WorldWideScience

Sample records for aleksandrs jemeljanovs mra

  1. Mõ interesnõ drug drugu / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2000-01-01

    Sillamäe kunstnike tööde näitusest Kärdla kultuurikeskuses. Esinesid Igor Lukjanov, German Jershov, Aleksandr Orlov, Vladimir ja Jelena Kuznetsovid, Aala Gitt, Tatjana Petsheritsa, Aleksandr Popolitov, Eduard Zenitski

  2. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... by Image/Video Gallery Your Radiologist Explains Magnetic Resonance Angiography (MRA) Transcript Welcome to Radiology Info dot ... d like to talk with you about magnetic resonance angiography, or as it’s commonly known, MRA. MRA ...

  3. Contrast-enhanced peripheral MRA

    DEFF Research Database (Denmark)

    Nielsen, Yousef W; Thomsen, Henrik S

    2012-01-01

    -state MRA. Gadolinium(Gd)-based contrast agents are used for CE-MRA of the peripheral arteries. Extracellular Gd agents have a pharmacokinetic profile similar to iodinated contrast media. Accordingly, these agents are employed for first-pass MRA. Blood-pool Gd-based agents are characterized by prolonged......In the last decade contrast-enhanced magnetic resonance angiography (CE-MRA) has gained wide acceptance as a valuable tool in the diagnostic work-up of patients with peripheral arterial disease. This review presents current concepts in peripheral CE-MRA with emphasis on MRI technique and contrast...... MRI contrast agent is injected intravenously and T1-weighted images are acquired in the subsequent arterial first-pass phase. In order to achieve high quality MR angiograms without interfering venous contamination or artifacts, a number of factors need to be taken into account. This includes magnetic...

  4. Renal artery stenosis: comparative assessment by unenhanced renal artery mra versus contrast-enhanced MRA

    International Nuclear Information System (INIS)

    Khoo, Michael M.Y.; Deeab, Dhafer; Gedroyc, Wladyslaw M.W.; Dick, Elizabeth A.; Duncan, Neil; Taube, David

    2011-01-01

    To evaluate steady-state free precession (SSFP) non-contrast-enhanced MR angiography (Unenhanced-MRA) versus conventional contrast-enhanced MR angiography (CE-MRA) in the detection of renal artery stenosis (RAS). Retrospective analysis of 70 consecutive patients referred for suspected RAS, examined by SSFP Unenhanced-MRA and CE-MRA. Image quality, quality of visible renal arterial segments, presence and grade of RAS were evaluated. The Unenhanced-MRA were compared against reference standard CE-MRA results. 149 renal arteries were assessed with 21 haemodynamically significant stenoses (≥50% stenosis) demonstrated by CE-MRA. Combined sensitivity and specificity for RAS detection by Unenhanced-MRA was 72.8% and 97.8% respectively. There is substantial correlation for RAS detection between Unenhanced-MRA and CE-MRA with kappa values of between 0.64 and 0.74. There was excellent inter-observer correlation for RAS on Unenhanced-MRA (kappa values 0.82-1.0). Our study has shown Unenhanced-MRA to be a viable alternative to CE-MRA, yielding images equal in quality without the requirement for gadolinium contrast agents. The sensitivity and specificity for the detection of haemodynamically significant stenoses are comparable to CE-MRA. Potentially, Unenhanced-MRA could be used as an initial investigation to avoid performing CE-MRA in patients with normal renal arteries, however we suggest that its real value will lie in being complementary to CE-MRA. (orig.)

  5. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... it’s commonly known, MRA. MRA is a noninvasive test that uses a powerful magnetic field and a computer to produce detailed pictures of the major blood vessels throughout your body. It may be performed ...

  6. Za vsjo horosheje - finansovaja udavka ili Aleksandr Kaljagin protiv Marinõ Dmitrijevskoi / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Vastasseisust Venemaa Teatritegelaste Liidu esimehe Aleksandr Kaljagini ja Peterburi teatriajakirja "Peterburgski teatralnõi zhurnal" peatoimetaja Marina Dmitrijevskaja vahel. Aleksandr Kaljagin ähvardab lõpetada ajakirja finantseerimise

  7. Aleksandr Zinovjevi Lääs / Haljand Udam

    Index Scriptorium Estoniae

    Udam, Haljand, 1936-2005

    1997-01-01

    Aleksandr Zinovjevi teosest "L'Occidentisme. Essai sur le triomphe d'une ideologie" (1993), vene k. pealk. "Zapad. Fenomen zapadnizma" (Moskva, 1995). Vene kommunismi ja Lääne vesternismi vastandamine. Ilmunud ka kogumikus: Udam, Haljand. Maagid, filosoofid, poliitikud. Tallinn : Perioodika, 2002, lk. 126-139. (Loomingu Raamatukogu)

