénierie et Sciences des Matériaux, de l’Université de Reims Champagne-Ardenne, nous proposons de valoriser la plante végétale d’Alfa, sous forme de fibres courtes en vue de renforcer par extrusion dans une première étape, puis par injection, des matrices polymères, en l’occurrence le Polypropylène (PP). Une première étape consiste à élaborer, par traitement chimique et extraction, la fibre courte à utiliser comme renfort. Il s’en ...

  7. Papel de la IL-6 y TNF-alfa en la enfermedad periodontal The role of IL-6 and TNF-alpha in periodontal disease

    Directory of Open Access Journals (Sweden)

    A. Carrillo de Albornoz Sainz


    Full Text Available La periodontitis se inicia por una serie de patógenos que inducen una cascada inflamatoria que estimula la destrucción de los tejidos mediada por el huésped. Están implicados un gran número de mediadores inflamatorios, entre los que destacan IL-6 y TNF-alfa. La IL-6 es una citoquina pleiotrópica de compleja actividad biológica, cuya función principal vinculada a la periodontitis es la inducción de la reabsorción ósea. TNF-alfa es una citoquina proinflamatoria cuya función más destacada es el reclutamiento y estimulación de neutrófilos y monocitos. Su papel en la periodontitis es diverso, ya que promueve tanto la inflamación, como la pérdida ósea y la destrucción del tejido conectivo, a la vez que limita la capacidad de reparación del periodonto.Periodontal disease is iniciated by several pathogens which induce an inflammatory cascade which stimulates the tisular destruction mediated by the host. Many inflammatory mediators are involved in this process. Amongst them we can remark IL-6 and TNF-alpha. IL-6 is a pleiotropic citokine of complex biological activity, which principal function linked to periodontitis is the induction of osseous resorption. TNF-alpha is a proinflammatory citokine which main function is the recruitment and stimulation of neutrophils and monocytes. Its role upon periodontitis is diverse. It gives rise to inflammation, as well as osseous resorption and connective tissue destruction, and limitates the reparative potential of periodontium.

  8. IL28B SNP rs12979860 is the Critical Predictor for Sustained Viral Response in Chinese Children Aged 1 to 6 Years with Chronic Hepatitis C


    Zhong, Yan-Wei; Zhang, Hong-Fei; Shi, Yan-Min; Li, Yong-Li; Chu, Fang; Xu, Zhi-Qiang; Chen, Da-Wei; Gan, Yu; Wang, Fu-Chuan; Gu, Mei-Lei; Dong, Yi; Zhu, Shi-Shu; Shi, Ce; Fan, Hua-Hao; Zhang, Xiu-Chang


    Clinical data on children with chronic hepatitis C (CHC) remain extremely limited. This study investigated sustained virologic response (SVR) to alfa-interferon 2b plus RBV treatment in children aged 1-6 years with unsafe injection-acquired CHC. 154 children with CHC aged 1 to 6 years were enrolled, 101 of them were male (65.6%) and 53 were female (34.4%), and they were treated with alfa-interferon at a dose of 1-5 MIU/m2 3 times weekly plus oral RBV (15 mg/kg/day) for 48 weeks. 57(39.3 %) of...

  9. Associação de bronquite plástica com enteropatia perdedora de proteínas após operação de Fontan Asociación de bronquitis plástica a la enteropatía perdedora de proteínas tras operación de fontan Association of plastic bronchitis to protein-losing enteropathy after fontan operation

    Directory of Open Access Journals (Sweden)

    Vanessa Alves Guimarães


    Full Text Available Relatamos um caso incomum de associação de bronquite plástica (BP com enteropatia perdedora de proteínas (EPP em menina de 4 anos e 9 meses de idade. com dupla via de entrada de ventrículo único tipo esquerdo e concordância ventrículo-arterial submetida à cirurgia cavopulmonar total. com túnel lateral intracardíaco aos três anos. Tornaram-se chamativas a eliminação de molde brônquico de fibrina de 10 cm (BP e a elevação de alfa-1-antitripsina de 52 mg/g de fezes. Em uso de sildenafila. programou-se. em caso de continuidade do processo. a ligadura do ducto torácico e transplante cardíaco.Referimos el caso atípico de asociación de bronquitis plástica (BP con enteropatía perdedora de proteínas (EPP en una menina de 4 años y 9 meses de edad, con doble vía de entrada de ventrículo único tipo izquierdo y concordancia ventrículo-arterial sometida a la cirugía cavopulmonar total, con túnel lateral intracardiaco a los 3 años. Se consideraron como llamativas la eliminación de molde bronquial de 10 cm formado por fibrina (BP y la elevación de alfa-1-antitripsina de 52 mg/g de heces. En uso de sildenafila, se programó, en caso de continuidad del proceso, la ligadura del conducto torácico y trasplante cardíaco.We report an unusual case of association of plastic bronchitis (PB to protein-losing enteropathy (PLE in a girl of 4 years and 9 months of age with double inlet single left ventricle and ventriculoarterial concordance. submitted to total cavopulmonary surgery. with an intracardiac lateral tunnel at the age of three. The elimination of the 10 cm fibrin bronchial mold (PB and the alpha-1-antitrypsin elevation of 52 mg/g in feces had both become outstanding. Using sildenafil. the thoracic duct ligature and the cardiac transplant were programmed in case of continuity of the process.

  10. Bronquite plástica em criança com talassemia alfa Plastic bronchitis in a child with thalassemia alpha

    Directory of Open Access Journals (Sweden)

    Tiago N. Veras


    Full Text Available OBJETIVO: A bronquite plástica é uma doença infreqüente na criança, sendo caracterizada por moldes ou cilindros mucofibrinosos na árvore traqueobrônquica. Faz parte do diagnóstico diferencial de crianças com insuficiência respiratória de início agudo, e o tratamento precoce é importante para a resolução do quadro. O objetivo deste relato é descrever um caso de bronquite plástica tratado com sucesso por endoscopia, em paciente portador de talassemia alfa. DESCRIÇÃO: Criança do sexo masculino, 3 anos de idade, sem antecedentes mórbidos significativos, apresentou quadro de insuficiência respiratória aguda, com achados radiológicos de atelectasia pulmonar sugestivos de aspiração de corpo estranho. Não havia sintomas respiratórios ou antecedentes de alergia ou infecções respiratórias de repetição. A realização de broncoscopia flexível, complementada por endoscopia rígida e exame anatomopatológico, evidenciou a presença de bronquite plástica. Após a realização da endoscopia, a criança evoluiu satisfatoriamente, com curva térmica afebril e extubação em 72 horas. Foram utilizadas medicações sintomáticas, sem necessidade de antimicrobianos. Dez dias após a alta, a radiografia de tórax encontrava-se normal. A talassemia alfa foi diagnosticada através da eletroforese de hemoglobina. COMENTÁRIOS: A importância clínica da bronquite plástica reside no fato de apresentar um quadro semelhante ao de outras doenças mais prevalentes, como a aspiração de corpo estranho e a asma brônquica. A suspeita do quadro recomenda a realização de endoscopia para diagnóstico e tratamento. É reconhecida a ocorrência de bronquite plástica em crianças com fibrose cística, pós-operatório de cirurgia cardíaca e anemia falciforme. No presente artigo, foi observada uma associação com talassemia alfa.OBJECTIVE: Plastic bronchitis is an unusual condition in children, associated with formation of mucofibrinous

  11. Coste-efectividad de drotrecogina alfa (activada en el tratamiento de la sepsis grave en España Cost-effectiveness of drotrecogin alpha [activated] in the treatment of severe sepsis in Spain

    Directory of Open Access Journals (Sweden)

    José A Sacristán


    Full Text Available Introducción: El ensayo clínico PROWESS ha demostrado que el tratamiento con drotrecogina alfa (activada en pacientes con sepsis grave se asocia a una reducción del riesgo absoluto de muerte en comparación con el tratamiento estándar. El objetivo del estudio fue evaluar el coste-efectividad de drotrecogina alfa (activada, frente a tratamiento estándar, en el tratamiento de la sepsis grave en España. Pacientes y métodos: Se elaboró un modelo de análisis de decisión en el que se compararon los costes hasta el alta hospitalaria y la eficacia a largo plazo de drotrecogina alfa (activada frente a tratamiento estándar de pacientes con sepsis grave en España, desde la perspectiva del financiador de los servicios sanitarios. La mayoría de la información para realizar el modelo se obtuvo del ensayo clínico PROWESS. El análisis basal fue doble: a para todos los pacientes incluidos en el ensayo clínico PROWESS, y b para los pacientes con 2 o más fallos orgánicos. Las variables principales de valoración clínica fueron la reducción de la mortalidad hospitalaria y los años de vida ganados (AVG. El coste-efectividad se expresó como coste por AVG. Se realizó un análisis de sensibilidad utilizando tasas de descuento del 3 y el 5% para los AVG y modificando los patrones de atención sanitaria, los costes de la unidad de cuidados intensivos, la esperanza de vida según la comorbilidad inicial y la eficacia terapéutica de drotrecogina alfa (activada. Resultados: El tratamiento con drotrecogina alfa (activada se asoció a un descenso del riesgo absoluto de mortalidad hospitalaria del 6,0% (p = 0,005 cuando se incluyeron todos los pacientes del estudio PROWESS, y una reducción del 7,3% (p = 0,005 cuando sólo se incluyeron los pacientes con 2 o más fracasos orgánicos. El coste-efectividad de drotrecogina alfa (activada fue de 13.550 euros por AVG respecto a placebo cuando se analizó el total de pacientes, y de 9.800 euros por AVG en el

  12. Cronbach’ın Alfası, Tek Boyutluluğun veya Benzeşikliğin (Homojenliğin) Bir Ölçüsü Değildir


    BADEMCİ, Vahit


    Güvenirlik, testler veya ölçme araçlarının değil, ölçümlerin bir özelliğidir. Cronbach’ın alfası katsayısı yöntemi, bir test ya da ölçme aracından elde edilen ölçümlerin güvenirliğini kestirme yöntemlerinden biridir. Başka bir ifadeyle, Cronbach’ın alfası, [madde] ölçümler[i] arasındaki iç tutarlılık üzerine temellenmiş bir ölçüm güvenirliğinin kestirilmesidir. Bunun yanı sıra, Cronbach’ın alfası katsayısı, ölçme aracının benzeşikliğinin (homojenliğinin) bir göstergesi olarak alınmamalı veya ...

  13. CXCL9 associated with sustained virological response in chronic hepatitis B patients receiving peginterferon alfa-2a therapy: a pilot study.

    Directory of Open Access Journals (Sweden)

    I-Cheng Lee

    Full Text Available BACKGROUND AND AIMS: There is lack of a practical biomarker to predict sustained virological response (SVR in chronic hepatitis B (CHB patients undergoing peginterferon alfa-2a (PEG-IFN. The aim of this pilot study was to identify immunological features associated with SVR. METHODS: Consecutive 74 CHB patients receiving 24 weeks (for hepatitis B e antigen (HBeAg-positive or 48 weeks (for HBeAg-negative PEG-IFN, were prospectively enrolled. Serum HBV viral loads, hepatitis B surface antigen (HBsAg, CXCL9, IFN-γ-inducible protein 10 (IP-10, interferon-gamma (IFN-γ and transforming growth factor beta (TGF-β were measured at baseline and week 12. SVR was defined as HBeAg seroconversion combined with viral load 80 pg/mL, HBV DNA 10% at week 12 were predictors of SVR. The performance of CXCL9 in predicting SVR was good in patients with HBV DNA <2.5 x 10(7 IU/mL, particularly in HBeAg-negative CHB cases (positive predictive value, PPV= 64.3%. CONCLUSIONS: Pre-treatment CXCL9 level has the potential to select CHB patients who can respond to PEG-IFN, especially in HBeAg-negative patients with low viral loads.

  14. Tenecteplase for ST-elevation myocardial infarction in a patient treated with drotrecogin alfa (activated for severe sepsis: a case report

    Directory of Open Access Journals (Sweden)

    Barra Lillian


    Full Text Available Abstract Introduction Drotrecogin alfa (activated (DrotAA, an activated protein C, promotes fibrinolysis in patients with severe sepsis. There are no reported cases or studies that address the diagnosis and treatment of myocardial infarction in septic patients treated with DrotAA. Case presentation A 59-year-old Caucasian man with septic shock secondary to community-acquired pneumonia treated with DrotAA, subsequently developed an ST-elevation myocardial infarction 12 hours after starting DrotAA. DrotAA was stopped and the patient was given tenecteplase thrombolysis resulting in complete resolution of ST-elevation and no adverse bleeding events. DrotAA was restarted to complete the 96-hour course. The sepsis resolved and the patient was discharged from hospital. Conclusion In patients with severe sepsis or septic shock complicated by myocardial infarction, it is difficult to determine if the myocardial infarction is an isolated event or caused by the sepsis process. The efficacy and safety of tenecteplase thrombolysis in septic patients treated with DrotAA need further study.

  15. Duchenne muscular dystrophy: alpha-dystroglycan immunoexpression in skeletal muscle and cognitive performance Distrofia muscular de Duchenne: imunoexpressão da alfa-distroglicana em musculatura esquelética e performance cognitiva

    Directory of Open Access Journals (Sweden)

    Conceição Campanario da Silva Pereira


    Full Text Available The Duchenne muscular systrophy (DMD is a muscular dystrophy with cognitive impairment present in 20-30% of the cases. In the present study, in order to study the relationship between the alpha-dystroglycan (alpha-DG immunostaining in skeletal muscle and cognitive performance in DMD patients, 19 were assessed. Twelve patients performed the intelligence quotient (IQ below the average. Among the 19 patients, two were assessed by the Stanford-Binet test and 17 by Wechsler Intelligence Scale for Children-III (WISC-III. Nine patients performed a verbal IQ below the average, only three patients performed an average verbal IQ. The muscle biopsies immunostained with antibodies to alpha-DG showed that 17 patients presented a low expression, below 25% of the total fibers. Two patients presented alpha-DG immunostaining above 40% and an IQ within the average. No significant statistical relationship was demonstrated among total IQ, verbal IQ and execution IQ and alpha-DG immunostaining at these patients muscle samples.A distrofia muscular de Duchenne (DMD é uma distrofia muscular com comprometimento cognitivo presente em 20-30% dos casos. No presente estudo, com a finalidade de estudar a relação entre a imunoexpressão da alfa-distroglicana (alfa-DG em musculatura esquelética e a performance cognitiva em pacientes com DMD, foram avaliadas 19 crianças. Doze pacientes apresentaram o quociente de inteligência (QI abaixo da média. Entre os 19 pacientes, dois foram avaliados pelo teste de Stanford-Binet e 17 pelo Wechsler Intelligence Scale para crianças-III (WISC-III. Nove apresentaram QI verbal abaixo da média, e apenas três QI verbal na média. As biopsias musculares com os anticorpos para alfa-DG mostraram que 17 pacientes apresentaram baixa expressão, abaixo de 25% do total de fibras. Dois pacientes apresentaram a imunoexpressão da alfa-DG acima de 40% e QI dentro da média. Não foi demonstrada relação estatisticamente significante entre o QI

  16. Alfa-amilase em frangos de corte: efeitos do balanço eletrolítico e do nível protéico da dieta Alpha-amylase in broiler chickens: effects of electrolytic balance and dietary protein level

    Directory of Open Access Journals (Sweden)

    Marcela Piedade Monteiro


    Full Text Available Um experimento foi conduzido com pintos de corte macho para o estudo dos efeitos dos níveis de 20 e 23% de PB combinados com 0, 50, 100, 150, 200, 250 mEq/kg de balanço dietético eletrolítico (BDE sobre a atividade da alfa-amilase pancreática de frangos de corte de 1 a 21 dias de idade. O delineamento utilizado foi o inteiramente casualizado. Dietas e água foram fornecidas ad libitum. Aos 1, 7, 14 e 21 dias, três aves de cada tratamento foram sacrificadas por deslocamento cervical para remoção do pâncreas, o qual foi removido, homogeneizado, congelado em nitrogênio líquido e liofilizado. Uma alíquota de cada amostra foi solubilizada em água deionizada e centrifugada a 7500 x g por 3 minutos a 4ºC, para determinação da atividade da alfa-amilase no sobrenadante. Aves alimentadas com 20% de PB apresentaram atividades específicas (U/mg de proteína superiores à daquelas que receberam 23%, exceto para os níveis de BDE de 100 a 200 mEq/kg, aos 14 dias. Observou-se tendência de aumento da atividade específica dos 7 aos 14 dias e redução dos 14 aos 21 dias. Para maior atividade específica de alfa-amilase, recomendam-se dietas com 20% de PB e 200 mEq/kg de BDE na fase pré-inicial e dietas com 20% de PB e 135 a 250 mEq/kg de BDE para frangos de corte dos 8 aos 21 dias de idade.An experiment was conducted with male broiler chicks to study the effects of 20 and 23% of crude protein (CP combined with 0, 50, 100, 150, 200, 250 mEq/kg of dietary electrolytic balance (DEB on the pancreatic alpha-amylase activity from 1 to 21 days. A completely randomized factorial design was used. Feed and water were supplied ad libitum. At days 1, 7, 14 and 21, three birds from each treatment were sacrificed by cervical dislocation, pancreas were removed, homogeneized and frozen in liquid nitrogen which were then freeze-dried. An aliquot of each sample was solubilized with deionized water and centrifuged at 7500 x g for three minutes at 4º

  17. Composicao quimica, perfil de acidos graxos e quantificacao dos acidos ƒ¿-linolenico, eicosapentaenoico e docosahexaenoico em visceras de tilapias (Oreochromis niloticus = Percentual composition, fatty acids and quantification of the LNA (Alfa-Linolenic, EPA (Eicosapentaenoic and DHA (Docosahexaenoic acids in visceras of Nile Tilapia (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Nilson Evelázio de Souza


    Full Text Available Foi avaliada a composição química de vísceras de tilápias (Oreochromis niloticus criadas em cativeiro Os teores de umidade, cinza, proteína bruta e lipídios totais foram de 64,4%; 1,3%; 6,3% e 18,0%, respectivamente, caracterizando alta concentração de lipídiostotais em relação a outros resíduos de peixes. Foram identificados 49 ácidos graxos, sendo majoritários os ácidos: oléico, (32,8%, seguido do palmítico, (19,9% e linoléico, (18,2%. As razões entre n-6/n-3 e ácidos poliinsaturados/saturados foram de 5,5 e 0,9, respectivamente. As quantificações dos ácidos graxos alfa-linolênico, eicosapentaenóico e docosahexaenóico, em mg/g de lipídios totais, foram de 10,4, 1,4 e 9,3, respectivamente. O elevado teor de lipídios totais das vísceras contribuiu significativamente para as quantidadesde ácidos graxos n-3. Todos os parâmetros analisados foram satisfatórios sob o ponto de vista nutricional e neste sentido as vísceras de tilápias poderão ser utilizadaa para alimentar peixes ou outros animais.The chemical composition was evaluated in visceras of tilapias raised in captivity. The moisture, ash, crude protein and total lipids contents were 64.4%; 1.3%; 6.3% and 18.0%, respectively, characterizing high total lipids concentration in relation other residues of fish. Forty nine fatty acids were detected, the major fatty acids were oleic (32.8%, palmitic (19.9% and linoleic-1 (18.2% and oleic (9.4%. The ratio n-6/n-3 and polyunsaturated/saturated fatty acids, showed the values 5.5 and 0.9, respectively. The quantifications of alfa-linolenic, eicosapentaenoic and docosahexaenoic acids (in mg/g of total lipids, were 10.4, 1.4 and 0.3, respectively. The higher contents of total lipids in visceras contributed significantly for amounts of n-3 fatty acids. All the parameters analyzed were shown nutritional value satisfactory in this sense visceras of tilapias can be used in the feed of fish and other animal.

  18. Estratégia de troca entre agentes anti-TNF-alfa não melhora a capacidade funcional em pacientes com artrite reumatoide de longa evolução Switching between anti-TNF-alpha agents does not improve functional capacity in patients with long-standing and active rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Maria Roberta Melo P Soares


    Full Text Available OBJETIVOS: Avaliar a resposta clínica após a estratégia de troca entre agentes antifator de necrose tumoral alfa (anti-TNF-alfa em pacientes com artrite reumatoide (AR. PACIENTES E MÉTODOS: Foram incluídos 99 pacientes com diagnóstico de AR (American College of Rheumatology, 1987, em uso de terapia anti-TNF-alfa, para avaliação da resposta terapêutica após 24 semanas. A estratégia de troca foi feita se, após 12 a 24 semanas, houvesse relato de evento adverso sério (T: toxicidade ou se não ocorresse redução maior que 0,6 do índice de atividade da doença (DAS28 inicial (RI: resposta inadequada. Nesse último caso, o paciente foi considerado como falência primária (FP. Falência secundária (FS foi definida se houvesse perda de resposta após melhora inicial. Remissão (DAS28 0,2 do questionário de avaliação da saúde (HAQ inicial] foram avaliadas por análise de regressão linear. P OBJECTIVES: To assess clinical response after switching between anti-tumor necrosis factor-alpha (anti-TNF-alpha agents in patients with rheumatoid arthritis (RA. PATIENTS AND METHODS: This study included 99 patients diagnosed with RA American College of Rheumatology, 1987, on anti-TNF-alpha therapy, to assess the therapeutic response after 24 weeks. Switching was performed if, after 12 to 24 weeks, a severe adverse event was reported (toxicity: T or if no reduction greater than 0.6 in the initial Disease Activity Score 28 (DAS28 occurred (inadequate response: IR. In case of IR, the patient was considered as primary failure (PF. Secondary failure (SF was defined as loss of response after initial improvement. Remission (DAS28 0.2] were assessed by use of linear regression analysis. The significance level adopted was P < 0.05. RESULTS: Switching was performed in 39 (39.4% patients, especially due to PF (24.3%, SF (35.1% and T (40.5%. The retention rate of the first agent was 60.1%, and the mean time for switching was 14.2 ± 10.9 months. After

  19. Reducción de la biohidrogenación del ácido linoleico y alfa linolénico por la adición de diferentes proporciones de ácido eicosapentaenoico y docosahexaenoico

    Directory of Open Access Journals (Sweden)

    Julian Castillo


    Full Text Available Se evaluó el efecto de la adición de ácidodocosahexaenoicoe (DHA y eicosapentaenocio(EPA a una mezcla de ácidolinoleico (ALi y alfa-linolénico (ALn,sobre su biohidrogenación, en fluidoruminal in vitro. A 500 mg de kikuyo,se agregaron 18 μL de una mezcla deALi:ALn (75:25 (Control o una mezclade 14,9 μL ALi:ALn (75:25 con 3,1μL de una mezcla que contenía cuatrorelaciones de DHA:EPA (100:0, 75:25,25:75, 0:100. El kikuyo sin adición deácidos grasos (AG (Control negativo ocon adición de estos, fue incubado confluido ruminal por triplicado, durante 0,5 o 16 horas, en tubos de 50 mL. Loslípidos del material incubado fueron extraídos,metilados y analizados para AGpor CG-FID. Las concentraciones relativas(g/100 g AG de los AG incubados ylos principales productos de la isomerizacióny biohidrogenación se compararonmediante un modelo completamenteal azar, usando el PROC GLM de SAS.La concentración relativa de ALi y ALndisminuyó con el tiempo de incubación,pero no fue diferente entre tratamientoscon EPA y DHA a las 16 horas. La adiciónde DHA y EPA puros o en mezclasdisminuyó la concentración relativade C18:0 (P < 0,01 e incrementó la deC18:1 trans-11 (ATV (P < 0,01 y C18:2trans-11, cis-15 (P < 0,01 (ALC,mientras que los cambios en la concentraciónrelativa del C18:2 cis-9, trans-11no fueron claros. Los resultados sugieren que la acción inhibitoria del EPA y DHA ocurre en los pasos finales de la biohidrogenación del ALi y del ALn.

  20. Níveis de alfa-tocoferol no soro e leite materno de puérperas atendidas em maternidade pública de Natal, Rio Grande do Norte Levels of alpha-tocopherol in the serum and breast-milk of child-bearing women attending a public maternity hospital in the city of Natal , in the Brazilian State of Rio Grande do Norte

    Directory of Open Access Journals (Sweden)

    Lígia Rejane Siqueira Garcia


    Full Text Available OBJETIVOS: avaliar os níveis de alfa-tocoferol no soro e leite materno em diferentes estágios de lactação de puérperas e verificar a adequação nutri cional de vitamina E do leite oferecido ao lactente. MÉTODOS: participaram do estudo 32 parturientes adultas com idade média de 25 anos. Foram coletados 5 mL de sangue e 2 mL de colostro, em condição de jejum, para análise dos níveis de alfa tocoferol. Entre 10 e 15 dias pós-parto foram coletados mais 2 mL de leite. As amostras foram analisadas por Cromatografia Líquida de Alta Eficiência. A adequação nutricional do leite para a vitamina E foi calculada pelo produto do volume estimado de ingestão de leite com a concentração de α-tocoferol no leite e por comparação direta desse produto com o valor de referência para ingestão do nutriente (4 mg/dia. RESULTADOS: os níveis de alfa-tocoferol no sangue foram 29 ± 0,9 µmol/L (Média ± Erro padrão e no colostro e leite de transição foram 28,7 ± 4,7 µmol/L e 7,8 ± 1,0 µmol/L, respectivamente. O consumo estimado de colostro forneceu 241% da recomendação dietética e o de leite de transição atingiu 66%. CONCLUSÕES: o grupo de mulheres estudadas apresentou um estado nutricional satisfatório de vitamina E, refletido no leite materno, principalmente no colostro, cujos valores foram capazes de suprir mais do que o dobro do requerimento nutricional do lactente.OBJECTIVES: to evaluate levels of alpha-tocopherol in the serum and breast-milk of women at various stages in lactation and to confirm whether nutritio nally appropriate levels of vitamin E are present in the milk given to the babies. METHODS: thirty-two child-bearing women with an average age of 25 years took part in the study. 5 mL of blood and 2 mL of colostrum were collected, under fasting conditions, for the purposes of analyzing the levels of alpha-tocopherol. Between 10 to 15 days after childbirth, a further 2 mL of breast-milk was collected. The samples were

  1. Teores de retinol, beta-caroteno e alfa-tocoferol em leites bovinos comercializados na cidade de São Paulo Amounts of retinol, beta-carotene and alpha-tocopherol in cow milk comercialized in the city of São Paulo

    Directory of Open Access Journals (Sweden)



    Full Text Available Os teores de retinol, beta-caroteno e alfa-tocoferol foram determinados por cromatografia líquida de alta eficiência em leites em pó, pasteurizados e esterilizados, comercializados na Cidade de São Paulo. Após a saponificação e extração, os compostos foram determinados simultaneamente utilizando-se coluna de sílica, fase móvel constituída por hexano:isopropanol (99:1 e fluxo de 2,0mL/min. O retinol e o beta-caroteno foram determinados no detector UV/visível e o alfa-tocoferol no detector de fluorescência, ligado em série com o anterior. Os valores de vitamina A dos leites foram calculados com e sem a consideração do beta-caroteno. A maior contribuição deste nutriente no valor de vitamina A esteve entre os leites em pó, cerca de 17% em uma das marcas. Os altos teores das vitamina A e E encontrados em alguns leites, indicam que os mesmos provavelmente receberam adição destas vitaminas, não trazendo, entretanto, tal informação no rótulo. A análise de vitaminas nestes produtos indica a necessidade de maior controle de qualidade dos mesmos.The amount of retinol, beta-carotene, alpha -tocopherol in powder, pasteurized and sterilized milk, comercialized in the city of São Paulo, were analyzed by high performance liquid chromatography. After saponification and extraction, compounds were determined simultaneously through a normal-phase column, mobile phase composed by hexan:2-propanol (99:1 and 2 mL/min flow. The retinol and beta-carotene were analysed by a UV/visible detector and the alpha-tocopherol by a fluorescence detector, both linked in series. The milk vitamin A values were calculated with and without beta-carotene. The major contribution of beta-carotene in the vitamin A value was in powder milks, around 17% in one of the brands. The high amounts of vitamin A and E found in some milks indicate that they probably were enriched with these vitamins but nothing is mentioned about this in their labels. The analysis of

  2. Potential cost saving of Epoetin alfa in elective hip or knee surgery due to reduction in blood transfusions and their side effects: a discrete-event simulation model.

    Directory of Open Access Journals (Sweden)

    Jörg Tomeczkowski

    Full Text Available OBJECTIVES: Transfusion of allogeneic blood is still common in orthopedic surgery. This analysis evaluates from the perspective of a German hospital the potential cost savings of Epoetin alfa (EPO compared to predonated autologous blood transfusions or to a nobloodconservationstrategy (allogeneic blood transfusion strategyduring elective hip and knee replacement surgery. METHODS: Individual patients (N = 50,000 were simulated based on data from controlled trials, the German DRG institute (InEK and various publications and entered into a stochastic model (Monte-Carlo of three treatment arms: EPO, preoperative autologous donation and nobloodconservationstrategy. All three strategies lead to a different risk for an allogeneic blood transfusion. The model focused on the costs and events of the three different procedures. The costs were obtained from clinical trial databases, the German DRG system, patient records and medical publications: transfusion (allogeneic red blood cells: €320/unit and autologous red blood cells: €250/unit, pneumonia treatment (€5,000, and length of stay (€300/day. Probabilistic sensitivity analyses were performed to determine which factors had an influence on the model's clinical and cost outcomes. RESULTS: At acquisition costs of €200/40,000 IU EPO is cost saving compared to autologous blood donation, and cost-effective compared to a nobloodconservationstrategy. The results were most sensitive to the cost of EPO, blood units and hospital days. CONCLUSIONS: EPO might become an attractive blood conservation strategy for anemic patients at reasonable costs due to the reduction in allogeneic blood transfusions, in the modeled incidence of transfusion-associated pneumonia andthe prolongedlength of stay.

  3. Effect of treatment with Omega-3 fatty acids on C-reactive protein and tumor necrosis factor-alfa in hemodialysis patients

    Directory of Open Access Journals (Sweden)

    Hamid Tayyebi-Khosroshahi


    Full Text Available C-reactive protein (CRP, a strong independent risk marker of cardiovascular disease (CVD, and tumor necrosis factor-alfa (TNF-α, a known pro-inflammatory cytokine, are elevated and have damaging effects in patients with chronic renal failure (CRF. Omega-3 fatty acids play an important modulatory role in inflammatory responses. The aim of this study is to review the alterations in serum levels of TNF-α, CRP and other parameters caused by omega-3 supplementation in dialysis patients. The clinical trial was performed in 37 patients with end-stage renal disease undergoing dialysis in hemodialysis centers of three university hospitals in Tabriz. Blood samples were obtained from the study patients for hemoglobin, albumin, ferritin, triglyceride, total cholesterol, low-density lipoprotein (LDL and high-density lipoprotein (HDL-cholesterol, TNF-α and high specific-CRP (hs-CRP measurement. The patients received 3 g omega-3 per day for 2 months. The side-effects noticed were nausea, diarrhea and dyspepsia and undesired drug smell. The difference noted in hemoglobin, albumin, ferritin, CRP, triglyceride, total, LDL and HDL-cholesterol before and after supplementation with omega-3 fatty acid was not statistically significant (P > 0.05. However, the use of omega-3 decreased the serum levels of TNF-α significantly. We conclude that the use of 3 g of omega-3 per day caused significant decrease in serum levels of TNF-α in the dialysis population, and its use is recommended in such patients.

  4. Acute inflammatory demyelinating polyneuropathy after treatment with pegylated interferon alfa-2a in a patient with chronic hepatitis C virus infection: a case report

    Directory of Open Access Journals (Sweden)

    Lahbabi Mounia


    Full Text Available Abstract Introduction The combination of polyethylene glycol (PEGylated interferon (pegylated interferon and ribavirin has been shown to be an effective treatment for chronic hepatitis C virus. In general, common side effects related to this combination therapy are mild and are well tolerated. However, peripheral neuropathy including demyelinating polyneuropathy related to PEG-interferon α2a (pegylated interferon alfa-2a is extremely rare. In the literature, only one case of acute inflammatory demyelinating polyneuropathy related to PEG-interferon α2a has been published previously. Case presentation To the best of our knowledge we present only the second case of acute inflammatory demyelinating polyneuropathy related to PEG-interferon α2a, occurring in a 63-year-old Caucasian man. He developed tingling, numbness, and weakness of his upper and lower extremities with acute neurological deficits after five weeks of a combination therapy with PEG-interferon α2a and ribavirin for chronic hepatitis C virus infection. His clinical course, neurological findings, and his electromyogram results were all consistent with acute inflammatory demyelinating polyneuropathy. Our patient recovered completely after interferon was stopped and symptomatic treatment and a further electromyogram showed a disappearance of neuropathy. Four weeks later, PEG-interferon α2a was reintroduced with a gradually increasing dose without any reappearance of neurological symptoms allowing hepatitis C seroconversion. Conclusions Recognition of this rare yet possible presentation is important for early and accurate diagnosis and treatment. This case report also suggests that the reintroduction of PEGylated interferon in patients who had presented with acute inflammatory demyelinating polyneuropathy related to interferon α may be safe, but this must be confirmed by further studies.

  5. The HI Mass Function and Velocity Width Function of Void Galaxies in the Arecibo Legacy Fast ALFA Survey

    CERN Document Server

    Moorman, Crystal M; Hoyle, Fiona; Pan, Danny C; Haynes, Martha P; Giovanelli, Riccardo


    We measure the HI mass function (HIMF) and velocity width function (WF) across environments over a range of masses $7.2<\\log(M_{HI}/M_{\\odot})<10.8$, and profile widths $1.3\\log(km/s)<\\log(W)<2.9\\log(km/s)$, using a catalog of ~7,300 HI-selected galaxies from the ALFALFA Survey, located in the region of sky where ALFALFA and SDSS (Data Release 7) North overlap. We divide our galaxy sample into those that reside in large-scale voids (void galaxies) and those that live in denser regions (wall galaxies). We find the void HIMF to be well fit by a Schechter function with normalization $\\Phi^*=(1.37\\pm0.1)\\times10^{-2} h^3Mpc^{-3}$, characteristic mass $\\log(M^*/M_{\\odot})+2\\log h_{70}=9.86\\pm0.02$, and low-mass-end slope $\\alpha=-1.29\\pm0.02$. Similarly, for wall galaxies, we find best-fitting parameters $\\Phi^*=(1.82\\pm0.03)\\times10^{-2} h^3Mpc^{-3}$, $\\log(M^*/M_{\\odot})+2\\log h_{70}=10.00\\pm0.01$, and $\\alpha=-1.35\\pm0.01$. We conclude that void galaxies typically have slightly lower HI masses than ...

  6. Análise de crédito por meio de modelos de previsão de insolvência: um estudo de caso na Empresa Cerâmica Alfa S.A. = Credit analysis through models for the forcasting of insolvency of the company Cerâmica Alfa S.A.

    Directory of Open Access Journals (Sweden)

    Paula Bez Birolo


    Full Text Available O objetivo deste artigo é avaliar os benefícios da utilização de modelos de previsão de insolvência para a análise de crédito em uma empresa do setor cerâmico. É descritivo, de caráter quantitativo, realizado por meio de um estudo de caso na empresa Cerâmica ALFA S.A. Para execução da pesquisa selecionou-se intencionalmente seis clientes, de acordo com os seguintes dados: a informações creditícias disponíveis no sistema gerencial de crédito/cobrança e b demonstrações contábeis divulgadas nos sites dos respectivos clientes. Os resultados apontam que os modelos de Elizabetsky e Kanitz demonstram fragilidades em identificar a situação financeira dos clientes. O modelo de previsão de insolvência desenvolvido por Matias apresenta melhor desempenho, em relação aos anteriores, para a análise de crédito. Conclui-se que é vantajoso utilizar o modelo de Matias para a análise de crédito, pois ele é adequado às necessidades da empresa e serve como um instrumento para auxílio na concessão de crédito e tomada de decisão. The objective of this article is to assess the benefits of using insolvency forecasting models for the credit analysis of a company in the ceramic sector. This study is descriptive of a quantitative nature through a case study in Cerâmica ALFA S.A. Six clients with the following data were intentionally selected for the execution of the research: a credit information available in the credit/collection management system and b account statements divulged in the sites of the respective clients. The results show that the Elizabetsky and Kanitz models demonstrated fragility in identifying the financial situation of the clients. The insolvency forecasting model developed by Matias showed better performance in relation to the previous ones for credit analysis. It was concludrd that it is advantageous to use the Matias model for credit analysis, because it is suitable for the company’s requirements and serves

  7. Implicación de las citoquinas TNF-[alfa] e IL-6 y de las metalotioneínas en la neuroinflamación desencadenada por lesión cerebral


    Quintana Romero, Albert


    Consultable des del TDX Títol obtingut de la portada digitalitzada La respuesta frente a lesiones traumáticas está orquestada por las citoquinas, grupo heterogéneo de proteínas de bajo peso molecular implicadas en la señalización intercelular, tales como la interleuquina-6 (IL-6) o el factor de necrosis tumoral alfa (TNF)-α. Pese a que estos dos factores fueron originalmente descritos como inductores y mediadores de la vertiente pro-apoptótica de la respuesta inflamatoria también se han...

  8. Papel de la lactancia materna en la respuesta al estrés: estudio comparativo y correlacional de los niveles de cortisol y alfa amilasa de madres y sus hijos lactantes con diferentes tipos de alimentación


    Agudelo Cañas, Samantha


    Se conoce que la exposición al estrés durante etapas tempranas de la vida, predispone al individuo a presentar psicopatologías como depresión y ansiedad entre otras. Actualmente no es claro si el tipo de alimentación puede ser una variable que afecte la respuesta al estrés en los niños durante los dos primeros años de vida. El objetivo de esta tesis fue determinar y establecer correlaciones entre las concentraciones de cortisol (CORT) y alfa amilasa (AA) (biomarcadores de la...





    Se sintetizó polietilenos (PE) metalocénicos de estructura lineal, del tipo homoetileno, y ramificada, del tipo copolímeros de etileno 1-olefinas, usando tolueno como medio de reacción en un proceso de polimerización tipo Slurry con Etilbislndenilcirconio 76p.

  10. Effect of short-term ornithine alpha-ketoglutarate pretreatment on intestinal ischemia-reperfusion in rats Efeitos do pré-tratamento em curto prazo com ornitina alfa-cetoglutarato na isquemia-reperfusão intestinal em ratos

    Directory of Open Access Journals (Sweden)

    Eduardo Silvio Gouveia Gonçalves


    Full Text Available PURPOSE: To investigate the effects of preventive enteral administration of ornithine alpha-ketoglutarate (OKG in an ischemia-reperfusion rat model. METHODS: Sixty rats were randomized into five groups (G1-G5, n = 12. Each group was divided into two subgroups (n = 6 and treated with calcium carbonate (CaCa or OKG by gavage. Thirty minutes later, the animals were anesthetized with xylazine 15mg + ketamine 1mg ip and subjected to laparotomy. G1-G3 rats served as controls. Rats in groups G4 and G5 were subjected to ischemia for 30 minutes. Ischemia was achieved by clamping the small intestine and its mesentery, delimiting a segment of bowel 5 cm long and 5 cm apart from the ileocecal valve. In addition, G5 rats underwent reperfusion for 30 minutes. Blood samples were collected at the end of the laparotomy (G1, after 30 minutes (G2, G4 and 60 minutes (G3, G5 to determine concentrations of metabolites (pyruvate, lactate, creatine phosphokinase (CPK, thiobarbituric acid reactive substances (TBARS and glutathione (GSH. RESULTS: There was a significant decrease in tissue pyruvate and lactate and plasma CPK levels in OKG-treated rats at the end of reperfusion period. GSH levels did not change significantly in ischemia and reperfusion groups. However, TBARS levels increased significantly (pOBJETIVO: Investigar os efeitos da administração enteral preventiva de ornitina alfa-cetoglutarato (OKG em modelo de isquemia-reperfusão no rato. MÉTODOS: Sessenta ratos foram randomizados em cinco grupos (G1-G5, n=12. Cada grupo foi redistribuído em dois subgrupos (n=6 e tratado com carbonato de cálcio (CaCa ou OKG por gavagem. Trinta minutos mais tarde, os animais foram anestesiados com xilazina 1mg+cetamina 15mg i.p. e submetidos à laparotomia. Os ratos dos grupos G4-G5 foram submetidos à isquemia por 30 minutos. A isquemia foi obtida por pinçamento do intestino delgado, delimitando um segmento com 5 cm de comprimento e distando 5 cm da válvula ileocecal. O

  11. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama The role of estrogen receptor alpha in breast cancer cell proliferation mediated by progestins

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli


    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.In C4-HD murine mammary carcinomas and in human breast cancer T47D cells, we showed that medroxyprogesterone acetate (MPA induces a nuclear physical association between estrogen receptor alpha (ERa and progesterone receptors (PR. The blockade of ERa inhibits cell proliferation mediated by progestins. We hypothesized that this nuclear association between ERa/PR is necessary to trigger progestin-induced cell proliferation and tumor growth. We demonstrated that fulvestrant (FUL, ICI182.780 induced complete regression of C4-HD tumors growing with progestins. MPA treatment induced an early increase in both CCND1 and MYC expression in T47D cells. The blockade of ERa

  12. El ácido alfa lipoico y su poder antioxidante frente al cáncer y las patologías de sensibilización central

    Directory of Open Access Journals (Sweden)

    Marisa Durand


    Full Text Available Introducción: El ácido alfa lipoico (ALA puede controlar y limitar la cantidad de radicales libres, influyendo el desarrollo de patologías como el cáncer o las enfermedades de sensibilización central, aunque los mecanismos moleculares implicados en este proceso aún están dilucidándose. Objetivo: Reunir y contrastar información sobre las propiedades antioxidantes del ALA en la prevención y desarrollo de las patologías relacionadas con el estrés oxidativo. Material y métodos: En este trabajo, se analizan más de 100 artículos publicados en los últimos 20 años que relacionan el consumo de ALA y la prevalencia y desarrollo de patologías relacionadas con el estrés oxidativo. Los artículos han sido obtenidos en diferentes bases de datos (PubMed central, Web of Science, Elsevier Journal, Science Direct, e incluyen experimentos en células, animales y humanos. Las palabras clave utilizadas fueron: cáncer, enfermedades de sensibilización central, radicales libres, y ALA. Resultados y discusión: Se han reunido resultados de trabajos realizados in vitro y en animales de laboratorio en los que se pone de manifiesto el efecto del ALA en el control de la apoptosis celular de diferentes tipos de cánceres mediante un aumento de las especies reactivas de oxígeno, así como también el retardo en el crecimiento de las mismas. Aparte, se ha demostrado que la capacidad antioxidante del ALA y su potencial para regenerar otros antioxidantes es de gran importancia para tratar las patologías de sensibilización central. Conclusiones: El ALA ha demostrado un papel significativo como antioxidante y prooxidante en el cáncer y las patologías de sensibilización central, aunque son necesarias más investigaciones en humanos.

  13. Alfa-lipoic acid protects testosterone secretion pathway and sperm quality against 4-tert-octylphenol induced reproductive toxicity. (United States)

    Othman, Azza I; El-Missiry, Mohamed A; Koriem, Khaled M; El-Sayed, Aml A


    The protective effect of α-lipoic acid (LA) (50 mg/kg bw) against 4-tert-octylphenol (OP) (50 mg/kg bw) induced reproductive toxicity in male rats was studied. LA was injected 1h prior to OP administration three times a week. OP caused significant increase in oxidative stress in hypothalamus and epididymal sperm, disturbed hormonal levels in serum, decreased sperm quality, increased DNA fragmentation and loss of 35 and 95 kDa proteins in sperm, as well as elevated proliferating index in testis. LA protected against oxidative stress through promoting the levels of glutathione and glutathione-S-transferase in hypothalamus and sperm. In addition, LA prevented the decrease in testosterone, dehydroepiandrosterone sulfate, 3β-hydroxysteroid dehydrogenase, and inhibited the elevations in sex-hormone-binding globulin levels and showed normal sperm quality. LA modulated proliferation of germ cell, protected against DNA fragmentation and maintained membrane protein organization in the sperm. In conclusion, LA normalized oxidative stress and protected testosterone synthesis pathway across hypothalamus-testicular axis and sperm quality indicating its defensive influence against OP-induced oxidative reproductive dysfunction in male rats.

  14. Arecibo Pulsar Survey Using ALFA. IV. Mock Spectrometer Data Analysis, Survey Sensitivity, and the Discovery of 41 Pulsars

    CERN Document Server

    Lazarus, P; Hessels, J W T; Karako-Argaman, C; Kaspi, V M; Lynch, R; Madsen, E; Patel, C; Ransom, S M; Scholz, P; Swiggum, J; Zhu, W W; Allen, B; Bogdanov, S; Camilo, F; Cardoso, F; Chatterjee, S; Cordes, J M; Crawford, F; Deneva, J S; Ferdman, R; Freire, P C C; Jenet, F A; Knispel, B; Lee, K J; van Leeuwen, J; Lorimer, D R; Lyne, A G; McLaughlin, M A; Siemens, X; Spitler, L G; Stairs, I H; Stovall, K; Venkataraman, A


    The on-going PALFA survey at the Arecibo Observatory began in 2004 and is searching for radio pulsars in the Galactic plane at 1.4 GHz. Observations since 2009 have been made with new wider-bandwidth spectrometers than were previously employed in this survey. A new data reduction pipeline has been in place since mid-2011 which consists of standard methods using dedispersion, searches for accelerated periodic sources, and search for single pulses, as well as new interference-excision strategies and candidate selection heuristics. This pipeline has been used to discover 41 pulsars, including 8 millisecond pulsars (MSPs; P = 100 ms that gradually becomes up to a factor of ~10 worse for P > 4 s at DM < 150 pc/cc. This degradation of sensitivity at long periods is largely due to red noise. We find that 35 +- 3% of pulsars are missed despite being bright enough to be detected in the absence of red noise. This reduced sensitivity could have implications on estimates of the number of long-period pulsars in the Gal...

  15. Ectoine and hydroxyectoine inhibit thermal-induced aggregation and increase thermostability of recombinant human interferon Alfa2b. (United States)

    Salmannejad, Faranak; Nafissi-Varcheh, Nastaran


    This study is to investigate whether ectoines (ectoine and hydroxyectoine) can reduce aggregation of rhIFNα2b in aqueous solutions on thermal stress. The effect of thermal stress condition on the stability was therefore investigated using size exclusion-high performance liquid chromatography (SE-HPLC), different spectroscopic measurements, dynamic light scattering (DLS), electrophoresis, and differential scanning calorimetry (DSC). All experiments were performed in a sodium phosphate buffer system (100mM, pH7). The protein samples (100μg/ml) were incubated at 50°C for 14days in the absence or presence (1, 10, 20, and 100mM) of ectoines. In summary, thermal-induced aggregation was reduced in the presence of ectoines, regardless of the ectoines concentration in different periods of incubation time by analyzing with SE-HPLC and turbidity measurement. The inhibitory effect of ectoines on the aggregation was shown by other techniques used. The optimal ectoines concentration was 10mM for aggregation reduction, so samples containing of 10mM of ectoines were selected for further evaluation. Secondary structural and conformational stability increased in presence of ectoines as measured by far-UV circular dichroism and fluorescence spectroscopy, respectively. DSC showed slight increase in Tm of interferon in the presence of ectoines. Hydroxyectoine had superior protein-stabilizing properties than ectoine. In conclusion, this study demonstrates that ectoine and hydroxyectoine are highly effective excipients which can significantly reduce the thermal-induced aggregation of rhIFNα2b at low concentration.

  16. Main: 1MID [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1MID 大麦 Barley Hordeum vulgare l. Nonspecific Lipid-Transfer Protein 1 Precursor; Synonyms=Papi; Hordeum Vulgare Molecule: Nonspecific Lipid-Transfer Protein 1; Chain: A; Synonym: Lipid... Transfer Protein Lipit Binding Protein A.Henriksen A.Henriksen Binding Of L-Alfa-Lysophosphatidylcholin...e, Lauroyl In The Hydrophobic Channel Of Barley Lipid Transfer Protein To Be Published Lipid...R003612; AAI.|InterPro; IPR000528; Plant_LTP.|Pfam; PF00234; Tryp_alpha_amyl; 1.|PRINTS; PR00382; LIPIDTRNSF

  17. Peginterferon Alfa-2a Injection (United States)

    ... appetite weight loss diarrhea dry or itchy skin hair loss difficulty falling asleep or staying asleep tiredness ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...


    Directory of Open Access Journals (Sweden)

    Guido Guido, Elsiana


    Full Text Available Resumen: En este artículo se presentan las acciones realizadas dentro del Proyecto Alfa Nro. DCl-ALA 2008/42: Aseguramiento de la calidad: políticas públicas y gestión universitaria financiado con fondos de la Unión Europea y coordinado, de manera general, por el Centro Interuniversitario de Desarrollo, CINDA. Participan 16 universidades latinoamericanas y 7 universidades europeas, y el objetivo general del proyecto es mejorar la gestión de la calidad de la Educación Superior, tanto a nivel de los sistemas nacionales como de las instituciones de Educación Superior, y contribuir con la generación de conocimiento y confianzas mutuas acerca de la calidad de la Educación Superior entre los países latinoamericanos y europeos. Como parte de las actividades desarrolladas se llevaron a cabo estudios en 7 países (5 de Latinoamérica y 2 de Europa para evaluar el impacto de los procesos de aseguramiento de la calidad implementados en las universidades. En Costa Rica, el proyecto ha sido coordinado y ejecutado por la Universidad de Costa Rica desde el año 2009 hasta la fecha. El estudio se realizó en dos universidades estatales y dos privadas, durante el período comprendido entre octubre de 2010 y mayo de 2011, se realizaron 26 entrevistas presenciales y 8 sesiones de grupo a las diferentes poblaciones definidas en el estudio, además, se realizaron un total de 652 encuestas a estudiantes activos y a personas egresadas. Los principales resultados obtenidos en Costa Rica se resumen en este artículo, de acuerdo con los niveles y dimensiones de calidad que fueron definidos en el marco referencial del proyecto.Abstract: The article presents actions carried out in Costa Rica, in the frame of the project Alfa Nro. DCl-ALA 2008/42: Quality assurance: public policies and management in universities. This project is funded by the European Commission and its general coordination is in charge of the Inter-university Center for Development (CINDA, in

  19. Associação entre os polimorfismos HaeIII e MspI do gene para o receptor alfa de estrogênio e densidade mamográfica em mulheres após a menopausa Association between HaeIII and MspI polymorphisms of estrogen receptor alpha gene and mammographic density in post-menopausal women

    Directory of Open Access Journals (Sweden)

    Eduardo Henrique de Moura Ramos


    Full Text Available OBJETIVO: Avaliar a presença dos polimorfismos HaeIII e MspI do gene para o receptor de estrogênio alfa, bem como fatores clínicos e suas possíveis associações com a densidade mamográfica em mulheres após a menopausa. MÉTODOS: Foram avaliadas 115 mulheres após a menopausa, não usuárias de terapia hormonal e sem lesão mamária clínica ou mamograficamente identificada. A densidade mamográfica foi determinada por três observadores independentes, tomando-se como base a classificação dos padrões mamográficos do ACR-BIRADS®, 2003 (duas avaliações subjetivas e uma computadorizada - Adobe Photoshop® 7.0. Amostras de raspado bucal foram obtidas para extração de DNA e em seguida foi realizada uma PCR-RFLP (Polymerase Chain Reation - Restriction Fragment Length Polymorphism para análise de polimorfismos presentes no íntron 1 e éxon 1 do gene do REalfa (HaeIII e MspI. RESULTADOS: O polimorfismo HaeIII foi encontrado em 43 (37,4% das 115 mulheres, ao passo que o MspI estava presente em 96 (83,5% das mesmas. Houve alto grau de concordância entre os três observadores na determinação da densidade mamográfica. Trinta e quatro (29,6% mulheres tinham mamas densas, e 81 (70,4%, mamas lipossubstituídas. CONCLUSÃO: Não houve associação entre o polimorfismo HaeIII do gene para o receptor de estrogênio alfa e densidade mamográfica (Fisher = 0,712. Houve associação próxima à significância estatística entre o polimorfismo MspI e densidade (Fisher = 0,098. Idade, paridade e índice de massa corporal mostraram-se associados com densidade mamográfica.PURPOSE: To assess the presence of estrogen receptor gene polymorphisms HaeIII and MspI as well as clinical factors, and their possible associations with high mammographic density in post-menopausal women. METHODS: One hundred and fifteen post-menopausal women, not in use of hormonal therapy and without clinical or mammographic lesions were evaluated. Three independent observers

  20. Efficacy of Budesonide Suspension for Inhalation combined with Poractant Alfa Injection in prevention of neonatal respiratory distress syndrome%布地奈德混悬液雾化吸入配合猪肺磷脂防治新生儿呼吸窘迫综合征效果观察

    Institute of Scientific and Technical Information of China (English)

    李兰; 范娟; 胡怡萍; 李茂军; 陈丽娜; 陈昌辉


    目的 探讨布地奈德混悬液雾化吸入配合猪肺磷脂(商品名:固尔苏)防治新生儿呼吸窘迫综合征(neonatal respiratory distress syndrome,NRDS)的效果.方法 选择2009年9月至2010年9月我院新生儿病房收治的胎龄29~34周、生后2小时内入院的早产儿46例.按入院顺序单双号随机分成治疗组(A组)和对照组(B组)各23例,两组均给予综合治疗及猪肺磷脂120 mg气管内滴入,在此基础上,A组给予布地奈德混悬液0.5mg雾化吸入,盐酸氨澳索针剂10 mg/kg静脉滴注,每8小时1次,连用5天;B组仅给予盐酸氨溴索针剂10 mg/kg静脉滴注,每8小时1次,连用5天.检测两组早产儿入院第1、2、3天动脉血氧分压(PaO2)、动脉血二氧化碳分压(PaCO2)水平及发生NRDS的例数.结果 两组PaO2、PaCO2第1天差异无统计学意义,第2、3天差异有统计学意义(P<0.05);A组无NRDS发生,B组发生NRDS4例,发生率17%,两组比较差异有统计学意义(P<0.05).结论布地奈德混悬液雾化吸入配合猪肺磷脂能较快改善早产儿通气及换气功能,改善血气指标,提高机体供氧,有效预防NRDS的发生,降低早产儿的病死率.%Objective To explore the efficacy of Budesonide Suspension for Inhalation combined with Poractant Alfa Injection in the prevention and treatment of neonatal respiratory distress syndrome (NRDS). Methods Forty-six preterm infants two hours after birth,with gestational age from 29 to 34 weeks,were admitted in the newborn nursery of our hospital from Sep 2009 to Sep 2010 and randomly divided into two groups according to orders of admission. Each group was involved 23 preterm infants and was given comprehensive treatment and Poractant Alfa Injection 120 mg by tracheal instillation. Croup A was discharged on Budesonide Suspension for Inhalation 0. 5 mg/kg plus Ambroxol Hydrochloride Injection 10 mg/kg Ⅳ q. 8 h for 5 days. Croup B was only discharged on Ambroxol Hydrochloride Injection 10 mg/kg Ⅳ q

  1. Efeitos de níveis de ácido L-glutâmico e de vitamina K da dieta sobre a atividade de alfa-amilase em frangos de corte Effects of dietary levels of L-glutamic acid and vitamin K in the activity of alpha-amylase of chicks

    Directory of Open Access Journals (Sweden)

    Flavia Escapini Fanchiotti


    Full Text Available Foram investigados os efeitos nutricionais de dois níveis de ácido L-glutâmico (L-Glu combinados com quatro níveis de vitamina K (Vit K sobre a atividade de alfa-amilase no quimo e pâncreas de aves de corte. Frangos de corte machos de um dia foram criados em baterias aquecidas e alimentados, à vontade, com dietas contendo todos L-aminoácidos essenciais, minerais e vitaminas (exceto Vit K até os 14 dias de idade. O experimento foi realizado em esquema fatorial, em delineamento inteiramente casualizado 2x4, com quatro repetições de oito aves cada. A dieta básica foi suplementada com 6,25 e 12,5% de L-Glu combinados com 0,02; 0,2; 20,0 e 200,0 mg de Vit K/kg de ração. Efeitos significativos de L-Glu e Vit K foram observados no quimo. A atividade específica máxima (1.005,78±245,25 UI/mg de proteína foi observada nas aves alimentadas com 6,25% de L-Glu e 20,0 mg de Vit K. Houve redução da atividade com a suplementação de 12,5% de L-Glu. No pâncreas, não houve interação entre L-Glu e Vit K, todavia, foi observado efeito de L-Glu sobre as atividades relativas, expressas em UI/g de tecido e UI/100 g de peso corporal. Os resultados sugerem que a associação entre L-Glu e Vit K interfere na atividade enzimática de alfa-amilase em aves de corte submetidas a dietas purificadas. Os resultados indicam que o nível de 12,5% de L-Glu associado aos diferentes níveis de vitamina K reduziu a atividade enzimática.The effects of two levels of L-glutamic acid (L-Glu combined with four levels of vitamin K (Vit K were studied with the objective of evaluating the activities of alpha-amylase in the chyme and pancreas of chicks. Day-old male broilers were reared in eletrically heated batteries, fed with purified amino acids diets, minerals and vitamins (except Vit K at the requirement levels, for 14 days. Feed and water were provided ad libitum. The experimental design was a factorial 2x4 with four replicates with eight chicks each The

  2. Investigation of the corrosion performance of different braze fillers fused onto stainless steel type 1.4401 (UNS S31600)

    Energy Technology Data Exchange (ETDEWEB)

    Wolfe, C.; Eklund, T.; Persson, O. [Alfa Laval Corporate AB, Tumba (Sweden)


    Corrosion measurements were performed on a new iron based braze filler, AlfaNova{sup 1} developed by Alfa Laval. The braze filler was fused onto stainless steel type EN 1.4401 (UNS S31600). The susceptibility to general corrosion, intergranular corrosion and pitting corrosion was evaluated by gravimetrical and electrochemical methods as well as metallographical examination of the samples. Different sample configurations were utilised, which simulate the geometry of a braze joint in a plate heat exchange. The results were compared with a selection of commercial nickel-based braze fillers. It was shown that the newly developed iron-based braze filler had similar corrosion resistance as the commercially available nickel-based fillers. It was seen that the precipitation of intermetallic phases due to melting point depressants had a governing effect on the corrosion resistance of the braze joint. (orig.)

  3. Alterações na banda alfa do eletrencefalograma durante imagética motora visual e cinestésica Changes in the electroencephalogram alpha band during visual and kinesthetic motor imagery

    Directory of Open Access Journals (Sweden)

    Marcus Vinicius Stecklow


    Full Text Available Foi investigada a contribuição em potência na vizinhança do pico da banda alfa (BPA do EEG durante imagética motora (IM. Sinais EEG (derivações occipitais e parietais foram adquiridos em sujeitos destros (18-40 anos, durante repouso (ESP e IM nas modalidades cinestésica (IMC e visual (IMV, sendo 15 atletas de voleibol e 15 não-atletas. O Revised Movement Imagery Questionnaire não indicou diferenças entre grupos ou modalidades de IM; todavia os atletas imaginaram-se melhor que os não-atletas. Para ambos os grupos, a potência em BPA resultou menor em IM do que em ESP, sendo mais reduzida em IMC. Ativação cortical similar ocorreu em ambos os hemisférios de não-atletas e mais pronunciada no hemisfério esquerdo de atletas, principalmente durante IMC. Tais resultados sugerem que IM reduz a atividade de alfa de acordo com o conhecimento real da tarefa e a modalidade de IM.This study aims at statistically assessing the differences in alpha band power, particularly in the vicinity of the alpha peak (BPA, during motor imagery (MI. Multi-channel EEG (occipital and parietal regions was acquired at rest condition (ESP and MI kinesthetic (MIC and visual (MIV modalities from right-handed male subjects (18-40 years, 15 ‘athletes’ (experienced volleyball players and 15 ‘non-athletes’. The Revised Movement Imagery Questionnaire indicated no differences between groups or MI modalities, but athletes imagine themselves more clearly than non-athletes during MI. The power within BPA reduces in both groups, but greater in MIC than in MIV. The cortical activation was similar in both hemispheres of non-athletes but more pronounced in left hemisphere of athletes, mainly in MIC. The findings suggest that MI reduces alpha activity according to individual knowledge of real execution of motor task and MI modalities.

  4. Southwest Oncology Group S0008: A Phase III Trial of High-Dose Interferon Alfa-2b Versus Cisplatin, Vinblastine, and Dacarbazine, Plus Interleukin-2 and Interferon in Patients With High-Risk Melanoma—An Intergroup Study of Cancer and Leukemia Group B, Children's Oncology Group, Eastern Cooperative Oncology Group, and Southwest Oncology Group (United States)

    Flaherty, Lawrence E.; Othus, Megan; Atkins, Michael B.; Tuthill, Ralph J.; Thompson, John A.; Vetto, John T.; Haluska, Frank G.; Pappo, Alberto S.; Sosman, Jeffrey A.; Redman, Bruce G.; Moon, James; Ribas, Antoni; Kirkwood, John M.; Sondak, Vernon K.


    Purpose High-dose interferon (IFN) for 1 year (HDI) is the US Food and Drug Administration–approved adjuvant therapy for patients with high-risk melanoma. Efforts to modify IFN dose and schedule have not improved efficacy. We sought to determine whether a shorter course of biochemotherapy would be more effective. Patients and Methods S0008 (S0008: Chemotherapy Plus Biological Therapy in Treating Patients With Melanoma) was an Intergroup phase III trial that enrolled high-risk patients (stage IIIA-N2a through IIIC-N3), randomly assigning them to receive either HDI or biochemotherapy consisting of dacarbazine, cisplatin, vinblastine, interleukin-2, IFN alfa-2b (IFN-α-2b) and granulocyte colony-stimulating factor given every 21 days for three cycles. Coprimary end points were relapse-free survival (RFS) and overall survival (OS). Results In all, 432 patients were enrolled. Grade 3 and 4 adverse events occurred in 57% and 7% of HDI patients and 36% and 40% of biochemotherapy patients, respectively. At a median follow-up of 7.2 years, biochemotherapy improved RFS (hazard ratio [HR], 0.75; 95% CI, 0.58 to 0.97; P = .015), with a median RFS of 4.0 years (95% CI, 1.9 years to not reached [NR]) versus 1.9 years for HDI (95% CI, 1.2 to 2.8 years) and a 5-year RFS of 48% versus 39%. Median OS was not different (HR, 0.98; 95% CI, 0.74 to 1.31; P = .55), with a median OS of 9.9 years (95% CI, 4.62 years to NR) for biochemotherapy versus 6.7 years (95% CI, 4.5 years to NR) for HDI and a 5-year OS of 56% for both arms. Conclusion Biochemotherapy is a shorter, alternative adjuvant treatment for patients with high-risk melanoma that provides statistically significant improvement in RFS but no difference in OS and more toxicity compared with HDI. PMID:25332243

  5. Sources of alpha-, beta-, gamma-, delta- and epsilon-carotenes: a twentieth century review Fontes de alfa-, beta-, gama-, delta-, e epsilon-carotenos: uma revisão do século XX

    Directory of Open Access Journals (Sweden)

    José M. Barbosa-Filho


    Full Text Available Since humans cannot synthesize carotenoids, they depend upon the diet exclusively for the source of these micronutrients. It has claimed that they may alleviate chronic diseases such as cancers. The present communication constitutes a global review of the scientific literature on plants and others organisms that biosynthesize carotenoids, which include the series alpha-, beta-, gamma-, delta- and epsilon-carotenes. The results of the literature survey lists more than five hundred sources.Uma vez que os humanos não podem sintetizar carotenóides, dependem exclusivamente da dieta como fonte desses micronutrientes. Tem sido afirmado que eles podem aliviar doenças crônicas, tais como cânceres. O presente artigo constitui uma revisão global da literatura científica sobre plantas e outros organismos que biossintetizam carotenóides, que incluem as séries alfa-, beta-, gama-, delta-, e epsilon-carotenos. Os resultados das listas de pesquisa da literatura mostram mais de quinhentas fontes.

  6. Elastólise pós-inflamatória e cutis laxa (doença de James Marshall: estudo de casos Post-inflammatory elastolysis and cutis laxa (James Marshall disease: case study

    Directory of Open Access Journals (Sweden)

    Claudemir Roberto Aguilar


    Full Text Available FUNDAMENTOS: Elastólise pós-inflamatória e cutis laxa são doenças raras, porém só o Estado de Minas Gerais responde por quase um terço dos casos relatados em todo o mundo. Também são escassos os trabalhos com seguimento dos pacientes. OBJETIVOS: Relatar nove casos observados no período de 1981 a 2004, confrontando seus achados com os 20 casos da literatura. MÉTODOS: Foram analisadas variáveis epidemiológicas, clínicas, histopatológicas e terapêuticas. RESULTADOS: Foram observados o predomínio na raça negra (8:1, no sexo feminino (4:1 e nos trópicos (9:1; idade de início até os quatro anos (93%; deficiência de alfa 1-antitripsina (7%; aortite (7%; dermatoses relacionadas (62%; aspecto facial envelhecido (97%, fase atrófica estável na infância após período variável de meses a anos com lesões inflamatórias (97%. A histopatologia das lesões recentes mostrou infiltrado mais intenso e perda elástica menor do que nas lesões tardias. A cirurgia de reconstrução deu bons resultados na fase atrófica, enquanto o ácido retinóico tópico a 0,05% não foi efetivo. CONCLUSÕES: A elastólise pós-inflamatória e cutis laxa na fase aguda correlacionaram-se com diversas dermatoses inflamatórias, que promoveram elastólise (62%. A abordagem adequada dessas doenças pode diminuir a extensão do quadro atrófico final, que tem como boa opção terapêutica a cirurgia reconstrutora. Sugere-se pesquisar a deficiência de alfa 1-antitripsina.BACKGROUND: Although rare diseases, one third of all cases of post-inflammatory elastolysis and cutis laxa published in the international literature are from the state of Minas Gerais, in Brazil. Reports with long term follow-up of these patients are also scarce. OBJECTIVES: To report nine cases observed from 1981 to 2004 and compare the findings with 20 cases described in the literature. METHODS: Epidemiological, clinical, pathological and therapeutical variables were assessed. RESULTS: The


    Directory of Open Access Journals (Sweden)

    Elsiana Guido Guido


    Full Text Available En este artículo se presentan las acciones realizadas dentro del Proyecto Alfa Nro. DCl-ALA 2008/42: Aseguramiento de la calidad: políticas públicas y gestión universitaria financiado con fondos de la Unión Europea y coordinado, de manera general, por el Centro Interuniversitario de Desarrollo, CINDA. Participan 16 universidades latinoamericanas y 7 universidades europeas, y el objetivo general del proyecto es mejorar la gestión de la calidad de la Educación Superior, tanto a nivel de los sistemas nacionales como de las instituciones de Educación Superior, y contribuir con la generación de conocimiento y confianzas mutuas acerca de la calidad de la Educación Superior entre los países latinoamericanos y europeos. Como parte de las actividades desarrolladas se llevaron a cabo estudios en 7 países (5 de Latinoamérica y 2 de Europa para evaluar el impacto de los procesos de aseguramiento de la calidad implementados en las universidades. En Costa Rica, el proyecto ha sido coordinado y ejecutado por la Universidad de Costa Rica desde el año 2009 hasta la fecha. El estudio se realizó en dos universidades estatales y dos privadas, durante el período comprendido entre octubre de 2010 y mayo de 2011, se realizaron 26 entrevistas presenciales y 8 sesiones de grupo a las diferentes poblaciones definidas en el estudio, además, se realizaron un total de 652 encuestas a estudiantes activos y a personas egresadas. Los principales resultados obtenidos en Costa Rica se resumen en este artículo, de acuerdo con los niveles y dimensiones de calidad que fueron definidos en el marco referencial del proyecto.


    Directory of Open Access Journals (Sweden)

    Jenny Martín


    Full Text Available Almidón de yuca comercial (variedad MTAI 8 se sometió a modificación física por sinéresis, extrusión, gelatinización y secado por rodillos. Al almidón nativo y a los almidones modificados se les determinó su morfología, cristalinidad, distribución molecular y susceptibilidad a la hidrólisis enzimática con una alfa amilasa porcina pancreática. En los almidones modificados físicamente se incrementó el grado de hidrólisis, en comparación con el almidón nativo. Sin embargo no se observaron diferencias estadísticamente significativas en el grado de hidrólisis entre los almidonesmodificados. El patrón de difracción de rayos X tipo A, presentado por el almidón de yuca nativo y su propiedad birrefringente se alteraron por los pretratamientos, presentándose difractogramas de estructuras amorfas y pérdida de la cruz de malta en los almidones modificados. La microscopía electrónica de barrido (MEB demostró alteración en la apariencia y estructura del gránulo nativo, dando lugar a partículas de formas irregulares con superficies fragmentadas y rugosas como resultado del proceso de modificación. La cromatografía de exclusión sobre sepharosa 6B confirmó la desaparición de la fracción de alto peso molecular presente en el almidón nativo, con el consecuente incremento de las fracciones de bajo peso molecular en los almidones modificados.

  9. A genetic validation study reveals a role of vitamin D metabolism in the response to interferon-alfa-based therapy of chronic hepatitis C.

    Directory of Open Access Journals (Sweden)

    Christian M Lange

    Full Text Available BACKGROUND: To perform a comprehensive study on the relationship between vitamin D metabolism and the response to interferon-α-based therapy of chronic hepatitis C. METHODOLOGY/PRINCIPAL FINDINGS: Associations between a functionally relevant polymorphism in the gene encoding the vitamin D 1α-hydroxylase (CYP27B1-1260 rs10877012 and the response to treatment with pegylated interferon-α (PEG-IFN-α and ribavirin were determined in 701 patients with chronic hepatitis C. In addition, associations between serum concentrations of 25-hydroxyvitamin D(3 (25[OH]D(3 and treatment outcome were analysed. CYP27B1-1260 rs10877012 was found to be an independent predictor of sustained virologic response (SVR in patients with poor-response IL28B genotypes (15% difference in SVR for rs10877012 genotype AA vs. CC, p = 0.02, OR = 1.52, 95% CI = 1.061-2.188, but not in patients with favourable IL28B genotype. Patients with chronic hepatitis C showed a high prevalence of vitamin D insufficiency (25[OH]D(3<20 ng/mL during all seasons, but 25(OHD(3 serum levels were not associated with treatment outcome. CONCLUSIONS/SIGNIFICANCE: Our study suggests a role of bioactive vitamin D (1,25[OH](2D(3, calcitriol in the response to treatment of chronic hepatitis C. However, serum concentration of the calcitriol precursor 25(OHD(3 is not a suitable predictor of treatment outcome.

  10. Ca(OH2 action on TNF-alpha and NO release in macrophage culture stimulated by Pseudomonas aeruginosa LPS = Ação do Ca(OH2 sobre a produção de TNF-alfa e NO de cultura de macrófagos estimulada por LPS de Pseudomonas aeruginosa

    Directory of Open Access Journals (Sweden)

    Queiroz, Celso Emanoel de Souza


    Full Text Available Objetivo: A ação do hidróxido de cálcio [Ca(OH2] com o sistema imune e o mecanismo de neutralização das bactérias e seus subprodutos ainda não foi completamente esclarecida. Neste estudo foi avaliada a capacidade do Ca(OH2 em neutralizar o lipopolissacarídeo (LPS de Pseudomonas aeruginosa, utilizando-se duas metodologias: liberação de Óxido Nítrico (NO e Fator de Necrose Tumoral Alfa (TNF-alfa em cultura de macrófagos peritoneais de camundongos. Metodologia: No ensaio do NO, as células peritoneais foram expostas a uma solução de LPS (25mg/mL e 50mg/mL; e à suspensão de LPS/Ca(OH2 em duas concentrações (50mg/ 25mg e 25mg/25mg. Após 8 horas de incubação, foi utilizado reagente de Griess, e a liberação de NO foi quantificada. No ensaio do TNF-alfa, a solução de LPS foi usada na concentração de 25mg/mL e o LPS/Ca(OH2 a 25mg/25mg. Após 24 horas, as células foram fixadas e coradas com cristal violeta, e os valores de absorbância foram obtidos. Os resultados foram expressos em micromols. Todos os testes foram realizados em triplicata. Resultados: A presença de Ca(OH2 nas duas concentrações avaliadas reduziu significativamente a liberação de NO e TNF-alfa. Conclusão: Pode-se concluir que o LPS bacteriano representa um forte estímulo para liberação destas citocinas, mas o hidróxido de cálcio foi capaz de neutralizar este efeito

  11. Relación de la enzima alfa-amilasa salivar con la presencia de sintomatología psicopatologica internalizada auto- y hetero-observada en una muestra de niños y niñas de entre 7 y 12 años de edad: un estudio piloto.


    Maldonado Montero, Enrique F.; Engüix Armada, Alfredo; Martínez-Escribano, Ana


    Introducción: La medición de la actividad enzimática (AAAs) y del flujo de secreción (FSAAs) de la enzima alfa-amilasa salivar han sido propuestos por diversos grupos de investigación como posibles marcadores biológicos indirectos, no invasivos, y de bajo coste, del nivel de actividad noradrenérgica periférica/central. Dicha actividad noradrenérgica se sustenta, esencialmente, gracias a la actividad preponderante del denominado Sistema Locus Coeruleus-Noradrenalina (LC-NA), un sistema básico ...

  12. Deoxyiminoalditols from Aldonic Acids - VI. - Preparation of the Four Stereoisomeric 4-Amino-3-hydroxypyrrolidines from Bromodeoxytetronic Acids. Discovery of a New alfa-Mannosidase Inhibitor

    DEFF Research Database (Denmark)

    Lundt, Inge; Limberg, Gerrit; Zavilla, John


    A convenient four step synthesis of amino hydroxy pyrrolidines is presented. From the readily available D- and L-tetronic acids the four possible stereoisomeric 4-amino-3-hydroxy pyrrolidines 14, 15, 17 and 19 could be accessed as crystalline compounds, avoiding any chromatographic purification....... The key step in the reactions was the regioselective formation of either the 2,4-diamino-2,4-dideoxy-D-threono-1,4-lactam (5) or the 3,4-diamino-3,4-dideoxy-L-erythrono-1,4-lactam (10) by treatment of the methyl 4-bromo-4-deoxy-2,3-cis- 3 or 2,3-trans- 9 epoxy tetronates, respectively, with liquid ammonia....... Thus, opposite regioselectivity for opening of the cis-configurated epoxide 3 (4 : 1, C-2 : C-3) and the trans-configurated epoxide 9 (3 : 7, C-2 : C-3) by ammonia was observed. - Initial testing as glycosidase inhibitors of the amino hydroxy pyrrolidines formed by reduction of the lactams showed...

  13. Double blind randomized clinical trial controlled by placebo with an alpha linoleic acid and prebiotic enriched cookie on risk cardiovascular factor in obese patients Ensayo clínico aletorizado doble ciego controlado con placebo con una galleta enriquecida en ácido alfa linoleico y prebióticos en el patrón de riesgo cardiovascular de pacientes obesos

    Directory of Open Access Journals (Sweden)

    D. A. de Luis


    Full Text Available Introduction: Inulin and FOS are prebiotics with potential benefit in cardiovascular risk factors. Alpha linolenic acid (ALA is the metabolic precursor of the long chain n-3 fatty acid eicosapentaenoic acid (20: 5n-3, this fatty acid has anti-inflammatory properties. The aim of our study was to evaluate the response of the cardiovascular risk profile in obese patients after inclusion in the diet of an ALA, FOS and inulin enriched-cookie. Material and methods: 36 patients were randomized in both branches: group I (inulin, FOS and ALA enriched cookie Gullon SL® and group II (control cookie. Previous and after 1 month of the treatment, a nutritional and biochemical study was realized. Results: 15 patients finished the procotol in each group. In group I, a significantly increase in soluble fiber (2.3 ± 0.8 g/day vs 7.7 ± 0.8 g/day: p Introducción: La inulina y los FOS son prebióticos con potenciales efectos beneficiosos a nivel cardiovascular. El acido alfa linolénico (ALA es el precursor del ácido eicosapentaenoico (20: 5n-3, presentando propiedades antinflamatorias. El objetivo de nuestro trabajo es evaluar la respuesta del perfil de riesgo cardiovascular en pacientes obesos tras la inclusión en la dieta de una galleta enriquecida en inulina, FOS y ALA. Material y métodos: Un total de 36 pacientes fueron randomizados a una de las siguientes ramas: galleta I (enriquecida con inulina, FOS y ALA y galleta II (galleta control (Gullón SL. Cada paciente recibió un total de 2 galletas al día (70 gramos de producto. Antes de iniciar el tratamiento y al mes, se realizó una valoración nutricional y analítica. Resultados: Finalizaron el protocolo un total de 15 pacientes en cada grupo. En el grupo I se produjo un aumento significativo en la ingesta de fibra soluble (2,3 ± 0,8 g/día vs 7,7 ± 0,8 g/día: p < 0,05 (inulina y FOS, así como ALA (0,6 ± 0,5 g/día vs 3,8 ± 0,5 g/día; p < 0,05. Se detectó en los pacientes varones que

  14. Polimorfismos genéticos para Alfa Actinina 3 e sua relaçao com dano muscular e capacidades funcionais em atletas de futebol


    Mendonça Pimenta, Eduardo


    193 p. La presente Tesis se compone de dos estudios independientes sobre comportamientos fisiológicos en atletas de fútbol con diferentes genotipos para el gene de la ACTN3. ESTUDIO 1 En este estudio investigamos el efecto de la ACTN3 o la ausencia de la ACTN3 en el desempeño físico de atletas de fútbol. Los autores evaluaron 200 atletas profesionales de fútbol en cuatro diferentes pruebas físicos que evalúan tanto a potência/força y resistencia. Fueron realizados dos variacione...

  15. Alfa-2-glicoproteína rica en leucina urinaria en pacientes con apendicitis aguda (Urinary leucine-rich alpha-2-glycoprotein in patients with acute appendicitis

    Directory of Open Access Journals (Sweden)

    Heberto Machado-Montero


    Full Text Available The objective of research was to determine diagnostic efficacy of urinary concentrations of leucine-rich alpha-2-glycoprotein (A2GRL in patients with acute appendicitis. There were included patients with high suspicion of acute appendicitis (group A; cases, n = 30. In group B (controls, n = 30 were included patients with non-surgical abdominal pain who attended to Hospital Central “Dr. Urquinaona”, Maracaibo, Zulia. General characteristics, urinary concentrations of A2GRL and diagnostic efficacy of assay were evaluated. Mean age of patients in group A was 36.3 +/- 8.8 years-old and in group B was 35.8 +/- 9.6 years-old (p = ns. There were not found significant differences in sex distribution, weight and height between groups (p = ns. Urinary concentrations of A2GRL were significantly higher in group A (1543.8 +/- 762.7 ng/mL compared with mean value in patients of group B (774.1 +/- 356.1 ng/mL; p < 0.0001. A2GRL presented a value below curve 0.81. A cut-off value of 1000 ng/mL, showed sensivity 73.3%, specificity 70.9%, positive predictive value 72.4% and negative predictive value 72.4%. It is concluded that urinary concentrations of A2GRL have a high diagnostic efficacy in patients with acute appendicitis

  16. Code Betal to calculation Alpha/Beta activities in environmental samples; Programa de ordenador Betal para el calculo de la actividad Beta/Alfa de muestras ambientales

    Energy Technology Data Exchange (ETDEWEB)

    Romero, L.; Travesi, A.


    A codes, BETAL, was developed, written in FORTRAN IV, to automatize calculations and presentations of the result of the total alpha-beta activities measurements in environmental samples. This code performs the necessary calculations for transformation the activities measured in total counts, to pCi/1., bearing in mind the efficiency of the detector used and the other necessary parameters. Further more, it appraise the standard deviation of the result, and calculus the Lower limit of detection for each measurement. This code is written in iterative way by screen-operator dialogue, and asking the necessary data to perform the calculation of the activity in each case by a screen label. The code could be executed through any screen and keyboard terminal, (whose computer accepts Fortran IV) with a printer connected to the said computer. (Author) 5 refs.

  17. Estudo de associação genética entre fator de necrose tumoral alfa e sepse e choque séptico em pacientes pediátricos tailandeses

    Directory of Open Access Journals (Sweden)

    Suwannee Phumeetham


    Full Text Available OBJETIVOS: Avaliar a associação entre o polimorfismo genético do fator de necrose tumoral alfa (TNF-α e o desenvolvimento de sepse e choque séptico em pacientes pediátricos tailandeses e investigar o impacto clínico de polimorfismos do TNF-α nessa população. MÉTODOS: Para a realização deste estudo de associação genética, foram analisados prospectivamente pacientes pediátricos (idade < 18 anos com sepse clínica/choque séptico. Todos os dados foram coletados por especialistas em terapia intensiva pediátrica e as análises genéticas foram realizadas em um laboratório central. Um polimorfismo de nucleotídeo único [single nucleotide polymorphism (SNP], localizado na região promotora 5' na posição -308, foi genotipado e os resultados foram associados a fenótipos clínicos. RESULTADOS: Foram investigados 167 indivíduos tailandeses, dos quais 66 eram pacientes pediátricos com sepse/choque séptico e 101 eram controles saudáveis. Curiosamente, não foi possível identificar associação entre sepse e o polimorfismo -308 (G→A, um dos principais SNPs anteriormente associado à sepse em várias populações caucasianas, visto que não houve diferença de frequência entre casos e controles. CONCLUSÕES: Neste estudo, o principal polimorfismo do TNF-α -308 não esteve associado à sepse clínica/choque séptico na população tailandesa. Essa informação é importante para futuras análises que busquem identificar a função do TNF-α como risco genético para o desenvolvimento de imunopatologia subjacente a várias doenças no continente asiático.