  8. Ainult kaks küsimust / Aleksandr Žedeljov

    Index Scriptorium Estoniae

    Žedeljov, Aleksandr

    2010-01-01

    Vene Teatris juunis 2011 esietenduvast live performance'ist "Alice", mis koosneb kaasaegsest koreograafiast, originaalsest autorimuusikast. videost, animatsioonist ja varjuteatrist. Lewis Carroll'i teosel "Alice Imedemaal" põhineva lavastuse autorid on Olga Privis, Aleksandr Žedeljov, MTÜ Fat Snail, MTÜ Vastik Sipsik, MTÜ HeliTelg

  9. Ja protiv zabivanija gvozdei / Aleksandr Gordon ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Gordon, Aleksandr

    2003-01-01

    Venemaal Gatshina filmifestivalil "Kirandus ja kino" ("Literatura i kino") sai žürii eriauhinna "Parima debüüdi eest" Aleksandr Gordoni mängufilm oma isa Garri Gordoni jutustuse järgi "Oma lehmade karjane" ("Pastuhh svoihh korov")

  10. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician ... it’s commonly known, MRA. MRA is a noninvasive test that uses a powerful magnetic field and a ...

  11. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Sponsored by Image/Video Gallery Your Radiologist Explains Magnetic Resonance Angiography (MRA) Transcript Welcome to Radiology Info ... I’d like to talk with you about magnetic resonance angiography, or as it’s commonly known, MRA. ...

  12. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... computer to produce detailed pictures of the major blood vessels throughout your body. It may be performed ... in your arm. MRA is used to examine blood vessels in key areas of your body and ...

  13. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Videos About Us News Physician Resources Professions Site Index A-Z Spotlight Recently posted: How to Obtain ... an MRA scan, there are several things you can do to prepare for the examination. First of ...

  14. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Abdominal Ultrasound Video: Pelvic Ultrasound Medical Imaging Costs Radiology and You Take our survey Sponsored by Image/ ... Explains Magnetic Resonance Angiography (MRA) Transcript Welcome to Radiology Info dot org Hello, I’m Dr. Elliot ...

  15. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... and You Take our survey Sponsored by Image/Video Gallery Your Radiologist Explains Magnetic Resonance Angiography (MRA) ... Carotid Intima-Media Thickness Test Medical Imaging Costs Video: Abdominal Ultrasound Video: Pelvic Ultrasound Radiology and You ...

  16. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... mild sedative prior to the examination. For more information about Magnetic Resonance Angiography of MRA or any ... Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  17. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... MRA scan, there are several things you can do to prepare for the examination. First of all, ... To help ensure current and accurate information, we do not permit copying but encourage linking to this ...

  18. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... at home. Tell the radiologic technologist if you have medical devices implanted in your body as these ... of MRA or any specific question you might have, visit Radiology Info dot org. Thank you for ...

  19. Nonenhanced magnetic resonance angiography (MRA) of the calf arteries at 3 Tesla: intraindividual comparison of 3D flow-dependent subtractive MRA and 2D flow-independent non-subtractive MRA.

    Science.gov (United States)

    Knobloch, Gesine; Lauff, Marie-Teres; Hirsch, Sebastian; Schwenke, Carsten; Hamm, Bernd; Wagner, Moritz

    2016-12-01

    To prospectively compare 3D flow-dependent subtractive MRA vs. 2D flow-independent non-subtractive MRA for assessment of the calf arteries at 3 Tesla. Forty-two patients with peripheral arterial occlusive disease underwent nonenhanced MRA of calf arteries at 3 Tesla with 3D flow-dependent subtractive MRA (fast spin echo sequence; 3D-FSE-MRA) and 2D flow-independent non-subtractive MRA (balanced steady-state-free-precession sequence; 2D-bSSFP-MRA). Moreover, all patients underwent contrast-enhanced MRA (CE-MRA) as standard-of-reference. Two readers performed a per-segment evaluation for image quality (4 = excellent to 0 = non-diagnostic) and severity of stenosis. Image quality scores of 2D-bSSFP-MRA were significantly higher compared to 3D-FSE-MRA (medians across readers: 4 vs. 3; p Tesla with significantly higher image quality and diagnostic accuracy compared to 3D flow-dependent subtractive MRA (3D-FSE-MRA). • 2D flow-independent non-subtractive MRA (2D-bSSFP-MRA) is a robust NE-MRA technique at 3T • 2D-bSSFP-MRA outperforms 3D flow-dependent subtractive MRA (3D-FSE-MRA) as NE-MRA of calf arteries • 2D-bSSFP-MRA is a promising alternative to CE-MRA for calf PAOD evaluation.