  18. Extrahepatic manifestations of chronic hepatitis C and their influence on response to treatment with Pegylated interferon alfa-2a and ribavirin

    Directory of Open Access Journals (Sweden)

    Fabri Milotka


    Full Text Available Introduction. Thirty to 50% of patients with chronic hepatitis C (CHC have one or more extrahepatic manifestations (EHMs of hepatitis C virus (HCV infection. Objective. The aim of this study was to evaluate the frequency of EHMs and to investigate the efficacy of pegylated interferon (Peg­IFN­α­2a plus ribavirin therapy in patients with HCV­related EHMs. Methods. The study included 280 patients suffering from CHC and treated with Peg­IFN­α­2a and ribavirin. The patients were divided in two groups according to presence or absence of EHMs. We evaluated virological response to antiviral therapy. Results. One or more EHMs were found among 27.9% of patients. Most frequently they had rheumatoid factor in serum (12.5%, organ­nonspecific antibodies ANA and AGMA (12.4%, thyroid hormone disorders (9.3%, vasculitis (5.7%, diabetes mellitus (4.65%, glomerulonephritis (0.71%, and porphyria cutanea tarda (0.36%. Among the patients with EHMs there was 52.6% of females vs. 30.2% of females in the group of patients without EHMs (p=0.001. HCV genotypes 1 and 4 had 85.9% patients with EHMs vs. 58.4% of patients without EHMs (p=0.000. Progressive fibrosis and cirrhosis were more frequently recorded in the EHM group of patients (32% vs. 23.2%, but without statistically significant difference (p=0.532. Serious adverse events of Peg­IFN­α­2a and ribavirin were statistically significantly recorded among the patients with EHMs (46.1% vs. 12.9%; p=0.000. Sustained virological response among the patients with and without EHMs rated 56.9% and 70.8% respectively (p=0.125. Conclusion. Patients with CHC and EHMs treated with combined Peg­IFN­α­2a and ribavirin experience handling difficulties, more often have serious adverse events, while successful outcome is achieved in about 50% of patients.

  19. Alternative method of smearing samples on slides facilitate visualization of hemoglobin H inclusion bodies in alpha thalassemia Método alternativo de dispersão das amostras no esfregaço facilita a visualização dos corpos de inclusão de hemoglobina H na talassemia alfa

    Directory of Open Access Journals (Sweden)

    Carlos F. Mendiburu


    Full Text Available Nas talassemias alfa, a HbH pode ser detectada, nos eritrócitos do sangue periférico como inclusões celulares quando coradas com azul crezil brillante. Este teste simples é útil para o diagnóstico de talassemia alfa, no entanto, a identificação dos corpos de inclusão de HbH é um processo laborioso e os resultados são altamente dependentes do observador. No intuito de melhorar a identificação das inclusões, foi testado um método alternativo para espalhar as amostras nas lâminas. Amostras de sangue foram espalhadas nas lâminas usando-se o método clássico e o método alternativo. O método alternativo permitiu uma melhor identificação das inclusões de HbH do que o método clássico. Nossos resultados mostraram que o método alternativo é uma opção útil para a pesquisa dos corpúsculos de inclusão de HbH naquelas amostras onde o método clássico não o permite.

  20. Polineuropatia desmielinizante inflamatória crônica pós-tratamento com interferon peguilado alfa 2b em um paciente co-infectado HIV/HCV: relato de caso Chronic inflammatory demyelinating polyneuropathy after treatment with pegylated interferon alpha 2b in a patient with HIV/HCV coinfection: case report

    Directory of Open Access Journals (Sweden)

    Bil Randerson Bassetti


    Full Text Available A polineuropatia desmielinizante inflamatória cônica possui forte associação com a infecção pelo HIV e HCV. Uma rara associação entre PDIC e o tratamento da hepatite C com interferon peguilado alfa foi descrita recentemente. Nós descrevemos o primeiro caso de polineuropatia desmielinizante inflamatória crônica em um paciente branco, sexo masculino infectado por HIV e HCV associado a interferon peguilado alfa 2b. O paciente recuperou-se completamente após o uso de imunoglobulina hiperimune endovenosa. Infectologistas e hapatologistas devem estar atentos à esta rara e grave associação, que exige imediata descontinuação da droga e tratamento precoce.Chronic inflammatory demyelinating polyneuropathy has a strong association with HIV and HCV infection. A rare association between chronic inflammatory demyelinating polyneuropathy and hepatitis C treatment with pegylated interferon alpha was described recently. We described the first case of chronic inflammatory demyelinating polyneuropathy associated with pegylated interferon alpha 2b in a white man infected with HIV and HCV. The patient recovered completely with the use of intravenous hyperimmune immunoglobulin. Infectologists and hepatologists should be alert regarding this rare and serious association, which requires immediately drug discontinuation and early treatment.

  1. A non-michaelian behavior of the in vitro metabolism of the pentacyclic triterpene alfa and beta amyrins by employing rat liver microsomes. (United States)

    Moreira, Fernanda de Lima; de Souza, Gustavo Henrique Bianco; Rodrigues, Ivanildes Vasconcelos; Lopes, Norberto Peporine; de Oliveira, Anderson Rodrigo Moraes


    Pharmacological studies employing alpha and beta amyrin have demonstrated potential application in several biological activities suggesting their application as promising drugs. In the early drug development, metabolism studies may give important parameters regarding the efficacy and safety of the drug candidate. Therefore, the aim of this work was to determine the enzymatic kinetic parameters of these pentacyclic triterpenes. Chromatographic analyzes were performed using a Shimadzu GC-MS system. The resolution of amyrins was achieved with a DB5-MS column of 0.25 μM film thickness, 30.0 cm length and 0.25 mm diameter. At this condition, the retention times of beta- and alpha-amyrin were 21.3 and 20.2 min, respectively. The proposed method showed to be linear over the concentration range of 0.16-42.18 μM for beta amyrin and 0.11-28.12 μM for alpha amyrin. The lowest concentration quantified by the validated method was 0.16 μM for beta and 0.11 μM for alpha amyrin. The stability study showed that amyrins were stable at room temperature for 12h and at 37°C for 1h. The absolute recovery of the amyrin isomers from the rat microsome was 54.3-59.2%. The enzymatic kinetics presented sigmoidal plots. It was observed a Vmax=0.698 ± 0.022 μmol/mg protein/min, S50=4.4 μM and Hill coefficient of 2.7 ± 0.17 for alpha amyrin and a Vmax=0.775 ± 0.034 μmol/mg protein/min, S50=7.0 μM and Hill coefficient of 2.5 ± 0.21 for beta amyrin. The obtained results give the first clues regarding amyrin metabolism and suggests a more detailed study conducted employing isolated CYP isoforms.

  2. Masculinização de larvas de tilápia do Nilo (Oreochromis niloticus L. a partir de banhos de imersão com 17alfa-metiltestosterona Masculinization of larvae of Nile tilapia (Oreochromis niloticus L. by immersion baths with alpha-methyltestosterone

    Directory of Open Access Journals (Sweden)

    Robie Allan Bombardelli


    Full Text Available Determinaram-se os períodos ontogênicos de maior sensibilidade das larvas de tilápias do Nilo (Oreochromis niloticus à masculinização, com 17 alfa-metiltestosterona (MT, a partir de banhos de imersão, contendo 2,0 mg MT.L-1, por 36 horas, em um experimento realizado em duas fases - a primeira com tratamentos hormonais e a segunda na fase de alevinagem. Foram utilizadas 1.200 larvas provenientes de um mesmo lote de reprodutores e distribuídas em 24 recipientes plásticos (0,5 L, em delineamento experimental inteiramente casualizado, composto por seis tratamentos hormonais e quatro repetições. Considerou-se, como unidade experimental, um recipiente plástico contendo 0,5 L de solução hormonal e 50 larvas. Os tratamentos constituíram-se na imersão das larvas em diferentes fases de desenvolvimento ontogênico, correspondentes a 133,7 UTAs (dias - grau ou 5 DPE (dias após a eclosão; 188,2 UTAs ou 7 DPE; 242,3 UTAs ou 9 DPE; 296,8 UTAs ou 11 DPE; 352,6 UTAs ou 13 DPE; e 408,2 UTAs ou 15 DPE. Após os tratamentos, as larvas foram cultivadas até atingirem o comprimento padrão mínimo de 25 mm. Os resultados de masculinização evidenciaram a existência de um período de maior sensibilidade aos 15 DPE ou 408,2 UTAs, com 85,19% de machos. Observou-se relação linear positiva entre o período ontogênico e as taxas de masculinização. As médias de comprimento total e peso final, fator de condição e sobrevivência não diferiram entre os tratamentos.An experiment was carried out to in two steps (the first was hormonal treatments and the other the larvae grow up phase to determine the best ontogenic periods for larvae of the Nile tilapia (Oreochromis niloticus regarding masculinization hormonal treatments with 17 alpha-methyltestosterone (MT by immersion baths in 2.0 mg MT.L-1 solution for 36 hours. One thousand and two hundred larvae of Nile tilapia, from the same reproduction bunch, were allotted to 24 plastic containers with 0.5 L

  3. Alfa Romeo MiTo GTA

    Institute of Scientific and Technical Information of China (English)



  4. Peginterferon Alfa-2b Injection (Sylatron) (United States)

    ... the arms, hands, legs, or feet cough rash hair loss Some side effects can be serious. If ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...

  5. Peginterferon Alfa-2b (PEG-Intron) (United States)

    ... diarrhea constipation heartburn weight loss headache dizziness confusion hair loss or thinning itching difficulty concentrating feeling cold ... to your pharmacist or contact your local garbage/recycling department to learn about take-back programs in ...

  6. Dagslyset som arkitekturens alfa og omega

    DEFF Research Database (Denmark)

    Madsen, Merete


    Artiklen pointerer vigtigheden af, at arkitekter, belysningsrådgivere og ingeniører arbejder sammen om planlægningen af god og hensigtsmæssig dagslysudnyttelse fra et meget tidligt tidspunkt i projektfasen, fordi de tidligste beslutninger om bebyggelsesplan, facadeudformning og rumlig disponering...

  7. The ALFA Roman Pot Detectors of ATLAS

    CERN Document Server

    Abdel Khalek, S.


    The ATLAS Roman Pot system is designed to determine the total proton-proton cross-section as well as the luminosity at the Large Hadron Collider (LHC) by measuring elastic proton scattering at very small angles. The system is made of four Roman Pot stations, located in the LHC tunnel in a distance of about 240~m at both sides of the ATLAS interaction point. Each station is equipped with tracking detectors, inserted in Roman Pots which approach the LHC beams vertically. The tracking detectors consist of multi-layer scintillating fibre structures readout by Multi-Anode-Photo-Multipliers.

  8. Biomarcadores del estado inflamatorio: nexo de unión con la obesidad y complicaciones asociadas Inflammatory biomarkers: the link between obesity and associated pathologies

    Directory of Open Access Journals (Sweden)

    M.ª A. Zulet


    Full Text Available El objetivo de este trabajo ha consistido en realizar una revisión de los biomarcadores que actualmente se proponen como el nexo de unión entre la inflamación, la obesidad y complicaciones asociadas, seleccionando los estudios llevados a cabo y las cuestiones pendientes. Cada vez hay mayor evidencia científica de que la inflamación puede jugar un papel importante en la etiología de diversas enfermedades crónicas de gran relevancia para la salud pública. En los últimos años, distintos estudios han sugerido que la obesidad podría ser un desorden inflamatorio. Asimismo, el estrés oxidativo se ha propuesto como un potencial inductor de la inflamación y de la susceptibilidad a la obesidad y patología asociadas. Entre los biomarcadores relacionados con la obesidad, la resistencia insulínica, las enfermedades cardiovasculares y el síndrome metabólico se encuentran: el factor de necrosis tumoral alfa, interleuquinas 6 y 18, angiotensinógeno, factor de crecimiento TGF-beta, inhibidor de la activación del plasminógeno, leptina, resistina, proteína C reactiva, amiloide A, ácido siálico, marcadores de disfunción endotelial (factor von Willebrand, ICAMs, vCAMs factor 3 del sistema del complemento, haptoglobina, glicoproteína zinc-alfa2, eotaxina, visfatina, apelina, alfa1-antitripsina, vaspina, omentina, proteína transportadora de retinol 4, ceruloplasmina, adiponectina y desnutrina. Algunos de estos biomarcadores son buenos predictores de riesgo cardiovascular (inhibidor de la activación de plasminógeno 1, angiotensinógeno, fibrinógeno, ácido siálico, factor 3 del complemento y proteína C reactiva, adiposidad (leptina, visfatina, resistina, haptoglobina y/o resistencia insulínica (ácido siálico, proteína C reactiva, inhibidor de la activación de plasminógeno 1, factor von Willebrand. Sin embargo, todavía queda por dilucidar el papel de muchos de ellos en la etiología de la obesidad y comorbilidades asociadas en

  9. [Aicardi-Goutieres syndrome due to mutation of the IFIH1 gene with pontine involvement. A case report]. (United States)

    Florido-Rodriguez, A; Eiris-Punal, J; Barros-Angueira, F; Toledo-Bravo de Laguna, L; Santana-Artiles, A; Sebastian-Garcia, I; Santana-Rodriguez, A; Cabrera-Lopez, J C


    Introduccion. El sindrome de Aicardi-Goutieres es una rara encefalopatia subaguda progresiva de inicio precoz –generalmente en el primer año de vida– caracterizada por retraso psicomotor, microcefalia, alteraciones en la sustancia blanca cerebral, calcificaciones intracraneales, pleocitosis y niveles elevados de interferon alfa en el liquido cefalorraquideo. Asocia un incremento en la expresion de los genes estimulados por interferon en la sangre periferica, hecho conocido como interferon signature. Los niveles de genes estimulados por interferon se han postulado como un buen biomarcador, pues se mantienen elevados en la sangre periferica en el tiempo y son mas sensibles, en comparacion con las determinaciones de interferon alfa y neopterinas en el liquido cefalorraquideo, las cuales descienden a partir del año de vida. Hasta la fecha se han descrito mutaciones en siete genes que sobreestimulan la via del interferon alfa, y el ultimo en descubrirse ha sido el IFIH1 (interferon induced with helicase C domain 1), con un patron de herencia autosomico dominante. Caso clinico. Se presenta el primer caso descrito en la bibliografia hispana debido a mutacion de novo en el gen IFIH1. Se expone el cuadro clinico, los estudios realizados y la revision de los aspectos clinicos, neurorradiologicos y geneticos. Conclusiones. La herencia de las mutaciones descritas para el sindrome de Aicardi-Goutieres era clasicamente autosomica recesiva, pero estos hallazgos muestran que mutaciones autosomicas dominantes en el gen IFIH1 pueden causar la enfermedad. Como hallazgo de neuroimagen no descrito previamente, presenta una lesion de encefalomalacia quistica en la protuberancia.

  10. Expressão local do fator de necrose tumoral alfa na ruptura prematura de membranas Local expression of tumor necrosis factor-alpha on premature rupture of membranes

    Directory of Open Access Journals (Sweden)

    Valquíria Roveran


    Full Text Available OBJETIVO: comparar a expressão do fator de necrose tumoral alfa (TNF-α em membranas ovulares com ruptura prematura (RPM e com ruptura oportuna das mesmas; verificar a associação entre a expressão do TNF-α em membranas ovulares e o grau de corioamnionite das mesmas e correlacionar a expressão do TNF-α e o tempo de ruptura das membranas. MÉTODOS: foram analisadas as membranas ovulares de 31 parturientes com RPM, com idade gestacional acima de 34 semanas, e de 14 parturientes com ruptura oportuna das membranas, com idade gestacional igual ou maior de 37 semanas. A detecção da corioamnionite foi feita por meio de estudo histopatológico. A avaliação da expressão do TNF-α foi feita por meio de técnica imunoistoquímica, na qual foi empregado o método streptavidina-biotina-peroxidase (LSAB. RESULTADOS: o tempo médio de ruptura foi de 16,6 horas. A frequência da expressão de TNF-α, nos Grupos Controle e Estudo, não mostrou diferença significante (χ2=6,6; p=0,08. No Grupo Estudo, houve correlação entre o grau de corioamnionite e a intensidade da expressão de TNF-α (coeficiente de Spearman (Rs=0,4; p=0,02. CONCLUSÕES: não houve diferença significante entre as expressões do TNF-α em membranas ovulares com ruptura prematura e com ruptura oportuna das mesmas; no Grupo Estudo, constatou-se associação significante entre a expressão do TNF-α e o grau de corioamnionite e não houve associação entre o tempo de ruptura e a intensidade da expressão do TNF-α.PURPOSE: to compare the expression of tumor necrosis factor-alpha (TNF-α in ovular membranes with premature rupture (MPR and with opportune rupture; to verify the association between the expression of the TNF-α in ovular membranes and the degree of chorioamnionitis, correlating the expression of the TNF-α and the membranes' time of rupture. METHODS: ovular membranes from 31 parturients with MPR, with gestational ages over 34 weeks, and from parturients with opportune


    Directory of Open Access Journals (Sweden)

    Adriana Z. MERCADANTE


    Full Text Available Numerosos trabalhos comprovaram que os carotenóides principais de folhas verdes são invariavelmente luteína, beta-caroteno, violaxantina e neoxantina. No entanto, há discordância em torno dos carotenóides minoritários. Portanto, a espectrometria de massas por impacto de elétrons e cromatografia líquida de alta eficiência com detector de arranjo de diodos foram utilizados para confirmar a identidade de carotenóides minoritários com atividade provitamínica A em verduras folhosas brasileiras. Os carotenóides pró-vitamínicos A, incluindo os isômeros cis e trans de beta-caroteno, foram separados em coluna de C18 polimérica, Vydac 201TP54, com metanol/água (98:2 como fase móvel. Os espectros UV-visível e de massas confirmaram o carotenóide monoidroxilado como sendo alfa-criptoxantina e não beta-criptoxantina como aponta a literatura internacional. Todas as onze folhas analisadas (agrião, alface crespa, alface lisa, almeirão, caruru, chicória, couve, espinafre, rúcula, salsinha e taioba apresentaram alfa-criptoxantina, 13-cis-beta-caroteno e 9-cis-beta-caroteno, enquanto que alfa-caroteno foi encontrado em apenas quatro folhas (caruru, couve, salsinha e taioba.The main carotenoids from green leafy vegetables have been consistently found to be lutein, beta-carotene, violaxanthin and neoxanthin. However, there is a controversy about the identity of minor carotenoids. Therefore, electron impact mass spectrometry and high performance liquid chromatography with a diode array detector were used in order to confirm the identity of the minor provitamin A carotenoids in Brazilian green leaves. The provitamin A carotenoids, including the cis and trans isomers of beta-carotene, were separated on a polymeric C18 column, Vydac 201TP54, with MeOH/H2O (98:2 as mobile phase. The UV-visible and mass spectra confirmed that the monohydroxy carotenoid present in Brazilian green leafy vegetable to be alpha-cryptoxanthin, and not beta

  12. Mutants of common bean alpha-amylase inhibitor-2 as an approach to investigate binding specificity to alpha-amylases Mutantes do inibidor-2 de alfa-amilase do feijão-comum para investigação da especificidade de ligação a alfa-amilases

    Directory of Open Access Journals (Sweden)

    Maria Cristina Mattar da Silva


    Full Text Available Despite the presence of a family of defense proteins, Phaseolus vulgaris can be attacked by bruchid insects resulting in serious damage to stored grains. The two distinct active forms of a-amylase inhibitors, a-AI1 and a-AI2, in P. vulgaris show different specificity toward a-amylases. Zabrotes subfasciatus a-amylase is inhibited by a-AI2 but not by a-AI1. In contrast, porcine a-amylase is inhibited by a-AI1 but not by a-AI2. The objective of this work was to understand the molecular basis of the specificity of two inhibitors in P. vulgaris (a-AI1 and a-AI2 in relation to a-amylases. Mutants of a-AI2 were made and expressed in tobacco plants. The results showed that all the a-AI2 mutant inhibitors lost their activity against the insect a-amylases but none exhibited activity toward the mammalian a-amylase. The replacement of His33 of a-AI2 with the a-AI1-like sequence Ser-Tyr-Asn abolished inhibition of Z. subfasciatus a-amylase. From structural modeling, the conclusion is that the size and complexity of the amylase-inhibitor interface explain why mutation of the N-terminal loop and resultant abolition of Z. subfasciatus a-amylase inhibition are not accompanied by gain of inhibitory activity against porcine a-amylase.Apesar de possuir uma família de proteínas de defesa, o feijão-comum (Phaseolus vulgaris L. pode ser atacado por insetos bruquídeos causando sérios danos aos grãos armazenados. O P. vulgaris possui duas formas ativas de inibidores de a-amilases, denominadas a-AI1 e a-AI2, que apresentam diferentes especificidades em relação às a-amilases. A a-amilase de Zabrotes subfasciatus é inibida por a-AI2 mas não por a-AI1. Em contraste, a a-amilase pancreática de porco é inibida por a-AI1 mas não é por a-AI2. O objetivo deste trabalho foi entender as bases moleculares da especificidade desses inibidores em relação às a-amilases. Para tanto, foram construídos mutantes do a-AI2, os quais foram expressados em plantas de fumo

  13. Avaliação do desempenho organizacional da empresa familiar Indústrias Alfa S.A.* com base no modelo de gestão estratégica balanced scorecard Organizational performance of a family business evaluated by the strategic performance balanced scorecard

    Directory of Open Access Journals (Sweden)

    Christine Schneider


    Full Text Available O balanced scorecard é um moderno modelo estratégico de desempenho organizacional que visa traduzir a missão, visão e estratégia em objetivos e medidas, organizados sob a ótica financeira, dos clientes, dos processos internos, do aprendizado e do crescimento. O modelo disponibiliza estrutura e linguagem para comunicar a estratégia da empresa e o alcance das metas no longo prazo. A Indústrias Alfa S.A. é uma empresa familiar de segunda geração, que tem por visão estratégica "Ser a escolha preferencial de soluções hidráulicas da América Latina nos setores residencial, industrial, agrícola e predial", orientada pelo macroobjetivo de oferecer soluções e serviços em motobombas hidráulicas de modo a satisfazer as necessidades dos clientes. Partindo desses princípios, o artigo avalia o desempenho organizacional da empresa familiar Indústrias Alfa S.A. no primeiro quadrimestre do ano de 2005, com base no modelo de controle estratégico balanced scorecard.The balanced scorecard is a modern strategic model of organizational performance that seeks to translate the company mission, vision and strategy into objectives and measures organized to focus on - finance, customers, internal procedures, learning and growth. This model provides structure and language to communicate business strategy and directs efforts, abilities and specific knowledge to achieve long term objectives. The strategic vision of this second generation family business is "to be the answer for hydraulic pump needs in the Latin American residential, industrial, agricultural and building management markets" oriented by an overall objective of offering solutions and services to satisfy customer needs. Based upon these considerations, performance of this family business was evaluated during the first four months of 2005 using the strategic performance balanced scorecard.

  14. Perfil bioquímico do soro de frangos de corte alimentados com dieta suplementada com alfa-amilase de Cryptococcus flavus e Aspergillus niger HM2003 Biochemichal serum profile of broilers fed diets suplemented with alfa-amylase from Cryptococcus flavus and Aspergillus niger HM2003

    Directory of Open Access Journals (Sweden)

    Cibele Silva Minafra


    Full Text Available Avaliou-se o perfil bioquímico do soro de frangos de corte alimentados com a enzima α-amilase produzida por dois microrganismos. Produziram-se dois extratos, um com a-amilase obtida a partir de Cryptococcus flavus em meio de levedura comercial e outro com Aspergillus niger HM2003 em meio de proteína de soja e amido comercial, com atividade de 9,58 U/mL e 10,0 U/mL, respectivamente. Utilizaram-se 360 pintos de corte Cobb 500 de 1 dia de idade e com 49,72 ± 0,68 g de peso vivo inicial. As aves foram alojadas em baterias e foram criadas até os 21 dias de idade. Foram utilizados três dietas, cada uma com cinco repetições de 12 aves, em delineamento inteiramente casualizado. A primeira dieta (basal foi formulada sem adição de enzima e as outras duas receberam a suplementação de a-amilase produzida por cultivo de Cryptococcus flavus e Aspergillus niger HM2003. Dietas à base de milho e soja foram formuladas em duas fases: pré-inicial (1-7 dias e inicial (8-21 dias. Na fase pré-inicial, foram observados os seguintes valores médios para cálcio (6,90 e 5,99 mg/dL, proteína plasmática (2,0 e 2,50 g/dL e fosfatase alcalina (979,98 e 974,66 UI/L, respectivamente para Cryptococcus flavus e Aspergillus niger HM2003. A dieta acrescida de a-amilase obtida a partir de Aspergillus niger HM2003 determinou maior concentração sérica de fósforo. Na fase inicial, os resultados significativos relacionaram-se a potássio quando avaliadas dietas com adição de a-amilase pelas duas fontes. A incorporação das enzimas testadas não proporciona alterações metabólicas ou toxicidade nos animais.It was evaluated the biochemical serum profile of broilers fed rations supplemented with α-amylase produced by two microorganisms. Two extracts were produced, one was produced with a-amylase obtained from Cryptococcus flavus in a commercial yeast-based medium and the other with Aspergillus niger HM2003 produced in soybean protein and commercial starch medium

  15. The frequency of β-globin gene haplotypes, α-thalassemia and genetic polymorphisms of methylenetetrahydrofolate reductase, factor V Leiden and prothrombin genes in children with sickle cell disease in Rio de Janeiro, Brazil Frequência dos haplótipos da globina beta, da talassemia alfa e dos polimorfismos genéticos dos genes da metilenotetrahidrofolato redutase, do fator V Leiden e da protrombina em crianças com doença falciforme no Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Isaac L. Silva Filho


    Full Text Available A freqüência dos haplótipos beta S e beta C do gene da globina e a prevalência de talassemia alfa e de mutações nos genes da metilenotetrahidrofolato redutase (MTHFR-C677T, do fator V de Leiden e da protrombina (G20210A foi estudada em crianças com doença falciforme do Rio de Janeiro. O haplótipo Bantu foi o mais freqüente (65,9%, 21,2% das crianças (18% heterozigotas e 3% homozigotas apresentam talassemia com mutação alfa 3.7kb, ao contrário da mutação alfa 4.2kb que não foi encontrada. Os alelos 677CT e 677TT da MTHFR foram observados em 20,2% e 4,8%, respectivamente. Os haplótipos Camarões, Árabe-Indiano e Senegal não foram detectados na amostra estudada, bem como mutações no gene do fator V de Leiden e da protrombina. Somente o haplótipo beta C CI foi observado. Esse é o primeiro estudo realizado em uma amostra proveniente do Programa de Triagem Neonatal para Hemoglobinopatias do estado do Rio de Janeiro. Apesar do Rio de Janeiro ser a segunda maior cidade brasileira e seus habitantes expressarem o elevado grau de miscigenação ocorrida no país, nossos resultados ainda coincidem com os registros históricos dos fluxos migratórios do gene beta S para o Brasil, bem como refletem a forte influência de indivíduos de origem africana na população do Rio de Janeiro.

  16. Eficacia del 6-cloro-2-metiltio-5-(1-naftiloxi) bencimidazol contra Fasciola hepatica de cuatro y diez semanas de edad en bovinos de México


    Yolanda Vera Montenegro; Froylán Ibarra Velarde; Héctor Quiroz Romero; Ángel Ríos Utrera; Alicia Hernández Campos


    El objetivo del presente estudio fue evaluar la eficacia fasciolicida del 6-cloro-2- metiltio-5-(1-naftiloxi) bencimidazol denominado compuesto “alfa” contra fasciolas de cuatro y 10 semanas de edad en bovinos. Se utilizaron 15 novillos libres de infección por F. Hepatica que se infectaron por vía oral con 300 metacercarias, administradas 150 en el día 0 y 150 en el día 45, respectivamente. A todos los bovinos se les tomaron muestras de heces con el propósito de corroborar la presencia del pa...

  17. Clinical profiles of circulating plasmacytoid dendritic cells in chronic hepatitis B patients in response to pegylated-interferon alfa-2a treatment%长效干扰素α-2a治疗慢性乙型肝炎过程中外周血浆样树突状细胞的变化及其与疗效的关系

    Institute of Scientific and Technical Information of China (English)

    贾妮娜; 林兰意; 郭斯敏; 赵钢德; 汤伟亮; 谢青


    Objective To investigate the changes in circulating plasmacytoid dendritic cells (pDCs) in patients with chronic hepatitis B (CHB) during the course of treatment with pegylated-intefferon alfa-2s (peg-IFNα-2a) and to determine the correlations with therapeutic response.Methods Forty-one patients with CHB who were receiving peg-IFNα-2a antiviral treatment for 48 weeks were enrolled in the study.Expression of the Toll-like receptor 9 (TLR9) on and frequency and functionality of the pDCs were analyzed at treatment weeks 0,2,12,24,36 and 48.Results All patients exhibited an initially rapid decrease in the numbers of circulating pDCs and showed CpG-induced endogenous IFNα production within the first 2 weeks of treatment.Subsequently,all responders displayed a continuous increase in pDC numbers as well as functionality,both of which peaked around week 12 of treatment; in addition,these treatment responses were accompanied by significantly increased levels of type 1 T helper cytokines (P < 0.05),which did not occur in the non-responders.Conclusion pDCs are involved in the initial therapeutic immune response stimulated by peg-IFNα-2a treatment.Recovery of blood pDC number and functionality may represent a predictor of favorable response to peg-IFNα-2a antiviral treatment in patients with CHB.%目的 观察长效干扰素(PEG-IFN α-2a)治疗慢性乙型肝炎过程中外周血浆样树突状细胞(pDC)亚群的变化及其与临床疗效的关系. 方法 41例慢性乙型肝炎患者接受PEG-IFN α-2a(180 μg)每周皮下注射一次,治疗48周;治疗过程中检测肝功能、血清HBV病毒学标志物和HBVDNA,在治疗前及治疗开始后2、12、24、36、48周分别检测外周血pDC数量和功能及Toll样受体(TLR)9的表达水平、血清肿瘤坏死因子(TNF)α及IFN γ水平.对数据进行成组设计t检验、非参数检验、重复测量资料的方差分析. 结果 应答组与无应答组比较,TLR9平均荧光强度、pDC数量及INF

  18. Comparação entre a relação PCR/albumina e o índice prognóstico inflamatório nutricional (IPIN Comparison of PCR/albumin ratio with prognostic inflammatory nutritional index (PINI

    Directory of Open Access Journals (Sweden)

    Camila Renata Corrêa


    Full Text Available Objetivo: Simplificar o cálculo do índice prognóstico inflamatório nutricional (IPIN empregando número menor de variáveis com conseqüente redução do custo da análise. Materiais e métodos: Foram estudados 54 pacientes e 12 indivíduos-controle com 48 ± 20 (média ± dp anos de idade. As principais patologias dos pacientes eram: doença arterial periférica (22, pênfigo foliáceo (7, doença inflamatória intestinal (7, trauma (6 e pós-operatório de ortognatia (3. Foram obtidas amostras de sangue periférico, colhidas em jejum para dosagens de proteínas positivas (+ e negativas (- de fase aguda (PFA pelo método nefelométrico. Proteína C reativa (PCR, alfa-1-glicoproteína-ácida (alfa-1-GA, alfa-1-antitripsina (alfa-1-AT e ceruloplasmina (CER foram as PFA+ e albumina (Alb, transtiretina (TTR, transferrina (TF e proteína ligadora do retinol (RBP foram as representantes das PFA-. Esses valores foram analisados quanto à associação de correlação isolada ou associadamente na fórmula do índice prognóstico inflamatório e nutricional (IPIN = PCR + alfa-1-GA / Alb + TTR. De acordo com o índice prognóstico inflamatório e nutricional, os pacientes foram classificados em grupo-controle (G1; pacientes sem infecção/inflamação (IPIN 1, G3. Em seguida os pacientes do G3 foram subdivididos em baixo risco (G3A, n = 16; médio risco ( G3B, n = 10; alto risco (G3C, n = 6 e com risco de morte (G3D, n = 11. Os resultados foram correlacionados entre si (teste de Spearman ou submetidos às comparações entre grupos (teste de Kruskall-Wallis. Resultados: Houve relação significativa entre as variáveis PCR ´ alfa-1-GA (r = 0,49, Alb ´ TTR (r = 0,60, Alb ´ RBP (r = 0,58, Alb ´ TF (r = 0,39, TTR ´ RBP (r = 0,56 e TTR´ TF (r = 0,43 e as melhores relações encontradas entre PFA+ e PFA- foram: PCR ´ Alb (r = - 0,71, PCR ´ TTR (r = - 0,54, PCR ´ TF (r = - 0,39 e alfa-1-GA ´ Alb (r = - 0,35. Os valores do IPIN mostraram a

  19. Clinical Effect of Poractant Alfa Injection on Severe Meconium Aspiration Pneumonia in Newborns%猪肺磷脂注射液治疗新生儿重症胎粪吸入性肺炎的临床疗效观察

    Institute of Scientific and Technical Information of China (English)



    Objective To observe the clinical effect of poractant alfa injection on severe meconium aspiration pneumonia in newborns. Methods From January 2012 to June 2014,a total of 60 newborns with severe meconium aspiration pneumonia were selected in the Department of Pediatrics,the First Affiliated Hospital of Nanhua University,and they were randomly divided into control group and observation group,each of 30 cases. Newborns of control group were given conventional therapy,while newborns of observation group were given poractant alfa injection based on conventional therapy. PaO2,PaO2/FiO2 before treatment and 2 -,12 -,24 -hour after treatment were compared between the two groups,and ventilator using time,oxygen inhalation time and hospital stays were recorded. Results No statistically significant differences of PaO2 or PaO2/FiO2 was found between the two groups before treatment ( P >0. 05 );while PaO2 and PaO2/FiO2 of observation group were higher than those of control group 2 -,12 -,24 -hour after treatment,respectively(P 0.05);观察组患儿治疗后2 h、12 h、24 h PaO2、PaO2/FiO2均高于对照组(P<0.05)。观察组患儿使用呼吸机时间、吸氧时间及住院时间均短于对照组(P<0.05)。结论猪肺磷脂注射液治疗新生儿重症胎粪吸入性肺炎的临床疗效确切,能有效改善患儿氧合状态,缩短患儿使用呼吸机时间、吸氧时间及住院时间。

  20. Autoimmune hemolytic anemia in HCV/HIV coinfected patients during treatment with pegylated alpha-2a interferon plus ribavirin Anemia hemolítica auto-imune durante o tratamento da hepatite crônica com interferon peguilado alfa 2a e ribavirina, em pacientes com co-infecção HCV/HIV

    Directory of Open Access Journals (Sweden)

    Fernando Crivelenti Vilar


    Full Text Available Two cases of autoimmune hemolytic anemia that occurred during the treatment of chronic hepatitis C with pegylated alpha-2a interferon and ribavirin, in HIV coinfected patients, are presented and described. The late occurrence (after six months of therapy of this severe hemolytic anemia leads to the recommendation that hemoglobin levels should be monitored throughout the treatment period, even among patients who presented stable hemoglobin levels in the preceding months.São apresentados e discutidos dois casos de anemia hemolítica auto-imune que ocorreram durante o tratamento da hepatite crônica pelo vírus C, com interferon peguilado alfa 2a e ribavirina, em pacientes co-infectados pelo HIV. A ocorrência de anemia hemolítica grave em etapa tardia, após o sexto mês da terapêutica, recomenda que o controle dos níveis de hemoglobina deva ser feito durante todo o período do tratamento , mesmo nos pacientes que apresentam níveis estáveis de hemoglobina nos meses precedentes.

  1. Evaluation of total carotenoids, alpha- and beta-carotene in carrots (Daucus carota L. during home processing Avaliação de carotenóides totais, alfa e beta-caroteno em cenoura (Daucus carota L. durante processamento a nível doméstico

    Directory of Open Access Journals (Sweden)

    Helena Maria PINHEIRO-SANT’ANA


    Full Text Available This study aims to analyze the influence of dehydration and different preparation methods during home processing related toalpha-carotene, beta-carotene and total carotenoids stability in carrots. Vitamin A values were evaluated after different treatments. Thus, carrots were submitted to steam cooking, water cooking with and without pressure, moist/dry cooking and conventional dehydration. Determination of alpha- and beta-carotenes was made by High-Performance Liquid Chromatography (HPLC (conditions were developed by us using spectrophotometric detection visible-UV at 470 nm; a RP-18 column and methanol: acetonitrile: ethyl acetate (80: 10: 10 as mobile phase. Total carotenoids quantification was made by 449 nm spectrophotometer. The retention of the analyzed carotenoids ranged from 60.13 to 85.64%. Water cooking without pressure promoted higher retention levels of alpha- and beta-carotene and vitamin A values, while water cooking with pressure promoted higher retention levels of total carotenoids. Dehydration promoted the highest carotenoid losses. The results showed that, among the routinely utilized methods under domestic condition, cooking without pressure, if performed under controlled time and temperature, is the best method as it reduces losses in the amount of alpha- and beta-carotene, the main carotenoids present in the carrots. Despite the significant carotenoid losses, carrots prepared through domestic methods, remain a rich source of provitamin A.O presente estudo teve como objetivo analisar a influência da desidratação e de diferentes métodos de preparo a nível doméstico sobre a estabilidade de alfa-caroteno, beta-caroteno e carotenóides totais em cenouras. Os valores de vitamina A foram avaliados após os diferentes tratamentos. Para tanto, amostras de cenoura foram submetidas à cocção a vapor, cocção em água com e sem pressão, cocção úmida/seca e à desidratação convencional. Para a determinação de alfa e beta

  2. 77 FR 74916 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to the Foreign... (United States)


    ....P. PIXD420806MSRXXL07 (Mexico) (individual) . 6. SALAMANCA BUITRAGO, Mesias, c/o GESTION ALFA LTDA...; Cedula No. 19133648 (Colombia) (individual) . Entity 1. GESTION ALFA LTDA., Calle 62 No. 9A-82 of....

  3. Novel Platinum-Catalyzed Ring-Opening of 1,2-Cyclopropanated Sugars with Alcohols

    DEFF Research Database (Denmark)

    Beyer, Jürgen; Madsen, Robert


    Reaction of 1,2-cyclopropanated sugars with a catalytic amount ofZeise's dimer [Pt(C2H4)Cl2]2 and an alcohol gives 2-C-branched glycosides by a novel platinum catalyzed ring-opening. A wide variety of alcohols can participate in this ring-opening reaction giving 2-C-branched glycosides ranging from...... methyl glycosides to complex disaccharides (17 examples). Very high diastereoselectivity is obtained at the newly formed C-1 stereocenter strongly favoring the alfa-glycoside. The mechanism presumably involves the formation of an intermediate platinacyclobutane which undergoes ring-opening at C-1...... by the alcohol followed by reductive elimination of platinum....

  4. Association between CYP7A1 and the risk of proximal colon cancer in Japanese. (United States)

    Ito, Hidemi; Matsuo, Keitaro; Hosono, Satoyo; Watanabe, Miki; Kawase, Takakazu; Suzuki, Takeshi; Hirai, Takashi; Yatabe, Yasushi; Tanaka, Hideo; Tajima, Kazuo


    Bile acids have long been implicated in the etiology of colorectal carcinogenesis by their genotoxicity as well as cytotoxicity. Cholesterol 7-alfa-hydroxylase (CYP7A1) is the rate-limiting enzyme that converts cholesterol into cholesterol 7-alfa-hydroxycholesterol in the first step of the classical pathway of bile acid synthesis. Recently, an association between a polymorphism (-204A>C, rs3808607) in CYP7A1 and proximal colon cancer/adenoma has been reported, which was not observed with distal colon or rectal cancer/adenoma. In this case-control study, we examined the association between haplotypes of CYP7A1 and proximal or distal colon/rectal cancer risk in a Japanese population. Subjects were 96 cases of proximal colon cancer, 357 of distal colon/rectal cancer and 961 age- and sex-matched non-cancer controls at Aichi Cancer Center. We examined five loci, including rs3808607, and evaluated the impact of haplotype on risk. In locus-specific analyses, we saw no association with rs3808607 for any site. Haplotype analyses revealed that the TAAGG haplotype was positively associated with proximal colon cancer [confounder-adjusted odds ratio: 1.72 (95% confidence interval: 1.10-2.71), p=0.018] but not with distal colon and rectal cancer combined. This association was consistently observed in analyses stratified by potential confounders. Our results indicate that CYP7A1 plays a role in the carcinogenesis of colorectal cancer specifically in the proximal colon. Confirmation of this association in other epidemiologic studies and biological evaluation of the TAAGG haplotype are warranted.