  20. Nonenhanced ECG-gated quiescent-interval single-shot MRA (QISS-MRA) of the lower extremities: Comparison with contrast-enhanced MRA

    Energy Technology Data Exchange (ETDEWEB)

    Klasen, J. [Department of Diagnostic and Interventional Radiology, University of Duesseldorf, Medical Faculty, Duesseldorf (Germany); Blondin, D., E-mail: blondin@med.uni-duesseldorf.de [Department of Diagnostic and Interventional Radiology, University of Duesseldorf, Medical Faculty, Duesseldorf (Germany); Schmitt, P. [Siemens AG, Healthcare Sector, Erlangen (Germany); Bi, X. [Siemens Healthcare, Chicago, IL (United States); Sansone, R. [Department of Cardiology, University of Duesseldorf, Medical Faculty, Duesseldorf (Germany); Wittsack, H.-J.; Kroepil, P.; Quentin, M.; Kuhlemann, J.; Miese, F. [Department of Diagnostic and Interventional Radiology, University of Duesseldorf, Medical Faculty, Duesseldorf (Germany); Heiss, C.; Kelm, M. [Department of Cardiology, University of Duesseldorf, Medical Faculty, Duesseldorf (Germany); Antoch, G.; Lanzman, R.S. [Department of Diagnostic and Interventional Radiology, University of Duesseldorf, Medical Faculty, Duesseldorf (Germany)

    2012-05-15

    Aim: To evaluate electrocardiogram (ECG)-gated quiescent-interval single-shot magnetic resonance angiography (QISS-MRA) for nonenhanced assessment of peripheral artery occlusive disease (PAOD) using contrast-enhanced MRA (CE-MRA) as the reference standard. Materials and methods: Twenty-seven patients (mean age 66.6 {+-} 10.8 years) with PAOD were included in the study. QISS-MRA and CE-MRA of the lower extremity were performed using a 1.5 T MR scanner. In each patient, subjective image quality and the degree of stenosis were evaluated on a four-point scale for 15 predefined arterial segments. Results: Twenty-five of the 27 patients were considered for analysis. Subjective image quality of QISS-MRA was significantly lower for the distal aorta, pelvic arteries, and femoral arteries as compared to CE-MRA (p < 0.01), while no significant difference was found for other vascular segments. The degree of stenosis was overestimated with QISS-MRA in 23 of 365 (6.3%) segments and underestimated in two of 365 (0.5%) segments. As compared to CE-MRA, QISS-MRA had a high sensitivity (98.6%), specificity (96%) as well as positive and negative predictive value (88.7 and 99.6%, respectively) for the detection of significant stenosis ({>=}50%). Conclusion: ECG-gated QISS-MRA is a promising imaging technique for reliable assessment of PAOD without the use of contrast material.

  1. Nonenhanced ECG-gated quiescent-interval single-shot MRA (QISS-MRA) of the lower extremities: Comparison with contrast-enhanced MRA

    International Nuclear Information System (INIS)

    Klasen, J.; Blondin, D.; Schmitt, P.; Bi, X.; Sansone, R.; Wittsack, H.-J.; Kröpil, P.; Quentin, M.; Kuhlemann, J.; Miese, F.; Heiss, C.; Kelm, M.; Antoch, G.; Lanzman, R.S.

    2012-01-01

    Aim: To evaluate electrocardiogram (ECG)-gated quiescent-interval single-shot magnetic resonance angiography (QISS-MRA) for nonenhanced assessment of peripheral artery occlusive disease (PAOD) using contrast-enhanced MRA (CE-MRA) as the reference standard. Materials and methods: Twenty-seven patients (mean age 66.6 ± 10.8 years) with PAOD were included in the study. QISS-MRA and CE-MRA of the lower extremity were performed using a 1.5 T MR scanner. In each patient, subjective image quality and the degree of stenosis were evaluated on a four-point scale for 15 predefined arterial segments. Results: Twenty-five of the 27 patients were considered for analysis. Subjective image quality of QISS-MRA was significantly lower for the distal aorta, pelvic arteries, and femoral arteries as compared to CE-MRA (p < 0.01), while no significant difference was found for other vascular segments. The degree of stenosis was overestimated with QISS-MRA in 23 of 365 (6.3%) segments and underestimated in two of 365 (0.5%) segments. As compared to CE-MRA, QISS-MRA had a high sensitivity (98.6%), specificity (96%) as well as positive and negative predictive value (88.7 and 99.6%, respectively) for the detection of significant stenosis (≥50%). Conclusion: ECG-gated QISS-MRA is a promising imaging technique for reliable assessment of PAOD without the use of contrast material.