  5. Sentetik piretroit alfa-sipermetrinin değişken desenli gece kurbağası, Bufotes variabilis iribaşlarındaki akut toksisitesi (Amphibia: Anura)


    Mert Gürkan; Seda Serbest; Sibel Hayretdağ


    In this study, acute toxic effects of alpha-cypermethrin were investigated in the tadpoles of Bufotes variabilis (Pallas, 1769). Tadpoles at Gosner stage 19 were exposed to 0, 0.1, 5 and 10 µgl-1 of alpha-cypermethrin concentrations for 96 hours. Mortality, the changes in some morphological measurements (snout-vent length, body width, tail length, and wet weight), morphological anomalies and behavioral changes were evaluated at the end of the experiment. The 96 hours LC50 value was calculate...

  6. AlteraÃÃes MetabÃlicas e EnzimÃticas na RegeneraÃÃo HepÃtica em Ratos Alimentados com Dietas Suplementar de L-Glutamina e Alfa-Cetoglutarato



    Estudos demonstraram que a hepatectomia parcial (HP) com remoÃÃo de dois terÃos do ÃrgÃo, em roedores, Ã seguida por crescimento do fÃgado remanescente. Em cÃlulas eucariontes a enzima malato desidrogenase, do ciclo de Krebs, pode ser encontrada no citoplasma (malato desidrogenase citoplÃsmica â (MDH1) e na matriz mitocondrial (malato desidrogenase mitocondrial - MDH2). A amÃnia, um composto quÃmico tÃxico para os animais, Ã produzida no curso do metabolismo. O fÃgado participa ativamente do ...

  7. Alpha radioactivity monitoring related to Radon-222 in water from wells in metropolitan area of Curitiba (PR), Brazil; Monitoramento da radioatividade alfa relacionada ao radonio-222 em aguas de pocos da regiao metropolitana de Curitiba (PR)

    Energy Technology Data Exchange (ETDEWEB)

    Correa, Janine Nicolosi; Paschuk, Sergei Anatolyevich; Kappke, Jaqueline; Claro, Flavia Del; Perna, Allan Felipe Nunes; Reque, Marilson, E-mail: [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy; Schelin, Hugo Reuters [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita Oliveira [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)


    This research objective was to assess the level of randon-222 concentration in well water of the metropolitan region of Curitiba, Parana. Current work presents the results of indoor {sup 222}Rn activity ground water samples from artesian wells from aquifers of the region. The studies of radon activity in water were performed using the radon detector AlphaGUARD. The calculations of initial radon activity in water were done considering the {sup 222}Rn decay correction as well as equilibrium level of {sup 222}Rn and {sup 226}Ra observed after 30 days of measurements. Obtained results show that about 70% of measured activity levels of {sup 222}Rn are higher than the recommended value of 11.1 Bq.L{sup -1}, which represent the risk for the human health associated with this radionuclide. The case study showed that previous measurements of radon are recommended for a construction project is implemented. In this case, it is observed that the radon concentrations decrease about 56% in the first water tank and 83% in the second water tank over the well. This fact shows that the actions for mitigation of radon are viable and do not require major modifications to the usual systems of construction. (author)

  8. Incidental findings on brain MRI of cognitively normal first-degree descendants of patients with Alzheimer's disease: a cross-sectional analysis from the ALFA (Alzheimer and Families) project (United States)

    Brugulat-Serrat, Anna; Rojas, Santiago; Bargalló, Nuria; Conesa, Gerardo; Minguillón, Carolina; Fauria, Karine; Gramunt, Nina; Molinuevo, José Luis; Gispert, Juan Domingo


    Objectives To describe the prevalence of brain MRI incidental findings (IF) in a cohort of cognitively normal first-degree descendants of patients with Alzheimer's disease (AD). Design Cross-sectional observational study. Setting All scans were obtained with a 3.0 T scanner. Scans were evaluated by a single neuroradiologist and IF recorded and categorised. The presence of white matter hyperintensities (WMH) was determined with the Fazekas scale and reported as relevant if ≥2. Participants 575 participants (45–75 years) underwent high-resolution structural brain MRI. Participants were cognitively normal and scored over the respective cut-off values in all the following neuropsychological tests: Mini-Mental State Examination (≥26), Memory Impairment Screen (≥6), Time Orientation Subtest of the Barcelona Test II (≥68), verbal semantic fluency (naming animals ≥12). Clinical Dementia Rating (CDR) had to be 0. Results 155 participants (27.0%) presented with at least one IF. Relevant WMH were present in 7.8% of the participants, and vascular abnormalities, cyst and brain volume loss in 10.7%, 3.1% and 6.9% of the study volunteers, respectively. Neoplastic brain findings were found in 2.4% of participants and within these, meningiomas were the most common (1.7%) and more frequently found in women. A positive correlation between increasing age and the presence of IF was found. Additionally, brain atrophy greater than that expected by age was significantly more prevalent in participants without a parental history of AD. Conclusions Brain MRIs of healthy middle-aged participants show a relatively high prevalence of IF even when study participants have been screened for subtle cognitive alterations. Most of our participants are first-degree descendants of patients with AD, and therefore these results are of special relevance for novel imaging studies in the context of AD prevention in cognitively healthy middle-aged participants. Trial registration number NCT

  9. Relato do primeiro paciente brasileiro com a forma infantil da doença de Pompe tratado com alfa-glicosidase recombinante humana Report of the first Brazilian infantile Pompe disease patient to be treated with recombinant human acid alpha-glucosidase

    Directory of Open Access Journals (Sweden)

    Sandra J. Pereira


    Full Text Available Objetivo: Relatar o primeiro caso de forma infantil da doença de Pompe tratado no Brasil. Descrição: Trata-se de doença de depósito lisossomal que se caracteriza por defeitos da enzima alfa-glicosidase ácida, com acúmulo intracelular de glicogênio, principalmente nos músculos. São descritas a forma infantil e tardia. Desde 2006, está disponível tratamento com enzima recombinante humana. Descreve-se o primeiro caso de forma infantil da doença tratado no Brasil. Trata-se de menina com 2,5 meses de idade e progressão rápida da doença, com perda dos movimentos dos membros, miocardiopatia hipertrófica e insuficiência respiratória aos 7 meses de idade. Após 10 meses de tratamento, apresentou boa resposta clínica, com remissão da insuficiência respiratória, recuperação parcial dos movimentos dos membros e melhora importante do quadro cardiológico. Comentários: Apesar de pouco freqüente, a forma infantil da doença de Pompe é letal. A disponibilidade de tratamento eficaz aumenta a necessidade de conhecimento e diagnóstico precoce da doença.Objective: To describe the first case of infantile Pompe disease to be treated in Brazil. Description: Pompe disease is a glycogen storage disease related to defects in the acid alpha-glucosidase enzyme, leading to an intracellular accumulation of glycogen, mainly in muscles. Two forms are described: infantile and juvenile. Since 2006, treatment with recombinant human acid alpha-glucosidase has been available. This article describes the first case of infantile Pompe disease treated in Brazil. A girl presented at 2.5 months of age with rapid disease progression, exhibiting severe hypotonia, loss of movements in both upper and lower limbs and hypertrophic cardiomyopathy, progressing to respiratory failure by the age of 7 months. After 10 months of treatment, she exhibited a good clinical response, with remission of the respiratory failure, partial recovery of arm and leg movements and

  10. Inhibitory effect of beta-pinene, alpha-pinene and eugenol on the growth of potential infectious endocarditis causing Gram-positive bacteria Efeito inibitório de eugenol, beta-pineno e alfa-pineno sobre o crescimento de bactérias Gram-positivas potencialmente causadoras de endocardite infecciosa

    Directory of Open Access Journals (Sweden)

    Aristides Medeiros Leite


    Full Text Available This study was led with the purpose of evaluating the effectiveness of eugenol, beta-pinene and alpha-pinene in inhibiting the growth of potential infectious endocarditis causing gram-positive bacteria. The phytochemicals Minimum Inhibitory Concentration-MIC was determined by solid medium diffusion procedure, while the interference of the MIC values on the bacterial cell viability was performed by viable cells count. Staphylococcus aureus, S. epidermidis, Streptococcus pneumoniae and S. pyogenes strains were used as test microorganisms. The assayed phytochemicals showed effectiveness in inhibiting all assayed bacteria strains presenting MIC values between 2.5 and 40 µL/mL. Eugenol showed the lowest MIC values which were between 2.5 and 5 µL/mL for the most bacteria strains. MIC values found to the phytochemicals were able to inhibit the cell viability of S. aureus providing a total elimination of the bacteria inoculum in a maximum time of 24 hours of exposure. These data showed the interesting antibacterial property of the assayed phytochemicals and support their possible and rational use in the antimicrobial therapy.Este estudo foi conduzido com a proposta de avaliar a efetividade de eugenol, beta-pineno e alfa-pineno em inibir o crescimento de cepas de bactérias Gram-positivas potencialmente causadoras de endocardite infecciosa. A Concentração Inibitória Mínima-CIM dos fitoconstituintes foi determinada através do método de difusão em meio sólido, enquanto a interferência da CIM sobre a viabilidade celular bacteriana foi avaliada através da contagem de células viáveis. Cepas de Staphylococcus aureus, S. epidermidis, Streptococcus pneumoniae e S. pyogenes foram utilizadas como microrganismos teste nos ensaios antimicrobianos. Os fitoconstituintes ensaiados mostraram efetividade em inibir todas as cepas bacterianas utilizadas como microrganismos testes apresentando valores de CIM entre 2.5 e 40 µL/mL. Eugenol apresentou os menores

  11. Measure of exposure of short-lived radon products using an alpha spectrometer for measuring indoor aerosol activity concentration and dose evaluation; Misure di esposizione ai prodotti di decadimento del radon a breve vita tramite uno spettrometro alfa per la misura dell'attivita' del particolato atmosferico indoor e valutazioni dosimetriche

    Energy Technology Data Exchange (ETDEWEB)

    Berico, M.; Castellani, C.M.; Formignani, M. [ENEA, Divisione Protezione dell' Uomo e degli Ecosistemi, Centro Ricerche Ezio Clementel, Bologna (Italy); Mariotti, F. [Bologna Univ., Bologna (Italy). Dipt. di Fisica


    A new italian law introduces the regulation of occupational exposure to radon. To evaluate the inhalation of radon daughters by the workers a sampling device has been assembled with the aim of evaluation of unattached and aerosol attached radon daughters' fractions. The instrument, based on selection of the aerosuspended particles by means of a wire screen type battery and subsequent collection on a total filter, allows to describe the behaviour of both fractions using defined temporal pattern of collecting particles and counting them by alpha spectroscopy. A measurement campaign to test the radon daughter dichotomous spectrometer in comparison with a commercial Radon Working Level meter, has been performed in a research laboratory of central Italy affected by high radon concentrations. The radon concentration during the measurement campaign has been also measured. The equilibrium factor F{sub e}q ad the attachment factor fp have been evaluated during 3 days campaign. Using the measured mean parameters (radon concentration, F{sub e}q, f{sub p}) the dose evaluation for workers using dosimetric approach has been performed. A comparison between the epidemiologic approach, based on the radon concentration, and dosimetric approach is also presented. [Italian] L'esposizione a radon in ambiente lavorativo e la conseguente inalazione dei suoi prodotti di decadimento in forma particolata e' oggetto di una recente normativa italiana in materia di protezione dalle radiazioni ionizzanti. Per rispondere a questa necessita', presso l'Istituto per la Radioprotezione dell'ENEA di Bologna e' stato progettato e realizzato uno spettrometro alfa per la misura della progenie del radon con la finalita' di valutare, su brevi periodi di tempo, la concentrazione individuale dei suoi prodotti di decadimento e, con l'impiego di batterie a diffusione a reti, consentire inoltre la discriminazione della concentrazione della frazione attaccata e non

  12. Determination of total alpha and beta activity in water for human consumption by LSC(Liquid Scintillation Counter); Determinacao de atividades alfa e beta total em agua para consumo humano por LSC (Contador de Cintilacao Liquida))

    Energy Technology Data Exchange (ETDEWEB)



    The Ordinance Brazilian of Ministry of Health (MS 2914/2011) establishes the standards for quality of water intended for human consumption, being limits values of 5.0 Bq/L for gross alpha, and 1.0 Bq/L for gross beta radioactivity. The liquid scintillation spectrometry (LSC) technique has been presented as an alternative to conventional procedure using gas flow proportional counter. The present work shows a review of the methods for determination of gross alpha and gross beta in water by using LSC. Between the factors that influence the accuracy and repeatability of the analytical results we can highlight: thermal preconcentration, type of the acid and calibration standard. A procedure was established and carried out to samples of the National Program of Intercomparison of Radionuclides in Environmental Samples for evaluation of its performance. The gross alpha and gross beta analysis in samples of the public water supplies in the Metropolitan Region of Goiania, state of Goias was carried out. The results are consistent with the guideline values form the Ministry of Health concerning radioactivity. (author)

  13. Quantitative analysis of N-glycans from human alfa-acid-glycoprotein using stable isotope labeling and zwitterionic hydrophilic interaction capillary liquid chromatography electrospray mass spectrometry as tool for pancreatic disease diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Giménez, Estela, E-mail: [Department of Analytical Chemistry, University of Barcelona, Diagonal 647, E-08028 Barcelona (Spain); Balmaña, Meritxell [Biochemistry and Molecular Biology Unit, Department of Biology, University of Girona, Campus Montilivi s/n, 17071 Girona (Spain); Figueras, Joan [Department of Surgery, Dr. Josep Trueta University Hospital, IdlBGi, 17007 Girona (Spain); Fort, Esther [Digestive Unit, Dr. Josep Trueta University Hospital, 17007 Girona (Spain); Bolós, Carme de [Gastroesophagic Cancer Research Group, Research Programme in Cancer, Hospital del Mar Medical Research Institute (IMIM), Dr. Aiguader, 88, 08003 Barcelona (Spain); Sanz-Nebot, Victòria [Department of Analytical Chemistry, University of Barcelona, Diagonal 647, E-08028 Barcelona (Spain); Peracaula, Rosa [Biochemistry and Molecular Biology Unit, Department of Biology, University of Girona, Campus Montilivi s/n, 17071 Girona (Spain); Rizzi, Andreas [Institute of Analytical Chemistry, University of Vienna, Währinger Straße 38, A-1090 Vienna (Austria)


    Highlights: • The method enables relative quantitation of hAGP glycans from pathological samples • Pancreatic cancer samples clearly showed an increase of hAGP fucosylated glycans. • Fucosylated glycans could be potential biomarkers for diagnosing pancreatic cancer. • The established method could be extremely useful to find novel glycoprotein biomarkers - Abstract: In this work we demonstrate the potential of glycan reductive isotope labeling (GRIL) using [{sup 12}C]- and [{sup 13}C]-coded aniline and zwitterionic hydrophilic interaction capillary liquid chromatography electrospray mass spectrometry (μZIC-HILIC-ESI-MS) for relative quantitation of glycosylation variants in selected glycoproteins present in samples from cancer patients. Human α{sub 1}-acid-glycoprotein (hAGP) is an acute phase serum glycoprotein whose glycosylation has been described to be altered in cancer and chronic inflammation. However, it is not clear yet whether some particular glycans in hAGP can be used as biomarker for differentiating between these two pathologies. In this work, hAGP was isolated by immunoaffinity chromatography (IAC) from serum samples of healthy individuals and from those suffering chronic pancreatitis and different stages of pancreatic cancer, respectively. After de-N-glycosylation, relative quantitation of the hAGP glycans was carried out using stable isotope labeling and μZIC-HILIC-ESI-MS analysis. First, protein denaturing conditions prior to PNGase F digestion were optimized to achieve quantitative digestion yields, and the reproducibility of the established methodology was evaluated with standard hAGP. Then, the proposed method was applied to the analysis of the clinical samples (control vs. pathological). Pancreatic cancer samples clearly showed an increase in the abundance of fucosylated glycans as the stage of the disease increases and this was unlike to samples from chronic pancreatitis. The results gained here indicate the mentioned glycan in h

  14. 利用Arecibo射电望远镜河外21-cm巡天数据进行中性氢吸收线的探测研究%HI Absorbers from Arecibo Legacy Fast ALFA Survey

    Institute of Scientific and Technical Information of China (English)

    吴忠祖; HAYNES Martha P; GIOVANELLI Riccardo; 朱明; 陈如荣


    利用Arecibo射电望远镜40%的ALFALFA (Arecibo Legacy Fast Arecibo L-band Feed Array)河外中性氢巡天数据,探讨了进行中性氢吸收线“盲寻”的过程与方法,并给出了搜寻吸收线的一些初步结果:(1)探测到的中性氢吸收源的数量共有10个,其中5个为文献中已知源,其余新发现的吸收线源需要进一步的研究与证实.(2)利用探测灵敏度给出了探测区域中性氢柱密度的上限,这些上限的频率统计分布显示阻尼莱曼α吸收线系统(DLAs)中的中性氢气体的平均自旋温度与覆盖因子的比值Ts/f很可能大于500K.射电干扰与驻波是影响Arecibo河外中性氢吸收线探测的两个重要因素,也将进行一定的分析以及讨论相应的解决方法等.正在建设中的500m口径射电望远镜FAST (The Five-hundred-meter Aperture Spherical Telescope)与Arecibo射电望远镜属于相似类型,但在灵敏度、频带宽度、观测天区范围等方面都将有较大的提高,结合目前的研究进展对将来FAST在中性氢吸收线方面的研究也给出了一定的展望.

  15. Sequenciamento e análise dos genes das subunidades alfa e beta do hormônio folículo estimulante de bovino (Bos taurus indicus Sequencing and analysis of subunits alpha and beta of the follicle stimulating hormone from bovine (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Luci Sayori Murata


    Full Text Available

    Este trabalho relata uma clonagem e seqüenciamento das subunidades alfa e beta do hormônio folículo estimulante de Bos taurus indicus. Também apresenta os resultados de comparação realizada das seqüências gênicas dessas cadeias com as seqüências das cadeias alfa e beta do FSH de suínos e da cadeia beta de bovinos Bos taurus taurus já presentes no GenBank. Na comparação das seqüências de nucleotídeos e de aminoácidos predita da cadeia αFSH de Bos taurus indicus com as cadeias αFSH de outras espécies como suínos e búfalo (Bubalis bubalis, observou-se que as seqüências são bastante similares. A comparação da seqüência da subunidade αFSH de Bos taurus indicus com a de suíno demonstrou diferenças em três resíduos de aminoácidos. Na comparação com ßFSH, registrou-se modificação na primeira base do codon que levou à alteração no resíduo do aminóacido 83, que, em Bos taurus indicus, é uma glicina, ao invés da serina presente em Bos taurus taurus. Confirmaram-se essa modificação e todas as outras identificadas na seqüência dos cDNA das cadeias αFSH e βFSH em outra clonagem. A modificação Ser para Gly na posição 83 foi a única que alterou a identidade do resíduo de aminoácido na comparação entre as subunidades beta do FSH de Bos taurus indicus e Bos taurus taurus. Contudo, ela não deve alterar significativamente as propriedades fisiológicas do FSH, uma vez que o resíduo de glicina encontrado nessa posição também é encontrado na cadeia βFSH suína. Trata-se, portanto, de uma modificação particular que distingue as cadeias βFSH de B. taurus taurus e B. taurus indicus.


    PALAVRAS-CHAVES: Bovino, clonagem, FSH, hormônio.

    The aim this work was to promove the cloning and analysis sequencing

  16. Efeito do treinamento físico como modulador positivo nas alterações no eixo neuroimunoendócrino em indivíduos com insuficiência cardíaca crônica: possível atuação do fator de necrose tumoral-alfa Efecto del entrenamiento físico como modulador positivo en las alteraciones en el eje neuroinmunoendócrino en indivíduos con insuficiência cardíaca crônica: posible actuación como factor de necrosis tumoral-alfa Effect of physical training as positive modulator on the alterations in the neuro-immune-endocrine axis in patients with chronic heart failure: possible role of the tumoral necrosis factor-alpha

    Directory of Open Access Journals (Sweden)

    Luís Fernando Bicudo Pereira Costa Rosa


    Full Text Available O exercício físico crônico ou o treinamento físico (TF tem sido largamente utilizado nos últimos anos com finalidade terapêutica e preventiva em uma série de condições fisiopatológicas, incluindo doenças cardiovasculares. Além dos benefícios cardiovasculares, o TF modula a expressão elevada de citocinas pró-inflamatórias, atuando sobre o eixo neuroimunoendócrino. Atualmente, o quadro de insuficiência cardíaca crônica (ICC tem sido reconsiderado como uma interação entre mecanismos hemodinâmicos, neurormonais, endócrinos e imunológicos. Esta resposta inflamatória anormal, incluindo a elevada expressão de citocinas pró-inflamatórias, tem sido proposta como responsável pela progressão e deterioração clínica na ICC. Neste quadro, a principal citocina envolvida no quadro fisiopatológico da ICC é o fator de necrose tumoral-alfa (TNF-alfa. Assim, o TF pode atuar no quadro de ICC de duas maneiras, melhorando o desempenho durante o exercício físico, bem como atenuando do quadro deletério de elevada concentração de citocinas pró-inflamatórias no sistema cardiovascular, podendo representar importante opção imunomodulatória e, desta forma, permitir melhora significativa no quadro clínico do paciente.El ejercicio físico o entrenamiento físico (TF viene siendo utilizado largamente en los ultimos años con finalidad terapéutica y preventiva en una serie de condiciones fisiopatológicas, incluyendo las afectaciones cardiovasculares. Además de los beneficios cardiovasculares, el TF modula la expresión elevada de las citocinas pro-inflamatorias, actuando sobre el eje neuroinmunoendócrino. Actualmente, el cuadro de insuficiencia cardíaca crônica (ICC viene siendo reconsiderado como una interación entre los mecanismos hemodinámicos, neuro-hormonales, endócrinos e imunológicos. Esta respuesta inflamatoria anormal, incluyendo la elevada expresión de citoquinas pro-inflamatorias, viene siendo propuesta como

  17. Alfa-fetoprotein secreting ovarian sex cord-stromal tumor

    Directory of Open Access Journals (Sweden)

    Kusum D Jashnani


    Full Text Available Ovarian sex cord-stromal tumors are relatively infrequent neoplasms that account for approximately 8% of all primary ovarian tumors. They are a heterogeneous group of neoplasms composed of cells derived from gonadal sex cords (granulosa and Sertoli cells, specialized gonadal stroma (theca and Leydig cells, and fibroblasts. They may show androgenic or estrogenic manifestations. We report such a tumor associated with markedly raised serum alpha-fetoprotein (AFP levels in a young female presenting with a mass and defeminising symptoms. Serum AFP levels returned to normal on removal of tumor.

  18. TNF-alfa e metabolismo do adipócito


    Teixeira, Chantelle Simões Leite


    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A prevalência da obesidade tem vindo a aumentar ao longo dos anos influenciando a qualidade de vida da população, tornando-a mais suscetível ao desenvolvimento de outras patologias como as doenças cardiovasculares e a diabetes. A obesidade é resultante do aumento progressivo do tamanho do tecido adiposo em consequência de maior volume e número de adipócitos, levando a uma crescente síntetese d...




    La ecología de comunidades y la biogeografía buscan entender los procesos que determinan los patrones en la naturaleza, pero generalmente a distintas escalas espaciales y enfatizando diferentes procesos. La ecología de comunidades por lo general se ha centrado en los efectos de los procesos de selección a pequeña escala, mientras que la biogeografía se ha enfocado en los efectos de la dispersión y especiación a gran escala, aunque recientemente han convergido a una escala regional, donde se t...

  20. Cancer blandt gigtpatienter behandlet med tumornekrosefaktor-alfa-haemmere

    DEFF Research Database (Denmark)

    Dreyer, Lene; Mellemkjaer, Lene; Hetland, Merete Lund


    is associated with an increased cancer incidence. MATERIAL AND METHODS: A descriptive study of cancer cases among 3,688 patients with rheumatic diseases who received anti-TNF therapy was performed. The patients were identified in the nationwide database DANBIO and had a total number of treatment years of 6......,092 years. All cancer cases were identified and the cancer diagnoses were subsequently confirmed by medical record review. RESULTS: A total of 30 cancers in 28 of 3,688 patients were registered in the DANBIO after initiation of anti-TNF therapy in the period from October 2000 to June 2007. Among these six......%). CONCLUSION: In our descriptive study from the nationwide database DANBIO, a total of 30 cancers were observed in 3,688 patients with rheumatic diseases within a cumulated period of treatment with anti-TNF of 6,092 years. Follow-up for anti-rheumatic and adverse effects in patients in the DANBIO database...

  1. Recombinant Interferon Alfa-2b in Treating Patients With Melanoma (United States)


    Stage IA Skin Melanoma; Stage IB Skin Melanoma; Stage IIA Skin Melanoma; Stage IIB Skin Melanoma; Stage IIC Skin Melanoma; Stage IIIA Skin Melanoma; Stage IIIB Skin Melanoma; Stage IIIC Skin Melanoma; Stage IV Skin Melanoma

  2. Optimizing Interferon Alfa Based Therapy for Chronic Hepatitis C

    NARCIS (Netherlands)

    R. Roomer (Robert)


    textabstractThe hepatitis C virus was first discovered in 1989 as the major cause of chronic non-A non-B hepatitis. The hepatitis C virus is a single stranded RNA virus that belongs to the family of flaviviruses. The primary target of the hepatitis C virus are hepatocytes where viral particles repli

  3. "Alfa-gerlz" rvutsja k vlasti / Ivan Lebedev

    Index Scriptorium Estoniae

    Lebedev, Ivan


    Naiste osast USA akadeemilistes ringkondades, majanduselus ja poliitikas. Esmakordselt võib saada USA presidendiks naispoliitik, Hillary Clintonit toetab üle 40 % demokraatidest. Vt. samas: Toimik: USA mõjukad naised

  4. GALFACTS: The G-ALFA Continuum Transit Survey

    CERN Document Server

    Taylor, Russ


    The GALFACTS project is using the L-band seven feed array receiver system on the Arecibo telescope to carry out an imaging spectro-polarimetric survey of the 30% of the sky visible from Arecibo. GALFACTS observations will create full-Stokes image cubes at an angular resolution of 3.5', with several thousand spectral channels covering 1225 - 1525 MHz, and band-averaged sensitivity of 90 uJy, allowing sensitive imaging of polarized radiation and Faraday Rotation Measure from both diffuse emission and against a high density grid of extragalactic sources. GALFACTS will be a major observational advance in imaging of the polarized radiation from the Milky Way and will provide a rich new database for exploration of the magnetic field of the Galaxy and the properties of the magneto-ionic medium.

  5. Bases moleculares de alfa-talasemia en la Argentina

    Directory of Open Access Journals (Sweden)

    Karen G Scheps


    Full Text Available La α-talasemia, es uno de los desórdenes hereditarios más frecuentes mundialmente. Al presente, el diagnóstico molecular es la única herramienta que permite el diagnóstico certero. El propósito de este trabajo fue caracterizar las bases moleculares de estos síndromes en nuestro medio, y establecer relaciones genotipo-fenotipo. Mediante la complementación de distintas técnicas de biología molecular e hibridación fluorescente in situ (FISH, se logró poner en evidencia la presencia de mutaciones α-talasémicas en 145 de 184 (78.8% pacientes estudiados con perfil hematológico compatible con α-talasemia. Dentro de este grupo, las deleciones correspondieron al defecto genético más frecuente, prevaleciendo la mutación -α3.7 en genotipos heterocigotas y homocigotas. Asimismo, en pacientes con fenotipo α0 las deleciones prevalentes fueron -MED y -CAL/CAMP. Este estudio permitió también describir una deleción de la región sub-telomérica en un paciente con α-talasemia y retraso mental. En el 7.6% de los pacientes caracterizados clínicamente como posibles α-talasémicos (microcitosis con valores de Hb A2 inferiores al 3.5%, se hallaron mutaciones β-talasémicas en estado heterocigota. Se lograron establecer perfiles hematológicos asociados a los genotipos α+ y α0 para pacientes adultos y niños. Esperamos que este trabajo pueda servir como guía para reconocer posibles portadores α-talasémicos. También permite destacar el trabajo en conjunto de médicos hematólogos, el laboratorio (bioquímico y de biología molecular y de los médicos genetistas, con el fin de proporcionar adecuado consejo genético.

  6. HI Absorbers from Arecibo Legacy Fast ALFA Survey (United States)

    Wu, Z. Z.; Haynes, M. P.; Giovanelli, R.; Zhu, M.; Chen, R. R.


    We present some preliminary results of an on-going study of the HI 21-cm absorption line based on the 40% data release of the Arecibo Legacy Fast Arecibo L-band Feed Array (ALFALFA) survey. Ten HI absorption candidates have been detected. Five of them are previously published in the literature, and the rest of them are new detections that need further confirmation. For those sources with no detected absorptions, we calculated the upper limits of their foreground HI column density N_{HI}. The statistical result of the N_{HI} distribution indicates that the ratio of average spin temperature to covering factor T_{s}/f for DLAs (the damped Lyα systems) might be larger than 500 K. Radio frequency interference (RFI) and standing waves are the main issues affecting the detection of HI absorption profiles. Our study can serve as the pathfinder for a large scale search of HI 21-cm absorption lines using the Five-Hundred-Meter Aperture Spherical Radio Telescope (FAST) which is an Arecibo-type radio telescope currently under construction in China. We discuss two types of observational studies of HI absorptions toward extragalactic sources using the FAST telescope.

  7. Monitorering af tumornekrosefaktor alfa-haemmeres biotilgaengelighed, farmakokinetik og immunogenicitet

    DEFF Research Database (Denmark)

    Steenholdt, Casper; Ainsworth, Mark; Thomsen, Ole Østergaard;


    Treatment of inflammatory bowel disease (IBD) with antibodies against tumour necrosis factor-alpha (TNF) is effective. Not all patients respond, however, and the effect wears off in a considerable fraction of initial responders over time. Individual differences in bioavailability, pharmacokinetics...... and immunogenicity are now recognized as essential problems in the use of biologicals, and blood measurements of functional anti-TNF antibodies and antibodies against anti-TNF drugs with robust and clinically relevant methods may optimize treatment of IBD through individualized therapeutic regimens....

  8. Determinação sérica de haptoglobina, ceruloplasmina e alfa-glicoproteína ácida em cães com gastrenterite hemorrágica Determination of serum haptoglobin, ceruloplasmin and acid alpha-glycoprotein in dogs with haemorrhagic gastroenteritis

    Directory of Open Access Journals (Sweden)

    Márcia Mery Kogika


    Full Text Available As proteínas de fase aguda (PFA são proteínas plasmáticas, cujo estímulo à síntese ocorre de forma rápida e marcante em resposta à injúria tecidual. Estas proteínas permitem o diagnóstico de processos inflamatórios em animais com supressão ou depressão medular. Além disso, são úteis na monitorização da resolução tecidual de traumas ou inflamação e também na avaliação da resposta orgânica ao tratamento. Uma vez que a leucopenia é observada nos estádios iniciais da parvovirose canina, a dosagem das PFA pode permitir a avaliação do processo inflamatório sob estas condições. Considerando-se estas hipóteses, foram determinados os níveis séricos das PFA (haptoglobina, ceruloplasmina e alfa-glicoproteína ácida em 11 cães saudáveis e 11 cães leucopênicos com gastrenterite hemorrágica, com suspeita clínica de parvovirose canina. A avaliação estatística mostrou diferença significativa, com intervalo de confiabilidade de 99% (PAcute phase proteins (APP are serum proteins whose stimulus for the synthesis happens in a quick and intense manner in response to tissue injury. Those proteins allow the diagnosis of inflammatory process in animals with bone marrow depression and, also, they are useful in the follow up of tissue resolution of traumas or inflammation, as well as in the evaluation of the organic response of the treatment. As leukopenia is observed in the initial stage of the canine parvovirus infection, the dosage of APP can allow the evaluation of the inflammatory process under these conditions. According to these hypothesis, serum APP levels (haptoglobin, ceruloplasm and a-acid-glycoprotein in 11 healthy dogs and 11 leukopenic dogs with haemorrhagic gastroenteritis, clinically suspected of canine parvovirus infection, were measured. There was a significant difference, with confidence interval of 99% (P <0.01 for the haptoglobin (p <0.0064 and the acid alpha-glycoprotein (p <0.0042 and 95% (P <0.05 of

  9. The Portuguese language version of social phobia and Anxiety Inventory: analysis of items and internal consistency in a Brazilian sample of 1,014 undergraduate students Versão para o português do Inventário de Fobia Social e Ansiedade: análise de itens e consistência interna numa amostra de 1.014 estudantes universitários brasileiros

    Directory of Open Access Journals (Sweden)

    Patrícia Picon


    Full Text Available OBJECTIVE: Theoretical and empirical analysis of items and internal consistency of the Portuguese-language version of Social Phobia and Anxiety Inventory (SPAI-Portuguese. METHODS: Social phobia experts conducted a 45-item content analysis of the SPAI-Portuguese administered to a sample of 1,014 university students. Item discrimination was evaluated by Student's t test; interitem, mean and item-to-total correlations, by Pearson coefficient; reliability was estimated by Cronbach's alpha. RESULTS: There was 100% agreement among experts concerning the 45 items. On the SPAI-Portuguese 43 items were discriminative (p OBJETIVO: Análise teórica e empírica dos itens e da consistência interna da versão em português do Social Phobia and Anxiety Inventory (SPAI-Português e subescalas. MÉTODOS: Peritos em fobia social conduziram análise de conteúdo dos 45 itens do SPAI-Português, administrado a 1.014 estudantes universitários. A discriminação dos itens foi avaliada por teste t de Student; correlações interitens, médias e item/total por coeficientes de Pearson; fidedignidade pelo alfa de Cronbach. RESULTADOS: Concordância plena entre os peritos para os 45 itens. SPAI-Português com 43 itens discriminativos (p < 0,05. Alguns itens, entre as subescalas, apresentaram coeficientes abaixo de 0,2. As médias das correlações interitens foram: 0,41 na subescala fobia social; 0,32 na subescala agorafobia; e 0,32 no SPAI-Português. As correlações item/total foram maiores do que 0,3 (p < 0,001. Alfas de Cronbach foram: 0,95 no SPAI-Português; 0,96 na subescala de fobia social; 0,85 na subescala de agorafobia. CONCLUSÃO: O conteúdo dos itens foi relacionado aos constructos subjacentes (agorafobia e fobia social, com discriminabilidade de 43 itens do SPAI-Português. As correlações médias interitens e alfas revelaram consistência interna de SPAI-Português e subescalas, além de multidimensionalidade das mesmas. Nenhum item foi suprimido

  10. [Association of inflammatory cytokines with bone turnover markers in type 1 diabetes]. (United States)

    Molina-Ayala, Mario; Cruz-Soto, Ruth Carmina; Vargas-Ortega, Guadalupe; González-Virla, Baldomero; Ferreira-Hermosillo, Aldo; Mac Gregor-Gooch, Julián; Mendoza-Zubieta, Victoria


    Introducción: la diabetes mellitus afecta de una manera adversa al esqueleto y esos mecanismos fisiopatológicos continúan sin entenderse completamente. Por lo tanto, el objetivo de este estudio es identificar citocinas inflamatorias (IL-1, IL-6 y TNFα) en pacientes con DM1 y su asociación con marcadores de formación (sPINP) y resorción (sCTX) óseas. Métodos: Se estudiaron 62 pacientes con DM1, mayores de 18 años. Se determinaron los valores de la HbA1c, la vitamina D, las citocinas inflamatorias, así como los de los marcadores de formación y resorción óseas. Resultados: 49 pacientes fueron del sexo femenino con una edad media de 33.5 años, HbA1c > 7.5 en 83%, vitamina D 16 ng/mL. En los pacientes con HbA1c > 7.5 hubo correlación positiva entre el TNFa y sCTX (r = 0.43, p = 0.05), IL-6 y sCTX (r = 0.48, p = 0.037). Posterior a un modelo de regresión lineal simple entre el sCTX y la IL-6 se encontró un coeficiente beta de 23.8, p = 0.030 (IC 2-45.6), es decir, por cada unidad de elevación de IL-6 hay un incremento de sCTX de 23.8 pg/mL. Conclusiones: encontramos una asociación positiva entre TNF-alfa e IL-6 con el marcador de resorción ósea (sCTX) en pacientes con HbA1c > 7.5 %. El descontrol metabólico se asoció con la elevación de citocinas inflamatorias TNF-alfa e IL-6.

  11. Th1 and Th2 immune responses related to pelvic endometriosis Resposta imunológica Th1 e Th2 relacionada à endometriose pélvica

    Directory of Open Access Journals (Sweden)

    Sergio Podgaec


    Full Text Available OBJECTIVE: This study analyzed the relationship between clinical characteristics of endometriosis and Th1/Th2 immune response patterns. METHODS: A prospective study was performed with 65 patients with endometriosis (Group A and 33 without the disease (Group B. Measurement of IL 2, 4 and 10, TNF-alpha and IFN-gamma was carried out in peripheral blood and peritoneal fluid. RESULTS: Serum TNF-alpha was higher in patients with endometriosis who had deep dyspareunia compared to controls (mean 4.5 pg/ml and 2.3 pg/ml, pOBJETIVO: Este estudo analisa a relação entre as características clínicas da endometriose e os padrões da resposta imune Th1/Th2. MÉTODOS: Estudo prospectivo realizado com 65 pacientes com endometriose (Grupo A e 33 pacientes sem a doença (Grupo B. Foram realizadas avaliação no fluido peritoneal e sangue periférico de IL 2, 4 e 10, TNF-alfa e IFN-gama. A significância foi estabelecida em p < 0,05. RESULTADOS: TNF-alfa encontrava-se elevado em pacientes com endometriose que apresentavam dispareunia de profundidade comparado com controle (média 4,5 pg/ml e 2,3 pg/ml, p< 0,05. Dentre essas pacientes (n=32, 65,5% apresentavam endometriose profunda. Pacientes com endometriose e infertilidade apresentavam concentrações maiores de IL-2 no fluido peritoneal quando comparadas com controle (média 5,9 pg/ml e 0,2 pg/ml, p< 0,05, sendo que neste grupo, 63,5% (n=14 apresentavam endometriose profunda. Foi observada também maior concentração de IL-10 nas pacientes que apresentavam endometriose ovariana quando comparadas às sem esse tipo de endometriose, assim como quando comparadas às pacientes do grupo controle (média 50pg/ml, 18,7pg/ml e 25,7pg/ml, p<0,05. CONCLUSÃO: Estes resultados sugerem que quando dados clínicos específicos associam-se a uma produção elevada de certas citocinas, ocorre um padrão de resposta Th1 que pode estar associado à endometriose profunda.