  2. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Recently posted: Carotid Intima-Media Thickness Test Medical Imaging Costs Video: Abdominal Ultrasound Video: Pelvic Ultrasound Radiology and You Take our survey Sponsored by Image/Video Gallery Your Radiologist Explains Magnetic Resonance Angiography (MRA) Transcript Welcome to Radiology Info dot ...

  3. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... your doctor for a mild sedative prior to the examination. For more information about Magnetic Resonance Angiography of MRA or any specific question you might have, visit Radiology Info dot org. Thank you for your time and for your attention! Spotlight Recently posted: How to Obtain and Share ...

  4. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos ... of your body and to identify abnormalities and disease. If you’re scheduled for an MRA scan, ...

  5. MRA in inflammatory disorders of the central nervous system

    International Nuclear Information System (INIS)

    Felber, S.

    2000-01-01

    In this review, we discuss the diagnostic potential of time of flight (TOF) MRA and contrast enhanced (CE) MRA in inflammatory disorders of the meninges and the brain. Cerebrovascular complications are frequently observed during infectious meningoencepalitis. 3D TOF-MRA and CE-MRA are complementary for the detection of basal intracranial artery stenosis and septic cerebral vein and sinus thrombosis due to secondary vasculitis. MRA reveals stenosis and occlusion as indirect signs of vasculitis, whereas MRI shows the inflammation of the brain and meninges and occasionally the vessel wall, together with the ischemic or hemorrhagic complication. In case of septic emboli MRA can detect peripheral occlusions and 'mycotic' aneurysms. For the diagnosis of noninfectious vasculitides of the intracranial vessels, high resolution 3D TOF-MRA is superior to CE-MRA for the detection of multiloculated segmental stenoses. However, there are presently no prospective studies on the sensitivity and specificity of MRA for these indications. Therefore, only positive MRA results can directly influence clinical management. In case of normal MRA, confirmation by catheder angiography may still be required. (orig.) [de

  6. Eesti kirjandus Moskvas : ajutine vaikus : [intervjuu] / Vera Ruber, Aleksandr Tomberg ; üles kirjut. Triin Parts

    Index Scriptorium Estoniae

    Ruber, Vera, 1925-2011

    1997-01-01

    Emil Tode (T. Õnnepalu) 'Piiririik' ilmub Vera Ruberi tõlkes ajakirja 'Druzhba Narodov' detsembrinumbris. Aleksandr Tombergil on valmis romaani 'Hind' tõlge, kuid seni puuduvad avaldamisvõimalused

  7. Kas e-saba leevendab olukorda? / Jelena Kazina, Aleksandr Bõstrov, Raiki Nelk

    Index Scriptorium Estoniae

    Kazina, Jelena

    2010-01-01

    Küsimusele elektroonilist piirijärjekorda võimaldava seaduse kohta vastavad Baltliner OÜ projektijuht Jelena Kazina, endine Cargoman OÜ juhataja Aleksandr Bõstrov ja AG Logistik OÜ ekspedeerija Raiki Nelk

  8. Nonenhanced magnetic resonance angiography (MRA) of the calf arteries at 3 Tesla: intraindividual comparison of 3D flow-dependent subtractive MRA and 2D flow-independent non-subtractive MRA

    Energy Technology Data Exchange (ETDEWEB)

    Knobloch, Gesine; Lauff, Marie-Teres; Hirsch, Sebastian; Hamm, Bernd; Wagner, Moritz [Charite - Universitaetsmedizin Berlin, Department of Radiology, Berlin (Germany); Schwenke, Carsten [SCO:SSiS Statistical Consulting, Berlin (Germany)

    2016-12-15

    To prospectively compare 3D flow-dependent subtractive MRA vs. 2D flow-independent non-subtractive MRA for assessment of the calf arteries at 3 Tesla. Forty-two patients with peripheral arterial occlusive disease underwent nonenhanced MRA of calf arteries at 3 Tesla with 3D flow-dependent subtractive MRA (fast spin echo sequence; 3D-FSE-MRA) and 2D flow-independent non-subtractive MRA (balanced steady-state-free-precession sequence; 2D-bSSFP-MRA). Moreover, all patients underwent contrast-enhanced MRA (CE-MRA) as standard-of-reference. Two readers performed a per-segment evaluation for image quality (4 = excellent to 0 = non-diagnostic) and severity of stenosis. Image quality scores of 2D-bSSFP-MRA were significantly higher compared to 3D-FSE-MRA (medians across readers: 4 vs. 3; p < 0.0001) with lower rates of non-diagnostic vessel segments on 2D-bSSFP-MRA (reader 1: <1 % vs. 15 %; reader 2: 1 % vs. 29 %; p < 0.05). Diagnostic performance of 2D-bSSFP-MRA and 3D-FSE-MRA across readers showed sensitivities of 89 % (214/240) vs. 70 % (168/240), p = 0.0153; specificities: 91 % (840/926) vs. 63 % (585/926), p < 0.0001; and diagnostic accuracies of 90 % (1054/1166) vs. 65 % (753/1166), p < 0.0001. 2D flow-independent non-subtractive MRA (2D-bSSFP-MRA) is a robust nonenhanced MRA technique for assessment of the calf arteries at 3 Tesla with significantly higher image quality and diagnostic accuracy compared to 3D flow-dependent subtractive MRA (3D-FSE-MRA). (orig.)

  9. MRA for diagnosis of venous thromboembolism

    Energy Technology Data Exchange (ETDEWEB)

    Sostman, H. D. [Cornell University, Weill Medical College, Chair of Radiology, New York (United States)

    2001-12-01

    Direct imaging of pulmonary embolism (PE) and deep vein thrombosis (DVT) with CT, and potentially with MR, will continue to replace V/Q scintigraphy. Venous imaging with MR far detecting DVT is used in a few centers, and their published accuracy figures are impressive. Recent studies of MR pulmonary angiography for PE reported that sensitivity of MRA was 85-100%, specificity 95-96%, but this data must be confirmed in other centers and patient populations. MR has advantages compared with CT, which make it worthwhile to continue MR development. Ionizing radiation and iodinated contrast material are not used. Imaging the pulmonary arteries and then imaging whichever venous region is of clinical interest is practical in a single examination. Repeated examinations can be performed safely. New contrast materials will facilitate the practically and accuracy of the MR technique and perfusion imaging may increase sensitivity. MR also has disadvantages compared with CT. It does not image effectively the non-vascular compartment of the lungs. It is more expensive, patient monitoring is more cumbersome, and a routine technique, which embodies all of MR's potential advantages, has not been packaged and tested. Accordingly, helical CT is a realistic option in clinical management of patients with suspected PE in most centers, while clinical application of MR is limited to centers with appropriate MR expertise and technology. However, MR has a number of fundamental characteristics that make it potentially ideal modality for evaluating patients with suspected acute venous thromboembolic disease and further clinical research with MRA is warranted.

  10. "...dorogi tshastnõje i mezhvremennõje" / Aleksandr Solzhenitsõn

    Index Scriptorium Estoniae

    Солженицын, Александр Исаевич, 1918-2008

    1999-01-01

    Katkend mälestustest: Solzhenitsõn, Aleksandr. Ugodila zernõshko promezh dvuhh zhernovov : otserki izgnanija. Tsh. 1 // Novõi Mir (1998) nr. 9, lk. 47-125. Ka A. Solzhenitsõni kiri V. Nabokovile (16. mai 1972)

  11. Aleksandr (Sasha) Pechersky (1909-1990) : In Search of a Life Story

    NARCIS (Netherlands)

    Leydesdorff, S.; Goodson, I.; Antikainen, A.; Sikes, P.; Andrews, M.

    2017-01-01

    It all began in Munich. When I interviewed survivors of the Sobibor death camp (“Vernichtungslager”) after the trial of John Demjanjuk (2009–2011), 2 they all praised and loved Aleksandr (“Sasha”) Pechersky, the Russian Jew who had led the revolt and escape that saved their lives. 3 Pechersky, the

  12. CBCT-based 3D MRA and angiographic image fusion and MRA image navigation for neuro interventions.

    Science.gov (United States)

    Zhang, Qiang; Zhang, Zhiqiang; Yang, Jiakang; Sun, Qi; Luo, Yongchun; Shan, Tonghui; Zhang, Hao; Han, Jingfeng; Liang, Chunyang; Pan, Wenlong; Gu, Chuanqi; Mao, Gengsheng; Xu, Ruxiang

    2016-08-01

    Digital subtracted angiography (DSA) remains the gold standard for diagnosis of cerebral vascular diseases and provides intraprocedural guidance. This practice involves extensive usage of x-ray and iodinated contrast medium, which can induce side effects. In this study, we examined the accuracy of 3-dimensional (3D) registration of magnetic resonance angiography (MRA) and DSA imaging for cerebral vessels, and tested the feasibility of using preprocedural MRA for real-time guidance during endovascular procedures.Twenty-three patients with suspected intracranial arterial lesions were enrolled. The contrast medium-enhanced 3D DSA of target vessels were acquired in 19 patients during endovascular procedures, and the images were registered with preprocedural MRA for fusion accuracy evaluation. Low-dose noncontrasted 3D angiography of the skull was performed in the other 4 patients, and registered with the MRA. The MRA was overlaid afterwards with 2D live fluoroscopy to guide endovascular procedures.The 3D registration of the MRA and angiography demonstrated a high accuracy for vessel lesion visualization in all 19 patients examined. Moreover, MRA of the intracranial vessels, registered to the noncontrasted 3D angiography in the 4 patients, provided real-time 3D roadmap to successfully guide the endovascular procedures. Radiation dose to patients and contrast medium usage were shown to be significantly reduced.Three-dimensional MRA and angiography fusion can accurately generate cerebral vasculature images to guide endovascular procedures. The use of the fusion technology could enhance clinical workflow while minimizing contrast medium usage and radiation dose, and hence lowering procedure risks and increasing treatment safety.