  12. Acurácia diagnóstica do leucograma, proteína C-reativa, interleucina-6 e fator de necrose tumoral-alfa na sepse neonatal tardia Accuracy of white blood cell count, C-reactive protein, interleukin-6 and tumor necrosis factor alpha for diagnosing late neonatal sepsis

    Directory of Open Access Journals (Sweden)

    Jamil P. S. Caldas


    Full Text Available OBJETIVO: Avaliar o valor do leucograma, proteína C-reativa (PCR, interleucina-6 (IL-6 e do fator de necrose tumoral-alfa (TNF-α, isoladamente e em conjunto, na detecção da sepse neonatal tardia. MÉTODOS: Estudo de validação diagnóstica. A PCR, IL-6 e TNF-α foram dosados por quimioluminescência à suspeita clínica, 24 e 48 horas depois, e o leucograma unicamente à suspeita. De acordo com evolução clínica e resultados de culturas, três grupos foram definidos: sepse comprovada (SC, sepse provável (SP e não infectados (NI. Os testes estatísticos utilizados foram os de Wilcoxon, qui-quadrado e análise de variância de Friedman e os limites de corte foram obtidos pela construção da curva ROC. RESULTADOS: Estudaram-se 82 crianças, sendo 42 no grupo SC, 16 no SP e 24 NI. Nos três momentos, as medianas da PCR e da IL-6 mostraram-se significativamente mais elevadas nos grupos SC e SP, e as do TNF-α alteraram-se apenas no grupo SC. Os índices diagnósticos da PCR foram elevados nos três momentos e com acurácia superior a do leucograma e semelhante a da IL-6 e a do TNF-α em suas primeiras medidas. Entre as citocinas, não houve diferença estatística entre elas, nem em relação ao leucograma. A associação dos testes não aumentou a capacidade diagnóstica, exceto na combinação entre leucograma e PCR2 e na dosagem seriada de PCR. CONCLUSÕES: A PCR e o leucograma mostram-se úteis no diagnóstico de sepse neonatal tardia e comparáveis à IL-6 e ao TNF-α. A acurácia aumentou com a associação PCR-leucograma e a dosagem seriada da PCR.OBJECTIVE: To evaluate the diagnostic value for late neonatal sepsis of white blood cell count (WBC and assays for C-reactive protein (CRP, interleukin-6 (IL-6 and tumor necrosis factor alpha (TNF-α, in isolation and in conjunction. METHODS: This was a diagnostic test validation study. Chemiluminescence was used to assay CRP, IL-6 and TNF-α at the time of clinical suspicion and again

  13. Exclusion of linkage between hypokalemic periodic paralysis and a candidate region in 1q31-32 suggests genetic heterogeneity

    Energy Technology Data Exchange (ETDEWEB)

    Sillen, A.; Wadelius, C.; Gustabson, K.H. [University Hospital, Uppsala (Sweden)] [and others


    Familial hypokalemic periodic paralysis (HOKPP) is an autosomal dominant disease with attacks of paralysis of varying severity. The attacks occur at intervals of days to years in otherwise healthy people combined with hypokalemia during attacks. The paralysis attacks are precipitated by a number of different factors, like carbohydrate-rich meals, cold, exercise and mental stress. Recently linkage for HOKPP was shown for chromosome 1q31-32 and the disease was mapped between D1S413 and D1S249. The gene for the calcium channel alfa1-subunit (CACNL 1A3) maps to this interval and in two families no recombination was found between a polymorphism in the CACNL 1A3 gene and the disease. This gene is therefore considered to be a candidate for HOKPP. The analysis of a large Danish family excludes linkage to this region and to the CACNL 1A3 gene. In each direction from D1S413, 18.8 cM could be excluded and for D1S249, 14.9 cM. The present study clearly excludes the possibility that the gene causing HOKPP in a large Danish family is located in the region 1q31-32. This result shows that HOKPP is a heterogenous disease, with only one mapped gene so far.

  14. Epithelial-mesenchymal interactions and lung branching morphogenesis. Role of polyamines and transforming growth factor ß1

    Directory of Open Access Journals (Sweden)

    G Stabellini


    Full Text Available Lung branching morphogenesis is a result of epithelial-mesenchymal interactions, which are in turn dependent on extracellular matrix composition and cytokine regulation. Polyamines have recently been demonstrated as able to modify chick embryo skin differentiation. In this work we have examined the effects of putrescine and spermidine during chick embryo lung morphogenesis in organotypic cultures by morphological, histochemical and biochemical examination. To verify the role of polyamines, we used specific inhibitors, such as bis-cyclohexylammonium sulphate and alfa-difluoromethylornithine, and transforming growth factor ß1, an ornithine decarboxylase and polyamine stimulator. Our data show that lung morphogenesis is significantly altered following the induced mesenchymal glycosaminoglycan changes. The increase of mesenchymal glycosaminoglycans is correlated with a stimulation of lung development in the presence of polyamines, and with its inhibition when transforming growth factor ß1 is added to the culture medium. The morphometric data show a uniform increase of both the mesenchyme and epithelial branching with spermidine and putrescine stimulus, whereas the mesenchymal substance alone is significantly increased in apical-median lung sections with transforming growth factor ß1 and transforming growth factor ß1 + spermidine lung cultures. Transforming growth factor ß1 and transforming growth factor ß1 + spermidine confirm the blocking of epithelial branching formations and fibroblast activation, and show that polyamines are unable to prevent the blocking of epithelial cells due to the inhibitory effect of transforming growth factor ß1.

  15. Investigação de fatores associados à asma de difícil controle Investigation of factors associated with difficult-to-control asthma

    Directory of Open Access Journals (Sweden)

    Ana Carla Sousa de Araujo


    Full Text Available OBJETIVO: Pesquisar a freqüência dos fatores associados à asma de difícil controle. MÉTODOS: Foram selecionados pacientes com diagnóstico de asma grave do ambulatório de asma do Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto. Os pacientes foram classificados em dois grupos: asma grave controlada e asma grave de difícil controle. Após nova tentativa de otimização do tratamento para o grupo de difícil controle, foram aplicados questionário e investigação complementar de fatores associados, como exposição ambiental domiciliar e ocupacional, tabagismo, fatores sociais, rinossinusite, doença do refluxo gastroesofágico (DRGE, apnéia obstrutiva do sono, insuficiência cardíaca congestiva (ICC, embolia pulmonar, fibrose cística, disfunção de cordas vocais, deficiência de alfa-1 antitripsina e vasculite de Churg-Strauss. RESULTADOS: Foram selecionados 77 pacientes com asma grave, dos quais 47 apresentavam asma de difícil controle, sendo 68,1% do sexo feminino, idade média de 44,4 anos (±14,4 e volume expiratório forçado no primeiro segundo de 54,7% (±18,3%. Dos diagnósticos encontrados em associação à asma de difícil controle, o mais freqüente foi a pouca adesão ao tratamento (68%. Outros foram as más condições ambientais (34% e ocupacionais (17%, rinossinusite (57%, DRGE (49%, apnéia obstrutiva do sono (2%, ICC (2% e tabagismo (10%. Em todos os casos, pelo menos um desses fatores concomitantes foi diagnosticado. CONCLUSÕES: O fator mais freqüente associado à asma de difícil controle nos indivíduos estudados é a pouca adesão à medicação prescrita. A investigação de co-morbidades é imperativa na avaliação de pacientes com esta forma da doença.OBJECTIVE: To determine the prevalence of factors associated with difficult-to-control asthma. METHODS: Patients with severe asthma were selected from the outpatient asthma clinic of the Ribeirão Preto School of Medicine Hospital das Cl

  16. Genotype 1 hepatitis C virus envelope features that determine antiviral response assessed through optimal covariance networks.

    Directory of Open Access Journals (Sweden)

    John M Murray

    Full Text Available The poor response to the combined antiviral therapy of pegylated alfa-interferon and ribavarin for hepatitis C virus (HCV infection may be linked to mutations in the viral envelope gene E1E2 (env, which can result in escape from the immune response and higher efficacy of viral entry. Mutations that result in failure of therapy most likely require compensatory mutations to achieve sufficient change in envelope structure and function. Compensatory mutations were investigated by determining positions in the E1E2 gene where amino acids (aa covaried across groups of individuals. We assessed networks of covarying positions in E1E2 sequences that differentiated sustained virological response (SVR from non-response (NR in 43 genotype 1a (17 SVR, and 49 genotype 1b (25 SVR chronically HCV-infected individuals. Binary integer programming over covariance networks was used to extract aa combinations that differed between response groups. Genotype 1a E1E2 sequences exhibited higher degrees of covariance and clustered into 3 main groups while 1b sequences exhibited no clustering. Between 5 and 9 aa pairs were required to separate SVR from NR in each genotype. aa in hypervariable region 1 were 6 times more likely than chance to occur in the optimal networks. The pair 531-626 (EI appeared frequently in the optimal networks and was present in 6 of 9 NR in one of the 1a clusters. The most frequent pairs representing SVR were 431-481 (EE, 500-522 (QA in 1a, and 407-434 (AQ in 1b. Optimal networks based on covarying aa pairs in HCV envelope can indicate features that are associated with failure or success to antiviral therapy.

  17. Análisis proteomico de la subunidad LSL1 de la lectina del Camaron Blanco del Golfo de Mexico Litopenaeus setiferus

    Directory of Open Access Journals (Sweden)

    Alpuche-Osorno, Ja,b.Pereyra, Ma.,Vazquez, Lc., Agundis, Ca., Rosas, Cd., Zenteno, Ea. a


    Full Text Available Se purificó por filtración en Sephacryl S-300 una subunidad de 84 kDa de la lectina de L. setiferus (LsL1, específica para azucares N-acetilados. Por dicroísmo circular se encontró que LsL1 contiene en su estructura secundaria 49% de hojas plegadas beta y 6.9% de alfa hélices. La secuencia de aminoácidos de la subunidad LsL1 se determinó por MALDI-TOF a partir de péptidos trípticos. Comparando los valores con la base de datos NCBInr (Swiss-Prot 2003/08/06, esta subunidad mostró 23% de similitud con el precursor hemocianina, proteína responsable de la respiración en crustáceos, que a su vez ha sido relacionada con la generación de péptidos de defensa; al alinear el péptido con otras proteínas involucradas con la defensa en crustáceos muestran una similitud del 80% con hemocianina, y profenoloxidasa, por lo que podemos asumir que las lectinas de esta especie participan en procesos de defensa. By filtration in a column of Sephacryll S-300 was purified a subunit of 84 kDa of the lectina of L. setiferus (LsL1, specific for N-acetilated sugars. By Circular dicroism we found that LsL1 in its secondary structure contains 49% of sheet beta and 6.9% of alfa helix. The sequence of amino acids of the subunit LsL1 were assayed from triptic peptides by MALDI-TOF and they had a rank of mass from 768.36 to 3379.76 m/z. Comparing these data with relative values obtained of the database NCBInr (Swiss-Prot 2003/08/06, this protein showed 23% of homology with a precursor of the responsible protein for the respiration in crustaceans, the one that besides has related to the generation of defense peptides. Alignments with other proteins related to mechanisms of defense in crustaceans indicate a homology of the 80% with similar proteins to the hemocyanin, and the profenoloxidase. We can assume that functionally lectinas of this species participate actively in processes of defense.

  18. Phase 1 safety, tolerability, and pharmacokinetic study of single ascending doses of XM17 (recombinant human follicle-stimulating hormone in downregulated healthy women

    Directory of Open Access Journals (Sweden)

    Lammerich A


    Full Text Available Andreas Lammerich, Peter Bias, Beate Gertz Merckle GmbH, Ulm, Germany Background: XM17 is a recombinant human follicle-stimulating hormone (follitropin alfa for stimulation of multifollicular development in women undergoing controlled ovarian hyperstimulation during assisted reproductive therapy and for treatment of anovulation. Manufactured using Chinese hamster ovary cells transfected with the human follicle-stimulating hormone gene, XM17 has an identical amino acid sequence to that of the human protein as well as to those of the other approved recombinant human follicle-stimulating hormone products. Glycosylation patterns may differ slightly between products. The objectives of this first-in-human study were to assess the safety, tolerability, pharmacokinetics, and dose-proportionality of single ascending subcutaneous doses of XM17 in healthy young female volunteers.Methods: Endogenous follicle-stimulating hormone was downregulated by implanting a 1-month depot of goserelin acetate 3.6 mg on day 0 in eligible subjects. On day 14 of the experimental period, subjects received one of four ascending doses of XM17. Blood sampling to obtain the pharmacokinetic profile of XM17 was done at frequent intervals until 168 hours post-dose.Results: Following downregulation of endogenous follicle-stimulating hormone to <4 IU/L, 40 subjects (of mean age 29±5.4 years received single subcutaneous doses of 37.5 (n=4, pilot group, 75, 150, or 300 IU (n=12 each of XM17. The mean serum concentration-time profiles of XM17 revealed dose-related increases in maximum concentration (Cmax within 24 hours followed by monoexponential decay for the three higher dose levels. Slopes estimated by linear regression for Cmax and AUC0–168h were ~1.0 (0.9052 IU/L and 1.0964 IU·h/L, respectively. For each IU of XM17 administered, Cmax and AUC0–168h rose by 0.032 IU/L and 2.60 IU·h/L, respectively. Geometric mean elimination half-life ranged from 54 to 90 hours. No antibodies

  19. Clinical performance of a resin-modified glass-ionomer and two polyacid-modified resin composites in cervical lesions restorations: 1-year follow-up. (United States)

    Chinelatti, M A; Ramos, R P; Chimello, D T; Palma-Dibb, R G


    The aim of this study was to assess the clinical performance of a resin-modified glass-ionomer cement (Vitremer) and two polyacid-modified resin composites (F2000 and Freedom) over 1 year. Nineteen patients with at least three cervical lesions were selected, providing an initial sample size of 87 restorations (29 per material), being 78 to non-carious and nine to carious lesions. Restorations were evaluated at baseline, 6 months and 1 year after placement, using modified US Public Health Service criteria: colour match, marginal discoloration, caries, anatomical form, marginal integrity and surface texture. At baseline, restorations were considered as acceptable for all criteria. At 1-year recall, 21 restorations per material were re-examined. Freedom was rated Bravo or Charlie for all the examined criteria and Vitremer earned an Alfa rating solely for the criterion caries. On the contrary, F2000 showed the best overall results, although presenting significant alteration in colour match. Statistical analysis of data was performed using chi-square and Mc Nemar tests. As to the evaluated periods, significant difference was observed solely between baseline and 1-year recall. Freedom and Vitremer were statistically different (P < 0.01) as to anatomical form and surface texture. For F2000, significant difference (P < 0.05) was noticed as to colour match and anatomical form. After 1-year follow-up, F2000 showed the most acceptable results as to the analysed criteria.

  20. Separation of monoglycosides from fruit juice by diafiltration

    DEFF Research Database (Denmark)

    Jensen, Morten Busch; Christensen, Knud Villy; Norddahl, Birgir

    The process of separating sugars from anthocyanins in black currant juice has been investigated. Diafiltration on a laboratory scale flat sheet module (Labstk M20, Alfa Laval Nakskov A/S, Denmark) loaded with an ultrafiltration membrane (ETNA01-PP, MWCO = 1,000 Da, Alfa Laval Nakskov A/S, Denmark...

  1. Monitoring of TNFR1, IL-2Rα, HGF, CCL8, IL-8 and IL-12p70 following HSCT and their role as GVHD biomarkers in paediatric patients. (United States)

    Berger, M; Signorino, E; Muraro, M; Quarello, P; Biasin, E; Nesi, F; Vassallo, E; Fagioli, F


    No predictive factors are currently available to establish patient-specific GVHD risk. A panel of six serum cytokines (TNF receptor 1, IL-2 receptor alfa (IL-2Rα), hepatocyte growth factor (HGF), monocyte chemo-attractant protein-2, IL-8, IL-12p70) were monitored at established time points (days -1, +1, +7, +14, +21, +28 and +60) in 170 paediatric hematopoietic SCT (HSCT) recipients. We found that higher concentrations of IL-2Rα on days +14 and +21 together with HGF on days +14 and +21 were significantly associated at a higher probability of both grade II-IV GVHD (on day +14 it was: 60% vs 28%, P=0.007) and grade III-IV (on day +14 it was: 40% vs 15%, P=0.001). The higher IL-8 serum concentration on day +28 was associated with a lower probability of chronic GVHD being 4% vs 29% (P=0.01) for patients with higher vs lower IL-8 serum concentration. These findings were confirmed when the analysis was restricted to the the matched unrelated donor group. In conclusion, even if the serum cytokine levels were related to several variables associated with HSCT, we identified two cytokines as predictors of GVHD II-IV and III-IV, translating into a higher TRM risk (17% vs 3%, P=0.004).

  2. Las células del epitelio pigmentario de la retina expresan receptores nicotínicos neuronales alfa-3 y alfa-7 funcionales


    Maneu Flores, Victoria; Company Sirvent, Miguel Ángel; Palmero Cabezas, Mercedes; Lax Zapata, Pedro


    Comunicación presentada a la XXVII Reunión del GEN (Grupo Español de Neurotransmisión), Chiclana (Cádiz), 12-16 diciembre 2006 Este trabajo ha sido financiado por la Universidad de Alicante (Ayudas a Grupos Jóvenes, GRJ05-07)

  3. Aplicação da calorimetria exploratória diferencial no estudo da cinética de transição alfa -> delta HMX Application of differential scanning calorimetry in the study of the kinetics of the alpha -> delta transition in HMX

    Directory of Open Access Journals (Sweden)

    Gilson da Silva


    Full Text Available Octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX or octogen is a white crystalline substance which occurs in four polymorphous forms. It is used in a wide variety of military and industrial formulations owing to its suitable properties. Researchers have demonstrated the usefulness of this energetic material in explosive components. In the present work we apply differential scanning calorimetry (DSC to measure the a ® d solid-solid phase transition energy of HMX. The results obtained by Kissinger's and Ozawa's methods were 487 and 495 kJ/mol, respectively.

  4. Studio 1:1

    Index Scriptorium Estoniae


    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  5. Drug: D00172 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00172 Drug Eptacog alfa (activated) (genetical recombination) (JAN); Eptacog alfa ...a preparations D00172 Eptacog alfa (activated) (genetical recombination) (JAN); Eptacog alfa (INN) Anatomica...oagulation factor VII D00172 Eptacog alfa (activated) (genetical recombination) (JAN); Eptacog alfa (INN) B0...2BD08 Eptacog alfa (activated) D00172 Eptacog alfa (activated) (genetical recombi

  6. Relationship between the level of serum ferritin and the effects of peginterferon alfa-2a in treating chronic hepatitis C patients%血清铁蛋白与培干扰素α-2a治疗慢性丙型肝炎疗效的关系

    Institute of Scientific and Technical Information of China (English)

    龚玲; 景钊; 江宇; 苏刚; 张友才


    目的:探讨血清铁蛋白(SF)的变化与培干扰素α-2a(Peg-IFNα-2a)治疗慢性丙型肝炎疗效的关系.方法:试验组31例慢性丙型肝炎病人,年龄(34±s 8)a,18~65 a;15例健康志愿者为对照组.试验组给予培干扰素α-2a,180 μg,皮下注射,每周1次,疗程24 wk,治疗结束后随访24 wk.分别在0,12,24及48 wk检测血清ALT及HCV RNA以判断疗效.在0 wk时检测31例病人和15例健康对照者的血清铁蛋白水平.根据疗效的不同,将病人分为持续应答、复发和无应答组.以SF值等于300 μg·L-1为界,将病人分为高SF组(≥300 μg·L-1)与低SF组(<300 μg·L-1).结果:慢性丙型肝炎病人的SF水平显著高于健康对照者.治疗前慢性丙型肝炎病人SF与ALT水平呈正相关.治疗前持续应答组SF含量明显低于复发组及无应答组(P<0.01).治疗前低SF组的病人对Peg-IFN α-2a的持续应答率显著高于高SF组的病人(P<0.05).结论:慢性丙型肝炎病人的SF水平与肝脏损伤程度有关,治疗前高SF水平与Peg-IFNα-2a疗效差及不稳固有关.

  7. High flow air sampling for determination of alpha long half-life emitters: area monitoring of a radioactive material disposal; Amostragem de ar de alto fluxo para determinacao de alfa emissores de meia vida longa: monitoracao de area em um deposito de material radioativo

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, W.S. [Industrias Nucleares do Brasil (SR/FCN/INB), Itatiaia, RJ (Brazil). Servico de Radioprotecao. Fabrica do Combustivel Nuclear; Kelecom, A. [Universidade Federal Fluminense (LARARA-PLS/GETA/UFF), Niteroi, RJ (Brazil). Lab. de Radiobiologia e Radiometria Pedro Lopes dos Santos. Grupo de Estudos em Temas Ambientais


    The Ore Treatment Unit (UTM) is a mine and closed uranium plant, located in Caldas, Minas Gerais, Brazil. It has a radioactive material disposal composed primarily of pie II and mesothorium. It is stored in six sheds designated C-01, C-02, C-05, C-06, C-07 and C-09. This study aims to present the high flow area monitoring program and results obtained in 2009. The threshold derived from concentration in the air was 0.25 Bq m{sup -3}. The average of the activity concentrations in 2009 were: for C-01 1.17 Bq m{sup -3}; C-02 0.006 Bq m{sup -3}; C-05 1.98 Bq m{sup -3}; C-06 2.14 Bq m{sup -3}; C-07 0.34 Bq m{sup -3} and C-09 0,025 Bq m{sup -3}. Such values indicate that the control stay is an important factor in occupational workers' control, as well as the use of EPI's and behavioral care, besides radioprotection training to allow the access to the areas. No worker, supervisor or visitor reached the limit research.

  8. ???????????? ?????? ?????????????????? ???????? 1,2,3-???????? ?? 1?-?????????, ????????? ????????? ??????????????? ??????



    ?????????? ?????????? ??????????? ? ???????? ??????? ??????? ????? ???????? 1,2,3-???????? ?? ?????????, ??? ??????????? ?? ???????????? ??????? ??????????????? ??????. ????????? ???? ???????????? ??????? ??????????????? ????(???????)?????? ?? ??????????????? ??????. ?????????? ???????? ??????? ? ?????? ???????? ????? ?????? ???????????????? ???? ?? ?????? ?????????????. ??????????? ???? ???????? ??????? ??????????????? ????(???????)?????? ? ??????????????????? ??-????????? ?????? ?????? (R1C...

  9. Eficácia analgésica da dexmedetomidina comparada ao sufentanil em cirurgias intraperitoneais: estudo comparativo


    Marangoni,Marco Aurélio; Castiglia, Yara Marcondes Machado [UNESP; Medeiros,Tiago Pechutti


    JUSTIFICATIVA E OBJETIVOS: A dexmedetomidina, agonista alfa2-adrenérgico com especificidade alfa1:alfa2 1:1620, não determina depressão respiratória, sendo utilizada no intra-operatório como sedativo e analgésico. Esse fármaco tem sido empregado com os opióides em anestesia de procedimentos com elevado estímulo doloroso, como os abdominais intraperitoneais, não havendo referências sobre seu uso como analgésico único. Comparou-se a dexmedetomidina ao sufentanil em procedimentos intraperitoneai...

  10. Medida de la concentración de actividad Alfa/Beta grueso, en agua potable


    Zutta Villate, Julián Mateo


    Introducción: La calidad del agua de consumo humano es de creciente interés en el mundo; para que esta pueda ser considerada como potable, debe ajustarse a ciertos niveles biológicos, químicos, físicos y radiológicos. Siguiendo recomendaciones de organismos internacionales de salud o, a estándares emitidos por cada país, establecidos según sus condiciones tanto ambientales, como socioeconómicas. La Organización Mundial de la Salud (OMS), en sus guías de potabilización del agua de consu...





    La agregación de ct-sinucleína se ha relacionado por varios autores con la enfermedad de parkinson. Recientemente, se ha evidenciado por estudios in vitro que la dopamina al oxidarse induce la agregación de a-sinucleína a estructuras protofibrilares neuro 120p.

  12. Influence of estrogen 'alfa' receptor genetic polymorphism in women with signal and symptoms of temporomandibular disorders


    Margarete Cristiane Ribeiro


    Resumo: Desordem Temporomandibular (DTM) é um termo utilizado para determinar as condições de patologias clínicas que envolvem os músculos mastigatórios e articulações temporomandibulares (ATM). Ocorre freqüentemente entre as mulheres em idade fértil, aumentando a prevalência após a puberdade e diminuindo na pós-menopausa, o que sugere uma correlação com os hormônios reprodutivos, principalmente o estrógeno. O objetivo deste trabalho foi correlacionar a freqüência de dois polimorfismos do gen...


    Directory of Open Access Journals (Sweden)

    Valter Pereira ROMANO


    Full Text Available • RESUMO: Este trabalho utiliza como corpus de análise os dados coletados pela equipe do Projeto Atlas Linguístico do Brasil em três regiões: Centro-Oeste, Sudeste e Sul. Os dados referem-se às cidades do interior e às capitais de cada estado, coletados junto a informantes selecionados segundo o perfil estabelecido. Nesta oportunidade, objetiva-se discutir a distribuição diatópica das variantes lexicais para a questão 132 – “Criança pequenininha, a gente diz que é bebê. E quando ela tem de 5 a 10 anos, do sexo masculino?” – do Questionário Semântico-Lexical (COMITÊ NACIONAL DO PROJETO ALIB, 2001. A metodologia utilizada envolveu análises descritivas e inferenciais pertinentes ao estudo. Para tanto, oito hipóteses foram testadas no sentido de averiguar o comportamento e a distribuição diatópica das cinco variantes mais produtivas no conjunto de respostas. Os principais resultados observados indicam que as variantes apresentam comportamento distinto nas três regiões: (i a variante “menino” apresenta distribuição homogênea nos dez estados; (ii as formas lexicais “guri” e “piá” possuem distribuição heterogênea na região Sul; (iii as variantes de etimologia indígena (“guri” e “piá” são mais representativas nas regiões Sul e Centro-Oeste; (iv há uma maior representatividade da variante “moleque” (étimo africano na região Sudeste, principalmente em São Paulo e Minas Gerais. • PALAVRAS-CHAVE: Projeto ALiB. Dialetologia. Variantes lexicais.

  14. Measurement of very low alpha activity in water; Medida de muy baja actividad alfa en aguas

    Energy Technology Data Exchange (ETDEWEB)

    Crespo, M. T.; Acena, M. L.


    Measurement of very low levels of alpha-emitting nuclides in water needs substantial improvements. A system based on the adsorbing properties manganese dioxide eliminates the need for transporting very large volumes of water and increases the sensitivity of the measurement. (Author) 21 refs.

  15. La actividad Alfa frontal en insomnes primarios con dificultad para iniciar el sueño


    Pedro Figueredo-Rodríguez; Yolanda del Río-Portilla; Jorge Iván Sánchez-Romero; Alfonso Pérez-Ortiz; María Corsi-Cabrera


    La dificultad para conciliar el sueño es uno de los síntomas más frecuentes del insomnio primario. La apreciación subjetiva de un periodo prolongado de latencia al sueño, aun en presencia de signos de sueño, puede deberse a la coexistencia de los mecanismos promotores de la vigilia y del sueño, y la lucha por el predominio de uno de ellos. La red de atención ejecutiva, conformada por las áreas de asociación frontales y parietales, cumple un papel de particular importancia en el control endóge...

  16. Alfa-tocopherol and beta-carotene in roughages and milk in organic dairy herds

    DEFF Research Database (Denmark)

    Mogensen, Lisbeth; Kristensen, Troels; Søegaard, Karen


    as stored silage. As an average of several sampling times, roughage α-tocopherol and β-carotene contents (mg per kg DM) during the period when the roughage was fed were, respectively, 30 and 21 in grass–clover silage, 13 and 8 in maize wholecrop silage and 28 and 9 in cereal wholecrop silage. Daily intake...... tendency, but due to few observations no final conclusions could be drawn: •For grass–clover silage there were generally no losses of vitamins during the ensiling process and during storage, but there were huge variations between farms. •For wholecrop silage there was a loss of vitamins during the ensiling...

  17. Alfa-synuclein in cerebrospinal fluid as a possible biomarker for Parkinson disease

    DEFF Research Database (Denmark)

    Juul Bøgelund Hansen, Morten; Brandslund, Ivan; Dalsgaard Lund, Erik

    Parkinson disease (PD) is one of the neurodegenerative diseases. The prevalence of PD is increasing due to the general increase of the population over 65 years. An estimate shows that there are about 6.000 – 8.000 people suffering from PD in Denmark. The pathology behind PD is loss of dopaminerge...

  18. Alpha particles spectrometer with photodiode PIN; Espectrometro de particulas alfa con fotodiodo PIN

    Energy Technology Data Exchange (ETDEWEB)

    Chacon R, A.; Hernandez V, R.; Hernandez D, V. M.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidades Academicas de Estudios Nucleares e Ingenieria Electrica, Calle Cipres No. 10, Fracc. La Penuela, 09869 Zacatecas (Mexico); Ramirez G, J. [Instituto Nacional de Estadistica Geografia e Informatica, Direccion General de Innovacion y Tecnologia de Informacion, Av. Heroes de Nacozari Sur 2301, Fracc. Jardines del Parque, 20276 Aguascalientes (Mexico)], e-mail:


    The radiation propagates in form of electromagnetic waves or corpuscular radiation; if the radiation energy causes ionization in environment that crosses it is considered ionizing radiation. To detect radiation several detectors types are used, if the radiation are alpha particles are used detectors proportional type or trace elements. In this work the design results, construction and tests of an alpha particles spectrometer are presented, which was designed starting from a photodiode PIN type. The system design was simulated with a code for electronic circuits. With results of simulation phase was constructed the electronic phase that is coupled to a multichannel analyzer. The resulting electronic is evaluated analyzing the electronic circuit performance before an alphas triple source and alpha radiation that produce two smoke detectors of domestic use. On the tests phase we find that the system allows obtain, in a multichannel, the pulses height spectrum, with which we calibrate the system. (Author)

  19. [Tumor necrosis factor alfa in cardiovascular diseases: molecular biology and genetics]. (United States)

    Fragoso Lona, José Manuel; Sierra Martínez, Mónica; Vargas Alarcón, Gilberto; Barrios Rodas, Angélica; Ramírez Bello, Julián


    Cardiovascular diseases are a major public health problem globally. In 1997, cardiovascular disease caused 41% of deaths in the United States. It has been reported that about 60 million people in the United States have some form of cardiovascular disease. These entities are chronic conditions initiated by a dysregulation of the immune response. One gene and its protein product -tumor necrosis factor a (TNF-α)- a powerful pleiotropic cytokine with multiple cellular functions, plays a role in the inflammation, initiation, development, susceptibility, severity, and response to treatment, etc. of coronary artery disease (CAD). The focus of the present review is to summarize recent evidence showing the biological role of TNF-α in the initiation and progression of endothelial dysfunction and complications of atherosclerosis, and as a genetic variation of TNF-α confer susceptibility, severity, and treatment response in CAD: ST-segment elevation myocardial infarction and non-ST segment elevation myocardial infarction, unstable angina, and coronary restenosis.

  20. [Multiple extrahepatic manifestations in a patient with chronic hepatitis C treated with interferon-alfa]. (United States)

    Napoli, Nicola; Tortorella, Cosimo; Deramo, Maria Teresa; Antonaci, Alessandra; Parisi, Carmen Vita; Antonaci, Salvatore


    The case of a 61-years-old female patient with chronic hepatitis C who developed multiple consecutive extrahepatic manifestations is reported. One of these manifestations (lichen planus) appeared before HCV-related chronic hepatitis was diagnosed and treated with interferon-alpha, suggesting that it was likely associated with HCV itself. Other manifestations appeared during IFN-alpha treatment (polyarthritis) or after the end of treatment (ulcerative cholitis, sarcoidosis) implying a role for either HCV or IFN-alpha treatment in the pathogenesis of extrahepatic manifestations.

  1. Comportamiento frente a la oxidación de aleaciones de titanio alfa + beta


    Vicente Escuder, Ángel; Schalht, A.; Amigó Mata, Angèlica; Amigó Borrás, Vicente


    Las aleaciones +, presentan excelentes propiedades mecánicas y frente a la corrosión lo que las hace excelentes candidatas para su aplicación en la industria química y aeronáutica, pero es importante mejorar su comportamiento frente a elevadas temperaturas, sobre todo su oxidación a esas temperaturas. En el presente trabajo se estudia la obtención de aleaciones + del tipo Ti-3%at. X (Nb, Mo, Ta) por vía pulvimetalúrgica a partir de mezcla elemental de polvos...

  2. Structural Evolution of Human Recombinant alfaB-Crystallin under UV Irradiation

    DEFF Research Database (Denmark)

    Sugiyama, Masaaki; Fujii, Noriko; Morimoto, Yukio;


    External stresses cause certain proteins to lose their regular structure and aggregate. In order to clarify this abnormal aggregation process, a structural evolution of human recombinant aB-crystallin under UV irradiation was observed with in situ small-angle neutron scattering. The abnormal...

  3. Development and application of novel multicomponent reactions using (a)alfa-acidic isocyanides

    NARCIS (Netherlands)

    Bon, R.S.


    The research described in this thesis deals with: i) the exploitation of the a-acidity of isocyanides in the development of new multicomponent reactions; ii) the application of such MCRs for the synthesis of NHC complexes; and iii) the C–2 functionalisation of 2 imidazolines as a route towards libr

  4. Development and application of novel multicomponent reactions using (a)alfa-acidic isocyanides


    Bon, R.S.


    The research described in this thesis deals with: i) the exploitation of the a-acidity of isocyanides in the development of new multicomponent reactions; ii) the application of such MCRs for the synthesis of NHC complexes; and iii) the C–2 functionalisation of 2 imidazolines as a route towards libraries of potential p53-MDM2 interaction inhibitors. In Chapter 2, the translation of Schöllkopf’s aldol type chemistry with a-isocyanoacetates to a novel multicomponent synthesis of 2H-2-imidazoline...

  5. Effects of Darbepoetin Alfa with exercise in cancer patients undergoing chemotherapy: an explorative study

    DEFF Research Database (Denmark)

    Rørth, Mikael; Rich Madsen, Katrine; Burmølle, Stine Hvid;


    Fatigue is frequent in cancer patients undergoing chemotherapy. Erythropoietins (EPO) have shown well-documented effects on these patients, and administered in pharmacological doses, may reduce the need for transfusion of blood cells and improve quality of life (QoL). An explorative, descriptive,...

  6. Drug: D05201 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05201 Drug Nonacog alfa (genetical recombination) (JAN); Nonacog alfa (USAN/INN); ...3 Plasma preparations D05201 Nonacog alfa (genetical recombination) (JAN); Nonacog alfa (USAN/INN) Anatomica...onacog alfa D05201 Nonacog alfa (genetical recombination) (JAN); Nonacog alfa (USAN/INN) CAS: 181054-95-5 113478-33-4 PubChem: 47206920 ...

  7. Terapêutica médica na hiperplasia benigna da próstata


    Silva, Odila Nunes da


    A hiperplasia benigna da próstata (HBP) é um tumor benigno da glândula prostática. A prevalência da HBP aumenta com a idade. A HBP manifesta-se comummente pelos sintomas do tracto urinário baixo (LUTS). O tratamento da HBP mudou drasticamente nos últimos 20 anos. A terapêutica médica clássica para a HBP compreende os antagonistas adrenérgicos alfa-1, os inibidores da enzima 5-alfa redutase, a terapêutica de associação com um antagonista adrenérgico alfa-1 e um inibidor da 5-alfa redutase e a ...

  8. A randomized, double-blind, placebo-controlled assessment of BMS-936558, a fully human monoclonal antibody to programmed death-1 (PD-1, in patients with chronic hepatitis C virus infection.

    Directory of Open Access Journals (Sweden)

    David Gardiner

    Full Text Available Expression of the programmed death 1 (PD-1 receptor and its ligands are implicated in the T cell exhaustion phenotype which contributes to the persistence of several chronic viral infections, including human hepatitis C virus (HCV. The antiviral potential of BMS-936558 (MDX-1106 - a fully human anti-PD-1 monoclonal immunoglobulin-G4 that blocks ligand binding - was explored in a proof-of-concept, placebo-controlled single-ascending-dose study in patients (N = 54 with chronic HCV infection. Interferon-alfa treatment-experienced patients (n = 42 were randomized 5∶1 to receive a single infusion of BMS-936558 (0.03, 0.1, 0.3, 1.0, 3.0 mg/kg [n = 5 each] or 10 mg/kg [n = 10] or of placebo (n = 7. An additional 12 HCV treatment-naïve patients were randomized to receive 10 mg/kg BMS-936558 (n = 10 or placebo (n = 2. Patients were followed for 85 days post-dose. Five patients who received BMS-936558 (0.1 [n = 1] or 10 mg/kg and one placebo patient achieved the primary study endpoint of a reduction in HCV RNA ≥0.5 log10 IU/mL on at least 2 consecutive visits; 3 (10 mg/kg achieved a >4 log10 reduction. Two patients (10 mg/kg achieved HCV RNA below the lower limit of quantitation (25 IU/mL, one of whom (a prior null-responder remained RNA-undetectable 1 year post-study. Transient reductions in CD4(+, CD8(+ and CD19(+ cells, including both naïve and memory CD4(+ and CD8(+ subsets, were observed at Day 2 without evidence of immune deficit. No clinically relevant changes in immunoglobulin subsets or treatment-related trends in circulating cytokines were noted. BMS-936558 exhibited dose-related exposure increases, with a half-life of 20-24 days. BMS-936558 was mostly well tolerated. One patient (10 mg/kg experienced an asymptomatic grade 4 ALT elevation coincident with the onset of a 4-log viral load reduction. Six patients exhibited immune-related adverse events of mild-to-moderate intensity, including two cases of

  9. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae


    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  10. Drug: D05401 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05401 Drug Octocog alfa (genetical recombination) (JAN); Octocog alfa (INN); Kogen...eparations D05401 Octocog alfa (genetical recombination) (JAN); Octocog alfa (INN) CAS: 139076-62-3 PubChem: 17398295 ...

  11. GLP-1

    DEFF Research Database (Denmark)

    Aaboe, Kasper; Krarup, Thure; Madsbad, Sten


    Glucagon-like peptide 1 (GLP-1) is a gut-derived incretin hormone with the potential to change diabetes. The physiological effects of GLP-1 are multiple, and many seem to ameliorate the different conditions defining the diverse physiopathology seen in type 2 diabetes. In animal studies, GLP-1...... and endothelial dysfunction. Enhancing incretin action for therapeutic use includes GLP-1 receptor agonists resistant to degradation (incretin mimetics) and dipeptidyl peptidase (DPP)-4 inhibitors. In clinical trials with type 2 diabetic patients on various oral antidiabetic regimes, both treatment modalities...

  12. Colestase neonatal prolongada: estudo prospectivo Prolonged neonatal cholestasis: a prospective study

    Directory of Open Access Journals (Sweden)

    Elizabeth Teixeira Mendes Livramento PRADO


    Full Text Available Em razão da urgência de se decidir por um tratamento clínico ou por uma intervenção cirúrgica imediata, o estudo da colestase neonatal prolongada envolve dois objetivos básicos: o diagnóstico diferencial entre atresia biliar e hepatite neonatal e a pesquisa dos agentes etiológicos associados. Desta maneira, através de estudo prospectivo desenvolvido na década de 1970, foram avaliadas 77 crianças portadoras de colestase neonatal prolongada para estabelecer o diagnóstico diferencial entre atresia biliar e hepatite neonatal e, numa segunda fase, 108 crianças, visando esclarecer a etiopatogenia da colestase neonatal prolongada. Os resultados do diagnóstico diferencial revelaram que, dos 18 atributos avaliados, apenas oito mostraram-se bons indicadores de atresia biliar, em ordem decrescente: ductos proliferados (espaço-porta, fibrose (espaço-porta, colestase (espaço-porta, cor das fezes -- acolia, hepatomegalia, colestase canalicular (lóbulo, infiltrado (espaço-porta, células gigantes (lóbulo. Estes oito atributos foram então compostos, mediante uma ponderação, em um único indicador de grande poder discriminativo, capaz de decidir o diagnóstico diferencial em 99% dos casos. Quanto à etiopatogenia, registrou-se: vírus rubéola 0%, vírus herpes simples 0%, listeriose 0%, citomegalovirose 2,2%, vírus hepatite B 2,4%, toxoplasmose 2,8%, deficiência de alfa-1-antitripsina 13,1%, sífilis 21,1 %, auto-anticorpos hepáticos 58,4%. O trabalho desenvolvido mostra que as 8 variáveis mais decisivas, como indicadoras diferenciais entre atresia biliar e hepatite neonatal, permanecem como índices fundamentais, auxiliando, em conjunto com novos métodos diagnósticos, na composição de uma estratégia multifatorial cada vez menos invasiva e mais precisa. O estudo da etiopatogenia, dependente das condições epidemiológicas locais e da época, com a introdução de novos métodos diagnósticos, torna-se atualmente cada vez mais

  13. TRPML1. (United States)

    Colletti, Grace A; Kiselyov, Kirill


    TRPML1 (or mucolipin 1) is the first member of the TRP family of ion channels that was found to function in the lower portions of the endocytic pathway. Mutations in the gene coding for TRPML1 (MCOLN1) cause the lysosomal storage disease mucolipidosis type IV (MLIV). TRPML1 localization in the lysosomes and the similarity of mucolipidosis type IV phenotype to lysosomal storage diseases whose origin has been directly linked to lysosomal dysfunction, suggest that TRPML1 activity drives some vitally important processes within the endocytic machinery. The specific aspect(s) of TRPML1 activity that make it indispensable for the proper function of the endocytic pathway as well as the specific aspect(s) of the endocytic activity that depend on TRPML1 are currently being discussed. Among the candidates are: membrane fusion within the lower portion of the endocytic pathway possibly mediated by Ca(2+) release through TRPML1, or regulation of lysosomal ion homeostasis (pH or Fe content) by TRPML1. In addition to delineating the mechanisms of MLIV pathogenesis, identifying the role of TRPML1 in the endocytic pathway will lead to important developments in our understanding of the endocytic pathway and, due to the neurodegenerative nature of MLIV, of the integrative function of the cell. Moreover, molecular modulators of TRPML1 function may lead to novel approaches to modulating biological processes that depend on the endocytic pathway such as growth factor signaling. The present review will focus on the recent developments in identifying the TRPML1 function.