  13. Peripheral occlusive vascular disease: Diagnostic performance of MRA and DSA

    International Nuclear Information System (INIS)

    Krug, B.; Kugel, H.; Harnischmacher, U.; Heindel, W.; Altenburg, A.; Fischbach, R.; Schmidt, R.

    1995-01-01

    In 59 patients with arterial flow disturbances 2-D inflow sequence of the abdominal and lower leg arteries were prospectively obtained on a 1.5 T MR-imager and were compared with additional DSA examinations. Supplementary Phase Contraste RSE ('Rapid Sequential Excitation') sequences were carried out in 29 patients. MRA and DSA angiograms were evaluated in random order by 4 readers using a questionnaire. The assessment of image quality were evaluated by variance analysis. Diagnostic performance of MRA and DSA was assessed by comparison of the readers' diagnostic assessments with reference diagnoses established by a radiologist and a vascular surgeon with full knowledge of all data concerning a patient. Image quality of inflow MRA was considered inferior to i.a. DSA (p [de

  14. Combined large field-of-view MRA and time-resolved MRA of the lower extremities: Impact of acquisition order on image quality

    International Nuclear Information System (INIS)

    Riffel, Philipp; Haneder, Stefan; Attenberger, Ulrike I.; Brade, Joachim; Schoenberg, Stefan O.; Michaely, Henrik J.

    2012-01-01

    Purpose: Different approaches exist for hybrid MRA of the calf station. So far, the order of the acquisition of the focused calf MRA and the large field-of-view MRA has not been scientifically evaluated. Therefore the aim of this study was to evaluate if the quality of the combined large field-of-view MRA (CTM MR angiography) and time-resolved MRA with stochastic interleaved trajectories (TWIST MRA) depends on the order of acquisition of the two contrast-enhanced studies. Methods: In this retrospective study, 40 consecutive patients (mean age 68.1 ± 8.7 years, 29 male/11 female) who had undergone an MR angiographic protocol that consisted of CTM-MRA (TR/TE, 2.4/1.0 ms; 21° flip angle; isotropic resolution 1.2 mm; gadolinium dose, 0.07 mmol/kg) and TWIST-MRA (TR/TE 2.8/1.1; 20° flip angle; isotropic resolution 1.1 mm; temporal resolution 5.5 s, gadolinium dose, 0.03 mmol/kg), were included. In the first group (group 1) TWIST-MRA of the calf station was performed 1–2 min after CTM-MRA. In the second group (group 2) CTM-MRA was performed 1–2 min after TWIST-MRA of the calf station. The image quality of CTM-MRA and TWIST-MRA were evaluated by 2 two independent radiologists in consensus according to a 4-point Likert-like rating scale assessing overall image quality on a segmental basis. Venous overlay was assessed per examination. Results: In the CTM-MRA, 1360 segments were included in the assessment of image quality. CTM-MRA was diagnostic in 95% (1289/1360) of segments. There was a significant difference (p < 0.0001) between both groups with regard to the number of segments rated as excellent and moderate. The image quality was rated as excellent in group 1 in 80% (514/640 segments) and in group 2 in 67% (432/649), respectively (p < 0.0001). In contrast, the image quality was rated as moderate in the first group in 5% (33/640) and in the second group in 19% (121/649) respectively (p < 0.0001). The venous overlay was disturbing in 10% in group 1 and 20% in group

  15. Contrast-enhanced MRA for investigation of cerebral arteriovenous malformations.

    Science.gov (United States)

    Suzuki, M; Matsui, O; Kobayashi, K; Ueda, F; Saitoh, C; Katagiri, A; Sanada, J; Tawara, M; Terayama, N; Kawashima, H; Kida, S; Yamashita, J

    2003-04-01

    We evaluated contrast-enhanced MRA (enhanced 3-D fast gradient-echo [efgre3d] with spectral inversion recovery) for identification of 15 intracranial arteriovenous malformations (AVMs) in 14 patients. Demonstration of the feeding arteries was classified as good for 16 examinations on maximum-intensity projections and multiprojection volume reconstruction images. The nidus was seen well in all patients. Definition of the draining veins was good or fair except for one poor result. Therapeutic effects were clearly demonstrated in three follow-up series. Contrast-enhanced MRA using efgre3d is useful for delineation of AVMs and for follow-up after treatment.