  14. Cirurgia redutora de volume pulmonar: critérios de seleção de pacientes no Hospital Universitário Antônio Pedro, Universidade Federal Fluminense, Niterói, Rio de Janeiro, RJ Lung volume reduction surgery (LVRS: criteria for selecting patient in Antonio Pedro Hospital, Federal Fluminense University, Niterói city, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Rodolfo Fred Behrsin


    Full Text Available O tratamento clínico da doença pulmonar obstrutiva crônica (DPOC está bem padronizado por consensos nacionais e internacionais. Junto com transplante pulmonar, a cirurgia redutora de volume pulmonar (CRVP é alternativa de tratamento cirúrgico para o enfisema. OBJETIVOS: Avaliar critérios de inclusão e exclusão para realização de CRVP em pacientes com DPOC. MÉTODOS: Trinta e um pacientes encaminhados e acompanhados no Ambulatório Multidisciplicar de Pesquisa em DPOC e Tabagismo dos Cursos de Pós-Graduação em Pneumologia da Universidade Federal Fluminense, submetidos a um protocolo de avaliação para seleção de candidatos à CRVP que incluiu anamnese e exame físico padronizados, espirometria com curva fluxo volume e teste com broncodilatador, gasometria arterial com paciente respirando ar ambiente, teste de caminhada por seis minutos (TC6M, radiografia convencional de tórax em póstero anterior e perfil esquerdo, tomografia computadorizada de tórax de alta resolução (TCAR e cintilografia pulmonar de ventilação e perfusão. Análise estatística: descritiva. RESULTADOS: Contra-indicações para CRVP: bronquite crônica (29% ou nove pacientes, VEF 1> 80,0% do previsto (13% ou quatro pacientes, recusa em realizar a cirurgia (10% ou três pacientes, áreas de fibrose, depressão e bronquiectasias (dois pacientes cada, nódulo pulmonar solitário neoplásico, obesidade mórbida, enfisema bolhoso grave, hipertensão pulmonar, passado de ressecção pulmonar, tabagismo corrente, enfisema difuso com deficiencia de alfa-1-antitripsina e doença cardiaca grave (um paciente cada. Um dos pacientes selecionados concordou e foi submetido à CRVP. Sua indicação foi enfisema pulmonar heterogênio com predomínio nos lobos superiores, diagnosticado pela TCAR e cintilografia pulmonar. CONCLUSÕES: Bronquite crônica representou a principal contra-indicação em 29% dos casos. Pacientes com indicação de CRVP, freqüentemente, apresentam

  15. Proteômica na sepse: estudo piloto Proteomics in sepsis: a pilot study

    Directory of Open Access Journals (Sweden)

    Rita Azevedo de Paiva


    Full Text Available Na sepse ocorre desregulação da expressão gênica. Os marcadores genéticos revelam apenas o genótipo do indivíduo, não sendo afetados pelos processos biológicos decorrentes da ação do ambiente, estes expressos nas proteínas. Este estudo teve como objetivo alcançar maior compreensão sobre as bases moleculares da sepse. Para tal realizou a identificação e análise da expressão diferencial de proteínas no soro de paciente séptico em diferentes estágios de gravidade (sepse, sepse grave e choque séptico através de técnicas proteômicas. Amostras de soro referentes a cada estágio da sepse foram colhidas e submetidas à eletroforese unidimensional em fitas com gradiente de pH imobilizado seguida de eletroforese bidimensional em gel de poliacrilamida 12,5%. Os géis obtidos foram corados, escaneados e analisados através do programa ImageMasterPlatinum. As proteínas expressas diferencialmente nos géis foram excisadas, digeridas com tripsina e identificadas através de espectrometria de massa. Foram identificadas 14 proteínas expressas diferencialmente entre os estágios da sepse, assim como uma proteína não expressa em todos os estágios, sugerindo a existência de um possível biomarcador. Foram elas: amilóide sérico A, apolipoproteína A-1 (2 isoformas, proteína dedo de zinco 222, albumina humana, PRO 2619, imunoglobulina de cadeia leve kappa região VLJ, imunoglobulina M monoclonal de aglutinação a frio e 7 inibidoras de proteases - alfa-1 antitripsina. Os resultados obtidos neste estudo piloto demonstram a participação das vias do complemento e coagulação, do metabolismo lipídico e da informação genética na sepse. A grande maioria de proteínas identificadas está envolvida no sistema imune com predomínio das proteínas inibidoras de proteases.Gene expression is disrupted by sepsis. Genetic markers can only reveal a patient's genotype, and they are not affected by environmental biological processes. These

  16. TRPV1. (United States)

    Bevan, Stuart; Quallo, Talisia; Andersson, David A


    TRPV1 is a well-characterised channel expressed by a subset of peripheral sensory neurons involved in pain sensation and also at a number of other neuronal and non-neuronal sites in the mammalian body. Functionally, TRPV1 acts as a sensor for noxious heat (greater than ~42 °C). It can also be activated by some endogenous lipid-derived molecules, acidic solutions (pH pungent chemicals and food ingredients such as capsaicin, as well as by toxins such as resiniferatoxin and vanillotoxins. Structurally, TRPV1 subunits have six transmembrane (TM) domains with intracellular N- (containing 6 ankyrin-like repeats) and C-termini and a pore region between TM5 and TM6 containing sites that are important for channel activation and ion selectivity. The N- and C- termini have residues and regions that are sites for phosphorylation/dephosphorylation and PI(4,5)P2 binding, which regulate TRPV1 sensitivity and membrane insertion. The channel has several interacting proteins, some of which (e.g. AKAP79/150) are important for TRPV1 phosphorylation. Four TRPV1 subunits form a non-selective, outwardly rectifying ion channel permeable to monovalent and divalent cations with a single-channel conductance of 50-100 pS. TRPV1 channel kinetics reveal multiple open and closed states, and several models for channel activation by voltage, ligand binding and temperature have been proposed. Studies with TRPV1 agonists and antagonists and Trpv1 (-/-) mice have suggested a role for TRPV1 in pain, thermoregulation and osmoregulation, as well as in cough and overactive bladder. TRPV1 antagonists have advanced to clinical trials where findings of drug-induced hyperthermia and loss of heat sensitivity have raised questions about the viability of this therapeutic approach.

  17. TRPA1. (United States)

    García-Añoveros, J; Nagata, K


    The TRPA1 protein has up to 18 N-terminal and presumed cytoplasmic ankyrin repeats followed by the six membrane spanning and single pore-loop domains characteristic of all TRPs. In mice, TRPA1 is almost exclusively expressed in nociceptive neurons of peripheral ganglia and in all the mechanosensory epithelia of inner ear. In nociceptive neurons, TRPA1 mediates the response to the proalgesic bradykinin as well as the response to pungent irritants found in mustards and garlic, and probably also to those found in cinnamon and tear gas. The channel properties of TRPA1 are discussed and compared to those of sensory transducers. TRPA1 is well conserved across the animal kingdom, with likely orthologs from human to nematode, which suggest an ancestral role for this channel, probably in sensation.

  18. Paucity of intrahepatic bile ducts in infancy: experience of a tertiary center Hipoplasia de vias biliares intra-hepáticas na infância: experiência de um serviço terciário

    Directory of Open Access Journals (Sweden)

    Adriana Maria Alves De Tommaso


    ória, características clínicas e bioquímicas, etiologia e evolução de crianças com hipoplasia das vias biliares intra-hepáticas acompanhadas em serviço terciário. CASUÍSTICA E MÉTODOS: Foram avaliadas 11 crianças com hipoplasia das vias biliares intra-hepáticas acompanhadas no ambulatório de Hepatologia Pediátrica do Hospital de Clínicas da Faculdade de Ciências Médicas da Universidade Estadual de Campinas, SP, no período de 1986 a 2001. RESULTADOS: Dos pacientes avaliados, três apresentavam a forma sindrômica e oito a forma não-sindrômica (dois com deficiência de alfa-1-antitripsina, um com lues, um como secundário a sepse, três com provável etiologia pelo citomegalovírus e um sem etiologia definida. A idade à época da primeira consulta variou de 31 a 1185 dias. O peso de nascimento variou de 1920 g a 3590 g. A maior parte dos pacientes apresentava alteração na coloração das fezes como apresentação inicial do quadro clínico. A mediana da relação ducto/espaço porta foi de 0,14. Com relação à evolução, a maioria das crianças apresentou evolução favorável, independente da forma de apresentação. CONCLUSÃO: A hipoplasia das vias biliares deve ser considerada em crianças com colestase e sua diferenciação com as causas extra-hepáticas de colestase neonatal é importante para se evitar cirurgia. O diagnóstico da forma não-sindrômica não deve ser considerado como de mau prognóstico, pois provavelmente, a evolução deve estar relacionada com a etiologia dessa forma de apresentação.

  19. 1+1 Gaudin Model

    Directory of Open Access Journals (Sweden)

    Andrei V. Zotov


    Full Text Available We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic curve. In sl(2 case we study the equations in detail and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve. We also analyze the 2-site case in its own right and describe its relation to the principal chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  20. 1+1 Gaudin Model

    CERN Document Server

    Zotov, A


    We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N) case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic cure. In sl(2) case we study the equations in details and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve). We also analyze the 2-site case in its own right and describe its relation to the principle chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  1. Leucograma e teores plasmáticos de proteínas de fase aguda de eqüinos portadores de abdômen agudo e submetidos à laparotomia Leukogram and plasma acute phase protein concentrations in horses with acute abdomen submitted to treatment by laparotomy

    Directory of Open Access Journals (Sweden)

    J.J. Fagliari


    Full Text Available Foram examinados 20 eqüinos adultos portadores de abdômen agudo e submetidos à laparotomia. Dez recuperaram-se sem intercorrência pós-operatória (G1 e 10 foram a óbito sete a 10 dias após a cirurgia, com sinais de choque séptico (G2. Avaliaram-se temperatura retal, freqüências cardíaca e respiratória, tempo de preenchimento capilar e teores plasmáticos das proteínas de fase aguda - fibrinogênio, ceruloplasmina, proteína C-reativa, antitripsina, haptoglobina e glicoproteína ácida -, antes e até sete dias após a laparotomia. As leucometrias às 72h e no sétimo dia pós-operatório dos eqüinos que foram a óbito foram, respectivamente, 34,6% e 57,1%, mais altas que a dos animais curados. Os maiores valores de proteína de fase aguda ocorreram no sétimo dia após a cirurgia; os percentuais de elevação de fibrinogênio, antitripsina, glicoproteina ácida, proteína C-reativa, ceruloplasmina e haptoglobina de eqüinos do G2 em relação ao G1 foram 46,8%, 67,9%, 91,9%, 112,2%, 126,9% e 186,2%, respectivamente.Twenty adult horses with acute abdomen were examined and submitted to treatment by laparotomy; ten had no postoperative complication (group 1, and ten showed septic shock symptom and died from seven to ten days after surgery (group 2. Body temperature, heart and respiratory rates, filling capillary time, and plasma acute phase protein concentrations - fibrinogen, ceruloplasmin, C-reactive protein, antitrypsin, haptoglobin, and acid glycoprotein - were evaluated before laparotomy and until seven days after surgery. White blood cell counts at 72h and seven days after surgery in group 2 animals were, respectively, 34.6% and 57.1%, and were higher than those measured in group 1 horses. The highest values of acute phase proteins occurred on the seventh day after surgery. The increase percentages of fibrinogen, antitrypsin, acid glycoprotein, C-reactive protein, ceruloplasmin, and haptoglobin plasma concentrations in group 2

  2. Shootin1

    DEFF Research Database (Denmark)

    Toriyama, Michinori; Shimada, Tadayuki; Kim, Ki Bum;


    Neurons have the remarkable ability to polarize even in symmetrical in vitro environments. Although recent studies have shown that asymmetric intracellular signals can induce neuronal polarization, it remains unclear how these polarized signals are organized without asymmetric cues. We describe...... a novel protein, named shootin1, that became up-regulated during polarization of hippocampal neurons and began fluctuating accumulation among multiple neurites. Eventually, shootin1 accumulated asymmetrically in a single neurite, which led to axon induction for polarization. Disturbing the asymmetric...... to the growth cones and diffused back to the soma; inhibiting this transport prevented its asymmetric accumulation in neurons. We propose that shootin1 is involved in the generation of internal asymmetric signals required for neuronal polarization....

  3. Danida1

    DEFF Research Database (Denmark)

    Henriksen, Mogens


    At the request of Danish Ministry of Foreign Affairs, Department TSA.4, electrical testing of possibly damaged cables has been evaluated. This matter concerns three different types of cable, which are10 km 30(36) kV XLPE armoured submarine power cable, 1-phase15 km 30(36) kV XLPE armoured...... underground power cable, 1-phase20 km 10(12) kV XLPE armoured underground power cable, 3-phase.The possible damage of said cables took place during shipment from Denmark to Bangladesh....

  4. Measurement of the total cross section from elastic scattering in pp collisions at 1.gif" overflow="scroll" xmlns:xocs="" xmlns:xs="" xmlns:xsi="" xmlns="" xmlns:ja="" xmlns:mml="" xmlns:tb="" xmlns:sb="" xmlns:ce="" xmlns:xlink="" xmlns:cals="" xmlns:sa="">s=8 TeV with the ATLAS detector

    Energy Technology Data Exchange (ETDEWEB)

    Aaboud, M.; Aad, G.; Abbott, B.; Abdallah, J.; Abdinov, O.; Abeloos, B.; Aben, R.; AbouZeid, O. S.; Abraham, N. L.; Abramowicz, H.; Abreu, H.; Abreu, R.; Abulaiti, Y.; Acharya, B. S.; Adachi, S.; Adamczyk, L.; Adams, D. L.; Adelman, J.; Adomeit, S.; Adye, T.; Affolder, A. A.; Agatonovic-Jovin, T.; Agricola, J.; Aguilar-Saavedra, J. A.; Ahlen, S. P.; Ahmadov, F.; Aielli, G.; Akerstedt, H.; Åkesson, T. P. A.; Akimov, A. V.; Alberghi, G. L.; Albert, J.; Albrand, S.; Alconada Verzini, M. J.; Aleksa, M.; Aleksandrov, I. N.; Alexa, C.; Alexander, G.; Alexopoulos, T.; Alhroob, M.; Ali, B.; Aliev, M.; Alimonti, G.; Alison, J.; Alkire, S. P.; Allbrooke, B. M. M.; Allen, B. W.; Allport, P. P.; Aloisio, A.; Alonso, A.; Alonso, F.; Alpigiani, C.; Alshehri, A. A.; Alstaty, M.; Alvarez Gonzalez, B.; Álvarez Piqueras, D.; Alviggi, M. G.; Amadio, B. T.; Amako, K.; Amaral Coutinho, Y.; Amelung, C.; Amidei, D.; Amor Dos Santos, S. P.; Amorim, A.; Amoroso, S.; Amundsen, G.; Anastopoulos, C.; Ancu, L. S.; Andari, N.; Andeen, T.; Anders, C. F.; Anders, G.; Anders, J. K.; Anderson, K. J.; Andreazza, A.; Andrei, V.; Angelidakis, S.; Angelozzi, I.; Anger, P.; Angerami, A.; Anghinolfi, F.; Anisenkov, A. V.; Anjos, N.; Annovi, A.; Antel, C.; Antonelli, M.; Antonov, A.; Anulli, F.; Aoki, M.; Aperio Bella, L.; Arabidze, G.; Arai, Y.; Araque, J. P.; Arce, A. T. H.; Arduh, F. A.; Arguin, J-F.; Argyropoulos, S.; Arik, M.; Armbruster, A. J.; Armitage, L. J.; Arnaez, O.; Arnold, H.; Arratia, M.; Arslan, O.; Artamonov, A.; Artoni, G.; Artz, S.; Asai, S.; Asbah, N.; Ashkenazi, A.; Åsman, B.; Asquith, L.; Assamagan, K.; Astalos, R.; Atkinson, M.; Atlay, N. B.; Augsten, K.; Avolio, G.; Axen, B.; Ayoub, M. K.; Azuelos, G.; Baak, M. A.; Baas, A. E.; Baca, M. J.; Bachacou, H.; Bachas, K.; Backes, M.; Backhaus, M.; Bagiacchi, P.; Bagnaia, P.; Bai, Y.; Baines, J. T.; Baker, O. K.; Baldin, E. M.; Balek, P.; Balestri, T.; Balli, F.; Balunas, W. K.; Banas, E.; Banerjee, Sw.; Bannoura, A. A. E.; Barak, L.; Barberio, E. L.; Barberis, D.; Barbero, M.; Barillari, T.; Barisits, M-S; Barklow, T.; Barlow, N.; Barnes, S. L.; Barnett, B. M.; Barnett, R. M.; Barnovska-Blenessy, Z.; Baroncelli, A.; Barone, G.; Barr, A. J.; Barranco Navarro, L.; Barreiro, F.; Barreiro Guimarães da Costa, J.; Bartoldus, R.; Barton, A. E.; Bartos, P.; Basalaev, A.; Bassalat, A.; Bates, R. L.; Batista, S. J.; Batley, J. R.; Battaglia, M.; Bauce, M.; Bauer, F.; Bawa, H. S.; Beacham, J. B.; Beattie, M. D.; Beau, T.; Beauchemin, P. H.; Bechtle, P.; Beck, H. P.; Becker, K.; Becker, M.; Beckingham, M.; Becot, C.; Beddall, A. J.; Beddall, A.; Bednyakov, V. A.; Bedognetti, M.; Bee, C. P.; Beemster, L. J.; Beermann, T. A.; Begel, M.; Behr, J. K.; Belanger-Champagne, C.; Bell, A. S.; Bella, G.; Bellagamba, L.; Bellerive, A.; Bellomo, M.; Belotskiy, K.; Beltramello, O.; Belyaev, N. L.; Benary, O.; Benchekroun, D.; Bender, M.; Bendtz, K.; Benekos, N.; Benhammou, Y.; Benhar Noccioli, E.; Benitez, J.; Benjamin, D. P.; Bensinger, J. R.; Bentvelsen, S.; Beresford, L.; Beretta, M.; Berge, D.; Bergeaas Kuutmann, E.; Berger, N.; Beringer, J.; Berlendis, S.; Bernard, N. R.; Bernius, C.; Bernlochner, F. U.; Berry, T.; Berta, P.; Bertella, C.; Bertoli, G.; Bertolucci, F.; Bertram, I. A.; Bertsche, C.; Bertsche, D.; Besjes, G. J.; Bessidskaia Bylund, O.; Bessner, M.; Besson, N.; Betancourt, C.; Bethani, A.; Bethke, S.; Bevan, A. J.; Bianchi, R. M.; Bianchini, L.; Bianco, M.; Biebel, O.; Biedermann, D.; Bielski, R.; Biesuz, N. V.; Biglietti, M.; Bilbao De Mendizabal, J.; Billoud, T. R. V.; Bilokon, H.; Bindi, M.; Binet, S.; Bingul, A.; Bini, C.; Biondi, S.; Bisanz, T.; Bjergaard, D. M.; Black, C. W.; Black, J. E.; Black, K. M.; Blackburn, D.; Blair, R. E.; Blanchard, J. -B.; Blazek, T.; Bloch, I.; Blocker, C.; Blue, A.; Blum, W.; Blumenschein, U.; Blunier, S.; Bobbink, G. J.; Bobrovnikov, V. S.; Bocchetta, S. S.; Bocci, A.; Bock, C.; Boehler, M.; Boerner, D.; Bogaerts, J. A.; Bogavac, D.; Bogdanchikov, A. G.; Bohm, C.; Boisvert, V.; Bokan, P.; Bold, T.; Boldyrev, A. S.; Bomben, M.; Bona, M.; Boonekamp, M.; Borisov, A.; Borissov, G.; Bortfeldt, J.; Bortoletto, D.; Bortolotto, V.; Bos, K.; Boscherini, D.; Bosman, M.; Bossio Sola, J. D.; Boudreau, J.; Bouffard, J.; Bouhova-Thacker, E. V.; Boumediene, D.; Bourdarios, C.; Boutle, S. K.; Boveia, A.; Boyd, J.; Boyko, I. R.; Bracinik, J.; Brandt, A.; Brandt, G.; Brandt, O.; Bratzler, U.; Brau, B.; Brau, J. E.; Breaden Madden, W. D.; Brendlinger, K.; Brennan, A. J.; Brenner, L.; Brenner, R.; Bressler, S.; Bristow, T. M.; Britton, D.; Britzger, D.; Brochu, F. M.; Brock, I.; Brock, R.; Brooijmans, G.; Brooks, T.; Brooks, W. K.; Brosamer, J.; Brost, E.; Broughton, J. H.; Bruckman de Renstrom, P. A.; Bruncko, D.; Bruneliere, R.; Bruni, A.; Bruni, G.; Bruni, L. S.; Brunt, BH; Bruschi, M.; Bruscino, N.; Bryant, P.; Bryngemark, L.; Buanes, T.; Buat, Q.; Buchholz, P.; Buckley, A. G.; Budagov, I. A.; Buehrer, F.; Bugge, M. K.; Bulekov, O.; Bullock, D.; Burckhart, H.; Burdin, S.; Burgard, C. D.; Burghgrave, B.; Burka, K.; Burke, S.; Burmeister, I.; Burr, J. T. P.; Busato, E.; Büscher, D.; Büscher, V.; Bussey, P.; Butler, J. M.; Buttar, C. M.; Butterworth, J. M.; Butti, P.; Buttinger, W.; Buzatu, A.; Buzykaev, A. R.; Cabras, G.; Cabrera Urbán, S.; Caforio, D.; Cairo, V. M.; Cakir, O.; Calace, N.; Calafiura, P.; Calandri, A.; Calderini, G.; Calfayan, P.; Callea, G.; Caloba, L. P.; Calvente Lopez, S.; Calvet, D.; Calvet, S.; Calvet, T. P.; Camacho Toro, R.; Camarda, S.; Camarri, P.; Cameron, D.; Caminal Armadans, R.; Camincher, C.; Campana, S.; Campanelli, M.; Camplani, A.; Campoverde, A.; Canale, V.; Canepa, A.; Cano Bret, M.; Cantero, J.; Cao, T.; Capeans Garrido, M. D. M.; Caprini, I.; Caprini, M.; Capua, M.; Carbone, R. M.; Cardarelli, R.; Cardillo, F.; Carli, I.; Carli, T.; Carlino, G.; Carminati, L.; Caron, S.; Carquin, E.; Carrillo-Montoya, G. D.; Carter, J. R.; Carvalho, J.; Casadei, D.; Casado, M. P.; Casolino, M.; Casper, D. W.; Castaneda-Miranda, E.; Castelijn, R.; Castelli, A.; Castillo Gimenez, V.; Castro, N. F.; Catinaccio, A.; Catmore, J. R.; Cattai, A.; Caudron, J.; Cavaliere, V.; Cavallaro, E.; Cavalli, D.; Cavalli-Sforza, M.; Cavasinni, V.; Ceradini, F.; Cerda Alberich, L.; Cerio, B. C.; Cerqueira, A. S.; Cerri, A.; Cerrito, L.; Cerutti, F.; Cerv, M.; Cervelli, A.; Cetin, S. A.; Chafaq, A.; Chakraborty, D.; Chan, S. K.; Chan, Y. L.; Chang, P.; Chapman, J. D.; Charlton, D. G.; Chatterjee, A.; Chau, C. C.; Chavez Barajas, C. A.; Che, S.; Cheatham, S.; Chegwidden, A.; Chekanov, S.; Chekulaev, S. V.; Chelkov, G. A.; Chelstowska, M. A.; Chen, C.; Chen, H.; Chen, K.; Chen, S.; Chen, S.; Chen, X.; Chen, Y.; Cheng, H. C.; Cheng, H. J.; Cheng, Y.; Cheplakov, A.; Cheremushkina, E.; Cherkaoui El Moursli, R.; Chernyatin, V.; Cheu, E.; Chevalier, L.; Chiarella, V.; Chiarelli, G.; Chiodini, G.; Chisholm, A. S.; Chitan, A.; Chizhov, M. V.; Choi, K.; Chomont, A. R.; Chouridou, S.; Chow, B. K. B.; Christodoulou, V.; Chromek-Burckhart, D.; Chudoba, J.; Chuinard, A. J.; Chwastowski, J. J.; Chytka, L.; Ciapetti, G.; Ciftci, A. K.; Cinca, D.; Cindro, V.; Cioara, I. A.; Ciocca, C.; Ciocio, A.; Cirotto, F.; Citron, Z. H.; Citterio, M.; Ciubancan, M.; Clark, A.; Clark, B. L.; Clark, M. R.; Clark, P. J.; Clarke, R. N.; Clement, C.; Coadou, Y.; Cobal, M.; Coccaro, A.; Cochran, J.; Colasurdo, L.; Cole, B.; Colijn, A. P.; Collot, J.; Colombo, T.; Compostella, G.; Conde Muiño, P.; Coniavitis, E.; Connell, S. H.; Connelly, I. A.; Consorti, V.; Constantinescu, S.; Conti, G.; Conventi, F.; Cooke, M.; Cooper, B. D.; Cooper-Sarkar, A. M.; Cormier, K. J. R.; Cornelissen, T.; Corradi, M.; Corriveau, F.; Corso-Radu, A.; Cortes-Gonzalez, A.; Cortiana, G.; Costa, G.; Costa, M. J.; Costanzo, D.; Cottin, G.; Cowan, G.; Cox, B. E.; Cranmer, K.; Crawley, S. J.; Cree, G.; Crépé-Renaudin, S.; Crescioli, F.; Cribbs, W. A.; Crispin Ortuzar, M.; Cristinziani, M.; Croft, V.; Crosetti, G.; Cueto, A.; Cuhadar Donszelmann, T.; Cummings, J.; Curatolo, M.; Cúth, J.; Czirr, H.; Czodrowski, P.; D' amen, G.; D' Auria, S.; D' Onofrio, M.; Da Cunha Sargedas De Sousa, M. J.; Da Via, C.; Dabrowski, W.; Dado, T.; Dai, T.; Dale, O.; Dallaire, F.; Dallapiccola, C.; Dam, M.; Dandoy, J. R.; Dang, N. P.; Daniells, A. C.; Dann, N. S.; Danninger, M.; Dano Hoffmann, M.; Dao, V.; Darbo, G.; Darmora, S.; Dassoulas, J.; Dattagupta, A.; Davey, W.; David, C.; Davidek, T.; Davies, M.; Davison, P.; Dawe, E.; Dawson, I.; De, K.; de Asmundis, R.; De Benedetti, A.; De Castro, S.; De Cecco, S.; De Groot, N.; de Jong, P.; De la Torre, H.; De Lorenzi, F.; De Maria, A.; De Pedis, D.; De Salvo, A.; De Sanctis, U.; De Santo, A.; De Vivie De Regie, J. B.; Dearnaley, W. J.; Debbe, R.; Debenedetti, C.; Dedovich, D. V.; Dehghanian, N.; Deigaard, I.; Del Gaudio, M.; Del Peso, J.; Del Prete, T.; Delgove, D.; Deliot, F.; Delitzsch, C. M.; Dell' Acqua, A.; Dell' Asta, L.; Dell' Orso, M.; Della Pietra, M.; della Volpe, D.; Delmastro, M.; Delsart, P. A.; DeMarco, D. A.; Demers, S.; Demichev, M.; Demilly, A.; Denisov, S. P.; Denysiuk, D.; Derendarz, D.; Derkaoui, J. E.; Derue, F.; Dervan, P.; Desch, K.; Deterre, C.; Dette, K.; Deviveiros, P. O.; Dewhurst, A.; Dhaliwal, S.; Di Ciaccio, A.; Di Ciaccio, L.; Di Clemente, W. K.; Di Donato, C.; Di Girolamo, A.; Di Girolamo, B.; Di Micco, B.; Di Nardo, R.; Di Simone, A.; Di Sipio, R.; Di Valentino, D.; Diaconu, C.; Diamond, M.; Dias, F. A.; Diaz, M. A.; Diehl, E. B.; Dietrich, J.; Díez Cornell, S.; Dimitrievska, A.; Dingfelder, J.; Dita, P.; Dita, S.; Dittus, F.; Djama, F.; Djobava, T.; Djuvsland, J. I.; do Vale, M. A. B.; Dobos, D.; Dobre, M.; Doglioni, C.; Dolejsi, J.; Dolezal, Z.; Donadelli, M.; Donati, S.; Dondero, P.; Donini, J.; Dopke, J.; Doria, A.; Dova, M. T.; Doyle, A. T.; Drechsler, E.; Dris, M.; Du, Y.; Duarte-Campderros, J.; Duchovni, E.; Duckeck, G.; Ducu, O. A.; Duda, D.; Dudarev, A.; Dudder, A. Chr.; Duffield, E. M.; Duflot, L.; Dührssen, M.; Dumancic, M.; Dunford, M.; Duran Yildiz, H.; Düren, M.; Durglishvili, A.; Duschinger, D.; Dutta, B.; Dyndal, M.; Eckardt, C.; Ecker, K. M.; Edgar, R. C.; Edwards, N. C.; Eifert, T.; Eigen, G.; Einsweiler, K.; Ekelof, T.; El Kacimi, M.; Ellajosyula, V.; Ellert, M.; Elles, S.; Ellinghaus, F.; Elliot, A. A.; Ellis, N.; Elmsheuser, J.; Elsing, M.; Emeliyanov, D.; Enari, Y.; Endner, O. C.; Ennis, J. S.; Erdmann, J.; Ereditato, A.; Ernis, G.; Ernst, J.; Ernst, M.; Errede, S.; Ertel, E.; Escalier, M.; Esch, H.; Escobar, C.; Esposito, B.; Etienvre, A. I.; Etzion, E.; Evans, H.; Ezhilov, A.; Ezzi, M.; Fabbri, F.; Fabbri, L.; Facini, G.; Fakhrutdinov, R. M.; Falciano, S.; Falla, R. J.; Faltova, J.; Fang, Y.; Fanti, M.; Farbin, A.; Farilla, A.; Farina, C.; Farina, E. M.; Farooque, T.; Farrell, S.; Farrington, S. M.; Farthouat, P.; Fassi, F.; Fassnacht, P.; Fassouliotis, D.; Faucci Giannelli, M.; Favareto, A.; Fawcett, W. J.; Fayard, L.; Fedin, O. L.; Fedorko, W.; Feigl, S.; Feligioni, L.; Feng, C.; Feng, E. J.; Feng, H.; Fenyuk, A. B.; Feremenga, L.; Fernandez Martinez, P.; Fernandez Perez, S.; Ferrando, J.; Ferrari, A.; Ferrari, P.; Ferrari, R.; Ferreira de Lima, D. E.; Ferrer, A.; Ferrere, D.; Ferretti, C.; Ferretto Parodi, A.; Fiedler, F.; Filipčič, A.; Filipuzzi, M.; Filthaut, F.; Fincke-Keeler, M.; Finelli, K. D.; Fiolhais, M. C. N.; Fiorini, L.; Firan, A.; Fischer, A.; Fischer, C.; Fischer, J.; Fisher, W. C.; Flaschel, N.; Fleck, I.; Fleischmann, P.; Fletcher, G. T.; Fletcher, R. R. M.; Flick, T.; Flores Castillo, L. R.; Flowerdew, M. J.; Forcolin, G. T.; Formica, A.; Forti, A.; Foster, A. G.; Fournier, D.; Fox, H.; Fracchia, S.; Francavilla, P.; Franchini, M.; Francis, D.; Franconi, L.; Franklin, M.; Frate, M.; Fraternali, M.; Freeborn, D.; Fressard-Batraneanu, S. M.; Friedrich, F.; Froidevaux, D.; Frost, J. A.; Fukunaga, C.; Fullana Torregrosa, E.; Fusayasu, T.; Fuster, J.; Gabaldon, C.; Gabizon, O.; Gabrielli, A.; Gabrielli, A.; Gach, G. P.; Gadatsch, S.; Gadomski, S.; Gagliardi, G.; Gagnon, L. G.; Gagnon, P.; Galea, C.; Galhardo, B.; Gallas, E. J.; Gallop, B. J.; Gallus, P.; Galster, G.; Gan, K. K.; Gao, J.; Gao, Y.; Gao, Y. S.; Garay Walls, F. M.; García, C.; García Navarro, J. E.; Garcia-Sciveres, M.; Gardner, R. W.; Garelli, N.; Garonne, V.; Gascon Bravo, A.; Gasnikova, K.; Gatti, C.; Gaudiello, A.; Gaudio, G.; Gauthier, L.; Gavrilenko, I. L.; Gay, C.; Gaycken, G.; Gazis, E. N.; Gecse, Z.; Gee, C. N. P.; Geich-Gimbel, Ch.; Geisen, M.; Geisler, M. P.; Gellerstedt, K.; Gemme, C.; Genest, M. H.; Geng, C.; Gentile, S.; Gentsos, C.; George, S.; Gerbaudo, D.; Gershon, A.; Ghasemi, S.; Ghneimat, M.; Giacobbe, B.; Giagu, S.; Giannetti, P.; Gibbard, B.; Gibson, S. M.; Gignac, M.; Gilchriese, M.; Gillam, T. P. S.; Gillberg, D.; Gilles, G.; Gingrich, D. M.; Giokaris, N.; Giordani, M. P.; Giorgi, F. M.; Giorgi, F. M.; Giraud, P. F.; Giromini, P.; Giugni, D.; Giuli, F.; Giuliani, C.; Giulini, M.; Gjelsten, B. K.; Gkaitatzis, S.; Gkialas, I.; Gkougkousis, E. L.; Gladilin, L. K.; Glasman, C.; Glatzer, J.; Glaysher, P. C. F.; Glazov, A.; Goblirsch-Kolb, M.; Godlewski, J.; Goldfarb, S.; Golling, T.; Golubkov, D.; Gomes, A.; Gonçalo, R.; Goncalves Pinto Firmino Da Costa, J.; Gonella, G.; Gonella, L.; Gongadze, A.; González de la Hoz, S.; Gonzalez Parra, G.; Gonzalez-Sevilla, S.; Goossens, L.; Gorbounov, P. A.; Gordon, H. A.; Gorelov, I.; Gorini, B.; Gorini, E.; Gorišek, A.; Gornicki, E.; Goshaw, A. T.; Gössling, C.; Gostkin, M. I.; Goudet, C. R.; Goujdami, D.; Goussiou, A. G.; Govender, N.; Gozani, E.; Graber, L.; Grabowska-Bold, I.; Gradin, P. O. J.; Grafström, P.; Gramling, J.; Gramstad, E.; Grancagnolo, S.; Gratchev, V.; Gravila, P. M.; Gray, H. M.; Graziani, E.; Greenwood, Z. D.; Grefe, C.; Gregersen, K.; Gregor, I. M.; Grenier, P.; Grevtsov, K.; Griffiths, J.; Grillo, A. A.; Grimm, K.; Grinstein, S.; Gris, Ph.; Grivaz, J. -F.; Groh, S.; Grohs, J. P.; Gross, E.; Grosse-Knetter, J.; Grossi, G. C.; Grout, Z. J.; Guan, L.; Guan, W.; Guenther, J.; Guescini, F.; Guest, D.; Gueta, O.; Guido, E.; Guillemin, T.; Guindon, S.; Gul, U.; Gumpert, C.; Guo, J.; Guo, Y.; Gupta, R.; Gupta, S.; Gustavino, G.; Gutierrez, P.; Gutierrez Ortiz, N. G.; Gutschow, C.; Guyot, C.; Gwenlan, C.; Gwilliam, C. B.; Haas, A.; Haber, C.; Hadavand, H. K.; Haddad, N.; Hadef, A.; Hageböck, S.; Hagihara, M.; Hajduk, Z.; Hakobyan, H.; Haleem, M.; Haley, J.; Halladjian, G.; Hallewell, G. D.; Hamacher, K.; Hamal, P.; Hamano, K.; Hamilton, A.; Hamity, G. N.; Hamnett, P. G.; Han, L.; Hanagaki, K.; Hanawa, K.; Hance, M.; Haney, B.; Hanke, P.; Hanna, R.; Hansen, J. B.; Hansen, J. D.; Hansen, M. C.; Hansen, P. H.; Hara, K.; Hard, A. S.; Harenberg, T.; Hariri, F.; Harkusha, S.; Harrington, R. D.; Harrison, P. F.; Hartjes, F.; Hartmann, N. M.; Hasegawa, M.; Hasegawa, Y.; Hasib, A.; Hassani, S.; Haug, S.; Hauser, R.; Hauswald, L.; Havranek, M.; Hawkes, C. M.; Hawkings, R. J.; Hayakawa, D.; Hayden, D.; Hays, C. P.; Hays, J. M.; Hayward, H. S.; Haywood, S. J.; Head, S. J.; Heck, T.; Hedberg, V.; Heelan, L.; Heim, S.; Heim, T.; Heinemann, B.; Heinrich, J. J.; Heinrich, L.; Heinz, C.; Hejbal, J.; Helary, L.; Hellman, S.; Helsens, C.; Henderson, J.; Henderson, R. C. W.; Heng, Y.; Henkelmann, S.; Henriques Correia, A. M.; Henrot-Versille, S.; Herbert, G. H.; Herde, H.; Herget, V.; Hernández Jiménez, Y.; Herten, G.; Hertenberger, R.; Hervas, L.; Hesketh, G. G.; Hessey, N. P.; Hetherly, J. W.; Hickling, R.; Higón-Rodriguez, E.; Hill, E.; Hill, J. C.; Hiller, K. H.; Hillier, S. J.; Hinchliffe, I.; Hines, E.; Hinman, R. R.; Hirose, M.; Hirschbuehl, D.; Hobbs, J.; Hod, N.; Hodgkinson, M. C.; Hodgson, P.; Hoecker, A.; Hoeferkamp, M. R.; Hoenig, F.; Hohn, D.; Holmes, T. R.; Homann, M.; Honda, T.; Hong, T. M.; Hooberman, B. H.; Hopkins, W. H.; Horii, Y.; Horton, A. J.; Hostachy, J-Y.; Hou, S.; Hoummada, A.; Howarth, J.; Hoya, J.; Hrabovsky, M.; Hristova, I.; Hrivnac, J.; Hryn' ova, T.; Hrynevich, A.; Hsu, C.; Hsu, P. J.; Hsu, S. -C.; Hu, Q.; Hu, S.; Huang, Y.; Hubacek, Z.; Hubaut, F.; Huegging, F.; Huffman, T. B.; Hughes, E. W.; Hughes, G.; Huhtinen, M.; Huo, P.; Huseynov, N.; Huston, J.; Huth, J.; Iacobucci, G.; Iakovidis, G.; Ibragimov, I.; Iconomidou-Fayard, L.; Ideal, E.; Idrissi, Z.; Iengo, P.; Igonkina, O.; Iizawa, T.; Ikegami, Y.; Ikeno, M.; Ilchenko, Y.; Iliadis, D.; Ilic, N.; Ince, T.; Introzzi, G.; Ioannou, P.; Iodice, M.; Iordanidou, K.; Ippolito, V.; Ishijima, N.; Ishino, M.; Ishitsuka, M.; Ishmukhametov, R.; Issever, C.; Istin, S.; Ito, F.; Iturbe Ponce, J. M.; Iuppa, R.; Iwanski, W.; Iwasaki, H.; Izen, J. M.; Izzo, V.; Jabbar, S.; Jackson, B.; Jackson, P.; Jain, V.; Jakobi, K. B.; Jakobs, K.; Jakobsen, S.; Jakoubek, T.; Jamin, D. O.; Jana, D. K.; Jansky, R.; Janssen, J.; Janus, M.; Jarlskog, G.; Javadov, N.; Javůrek, T.; Jeanneau, F.; Jeanty, L.; Jeng, G. -Y.; Jennens, D.; Jenni, P.; Jeske, C.; Jézéquel, S.; Ji, H.; Jia, J.; Jiang, H.; Jiang, Y.; Jiggins, S.; Jimenez Pena, J.; Jin, S.; Jinaru, A.; Jinnouchi, O.; Jivan, H.; Johansson, P.; Johns, K. A.; Johnson, W. J.; Jon-And, K.; Jones, G.; Jones, R. W. L.; Jones, S.; Jones, T. J.; Jongmanns, J.; Jorge, P. M.; Jovicevic, J.; Ju, X.; Juste Rozas, A.; Köhler, M. K.; Kaczmarska, A.; Kado, M.; Kagan, H.; Kagan, M.; Kahn, S. J.; Kaji, T.; Kajomovitz, E.; Kalderon, C. W.; Kaluza, A.; Kama, S.; Kamenshchikov, A.; Kanaya, N.; Kaneti, S.; Kanjir, L.; Kantserov, V. A.; Kanzaki, J.; Kaplan, B.; Kaplan, L. S.; Kapliy, A.; Kar, D.; Karakostas, K.; Karamaoun, A.; Karastathis, N.; Kareem, M. J.; Karentzos, E.; Karnevskiy, M.; Karpov, S. N.; Karpova, Z. M.; Karthik, K.; Kartvelishvili, V.; Karyukhin, A. N.; Kasahara, K.; Kashif, L.; Kass, R. D.; Kastanas, A.; Kataoka, Y.; Kato, C.; Katre, A.; Katzy, J.; Kawagoe, K.; Kawamoto, T.; Kawamura, G.; Kazanin, V. F.; Keeler, R.; Kehoe, R.; Keller, J. S.; Kempster, J. J.; Kentaro, K.; Keoshkerian, H.; Kepka, O.; Kerševan, B. P.; Kersten, S.; Keyes, R. A.; Khader, M.; Khalil-zada, F.; Khanov, A.; Kharlamov, A. G.; Kharlamova, T.; Khoo, T. J.; Khovanskiy, V.; Khramov, E.; Khubua, J.; Kido, S.; Kilby, C. R.; Kim, H. Y.; Kim, S. H.; Kim, Y. K.; Kimura, N.; Kind, O. M.; King, B. T.; King, M.; Kirk, J.; Kiryunin, A. E.; Kishimoto, T.; Kisielewska, D.; Kiss, F.; Kiuchi, K.; Kivernyk, O.; Kladiva, E.; Klein, M. H.; Klein, M.; Klein, U.; Kleinknecht, K.; Klimek, P.; Klimentov, A.; Klingenberg, R.; Klinger, J. A.; Klioutchnikova, T.; Kluge, E. -E.; Kluit, P.; Kluth, S.; Knapik, J.; Kneringer, E.; Knoops, E. B. F. G.; Knue, A.; Kobayashi, A.; Kobayashi, D.; Kobayashi, T.; Kobel, M.; Kocian, M.; Kodys, P.; Koehler, N. M.; Koffas, T.; Koffeman, E.; Koi, T.; Kolanoski, H.; Kolb, M.; Koletsou, I.; Komar, A. A.; Komori, Y.; Kondo, T.; Kondrashova, N.; Köneke, K.; König, A. C.; Kono, T.; Konoplich, R.; Konstantinidis, N.; Kopeliansky, R.; Koperny, S.; Köpke, L.; Kopp, A. K.; Korcyl, K.; Kordas, K.; Korn, A.; Korol, A. A.; Korolkov, I.; Korolkova, E. V.; Kortner, O.; Kortner, S.; Kosek, T.; Kostyukhin, V. V.; Kotwal, A.; Kourkoumeli-Charalampidi, A.; Kourkoumelis, C.; Kouskoura, V.; Kowalewska, A. B.; Kowalewski, R.; Kowalski, T. Z.; Kozakai, C.; Kozanecki, W.; Kozhin, A. S.; Kramarenko, V. A.; Kramberger, G.; Krasnopevtsev, D.; Krasny, M. W.; Krasznahorkay, A.; Kravchenko, A.; Kretz, M.; Kretzschmar, J.; Kreutzfeldt, K.; Krieger, P.; Krizka, K.; Kroeninger, K.; Kroha, H.; Kroll, J.; Kroseberg, J.; Krstic, J.; Kruchonak, U.; Krüger, H.; Krumnack, N.; Kruse, M. C.; Kruskal, M.; Kubota, T.; Kucuk, H.; Kuday, S.; Kuechler, J. T.; Kuehn, S.; Kugel, A.; Kuger, F.; Kuhl, A.; Kuhl, T.; Kukhtin, V.; Kukla, R.; Kulchitsky, Y.; Kuleshov, S.; Kuna, M.; Kunigo, T.; Kupco, A.; Kurashige, H.; Kurochkin, Y. A.; Kus, V.; Kuwertz, E. S.; Kuze, M.; Kvita, J.; Kwan, T.; Kyriazopoulos, D.; La Rosa, A.; La Rosa Navarro, J. L.; La Rotonda, L.; Lacasta, C.; Lacava, F.; Lacey, J.; Lacker, H.; Lacour, D.; Lacuesta, V. R.; Ladygin, E.; Lafaye, R.; Laforge, B.; Lagouri, T.; Lai, S.; Lammers, S.; Lampl, W.; Lançon, E.; Landgraf, U.; Landon, M. P. J.; Lanfermann, M. C.; Lang, V. S.; Lange, J. C.; Lankford, A. J.; Lanni, F.; Lantzsch, K.; Lanza, A.; Laplace, S.; Lapoire, C.; Laporte, J. F.; Lari, T.; Lasagni Manghi, F.; Lassnig, M.; Laurelli, P.; Lavrijsen, W.; Law, A. T.; Laycock, P.; Lazovich, T.; Lazzaroni, M.; Le, B.; Le Dortz, O.; Le Guirriec, E.; Le Quilleuc, E. P.; LeBlanc, M.; LeCompte, T.; Ledroit-Guillon, F.; Lee, C. A.; Lee, S. C.; Lee, L.; Lefebvre, B.; Lefebvre, G.; Lefebvre, M.; Legger, F.; Leggett, C.; Lehan, A.; Lehmann Miotto, G.; Lei, X.; Leight, W. A.; Leisos, A.; Leister, A. G.; Leite, M. A. L.; Leitner, R.; Lellouch, D.; Lemmer, B.; Leney, K. J. C.; Lenz, T.; Lenzi, B.; Leone, R.; Leone, S.; Leonidopoulos, C.; Leontsinis, S.; Lerner, G.; Leroy, C.; Lesage, A. A. J.; Lester, C. G.; Levchenko, M.; Levêque, J.; Levin, D.; Levinson, L. J.; Levy, M.; Lewis, D.; Leyko, A. M.; Leyton, M.; Li, B.; Li, C.; Li, H.; Li, H. L.; Li, L.; Li, L.; Li, Q.; Li, S.; Li, X.; Li, Y.; Liang, Z.; Liberti, B.; Liblong, A.; Lichard, P.; Lie, K.; Liebal, J.; Liebig, W.; Limosani, A.; Lin, S. C.; Lin, T. H.; Lindquist, B. E.; Lionti, A. E.; Lipeles, E.; Lipniacka, A.; Lisovyi, M.; Liss, T. M.; Lister, A.; Litke, A. M.; Liu, B.; Liu, D.; Liu, H.; Liu, H.; Liu, J.; Liu, J. B.; Liu, K.; Liu, L.; Liu, M.; Liu, M.; Liu, Y. L.; Liu, Y.; Livan, M.; Lleres, A.; Llorente Merino, J.; Lloyd, S. L.; Lo Sterzo, F.; Lobodzinska, E. M.; Loch, P.; Lockman, W. S.; Loebinger, F. K.; Loevschall-Jensen, A. E.; Loew, K. M.; Loginov, A.; Lohse, T.; Lohwasser, K.; Lokajicek, M.; Long, B. A.; Long, J. D.; Long, R. E.; Longo, L.; Looper, K. A.; López, J. A.; Lopez Mateos, D.; Lopez Paredes, B.; Lopez Paz, I.; Lopez Solis, A.; Lorenz, J.; Lorenzo Martinez, N.; Losada, M.; Lösel, P. J.; Lou, X.; Lounis, A.; Love, J.; Love, P. A.; Lu, H.; Lu, N.; Lubatti, H. J.; Luci, C.; Lucotte, A.; Luedtke, C.; Luehring, F.; Lukas, W.; Luminari, L.; Lundberg, O.; Lund-Jensen, B.; Luzi, P. M.; Lynn, D.; Lysak, R.; Lytken, E.; Lyubushkin, V.; Ma, H.; Ma, L. L.; Ma, Y.; Maccarrone, G.; Macchiolo, A.; Macdonald, C. M.; Maček, B.; Machado Miguens, J.; Madaffari, D.; Madar, R.; Maddocks, H. J.; Mader, W. F.; Madsen, A.; Maeda, J.; Maeland, S.; Maeno, T.; Maevskiy, A.; Magradze, E.; Mahlstedt, J.; Maiani, C.; Maidantchik, C.; Maier, A. A.; Maier, T.; Maio, A.; Majewski, S.; Makida, Y.; Makovec, N.; Malaescu, B.; Malecki, Pa.; Maleev, V. P.; Malek, F.; Mallik, U.; Malon, D.; Malone, C.; Malone, C.; Maltezos, S.; Malyukov, S.; Mamuzic, J.; Mancini, G.; Mandelli, L.; Mandić, I.; Maneira, J.; Manhaes de Andrade Filho, L.; Manjarres Ramos, J.; Mann, A.; Manousos, A.; Mansoulie, B.; Mansour, J. D.; Mantifel, R.; Mantoani, M.; Manzoni, S.; Mapelli, L.; Marceca, G.; March, L.; Marchiori, G.; Marcisovsky, M.; Marjanovic, M.; Marley, D. E.; Marroquim, F.; Marsden, S. P.; Marshall, Z.; Marti-Garcia, S.; Martin, B.; Martin, T. A.; Martin, V. J.; Martin dit Latour, B.; Martinez, M.; Martinez Outschoorn, V. I.; Martin-Haugh, S.; Martoiu, V. S.; Martyniuk, A. C.; Marx, M.; Marzin, A.; Masetti, L.; Mashimo, T.; Mashinistov, R.; Masik, J.; Maslennikov, A. L.; Massa, I.; Massa, L.; Mastrandrea, P.; Mastroberardino, A.; Masubuchi, T.; Mättig, P.; Mattmann, J.; Maurer, J.; Maxfield, S. J.; Maximov, D. A.; Mazini, R.; Mazza, S. M.; Mc Fadden, N. C.; Mc Goldrick, G.; Mc Kee, S. P.; McCarn, A.; McCarthy, R. L.; McCarthy, T. G.; McClymont, L. I.; McDonald, E. F.; Mcfayden, J. A.; Mchedlidze, G.; McMahon, S. J.; McPherson, R. A.; Medinnis, M.; Meehan, S.; Mehlhase, S.; Mehta, A.; Meier, K.; Meineck, C.; Meirose, B.; Melini, D.; Mellado Garcia, B. R.; Melo, M.; Meloni, F.; Mengarelli, A.; Menke, S.; Meoni, E.; Mergelmeyer, S.; Mermod, P.; Merola, L.; Meroni, C.; Merritt, F. S.; Messina, A.; Metcalfe, J.; Mete, A. S.; Meyer, C.; Meyer, C.; Meyer, J-P.; Meyer, J.; Meyer Zu Theenhausen, H.; Miano, F.; Middleton, R. P.; Miglioranzi, S.; Mijović, L.; Mikenberg, G.; Mikestikova, M.; Mikuž, M.; Milesi, M.; Milic, A.; Miller, D. W.; Mills, C.; Milov, A.; Milstead, D. A.; Minaenko, A. A.; Minami, Y.; Minashvili, I. A.; Mincer, A. I.; Mindur, B.; Mineev, M.; Minegishi, Y.; Ming, Y.; Mir, L. M.; Mistry, K. P.; Mitani, T.; Mitrevski, J.; Mitsou, V. A.; Miucci, A.; Miyagawa, P. S.; Mjörnmark, J. U.; Mlynarikova, M.; Moa, T.; Mochizuki, K.; Mohapatra, S.; Molander, S.; Moles-Valls, R.; Monden, R.; Mondragon, M. C.; Mönig, K.; Monk, J.; Monnier, E.; Montalbano, A.; Montejo Berlingen, J.; Monticelli, F.; Monzani, S.; Moore, R. W.; Morange, N.; Moreno, D.; Moreno Llácer, M.; Morettini, P.; Morgenstern, S.; Mori, D.; Mori, T.; Morii, M.; Morinaga, M.; Morisbak, V.; Moritz, S.; Morley, A. K.; Mornacchi, G.; Morris, J. D.; Mortensen, S. S.; Morvaj, L.; Mosidze, M.; Moss, J.; Motohashi, K.; Mount, R.; Mountricha, E.; Moyse, E. J. W.; Muanza, S.; Mudd, R. D.; Mueller, F.; Mueller, J.; Mueller, R. S. P.; Mueller, T.; Muenstermann, D.; Mullen, P.; Mullier, G. A.; Munoz Sanchez, F. J.; Murillo Quijada, J. A.; Murray, W. J.; Musheghyan, H.; Muškinja, M.; Myagkov, A. G.; Myska, M.; Nachman, B. P.; Nackenhorst, O.; Nagai, K.; Nagai, R.; Nagano, K.; Nagasaka, Y.; Nagata, K.; Nagel, M.; Nagy, E.; Nairz, A. M.; Nakahama, Y.; Nakamura, K.; Nakamura, T.; Nakano, I.; Namasivayam, H.; Naranjo Garcia, R. F.; Narayan, R.; Narrias Villar, D. I.; Naryshkin, I.; Naumann, T.; Navarro, G.; Nayyar, R.; Neal, H. A.; Nechaeva, P. Yu.; Neep, T. J.; Negri, A.; Negrini, M.; Nektarijevic, S.; Nellist, C.; Nelson, A.; Nemecek, S.; Nemethy, P.; Nepomuceno, A. A.; Nessi, M.; Neubauer, M. S.; Neumann, M.; Neves, R. M.; Nevski, P.; Newman, P. R.; Nguyen, D. H.; Nguyen Manh, T.; Nickerson, R. B.; Nicolaidou, R.; Nielsen, J.; Nikiforov, A.; Nikolaenko, V.; Nikolic-Audit, I.; Nikolopoulos, K.; Nilsen, J. K.; Nilsson, P.; Ninomiya, Y.; Nisati, A.; Nisius, R.; Nobe, T.; Nomachi, M.; Nomidis, I.; Nooney, T.; Norberg, S.; Nordberg, M.; Norjoharuddeen, N.; Novgorodova, O.; Nowak, S.; Nozaki, M.; Nozka, L.; Ntekas, K.; Nurse, E.; Nuti, F.; O' grady, F.; O' Neil, D. C.; O' Rourke, A. A.; O' Shea, V.; Oakham, F. G.; Oberlack, H.; Obermann, T.; Ocariz, J.; Ochi, A.; Ochoa, I.; Ochoa-Ricoux, J. P.; Oda, S.; Odaka, S.; Ogren, H.; Oh, A.; Oh, S. H.; Ohm, C. C.; Ohman, H.; Oide, H.; Okawa, H.; Okumura, Y.; Okuyama, T.; Olariu, A.; Oleiro Seabra, L. F.; Olivares Pino, S. A.; Oliveira Damazio, D.; Olszewski, A.; Olszowska, J.; Onofre, A.; Onogi, K.; Onyisi, P. U. E.; Oreglia, M. J.; Oren, Y.; Orestano, D.; Orlando, N.; Orr, R. S.; Osculati, B.; Ospanov, R.; Otero y Garzon, G.; Otono, H.; Ouchrif, M.; Ould-Saada, F.; Ouraou, A.; Oussoren, K. P.; Ouyang, Q.; Owen, M.; Owen, R. E.; Ozcan, V. E.; Ozturk, N.; Pachal, K.; Pacheco Pages, A.; Pacheco Rodriguez, L.; Padilla Aranda, C.; Pagáčová, M.; Pagan Griso, S.; Paganini, M.; Paige, F.; Pais, P.; Pajchel, K.; Palacino, G.; Palazzo, S.; Palestini, S.; Palka, M.; Pallin, D.; St. Panagiotopoulou, E.; Pandini, C. E.; Panduro Vazquez, J. G.; Pani, P.; Panitkin, S.; Pantea, D.; Paolozzi, L.; Papadopoulou, Th. D.; Papageorgiou, K.; Paramonov, A.; Paredes Hernandez, D.; Parker, A. J.; Parker, M. A.; Parker, K. A.; Parodi, F.; Parsons, J. A.; Parzefall, U.; Pascuzzi, V. R.; Pasqualucci, E.; Passaggio, S.; Pastore, Fr.; Pásztor, G.; Pataraia, S.; Pater, J. R.; Pauly, T.; Pearce, J.; Pearson, B.; Pedersen, L. E.; Pedersen, M.; Pedraza Lopez, S.; Pedro, R.; Peleganchuk, S. V.; Penc, O.; Peng, C.; Peng, H.; Penwell, J.; Peralva, B. S.; Perego, M. M.; Perepelitsa, D. V.; Perez Codina, E.; Perini, L.; Pernegger, H.; Perrella, S.; Peschke, R.; Peshekhonov, V. D.; Peters, K.; Peters, R. F. Y.; Petersen, B. A.; Petersen, T. C.; Petit, E.; Petridis, A.; Petridou, C.; Petroff, P.; Petrolo, E.; Petrov, M.; Petrucci, F.; Pettersson, N. E.; Peyaud, A.; Pezoa, R.; Phillips, P. W.; Piacquadio, G.; Pianori, E.; Picazio, A.; Piccaro, E.; Piccinini, M.; Pickering, M. A.; Piegaia, R.; Pilcher, J. E.; Pilkington, A. D.; Pin, A. W. J.; Pinamonti, M.; Pinfold, J. L.; Pingel, A.; Pires, S.; Pirumov, H.; Pitt, M.; Plazak, L.; Pleier, M. -A.; Pleskot, V.; Plotnikova, E.; Plucinski, P.; Pluth, D.; Poettgen, R.; Poggioli, L.; Pohl, D.; Polesello, G.; Poley, A.; Policicchio, A.; Polifka, R.; Polini, A.; Pollard, C. S.; Polychronakos, V.; Pommès, K.; Pontecorvo, L.; Pope, B. G.; Popeneciu, G. A.; Poppleton, A.; Pospisil, S.; Potamianos, K.; Potrap, I. N.; Potter, C. J.; Potter, C. T.; Poulard, G.; Poveda, J.; Pozdnyakov, V.; Pozo Astigarraga, M. E.; Pralavorio, P.; Pranko, A.; Prell, S.; Price, D.; Price, L. E.; Primavera, M.; Prince, S.; Prokofiev, K.; Prokoshin, F.; Protopopescu, S.; Proudfoot, J.; Przybycien, M.; Puddu, D.; Purohit, M.; Puzo, P.; Qian, J.; Qin, G.; Qin, Y.; Quadt, A.; Quayle, W. B.; Queitsch-Maitland, M.; Quilty, D.; Raddum, S.; Radeka, V.; Radescu, V.; Radhakrishnan, S. K.; Radloff, P.; Rados, P.; Ragusa, F.; Rahal, G.; Raine, J. A.; Rajagopalan, S.; Rammensee, M.; Rangel-Smith, C.; Ratti, M. G.; Rauscher, F.; Rave, S.; Ravenscroft, T.; Ravinovich, I.; Raymond, M.; Read, A. L.; Readioff, N. P.; Reale, M.; Rebuzzi, D. M.; Redelbach, A.; Redlinger, G.; Reece, R.; Reed, R. G.; Reeves, K.; Rehnisch, L.; Reichert, J.; Reiss, A.; Rembser, C.; Ren, H.; Rescigno, M.; Resconi, S.; Rezanova, O. L.; Reznicek, P.; Rezvani, R.; Richter, R.; Richter, S.; Richter-Was, E.; Ricken, O.; Ridel, M.; Rieck, P.; Riegel, C. J.; Rieger, J.; Rifki, O.; Rijssenbeek, M.; Rimoldi, A.; Rimoldi, M.; Rinaldi, L.; Ristić, B.; Ritsch, E.; Riu, I.; Rizatdinova, F.; Rizvi, E.; Rizzi, C.; Robertson, S. H.; Robichaud-Veronneau, A.; Robinson, D.; Robinson, J. E. M.; Robson, A.; Roda, C.; Rodina, Y.; Rodriguez Perez, A.; Rodriguez Rodriguez, D.; Roe, S.; Rogan, C. S.; Røhne, O.; Romaniouk, A.; Romano, M.; Romano Saez, S. M.; Romero Adam, E.; Rompotis, N.; Ronzani, M.; Roos, L.; Ros, E.; Rosati, S.; Rosbach, K.; Rose, P.; Rosien, N. -A.; Rossetti, V.; Rossi, E.; Rossi, L. P.; Rosten, J. H. N.; Rosten, R.; Rotaru, M.; Roth, I.; Rothberg, J.; Rousseau, D.; Rozanov, A.; Rozen, Y.; Ruan, X.; Rubbo, F.; Rudolph, M. S.; Rühr, F.; Ruiz-Martinez, A.; Rurikova, Z.; Rusakovich, N. A.; Ruschke, A.; Russell, H. L.; Rutherfoord, J. P.; Ruthmann, N.; Ryabov, Y. F.; Rybar, M.; Rybkin, G.; Ryu, S.; Ryzhov, A.; Rzehorz, G. F.; Saavedra, A. F.; Sabato, G.; Sacerdoti, S.; Sadrozinski, H. F-W.; Sadykov, R.; Safai Tehrani, F.; Saha, P.; Sahinsoy, M.; Saimpert, M.; Saito, T.; Sakamoto, H.; Sakurai, Y.; Salamanna, G.; Salamon, A.; Salazar Loyola, J. E.; Salek, D.; Sales De Bruin, P. H.; Salihagic, D.; Salnikov, A.; Salt, J.; Salvatore, D.; Salvatore, F.; Salvucci, A.; Salzburger, A.; Sammel, D.; Sampsonidis, D.; Sanchez, A.; Sánchez, J.; Sanchez Martinez, V.; Sandaker, H.; Sandbach, R. L.; Sander, H. G.; Sandhoff, M.; Sandoval, C.; Sankey, D. P. C.; Sannino, M.; Sansoni, A.; Santoni, C.; Santonico, R.; Santos, H.; Santoyo Castillo, I.; Sapp, K.; Sapronov, A.; Saraiva, J. G.; Sarrazin, B.; Sasaki, O.; Sato, K.; Sauvan, E.; Savage, G.; Savard, P.; Savic, N.; Sawyer, C.; Sawyer, L.; Saxon, J.; Sbarra, C.; Sbrizzi, A.; Scanlon, T.; Scannicchio, D. A.; Scarcella, M.; Scarfone, V.; Schaarschmidt, J.; Schacht, P.; Schachtner, B. M.; Schaefer, D.; Schaefer, L.; Schaefer, R.; Schaeffer, J.; Schaepe, S.; Schaetzel, S.; Schäfer, U.; Schaffer, A. C.; Schaile, D.; Schamberger, R. D.; Scharf, V.; Schegelsky, V. A.; Scheirich, D.; Schernau, M.; Schiavi, C.; Schier, S.; Schillo, C.; Schioppa, M.; Schlenker, S.; Schmidt-Sommerfeld, K. R.; Schmieden, K.; Schmitt, C.; Schmitt, S.; Schmitz, S.; Schneider, B.; Schnoor, U.; Schoeffel, L.; Schoening, A.; Schoenrock, B. D.; Schopf, E.; Schott, M.; Schovancova, J.; Schramm, S.; Schreyer, M.; Schuh, N.; Schulte, A.; Schultens, M. J.; Schultz-Coulon, H. -C.; Schulz, H.; Schumacher, M.; Schumm, B. A.; Schune, Ph.; Schwartzman, A.; Schwarz, T. A.; Schweiger, H.; Schwemling, Ph.; Schwienhorst, R.; Schwindling, J.; Schwindt, T.; Sciolla, G.; Scuri, F.; Scutti, F.; Searcy, J.; Seema, P.; Seidel, S. C.; Seiden, A.; Seifert, F.; Seixas, J. M.; Sekhniaidze, G.; Sekhon, K.; Sekula, S. J.; Seliverstov, D. M.; Semprini-Cesari, N.; Serfon, C.; Serin, L.; Serkin, L.; Sessa, M.; Seuster, R.; Severini, H.; Sfiligoj, T.; Sforza, F.; Sfyrla, A.; Shabalina, E.; Shaikh, N. W.; Shan, L. Y.; Shang, R.; Shank, J. T.; Shapiro, M.; Shatalov, P. B.; Shaw, K.; Shaw, S. M.; Shcherbakova, A.; Shehu, C. Y.; Sherwood, P.; Shi, L.; Shimizu, S.; Shimmin, C. O.; Shimojima, M.; Shirabe, S.; Shiyakova, M.; Shmeleva, A.; Shoaleh Saadi, D.; Shochet, M. J.; Shojaii, S.; Shope, D. R.; Shrestha, S.; Shulga, E.; Shupe, M. A.; Sicho, P.; Sickles, A. M.; Sidebo, P. E.; Sidiropoulou, O.; Sidorov, D.; Sidoti, A.; Siegert, F.; Sijacki, Dj.; Silva, J.; Silverstein, S. B.; Simak, V.; Simic, Lj.; Simion, S.; Simioni, E.; Simmons, B.; Simon, D.; Simon, M.; Sinervo, P.; Sinev, N. B.; Sioli, M.; Siragusa, G.; Sivoklokov, S. Yu.; Sjölin, J.; Skinner, M. B.; Skottowe, H. P.; Skubic, P.; Slater, M.; Slavicek, T.; Slawinska, M.; Sliwa, K.; Slovak, R.; Smakhtin, V.; Smart, B. H.; Smestad, L.; Smiesko, J.; Smirnov, S. Yu.; Smirnov, Y.; Smirnova, L. N.; Smirnova, O.; Smith, M. N. K.; Smith, R. W.; Smizanska, M.; Smolek, K.; Snesarev, A. A.; Snyder, I. M.; Snyder, S.; Sobie, R.; Socher, F.; Soffer, A.; Soh, D. A.; Sokhrannyi, G.; Solans Sanchez, C. A.; Solar, M.; Soldatov, E. Yu.; Soldevila, U.; Solodkov, A. A.; Soloshenko, A.; Solovyanov, O. V.; Solovyev, V.; Sommer, P.; Son, H.; Song, H. Y.; Sood, A.; Sopczak, A.; Sopko, V.; Sorin, V.; Sosa, D.; Sotiropoulou, C. L.; Soualah, R.; Soukharev, A. M.; South, D.; Sowden, B. C.; Spagnolo, S.; Spalla, M.; Spangenberg, M.; Spanò, F.; Sperlich, D.; Spettel, F.; Spighi, R.; Spigo, G.; Spiller, L. A.; Spousta, M.; St. Denis, R. D.; Stabile, A.; Stamen, R.; Stamm, S.; Stanecka, E.; Stanek, R. W.; Stanescu, C.; Stanescu-Bellu, M.; Stanitzki, M. M.; Stapnes, S.; Starchenko, E. A.; Stark, G. H.; Stark, J.; Staroba, P.; Starovoitov, P.; Stärz, S.; Staszewski, R.; Steinberg, P.; Stelzer, B.; Stelzer, H. J.; Stelzer-Chilton, O.; Stenzel, H.; Stewart, G. A.; Stillings, J. A.; Stockton, M. C.; Stoebe, M.; Stoicea, G.; Stolte, P.; Stonjek, S.; Stradling, A. R.; Straessner, A.; Stramaglia, M. E.; Strandberg, J.; Strandberg, S.; Strandlie, A.; Strauss, M.; Strizenec, P.; Ströhmer, R.; Strom, D. M.; Stroynowski, R.; Strubig, A.; Stucci, S. A.; Stugu, B.; Styles, N. A.; Su, D.; Su, J.; Suchek, S.; Sugaya, Y.; Suk, M.; Sulin, V. V.; Sultansoy, S.; Sumida, T.; Sun, S.; Sun, X.; Sundermann, J. E.; Suruliz, K.; Susinno, G.; Sutton, M. R.; Suzuki, S.; Svatos, M.; Swiatlowski, M.; Sykora, I.; Sykora, T.; Ta, D.; Taccini, C.; Tackmann, K.; Taenzer, J.; Taffard, A.; Tafirout, R.; Taiblum, N.; Takai, H.; Takashima, R.; Takeshita, T.; Takubo, Y.; Talby, M.; Talyshev, A. A.; Tan, K. G.; Tanaka, J.; Tanaka, M.; Tanaka, R.; Tanaka, S.; Tanioka, R.; Tannenwald, B. B.; Tapia Araya, S.; Tapprogge, S.; Tarem, S.; Tartarelli, G. F.; Tas, P.; Tasevsky, M.; Tashiro, T.; Tassi, E.; Tavares Delgado, A.; Tayalati, Y.; Taylor, A. C.; Taylor, G. N.; Taylor, P. T. E.; Taylor, W.; Teischinger, F. A.; Teixeira-Dias, P.; Temming, K. K.; Temple, D.; Ten Kate, H.; Teng, P. K.; Teoh, J. J.; Tepel, F.; Terada, S.; Terashi, K.; Terron, J.; Terzo, S.; Testa, M.; Teuscher, R. J.; Theveneaux-Pelzer, T.; Thomas, J. P.; Thomas-Wilsker, J.; Thompson, E. N.; Thompson, P. D.; Thompson, A. S.; Thomsen, L. A.; Thomson, E.; Thomson, M.; Tibbetts, M. J.; Ticse Torres, R. E.; Tikhomirov, V. O.; Tikhonov, Yu. A.; Timoshenko, S.; Tipton, P.; Tisserant, S.; Todome, K.; Todorov, T.; Todorova-Nova, S.; Tojo, J.; Tokár, S.; Tokushuku, K.; Tolley, E.; Tomlinson, L.; Tomoto, M.; Tompkins, L.; Toms, K.; Tong, B.; Tornambe, P.; Torrence, E.; Torres, H.; Torró Pastor, E.; Toth, J.; Touchard, F.; Tovey, D. R.; Trefzger, T.; Tricoli, A.; Trigger, I. M.; Trincaz-Duvoid, S.; Tripiana, M. F.; Trischuk, W.; Trocmé, B.; Trofymov, A.; Troncon, C.; Trottier-McDonald, M.; Trovatelli, M.; Truong, L.; Trzebinski, M.; Trzupek, A.; Tseng, J. C-L.; Tsiareshka, P. V.; Tsipolitis, G.; Tsirintanis, N.; Tsiskaridze, S.; Tsiskaridze, V.; Tskhadadze, E. G.; Tsui, K. M.; Tsukerman, I. I.; Tsulaia, V.; Tsuno, S.; Tsybychev, D.; Tu, Y.; Tudorache, A.; Tudorache, V.; Tuna, A. N.; Tupputi, S. A.; Turchikhin, S.; Turecek, D.; Turgeman, D.; Turra, R.; Tuts, P. M.; Tyndel, M.; Ucchielli, G.; Ueda, I.; Ughetto, M.; Ukegawa, F.; Unal, G.; Undrus, A.; Unel, G.; Ungaro, F. C.; Unno, Y.; Unverdorben, C.; Urban, J.; Urquijo, P.; Urrejola, P.; Usai, G.; Vacavant, L.; Vacek, V.; Vachon, B.; Valderanis, C.; Valdes Santurio, E.; Valencic, N.; Valentinetti, S.; Valero, A.; Valery, L.; Valkar, S.; Valls Ferrer, J. A.; Van Den Wollenberg, W.; Van Der Deijl, P. C.; van der Graaf, H.; van Eldik, N.; van Gemmeren, P.; Van Nieuwkoop, J.; van Vulpen, I.; van Woerden, M. C.; Vanadia, M.; Vandelli, W.; Vanguri, R.; Vaniachine, A.; Vankov, P.; Vardanyan, G.; Vari, R.; Varnes, E. W.; Varol, T.; Varouchas, D.; Vartapetian, A.; Varvell, K. E.; Vasquez, J. G.; Vasquez, G. A.; Vazeille, F.; Vazquez Schroeder, T.; Veatch, J.; Veeraraghavan, V.; Veloce, L. M.; Veloso, F.; Veneziano, S.; Ventura, A.; Venturi, M.; Venturi, N.; Venturini, A.; Vercesi, V.; Verducci, M.; Verkerke, W.; Vermeulen, J. C.; Vest, A.; Vetterli, M. C.; Viazlo, O.; Vichou, I.; Vickey, T.; Vickey Boeriu, O. E.; Viehhauser, G. H. A.; Viel, S.; Vigani, L.; Villa, M.; Villaplana Perez, M.; Vilucchi, E.; Vincter, M. G.; Vinogradov, V. B.; Vittori, C.; Vivarelli, I.; Vlachos, S.; Vlasak, M.; Vogel, M.; Vokac, P.; Volpi, G.; Volpi, M.; von der Schmitt, H.; von Toerne, E.; Vorobel, V.; Vorobev, K.; Vos, M.; Voss, R.; Vossebeld, J. H.; Vranjes, N.; Vranjes Milosavljevic, M.; Vrba, V.; Vreeswijk, M.; Vuillermet, R.; Vukotic, I.; Vykydal, Z.; Wagner, P.; Wagner, W.; Wahlberg, H.; Wahrmund, S.; Wakabayashi, J.; Walder, J.; Walker, R.; Walkowiak, W.; Wallangen, V.; Wang, C.; Wang, C.; Wang, F.; Wang, H.; Wang, H.; Wang, J.; Wang, J.; Wang, K.; Wang, R.; Wang, S. M.; Wang, T.; Wang, T.; Wang, W.; Wang, X.; Wanotayaroj, C.; Warburton, A.; Ward, C. P.; Wardrope, D. R.; Washbrook, A.; Watkins, P. M.; Watson, A. T.; Watson, M. F.; Watts, G.; Watts, S.; Waugh, B. M.; Webb, S.; Weber, M. S.; Weber, S. W.; Weber, S. A.; Webster, J. S.; Weidberg, A. R.; Weinert, B.; Weingarten, J.; Weiser, C.; Weits, H.; Wells, P. S.; Wenaus, T.; Wengler, T.; Wenig, S.; Wermes, N.; Werner, M.; Werner, M. D.; Werner, P.; Wessels, M.; Wetter, J.; Whalen, K.; Whallon, N. L.; Wharton, A. M.; White, A.; White, M. J.; White, R.; Whiteson, D.; Wickens, F. J.; Wiedenmann, W.; Wielers, M.; Wiglesworth, C.; Wiik-Fuchs, L. A. M.; Wildauer, A.; Wilk, F.; Wilkens, H. G.; Williams, H. H.; Williams, S.; Willis, C.; Willocq, S.; Wilson, J. A.; Wingerter-Seez, I.; Winklmeier, F.; Winston, O. J.; Winter, B. T.; Wittgen, M.; Wittkowski, J.; Wolf, T. M. H.; Wolter, M. W.; Wolters, H.; Worm, S. D.; Wosiek, B. K.; Wotschack, J.; Woudstra, M. J.; Wozniak, K. W.; Wu, M.; Wu, M.; Wu, S. L.; Wu, X.; Wu, Y.; Wyatt, T. R.; Wynne, B. M.; Xella, S.; Xu, D.; Xu, L.; Yabsley, B.; Yacoob, S.; Yamaguchi, D.; Yamaguchi, Y.; Yamamoto, A.; Yamamoto, S.; Yamanaka, T.; Yamauchi, K.; Yamazaki, Y.; Yan, Z.; Yang, H.; Yang, H.; Yang, Y.; Yang, Z.; Yao, W-M.; Yap, Y. C.; Yasu, Y.; Yatsenko, E.; Yau Wong, K. H.; Ye, J.; Ye, S.; Yeletskikh, I.; Yen, A. L.; Yildirim, E.; Yorita, K.; Yoshida, R.; Yoshihara, K.; Young, C.; Young, C. J. S.; Youssef, S.; Yu, D. R.; Yu, J.; Yu, J. M.; Yu, J.; Yuan, L.; Yuen, S. P. Y.; Yusuff, I.; Zabinski, B.; Zaidan, R.; Zaitsev, A. M.; Zakharchuk, N.; Zalieckas, J.; Zaman, A.; Zambito, S.; Zanello, L.; Zanzi, D.; Zeitnitz, C.; Zeman, M.; Zemla, A.; Zeng, J. C.; Zeng, Q.; Zengel, K.; Zenin, O.; Ženiš, T.; Zerwas, D.; Zhang, D.; Zhang, F.; Zhang, G.; Zhang, H.; Zhang, J.; Zhang, L.; Zhang, R.; Zhang, R.; Zhang, X.; Zhang, Z.; Zhao, X.; Zhao, Y.; Zhao, Z.; Zhemchugov, A.; Zhong, J.; Zhou, B.; Zhou, C.; Zhou, L.; Zhou, L.; Zhou, M.; Zhou, N.; Zhu, C. G.; Zhu, H.; Zhu, J.; Zhu, Y.; Zhuang, X.; Zhukov, K.; Zibell, A.; Zieminska, D.; Zimine, N. I.; Zimmermann, C.; Zimmermann, S.; Zinonos, Z.; Zinser, M.; Ziolkowski, M.; Živković, L.; Zobernig, G.; Zoccoli, A.; zur Nedden, M.; Zwalinski, L.


    A measurement of the total ppcross section at the LHC at √s=8TeV is presented. An integrated luminosity of 500 μb-1 was accumulated in a special run with high-β beam optics to measure the differential elastic cross section as a function of the Mandelstam momentum transfer variable t. The measurement is performed with the ALFA sub-detector of ATLAS. Using a fit to the differential elastic cross section in the -t range from 0.014GeV2 to 0.1GeV2 to extrapolate t→0, the total cross section, σtot(pp →X), is measured via the optical theorem to be σtot(pp→ X) = 96.07±0.18 (stat.)±0.85 (exp.)± 0.31 (extr.) mb, where the first error is statistical, the second accounts for all experimental systematic uncertainties and the last is related to uncertainties in the extrapolation t→0. In addition, the slope of the exponential function describing the elastic cross section at small t is determined to be B =19.74 ±0.05 (stat.) ±0.23 (syst.) GeV-2.

  5. Caracterización molecular de la alfa-talasemia no deleción y hemoglobinopatías estructurales de cadena alfa en España


    Fuente Gonzalo, Félix de la


    Las talasemias son un grupo heterogéneo de anemias hereditarias desde el punto de vista molecular, clínico y hematológico; caracterizadas por la disminución o ausencia total de síntesis de una o varias cadenas de globina. La cadena sintetizada en menor cuantía es, por lo general, rigurosamente normal en su composición y estructura. En las talasemias, se encuentra una anemia microcítica e hipocroma, a la que se le añade un determinado componente hemolítico. Esta anemia se asocia, en el pacient...

  6. Pentacene on Au(111), Ag(111) and Cu(111): From physisorption to chemisorption (United States)

    Lu, Meng-Chao; Wang, Rong-Bin; Yang, Ao; Duhm, Steffen


    We measured the electronic and the molecular surface structure of pentacene deposited on the (111)-surfaces of coinage metals by means of ultraviolet photoelectron spectroscopy (UPS) and low-energy electron diffraction (LEED). Pentacene is almost flat-lying in monolayers on all three substrates and highly ordered on Au(111) and on Cu(111). On Ag(111), however, weak chemisorption leads to almost disordered monolayers, both, at room temperature and at 78 K. On Cu(111) pentacene is strongly chemisorbed and the lowest unoccupied molecular orbital becomes observable in UPS by a charge transfer from the substrate. On Ag(111) and Cu(111) multilayers adopt a tilted orientation and a high degree of crystallinity. On Au(111), most likely, also in multilayers the molecular short and long axes are parallel to the substrate, leading to a distinctively different electronic structure than on Ag(111) and Cu(111). Overall, it could be demonstrated that the substrate not only determines the geometric and electronic characteristics of molecular monolayer films but also plays a crucial role for multilayer film growth.

  7. ASC-1

    DEFF Research Database (Denmark)

    Jakimoski, Goce; Khajuria, Samant


    The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes. Unfortun......The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes...... uses leak extraction from diÆerent AES rounds to compute the key material that is XOR-ed with the message to compute the ciphertext. Unlike LEX, the ASC-1 operates in a CFB fashion to compute an authentication tag over the encrypted message. We argue that ASC-1 is secure by reducingits (IND-CCA , INT...

  8. Bibliographie1



    I. OUVRAGES GÉNÉRAUX A. Droit français B. Droit africain 1°. Droits des pays d’Afrique 2°. Droit de l’O.H.A.D.A. C. Droit comparé en général II. OUVRAGES SPÉCIAUX, THÈSES ET MONOGRAPHIES A. Droit français B. Droit africain 1°. Droits des pays d’Afrique 2°. Droit de l’O.H.A.D.A. C. Droit comparé en général III. RÉPERTOIRES ET OUVRAGES PRATIQUES A. Droit français B. Droit africain C. Droit comparé en général IV. OUVRAGES DE MÉTHODOLOGIE V. ARTICLES ET CHRONIQUES A. Droit français B. Droit afric...