  16. Contrast-enhanced MRA for investigation of cerebral arteriovenous malformations

    International Nuclear Information System (INIS)

    Suzuki, M.; Matsui, O.; Ueda, F.; Saitoh, C.; Katagiri, A.; Sanada, J.; Tawara, M.; Terayama, N.; Kawashima, H.; Kobayashi, K.; Kida, S.; Yamashita, J.

    2003-01-01

    We evaluated contrast-enhanced MRA (enhanced 3-D fast gradient-echo [efgre3d] with spectral inversion recovery) for identification of 15 intracranial arteriovenous malformations (AVMs) in 14 patients. Demonstration of the feeding arteries was classified as good for 16 examinations on maximum-intensity projections and multiprojection volume reconstruction images. The nidus was seen well in all patients. Definition of the draining veins was good or fair except for one poor result. Therapeutic effects were clearly demonstrated in three follow-up series. Contrast-enhanced MRA using efgre3d is useful for delineation of AVMs and for follow-up after treatment. (orig.)

  17. MRI and MRA of a giant hydrocoele in an infant

    Energy Technology Data Exchange (ETDEWEB)

    Schlup, Sandrine [Department of Paediatric Radiology, Hopital Universitaire des Enfants, Geneva (Switzerland); Department of Radiology, Hopital Universitaire de Pediatrie, rue Willy Donze 6, 1211 Geneva (Switzerland); Hanquinet, Sylvianne; Dumont, Merak; Jequier, Sigrid [Department of Paediatric Radiology, Hopital Universitaire des Enfants, Geneva (Switzerland); Bugmann, Philippe [Department of Surgery, Hopital Universitaire des Enfants, Geneva (Switzerland)

    2002-12-01

    We present a 7-month-old boy with a giant abdominoscrotal hydrocoele associated with right leg oedema. US revealed an abdominoscrotal fluid-filled mass with a normal testis in the scrotum. MRI allowed precise delineation of the mass while MRA sequences showed extrinsic compression of the right iliac vein and its patency. Hydrocoelectomy and laparotomy were performed and confirmed the diagnosis. US followed by MRI are often necessary to diagnose and delineate giant hydrocoeles. MRA is a non-invasive elegant tool for the detection of vascular complications. (orig.)

  18. Non invasive assessment of renal artery using dual MRA techniques compared with invasive renal angiography in cases of renovascular hypertension

    Directory of Open Access Journals (Sweden)

    Y. Ragab

    2011-03-01

    Conclusion: The combined approach of non-invasive CE MRA and PC MRA techniques achieves a very high specificity, PPV and NPV for the detection of renal arterial pathomorphologic features as compared to standard renal angiography. Adding PC MRA to CE MRA helps to differentiate between mild and moderate stenoses as well as moderate and sever arterial stenotic lesions. So, CE MRA is a morphological test while PC MRA helps in grading the arterial stenoses.

  19. Initial experience with 3T 3D-TOF MRA in the diagnosis of intracranial aneurysms

    International Nuclear Information System (INIS)

    Senba, Yoshiki; Takahashi, Shizue; Matsubara, Ichiro; Sadamoto, Kazuhiko; Miki, Hitoshi; Mochizuki, Teruhito

    2006-01-01

    We assessed the value of 3T 3D-time of flight (TOF) MR angiography (MRA) in the diagnosis of intracranial aneurysms compared with 1.5T 3D-TOF MRA. Twenty-one patients with 22 aneurysms underwent MRA at 1.5T and 3T. Images were interpreted by two radiologists. Each of nine aneurysms that had been considered ''definite'' at 1.5T 3D-TOF MRA were considered ''definite'' at 3T 3D-TOF MRA. Seven aneurysms that had been considered ''suspicious'' at 1.5T MRA were considered ''definite'' at 3T. And four aneurysms that had been considered ''suspicious'' at 1.5T were considered ''negative'' at 3T. We concluded that 3T 3D-TOF MRA is superior to 1.5T 3D-TOF MRA in the diagnosis of intracranial aneurysms. (author)

  20. MRA in inflammatory disorders of the central nervous system; Magnetresonanz-Angiographie bei entzuendlichen Hirnerkrankungen

    Energy Technology Data Exchange (ETDEWEB)

    Felber, S. [Universitaetsklinik Innsbruck (Austria). Klinische Abt. fuer Radiologie II; Auer, A. [Universitaetsklinik Innsbruck (Austria). Inst. fuer Magnetresonanztomographie und Spektroskopie; Schmutzhard, E. [Universitaetsklinik fuer Neurologie, Innsbruck (Austria)