  9. Mercury(1)

    Institute of Scientific and Technical Information of China (English)


    1.Mercury is the planet closest to the sun.It is thefastest moving planet.And it is the second smallestplanet in our solar system. 2.Mercury is very difficult to see.Its orbit isbetween us and the sun.So,we have to look toward thebright light of the sun to see it.The sunlight usuallyhides Mercury.When we can see it,it appears as a fuzzyball.

  10. Fengyinzhan 1

    Institute of Scientific and Technical Information of China (English)


    Fengyinzhan 1 is a late season indica rice variety with moderate sensitivity to photoperiod. It was from the cross of Qingfengzhan, which is a disease resistant, photopetiod sensitive, late season indica rice variety, and Yinsizhan, which is a photoperiod insensitive, early season indica riCe variety with tenerness and good quality. Its plant area in Guangdong was 33 ha in 1991 and 4,400 ha in 1992.

  11. Protoexist1 (United States)

    Copete, Antonio; Allen, B.; Hong, J.; Grindlay, J.; Gehrels, N.; Barthelmy, S.; Baker, R.; Apple, J.; Benson, C.; Garson, T.; Krawczynski, H.; McLean, R.; Cook, R.


    The ProtoEXIST1 mission, a pathfinder for the EXIST high energy telescope (HET), is slated for a spring 2009 flight out of Ft. Sumner, NM. The ProtoEXIST payload consists of two coded aperture telescopes, each with a 10^ 10^deg field of view and an angular resolution of approximately 10'. One telescope will be outfitted with passive Pb/Sn/Cu rear and side shielding while the other will utilize a rear active CsI anti-coincidence shield and passive side shielding for comparison of background rejection efficiency. The detector plane of each telescope consists of a 8 times 8 large tiled array of 2.04 cm times 2.04 cm CZT detectors, each with thickness of 0.5 cm and a pixilated anode consisting of 2.5 mm pixels. Each detector is read out utilizing the Caltech RADNET ASIC. In total the detector plane of a single telescope measures 16 cm times 16 cm and is sensitive over an energy range of 10 keV up to 500 keV, with an energy resolution of 3.1 keV FWHM at 59 keV. The ProtoEXIST1 flight will validate the use of tiled CZT arrays in flight and pave the way for ProtoEXIST2 which will demonstrate the use of a tiled array of CZT detectors with 0.6 mm pixels.

  12. HBcrAg Identifies Patients Failing to Achieve HBeAg Seroconversion Treated with Pegylated Interferon Alfa-2b

    Directory of Open Access Journals (Sweden)

    Hui Ma


    Conclusions: Effective antiviral treatment can decrease HBcrAg levels in the serum. The NPVs of HBcrAg for predicting HBeAg seroconversion at 24-week follow-up was 100%, but the PPVs were not satisfactory (all <31%. The serum HBcrAg levels of the patients with HBeAg seroconversion at the end of the 24-week follow-up steadily declined or even became undetectable during the LTFU.

  13. Advances in recombinant DNA technology : corifollitropin alfa, a hybrid molecule with sustained follicle-stimulating activity and reduced injection frequency

    NARCIS (Netherlands)

    Fauser, B. C. J. M.; Mannaerts, B. M. J. L.; Devroey, P.; Leader, A.; Boime, I.; Baird, D. T.


    Recombinant DNA technologies have been used to develop longer-acting therapeutic proteins. One approach is to introduce sequences containing additional glycosylation sites. Using this technique, a new chimeric gene has been developed containing the coding sequences of the FSH beta-subunit and the C-

  14. Treatment of hepatitis C virus genotype 4 with peginterferon alfa-2a: Impact of bilharziasis and fibrosis stage

    Institute of Scientific and Technical Information of China (English)

    MF Derbala; A Bener; SR Al Kaabi; NZ El Dweik; F Pasic; MT Butt; R Yakoob; A Al-Marri; AM Amer; N Morad


    AIM: To evaluate pegylated interferon alpha2a (PegIFN-α2a) in Egyptian patients with HCV genotype 4, and the impact of pretreatment viral load, co-existent bilharziasis and histological liver changes on response rate.METHODS: A total of 73 na(i)ve patients (61 with history of bilharziasis) with compensated chronic HCV genotype 4 were enrolled into: group A (38 patients) who received 180 mg PegIFN-alpha2a subcutaneously once weekly for a year and group B (35 patients) recved IFN alpha-2a 3 MU 3 times weekly. Ribavirin was added to each regimen at a dose of 1200 mg. Patients were followed for 72 wk and sustained response was assessed.RESULTS: Significant improvement in both end of treatment response (ETR) (P < 0.002) and sustained response (SR) (P < 0.05) was noted with pegylated interferon, where ETR was achieved in 29 (76.3%) and 14 patients (40%) in both groups respectively, and 25 patients in group A (65.8%) and 9 (25.7%) in group B could retain negative viraemia by the end of follow up period. Sustained virological response (SVR) showed a significant negative correlation with age and positive correlation with pretreatment inflammation in patients receiving PegIFN. Viral clearance after 3 mo of therapy was associated with high incidence of ETR and SR (P <0.001), but without significant difference between both forms of interferon. Significant improvement in response was achieved in patients with high grade fibrosis (grade 3 and 4) with PegIFN-α2a, where SR was seen in 5 out of 13 patients in group A, but none in group B. There was no significant difference in response between bilharzial and non-bilharzial patients in both groups. In terms of safety and tolerability, neutropenia was the predominant side effect; both drugs were comparable.CONCLUSION: PegIFN-α2a combined with ribavirin results in improvement in sustained response in HCV genotype 4, irrespective of history of bilharzial infestation.

  15. Protective Effect of Infliximab, a Tumor Necrosis Factor-Alfa Inhibitor, on Bleomycin-Induced Lung Fibrosis in Rats. (United States)

    Altintas, Nejat; Erboga, Mustafa; Aktas, Cevat; Bilir, Bulent; Aydin, Murat; Sengul, Aysun; Ates, Zehra; Topcu, Birol; Gurel, Ahmet


    We aimed to investigate the preventive effect of Infliximab (IFX), a tumor necrosis factor (TNF)-α inhibitor, on bleomycin (BLC)-induced lung fibrosis in rats. Rats were assigned into four groups as follows: I-BLC group, a single intra-tracheal BLC (2.5 mg/kg) was installed; II-control group, a single intra-tracheal saline was installed; III-IFX + BLC group, a single-dose IFX (7 mg/kg) was administered intraperitoneally (i.p.), 72 h before the intra-tracheal BLC installation; IV-IFX group, IFX (7 mg/kg) was administered alone i.p. on the same day with IFX + BLC group. All animals were sacrificed on the 14th day of BLC installation. Levels of tumor necrosis factor (TNF)-α, transforming growth factor (TGF)-β, interleukin (IL)-6, periostin, YKL-40, nitric oxide (NO) in rat serum were measured, as well as, myeloperoxidase (MPO), superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GPx) activity, and reduced glutathione (GSH), hydroxyproline, malondialdehyde (MDA) content in lung homogenates. Lung tissues were stained with hematoxylin and eosin (H&E) for quantitative histological evaluation. The inducible nitric oxide synthase (iNOS) expression and cell apoptosis in the lung tissues were determined quantitatively by immunohistochemical staining (INOS) and by TUNNEL staining, respectively. BLC installation worsened antioxidant status (such as SOD, CAT, GPx, GSH, MPO), while it increased the serum TNF-α, TGF-β, IL-6, periostin, YKL-40, and lipid peroxidation, and collagen deposition, measured by MDA and hydroxyproline, respectively. IFX pretreatment improved antioxidant status as well as BLC-induced lung pathological changes, while it decreased the TNF-α, TGF-β, IL-6, periostin, YKL-40, lipid peroxidation and collagen deposition. Finally, histological, immunohistochemical, and TUNNEL evidence also supported the ability of IFX to prevent BLC-induced lung fibrosis. The results of the present study indicate that IFX pretreatment can attenuate BLC-induced pulmonary fibrosis.


    Directory of Open Access Journals (Sweden)

    Eddy M. Sutanto


    Full Text Available Job stress can be caused by organizational factors and non-organizational factors. In the organizational factor, the dimensions of organizational design affect the job-stress level. This happens because the organizational design determines how the organization or company will run its process. One of the non-organizational factors that cause stress is the personality type of the employees. This research will be examined the variables of organizational design and the personality type which affect the employee's stress level in the company. It suggests that employees' perception to the dimensions of organizational design significantly and positively affect the level of employees' work stress along with their personality type. In this case, those dimensions are formalization-authority, specialization, environment, work load-type of work, centralization-number of workers. The personality type is only considered as minor factor. Abstract in Bahasa Indonesia : Stres kerja dapat disebabkan oleh faktor-faktor organisasional maupun faktor-faktor non organisasional. Dimensi-dimensi disain organisasi memberikan pengaruh terhadap tingkat stres kerja. Hal ini terjadi disebabkan karena disain organisasi yang menentukan bagaimana sutau organisasi atau perusahaan menjalankan prosesnya. Salah satu faktor non organisasional yang dapat menyebabkan stres ialah tipe kepribadian dari karyawan. Di dalam penelitian ini akan diuji variabel-variabel disain organisasional dan tipe kepribadian yang mempengaruhi tingkat stres kerja karyawan di dalam perusahaan. Penelitian menyimpulkan bahwa persepsi karyawan terhadap dimensi-dimensi disain organisasional dan tipe kepribadiannya secara signifikan dan positif mempegaruhi tingkat stres kerja karyawan. Dalam hal ini, beberapa dimensi tersebut ialah formalisasi-wewenang, spesialisasi, lingkungan, beban kerja-tipe pekerjaan, sentralisasi-jumlah pekerja. Sementara itu tipe kepribadian merupakan faktor yang minor. Kata kunci: disain organisasi, kepribadian, stres kerja.

  17. Alfa-glucosidase-inhibiting activity of some Mexican plants used in the treatment of type 2 diabetes. (United States)

    Andrade-Cetto, Adolfo; Becerra-Jiménez, Jaime; Cárdenas-Vázquez, René


    Type 2 diabetes is an endocrine disease, which accounts for 9% of deaths worldwide. The aim of oral therapy is to reach normoglycemia to prevent later complications. Among glucose-lowering medications, alpha-glucosidase inhibitors delay the absorption of ingested carbohydrates, reducing the postprandial glucose and insulin peaks. In the present study, we tested the butanolic extracts of four Mexican plants with respect to their alpha-glucosidase inhibition activity, without excluding other possible mechanisms of action. The plants Cecropia obtusifolia Bertol., Equisetum myriochaetum Schlecht & Cham, Acosmium panamense (Benth.) Yacolev and Malmea depressa (Baill) R.E. Fries are used in traditional medicine to treat type 2 diabetes. In previous studies, we have demonstrated these plants' hypoglycemic activity and determined the phytochemical composition of their extracts. Our results in n-STZ diabetic rats loaded with maltose showed that Malmea and Acosmium extracts decreased plasma glucose significantly from 30 min on resembling the effect of acarbose. Cecropia extract produced the highest reduction of plasma glucose, and at 90 min, the glucose level was lower than the fasting level, which suggests another mechanism of action. Equisetum did not exert any effect. In vitro assays of alpha-glucosidase activity showed an IC(50) of 14 microg/ml for Cecropia, 21 microg/ml for Malmea, and 109 microg/ml for Acosmium, which were lower than that of acarbose (128 microg/ml). Equisetum did not show any significant effect on this assay, either. These results contribute to understand the mechanism of action of these plants on glucose metabolism.



    Владимир Александрович Левданский; Александр Владимирович Левданский; Борис Николаевич Кузнецов


    The «green» method of obtaining from fir-wood the cellulosic product with high content of alpha-cellulose was developed. It consists of the stage of wood delignification by hydrogen peroxide in the medium «acetic acid – water – sulfuric acid catalyst» and of the stage of alkaline treatment by NaOH. Preparation conditions were selected which allow to obtain with an acceptable yield (30–31% mas.) the cellulosic product containing 97,3–98,0% mas. of alpha-cellulose.

  19. Chemical vapor deposition (CVD) of uranium for alpha spectrometry; Deposicion quimica de vapor (CVD) de uranio para espectrometria alfa

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez V, M. L.; Rios M, C.; Ramirez O, J.; Davila R, J. I.; Mireles G, F., E-mail: [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)


    The uranium determination through radiometric techniques as alpha spectrometry requires for its proper analysis, preparation methods of the source to analyze and procedures for the deposit of this on a surface or substrate. Given the characteristics of alpha particles (small penetration distance and great loss of energy during their journey or its interaction with the matter), is important to ensure that the prepared sources are thin, to avoid problems of self-absorption. The routine methods used for this are the cathodic electro deposition and the direct evaporation, among others. In this paper the use of technique of chemical vapor deposition (CVD) for the preparation of uranium sources is investigated; because by this, is possible to obtain thin films (much thinner than those resulting from electro deposition or evaporation) on a substrate and comprises reacting a precursor with a gas, which in turn serves as a carrier of the reaction products to achieve deposition. Preliminary results of the chemical vapor deposition of uranium are presented, synthesizing and using as precursor molecule the uranyl acetylacetonate, using oxygen as carrier gas for the deposition reaction on a glass substrate. The uranium films obtained were found suitable for alpha spectrometry. The variables taken into account were the precursor sublimation temperatures and deposition temperature, the reaction time and the type and flow of carrier gas. Of the investigated conditions, two depositions with encouraging results that can serve as reference for further work to improve the technique presented here were selected. Alpha spectra obtained for these depositions and the characterization of the representative samples by scanning electron microscopy and X-ray diffraction are also presented. (Author)

  20. Peginterferon-alfa mono-therapy in the treatment of acute hepatitis C in HIV-infection

    NARCIS (Netherlands)

    Boesecke, C.; van Assen, S.; Stellbrink, H. -J.; Baumgarten, A.; Ingiliz, P.; Strassburg, C. P.; Schwarze-Zander, C.; Wasmuth, J. -C.; Hoepelman, A. I. M.; Rockstroh, J. K.; Arends, J. E.


    The ongoing epidemic of acute hepatitis C (AHC) infection among MSM highlights the need to identify factors allowing for optimal treatment outcome in HIV co-infected individuals. Cohort study of 105 HIV-infected patients with AHC infection from five centres in two European countries was carried out.

  1. Design of a preamplifier for an alpha particles spectrometer; Diseno de un preamplificador para un espectrometro de particulas alfa

    Energy Technology Data Exchange (ETDEWEB)

    Murillo O, R.; Hernandez D, V. M.; Chacon R, A.; Vega C, H. R., E-mail: [Universidad Autonoma de Zacatecas, Unidades Academicas de Estudios Nucleares e Ingenieria Electrica, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)


    To detect radiation diverse detector types are used, when these are alpha particles proportional type detectors are used, semiconductor, of scintillation or traces. In this work the design results, the construction and the first tests of a spectrometer (preamplifier) are presented for alpha particles that was designed starting from a Pin type photodiode. The system was designed and simulated with a program for electronic circuits. With the results of the simulation phase was constructed the electronics that is coupled to a spectroscopic amplifier and a multichannel analyzer. The total of the system is evaluated analyzing its performance before a triple source of alphas and that they are produced by two smoke detectors of domestic use. Of the tests phase we find that the system allows to obtain in a multichannel, the pulses height spectrum, with which we calibrate the system. (Author)

  2. Induction; Induccion de la respuesta SOS por radiacion alfa en cepas de Escherichia coli defectuosas en reparacion y recombinacion

    Energy Technology Data Exchange (ETDEWEB)

    Serment G, J.; Brena V, M. [Laboratorio de Genetica Microbiana, Departamento de Biologia, ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico)


    At the incidence on biological systems, the ionizing radiation can affect so much its structural components as the genetic material since in a direct form or by the free radicals produced mainly the water radiolysis via (indirect effect). The alpha particles produce a great quantity of leisures in sites very near of them, by consequence results in a major RDB frequency. For establish the influence that would be the leisures concentration (specifically RDB) it was decided to research what occur when is irradiated with high LET corpuscular radiation and major power of ionization using for this alpha particles of an Americium 241 source and Escherichia coli stubs with different defects in reparation genes, recombination and protection to the radiation damage. (Author)

  3. [Efficacy of combined antiviral therapy with interferon alfa and ribavirin in chronic hepatitis C patients with extrahepatic manifestations]. (United States)

    Zarebska-Michaluk, Dorota; Lebensztejn, Dariusz Marek; Kryczka, Wiesław


    The aim of the study was to assess the efficacy and safety of treatment with interferon alpha and ribavirin in patients with chronic hepatitis C and extrahepatic manifestations as well as to determine prognostic factors of therapy effectiveness. 179 consecutive naive patients with chronic hepatitis C treated with interferon alpha and ribavirin were studied. 120 patients (67%) presented extrahepatic manifestations. The most frequent were cryoglobulinaemia, thrombocytopenia and thyroid gland pathology. Efficacy of antiviral treatment was lower (SVR 33.3% vs. 52.5%, p=0.013) and frequency of adverse events higher in patients with chronic hepatitis C and extrahepatic manifestations in comparison to those without extrahepatic pathology. Younger age, shorter duration of HCV infection and less advanced liver fibrosis were prognostic factors of better response to antiviral therapy in group of patients with chronic hepatitis C and extrahepatic manifestations.

  4. Tumor necrosis factor-alfa and interleukin-4 in cerbrospinal fluid and plasma in different clinical forms of multiple sclerosis

    Directory of Open Access Journals (Sweden)

    Obradović Dragana


    Full Text Available Background/Aim. Multiple sclerosis (MS is an immunemediated central nervous system disease characterized by inflammation, demyelination and axonal degeneration. Cytokines are proven mediators of immunological process in MS. The aim of this study was to investigate whether there is a difference in the production of the tumor necrosis factor alpha (TNF-alpha and interleukin-4 (IL-4 in cerebrospinal fluid (CSF and plasma in the MS patients and the controls (other neurological non-inflammatory diseases and to determine a possible difference in these cytokines in plasma and CSF in different clinical forms of MS. Methods. This study involved 60 consecutive MS patients - 48 patients with relapsing-remitting MS (RRMS and 12 patients with secondary progressive MS (SPMS. The control group consisted of 20, age and sex matched, nonimmunological, neurological patients. According to the clinical presentation of MS at the time of this investigation, 34 (56.7% patients had relapse (RRMS, 14 (23.3% were in remission (RRMS, while the rest of the patients, 12 (20.0%, were SPMS. TNF-alpha and IL-4 concentrations were measured in the same time in CSF and plasma in the MS patients and the controls. Extended disability status score (EDSS, albumin ratio and IgG index were determined in all MS patients. Results. The MS patients had significantly higher CSF and plasma levels of TNF-alpha than the controls (p < 0.001 for both samples. IL-4 CSF levels were significantly lower in the MS patients than in the controls (p < 0.001, however plasma levels were similar. The patients in relapse (RRMS and with progressive disease (SPMS had higher concentrations of CSF TNF-alpha levels than the patients in remission (p < 0.001. IL-4 CSF levels in relapse (RRMS and SPMS groups were lower than in the patients in remission. The patients in remission had an unmeasurable plasma TNF-alpha level and the patients with SPMS had significantly lower IL-4 levels in plasma than the patients in relapse and remission (p < 0.001. The only significant correlation between cytokine level with either EDSS, or albumin ratio, or IgG index, was found between CSF TNF-alpha levels and albumin ratio in the patients with relapse (R square = 0.431, p < 0.001. Conclusion. According to the obtained data MS relapse was characterized by high concentrations of TNF-alpha in CSF and plasma and low concentrations of IL-4 in CSF. Remission was characterized by high concentrations of IL-4 and low concentrations of TNF-alpha both in CSF and plasma. SPMS was characterized with lower concentrations of TNF-alpha and IL-4 compared to relapse, both in CSF and plasma.

  5. Granuloma periférico de células gigantes: análisis inmunohistoquímico de la población celular en tres casos clínicos Peripheral giant cell granuloma: immunohistochemical analysis of different markers. Study of three cases

    Directory of Open Access Journals (Sweden)

    Falaschini S


    Full Text Available El granuloma periférico de células gigantes (GPCG es una lesión de tejido blando no neoplásica ocasionada por una reacción hiperplásica a consecuencia de un traumatismo o inflamación. Es una lesión reactiva del tejido blando que se desarrolla exclusivamente en la cavidad oral y con una ligera predilección en el sexo femenino. La localización habitual de GPCG es en la región de los premolares y la mucosa de la cresta alveolar edéntula. Se presentan tres casos con GPCG (dos hombres y una mujer con una edad comprendida entre los 25 y 35 años. Todos los pacientes se trataron con resección quirúrgica y ninguno sufrió recidivas. Con el propósito de determinar el posible origen de las células estromales mononucleares y de las células gigantes multinucleares, las muestras de cada caso se estudiaron mediante inmunohistoquímica (marcadores CD-68, CD-34 y α-1 antitripsina con el fin de evaluar la expresión del linaje endotelial y del linaje monocito/macrófago. Los resultados inmunohistoquímicos mostraron una marcada positividad difusa de CD-68 en las células estromales mononucleares y en las células gigantes multinucleadas. Estas últimas resultaron ser inmunonegativas para CD-34 y sólo puntualmente positivas para α-1 antitripsina. Estos resultados sugieren que las cιlulas gigantes multinucleares poseen un fenotipo osteoclαstico, proviniendo del linaje monocito/macrσfago, y que no derivan del linaje de las células endoteliales de los capilares. Se establece la importancia de un exhaustivo diagnóstico y de una exéresis quirúrgica completa de la lesión (curetaje óseo con el propósito de evitar la reabsorción del diente y hueso adyacente.


    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 S000311 7-Sep-2000 (last modified) seki tef1 box found in the Arabidops... translational apparatus; EF-1alpha; A1; tef1 box; Arabidopsis (Arabidopsis thaliana) ACAGGGGCATAATGGTAATTTAAA ...

  7. Drug: D03896 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03896 Drug Dornase alfa (genetical recombination) (JAN); Dornase alfa (USAN/INN); ...llaneous 2290 Miscellaneous D03896 Dornase alfa (genetical recombination) (JAN); Dornase alfa (USAN/INN) Ana...ytics R05CB13 Dornase alfa (desoxyribonuclease) D03896 Dornase alfa (genetical recombination) (JAN); Dornase alfa (USAN/INN) CAS: 143831-71-4 PubChem: 17397980 DrugBank: DB00003 ...

  8. Drug: D06120 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06120 Drug Thyrotropin alfa (genetical recombination) (JAN); Thyrotropin alfa (USA...N/INN); Thyrotropin human alfa (genetical recombination); Thyrogen (TN) Thyroid hormone Therapeutic category... Other agents not mainly for therapeutic purpose 799 Miscellaneous 7990 Miscellaneous D06120 Thyrotropin alfa (genetica...UES H01AB Thyrotropin H01AB01 Thyrotropin alfa D06120 Thyrotropin alfa (genetical...NTS V04CJ Tests for thyreoidea function V04CJ01 Thyrotropin D06120 Thyrotropin alfa (genetical recombination

  9. Lactoferrin acute-phase protein and proteinase inhibitors in blood of patients with Q-wave myocardial infraction complicated by acute heart failure

    Directory of Open Access Journals (Sweden)

    K. P. Belokoneva


    Full Text Available 153 patients with Q-wave noncomplicated and complicated myocardial infraction have been examined. Blood serum was studied for acute-phase proteins (alfa-2-macroglobulin (MG, alfa-1-antitrypsin (ATr, and lactoferrin (LF in 97 patients ((57.9 ± 1.06 years old. Blood was sampled at the 1st, 7th, and 14th days after myocardial infraction. The decrease of MG in acute phase was observed in patients with cardiogenic shock. Increased concentrations of LF and unchanged MG level at the 1—7 days were observed at pulmonary edema.

  10. The Association of Substitutions in the Hepatitis C Virus Subtype 1b Core Gene and IL28B Polymorphisms With the Response to Peg-IFNα-2a/RBV Combination Therapy in Azerbaijani Patients

    Directory of Open Access Journals (Sweden)



    Full Text Available Background The hepatitis C virus (HCV infection has been identified as a leading cause of progressive liver diseases worldwide. Despite new treatment strategies, pegylated interferon alfa-2a (Peg-IFNα-2a, in combination with ribavirin (RBV, still represents the gold standard of therapy for hepatitis C in developing countries. Objectives The aim of this study was to investigate the association of substitutions in the HCV subtype 1b (HCV-1b core protein and the rs12979860 polymorphism in the interleukin 28B gene (IL28B with the response to Peg-IFNα-2a/RBV combination therapy in Azerbaijani patients. Patients and Methods A total of fifty-one chronically HCV-1b-infected Azerbaijani patients were enrolled in this cross-sectional study from March 2010 to June 2015. After RNA extraction from pre-treatment plasma, the core region of the HCV genome was amplified using the nested reverse transcription (RT polymerase chain reaction (PCR method, followed by standard sequencing. In addition, genomic DNA was extracted from peripheral blood mononuclear cell (PBMC specimens, and the rs12979860 single nucleotide polymorphism (SNP was identified using a PCR-restriction fragment length polymorphism (PCR-RFLP assay. Results In this study, a significant association was observed between the non-responders and relapsers to antiviral therapy and substitutions in the HCV-1b core region at positions 43 (R43K, P = 0.047, 70 (R70Q, P < 0.001, 91 (M91L, P = 0.037, and 106 (S106N, P = 0.018. Concerning the IL28B polymorphism, the results showed that sustained virological response was significantly associated with homozygous CC patients (P = 0.009 as compared with other genotypes, while homozygous TT subjects were associated with HCV relapse after therapy (P = 0.006. Conclusions The data of the present study suggest that amino acid substitutions at position 43, 70, 91, and 106 in the HCV-1b core protein are correlated with the response to the Peg-IFNα-2a/RBV treatment in

  11. InfluÃncia da forma do assoreamento na vazÃo regularizada de reservatÃrios do Estado do CearÃ


    Jody Campos


    Este trabalho apresenta uma avaliaÃÃo da influÃncia das diferentes formas de deposiÃÃo da massa assoreada em reservatÃrios do Estado do CearÃ, e os seus impactos na vazÃo regularizada. Foram investigadas trÃs formas distintas de assoreamento, denominadas neste trabalho de alfa 1 1), alfa 2 () e alfa 3 (3). ApÃs definiÃÃo dessas formas, foram construÃdas Curvas Cota x Ãrea x Volume (CAVs) dos reservatÃrios. Com o uso do programa Simres para simulaÃÃo hid...

  12. Exploring the Reactivity of Thiocarbonyl S-(tert-Alkylimides)

    DEFF Research Database (Denmark)

    El-Essawy, Farag A. G.; Khattab, Ahmed F.; Yassin, Salah M.;


    Three new alfa-oxo thione S-(tert-alkylimides) 3 have been prepared. Thiocarbonyl S- (tert-alkylimides) react with chlorine and bromine, but not with other halogens or pseudohalogens, to give the corresponding dihalomethylene compounds. The pyrolysis of 3 leads to the corresponding 1,2,4-trithiol......Three new alfa-oxo thione S-(tert-alkylimides) 3 have been prepared. Thiocarbonyl S- (tert-alkylimides) react with chlorine and bromine, but not with other halogens or pseudohalogens, to give the corresponding dihalomethylene compounds. The pyrolysis of 3 leads to the corresponding 1......,2,4-trithiolanes, presumably via intermediate thiosulfines. Ozonization of 3 gives the corresponding alfa-diketones....

  13. Main: TGA1ANTPR1A [PLACE

    Lifescience Database Archive (English)

    Full Text Available TGA1ANTPR1A S000247 16-Feb-2001 (last modified) seki TGA1a binding site in tobacco ...(N.t.) PR1a gene; as-1-like sequence; Contains two TGACG elements reminiscent of activation sequence-1 (as-1...); See other as-1-like sequences; TGA1a is preferentially expressed in root tip meristems; TGA1a may contrib...ute to the expression of GST isoenzymes, especially in root tip meristems; TGA1a;... as-1; PR1a; xenobiotic stress; root; tip; meristem; tobacco (Nicotiana tabacum) CGTCATCGAGATGACG ...

  14. Hereditary angioedema type I: a case report

    Directory of Open Access Journals (Sweden)

    Francisca Muñoz Peralta


    Full Text Available El angioedema hereditario es una enfermedad rara, de gran heterogeneidad en los síntomas, manifestándose con edema a nivel cutáneo, mucosa gastrointestinal y de laringe/faringe. Aunque existen tres variedades, el tipo I es el más frecuente y es provocado por una deficiencia en la síntesis del complemento C1 inhibidor. La gravedad de la clínica, junto a la baja prevalencia de la enfermedad y la necesidad de un tratamiento específico, hacen que el diagnóstico y tratamiento de dicha patología sea aún una asignatura pendiente para el médico de familia en atención primaria. Presentamos el caso de un adolescente varón con déficit de α-1 antitripsina desde los seis meses de edad, con aparición de angioedemas en piernas y brazos a los 11 años, diagnosticado de angioedema hereditario tipo I un año después. El diagnóstico definitivo de la enfermedad permitió instaurar un tratamiento adecuado a su patología, que consiste en la prevención de brotes que puedan comprometer la vida del paciente y, en el caso de que aparezcan, en la administración del complemento C1 inhibidor.

  15. Main: L1DCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1DCPAL1 S000504 15-September-2006 (last modified) kehi L1 element, found in PAL1 p...romoter in carrot (Daucus carota), is a protoplastization (dilution) responsive element; L1 contains Box L-l...ike sequence (ACCTACCC); see also S000492 (BOXL CORE of DC PAL1); L1 Daucus carota (carrot) ATTCACCTACCC ...

  16. 18 CFR 1b.1 - Definitions. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Definitions. 1b.1 Section 1b.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES RULES RELATING TO INVESTIGATIONS § 1b.1 Definitions. For purposes of this part—...

  17. Citocinas anti-inflamatorias y sus acciones y efectos en la sepsis y el choque séptico - Anti-inflammatory cytokines and their actions and effects in the sepsis and septic shock


    González Álvarez, Ricardo; Zamora Rodríguez, Zullit; Alonso González, Yaima


    ResumenLas citocinas anti- inflamatorias reconocidas son las interleucinas (IL) IL-4, IL-10, IL-6, IL-13, el factor estimulante de colonia granulocito –macrófago (FEC-GM) y el interferón alfa (IFN-alfa), los cuales tienen la capacidad de inhibir la liberación de las citocinas pro-inflamatorias y de inducir la producción del antagonista del receptor de la IL-1 y la liberación del receptor soluble del FNT, los cuales limitan algunas de las actividades de las citocinas pro-inflamatorias IL-1 y F...

  18. A new perspective on the treatment of complicated giant emphysematous bulla A case report. (United States)

    Mazzella, Antonio; Izzo, Alessandro; Amore, Dario; Cerqua, Francesco Saverio; Perrotta, Fabio


    L’enfisema bolloso gigante, altresì detto polmone evanescente, è una sindrome clinica già descritta nel 1937 da Burke1. Si tratta di una patologia idiopatica che colpisce i giovani, spesso fumatori; altri fattori di rischio sono rappresentati dal deficit di α-1 antitripsina e dall’abuso di marijuana2. La severa distorsione dell’architettura del parenchima polmonare determina alterazioni della ventilazione e degli scambi gassosi. Le più frequenti complicanze sono rappresentate dallo pneumotorace spontaneo o provocato dalla ventilazione meccanica, e dalle infezioni. La “lung volume reduction surgery” (LVRS) è il trattamento gold standard in gruppi selezionati di pazienti. Le raccomandazioni alla chirurgia prevedono bolle occupanti > 30% dell’emitorace affetto o bolle complicate (rottura e/o sovrainfezione). Negli ultimi anni, la videotoracoscopia ha dimostrato una maggiore efficacia in termini di ridotte complicanze peri e post-operatorie, riduzione del dolore, riduzione dei tempi di degenza e dei costi in confronto alla chirurgia “open” 3. Riportiamo un caso di una donna di 31 anni affetta da bolla gigante complicata del lobo superiore del polmone destro. La paziente, ricoverata per idro – pneumotorace, a causa di prolungate perdite aeree, nonostante drenaggio toracico veniva indirizzata a LVRS. Mediante VATS uniportale con singola incisione cutanea di 4 cm veniva individuata la rottura di bolla gigante del lobo superiore di destra e si eseguiva pertanto bullectomia e pleurodesi meccanica. Questo caso, nella nostra conoscenza, rappresenta la prima resezione di bolla gigante eseguita in VATS uniportale.

  19. Main: 1OM1 [RPSD[Archive

    Lifescience Database Archive (English)


  20. Main: 1FK1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK1 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK1.jpg ...

  1. Influence of G1359A polimorphysm of the cannabinoid receptor gene (CNR1 on insulin resistance and adipokines in patients with non alcoholic fatty liver disease Influencia del polimorfismo G1359a del gen del receptor cannabinoide (CNR1 sobre la resistencia a la insulina y adipocinas en pacientes con enfermedad hepática no alcohólica

    Directory of Open Access Journals (Sweden)

    R. Aller


    la resistencia a la insulina, cambios en la histología hepática, parámetros antropométricos y adipocitoquinas en pacientes con hígado graso no alcohólico. Material y métodos: Una población de 71 pacientes con hígado graso no alcohólico fue reclutado en un estudio de corte transversal. Se realizó un análisis bioquímico de suero. El genotipo del polimorfismo G1359A del gen del receptor CB1 se ha estudiado en todos los pacientes. Cuarenta y un pacientes (36,9% tenían el genotipo G1359G (grupo de tipo salvaje y veintinueve (26,1% de los pacientes o G1359A A1359A (grupo mutante. Resultados: Veinticuatro 24 pacientes (32,3% tenían un grado de Brunt > 4 y 12 pacientes (17% tenían una fibrosis significativa (F > = 2. Los valores de HOMA fueron mayores en el grupo con genotipo salvaje que el grupo mutante. Los niveles de adiponectina y visfatina fueron mayores en el grupo con genotipo mutante. Por otra parte, el TNF-alfa y los niveles de resistina fueron más altos en el grupo con genotipo salvaje que el grupo mutante. Los pacientes con genotipo mutante mostraron niveles elevados de menor frecuencia de AST. AST > 40 UI/L se detectó en el 28,5% de los pacientes con el genotipo mutante frente a 53% de los pacientes con genotipo salvaje, p = 4 con menos frecuencia que los pacientes con genotipo salvaje (28,5%vs 7,1%. Conclusión: Una variante del polimorfismo G1359A CBR1 se asocia con menores niveles de HOMA, TNF-alfa, resistina y mayores niveles de adiponectina que los pacientes con la variante salvaje de este polimorfismo. Además, los pacientes con una variante del alelo muestra menor grado de Brunt en la biopsia hepática.


    Lifescience Database Archive (English)

    Full Text Available L1BOXATPDF1 S000386 05-November-2005 (last modified) kehi L1 box found in promoter ...of Arabidopsis thaliana (A.t.) PROTODERMAL FACTOR1 (PDF1) gene; Located between -134 and -127; Involved in L...ding motif (Wang et al., 2004); HDZip IV; See also S000371; PDF1; L1 box; L1 layer-specific expression; Shoo

  3. Containment of 0 and 1 in 1(, )

    Indian Academy of Sciences (India)

    Mohsen Alimohammady


    Suppose 1(, ) is the space of all absolutely 1-summing operators between two Banach spaces and . We show that if has a copy of 0, then 1(, ) will have a copy of 0, and under some conditions if has a copy of 1 then 1(, ) would have a complemented copy of 1.

  4. 26 CFR 1.535-1 - Definition. (United States)


    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition. 1.535-1 Section 1.535-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.535-1 Definition. (a)...

  5. Main: MNF1ZMPPC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MNF1ZMPPC1 S000251 11-Oct-1999 (last modified) kehi MNF1 binding site in maize (Z.m....) Ppc1 (phosphoenolpyruvate carboxylase) gene promoter; Involved in light induction; MNF1; Ppc1; light; leaf; shoot; maize (Zea mays) GTGCCCTT ...

  6. 45 CFR 1220.1-1 - Introduction. (United States)


    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1220.1-1 Section 1220.1-1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE PAYMENT OF VOLUNTEER LEGAL EXPENSES General § 1220.1-1 Introduction. Section 419 of the Domestic...

  7. 26 CFR 1.72-1 - Introduction. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Introduction. 1.72-1 Section 1.72-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.72-1 Introduction. (a)...

  8. 26 CFR 1.581-1 - Banks. (United States)


    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Banks. 1.581-1 Section 1.581-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Banking Institutions § 1.581-1 Banks. (a) In order to be a bank as defined in section 581,...

  9. Main: 1UD1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UD1 大豆 Soybean Glycine max (L.) Merrill Glycinin G1 Precursor [Contains: Glycinin ...A1a Subunit; Glycinin Bx De Subunit]. Name=Gy1; Glycine Max Molecule: Glycinin G1; Chain: A, B, C; Synonym:

  10. A molecular approach to pre-harvest impact on post-harvest quality of trout

    DEFF Research Database (Denmark)

    Nielsen, Michael Engelbrecht; Hyldig, Grethe; Nielsen, Henrik Hauch;

    damage in rainbow trout (Oncorhynchus mykiss). Needle disrupted muscle tissue was sampled at different time points and subject to real-time RT-PCR for measuring the expression of the genes IL-1ß, IL-8, IL-10, TGF-ß, Myostatin-1ab, MMP-2, CTGF, Collagen-1alfa, VEGF, iNOS, Arg-2 and FGF. The results showed...

  11. Main: SB1NPABC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SB1NPABC1 S000435 27-Jan-2004 (last modified) kehi Sclareol box1 (SB1) found at -82...7 of a plasma membrane ATP binding cassette (ABC) transporter gene (NpABC1) in N. plumbaginifolia; Mutation SB3 completely abolished sclareolide-mediated expression; See S ; scalareol; diterpene; ABC; transporter; Nicotiana plumbaginifolia (tobacco); CACTAACACAAAGTAA ...

  12. Main: CCA1ATLHCB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CCA1ATLHCB1 S000149 10-May-1998 (last modified) kehi CCA1 binding site; CCA1 protei...n (myb-related transcription factor) interact with two imperfect repeats of AAMAATCT in Lhcb1*3 gene of Arab

  13. Reference: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 Villain P, Clabault G, Mache R, Zhou DX S1F binding site is related to ...but different from the light-responsive GT-1 binding site and differentially represses the spinach rps1 prom

  14. 1 CFR 3.1 - Information services. (United States)


    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Information services. 3.1 Section 3.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER GENERAL SERVICES TO THE PUBLIC § 3.1 Information services. Except in cases where the time required would be excessive, information concerning...

  15. Eletroforese em acetato de celulose das proteínas do líquido cefalorraqueano: valores normais

    Directory of Open Access Journals (Sweden)

    Izelino Caldas Filho


    Full Text Available Foi feita eletroforese das proteinas de LCR colhido por via lombar de 19 pacientes neurologicamente normais entre 10 e 54 anos. A proteinorraquia total variou entre 10 e 28 mg% (método de Meulemans. Sete pacientes eram normais e 12 apresentavam neuroses. As médias das frações separadas pela eletroforese foram: pré-albumina 4.3%; albumina 54.8%; globulina alfa-1 5.9%; globulina alfa-2 8.3%; globulinas beta 15.5%; globulinas gama 11.2%.

  16. Evaluación de factores biológicos solubles en líquido sinovial y suero como candidatos a biomarcadores en espondiloartropatías


    Romero Sánchez, María Consuelo


    El estudio de biomarcadores, definidos como molecular que reflejan un proceso biológico o patológico especifico en la espodiloartropatías (EAS), ha emergido como un área relevante dentro de la investigación básica y clínica. Los hallazgos del trabajo permiten primero proponer a la IL-1 alfa como un candidato a biomarcador de respuesta temprana y monitoreo al tratamiento con anti TNF-alfa, considerado de importancia continuar con los estudios de la variabilidad aportada por el polimorfismo ? 3...

  17. Angle-resolved photoemission study of Ag(1 1 1) (United States)

    Edamoto, K.; Miyazaki, E.; Shimokoshi, K.; Kato, H.


    The (1 1 1) face of Ag has been studied by angle-resolved photoemission spectroscopy utilizing synchrotron radiation as the excitation source (25 FIRO method. The peak positions thus determined are used to map the dispersion curves along the lang1 1 1rang (Γ-L) direction. The results show general agreement with calculated band structure, so far as the energy levels and symmetries are concerned. However, it is found that the density of state effect is dominant in the spectra obtained in the present photon energy region. The emission from the Ag 5s, p bands is observed to be broadened due to the indirect transition process.

  18. Main: JASE