    2000-11-01

    In this review, we discuss the diagnostic potential of time of flight (TOF) MRA and contrast enhanced (CE) MRA in inflammatory disorders of the meninges and the brain. Cerebrovascular complications are frequently observed during infectious meningoencepalitis. 3D TOF-MRA and CE-MRA are complementary for the detection of basal intracranial artery stenosis and septic cerebral vein and sinus thrombosis due to secondary vasculitis. MRA reveals stenosis and occlusion as indirect signs of vasculitis, whereas MRI shows the inflammation of the brain and meninges and occasionally the vessel wall, together with the ischemic or hemorrhagic complication. In case of septic emboli MRA can detect peripheral occlusions and 'mycotic' aneurysms. For the diagnosis of noninfectious vasculitides of the intracranial vessels, high resolution 3D TOF-MRA is superior to CE-MRA for the detection of multiloculated segmental stenoses. However, there are presently no prospective studies on the sensitivity and specificity of MRA for these indications. Therefore, only positive MRA results can directly influence clinical management. In case of normal MRA, confirmation by catheder angiography may still be required. (orig.) [German] Diese Uebersicht behandelt die Moeglichkeiten der Time of flight MRA (TOF-MRA) und der kontrastmittelunterstuetzten MRA (KM-MRA) bei zerebral entzuendlichen Erkrankungen. Vaskulaere Komplikationen bei entzuendlichen Erkrankungen des Gehirns und der Meningen sind haeufig. Bei der infektioesen Meningitis kann die MRA eine sekundaere Vaskulitis des Circulus arteriosus Willisii und seiner Aeste, aber auch eine septische Hirnvenen- und Sinusthrombose nachweisen. Die TOF-MRA und KM-MRA liefern dabei komplementaere Informationen. In der gleichen Untersuchung kann eine entzuendliche Infiltration der Meningen bildgebend diagnostiziert werden. Bei der haematogen Herdenzephalitis im Rahmen einer Sepsis oder Endokarditis ist die MRA zur diagnose embolischer

  1. Oma rahva säästmine on riigi ülim ülesanne / Aleksandr Solzhenitsõn ; interv. Vitali Tretjak

    Index Scriptorium Estoniae

    Solženitsõn, Aleksandr, 1918-2008

    2006-01-01

    Venemaa nädalalehes Moskovskije Novosti ilmunud vene ühiskondliku mõtte korüfee Aleksandr Solzhenitsõni intervjuu, mis analüüsib olukorda maailmas ja Venemaal. Vt. samas: Ilmar Mikiver. Solzhenitsõn - apostaat?; Aleksandr Solzhenitsõn Eestis

  2. Combination of functional MRI with SAS and MRA

    Energy Technology Data Exchange (ETDEWEB)

    Sumida, Masayuki; Takeshita, Shinichirou; Kutsuna, Munenori; Akimitsu, Tomohide; Arita, Kazunori; Kurisu, Kaoru [Hiroshima Univ. (Japan). School of Medicine

    1999-02-01

    For presurgical diagnosis of brain surface, combination of functional MRI (fMRI) with the MR angiography was examined. This method could visualize brain bay, convolution and vein as index of surface. Five normal adults (male, mean age: 28-year-old) and 7 patients with brain tumor on the main locus to surface (male: 4, female: 3, mean age: 52.3-year-old) were studied. fMRI was performed by SPGR method (TR 70, TE 40, flip angle 60, one slice, thickness 10 mm, FOV 20 cm, matrix 128 x 128). The brain surface was visualized by SAS (surface anatomy scanning). SAS was performed by FSE method (TR 6000, TE 200, echo train 16, thickness 20 mm, slice 3, NEX 2). Cortical veins near superior sagittal sinus were visualized by MRA with 2D-TOF method (TR 50, TE 20, flip angle 60, thickness 2 mm, slice 28, NEX 1). These images were superimposed and functional image of peripheral sensorimotor region was evaluated anatomically. In normal adults, high signal was visualized at another side of near sensorimotor region at 8 of 10 sides. All high signal area of fMRI agreed with cortical vein near sensorimotor region that was visualized by MRA. In patients with brain tumor, signal was visualized at another side of sensorimotor region of tumor without 2 cases with palsy. In another side of tumor, signal of fMRI was visualized in 5 of 7 cases. The tumor was visualized as opposite low signal field in SAS. Locational relation between tumor and brain surface and brain function was visualized distinctly by combination of MRA, SAS and MRA. This method could become useful for presurgical diagnosis. (K.H.)

  3. Aleksandr Kondratov e le sue ipostasi: un «avanguardista accademico» nella Leningrado underground

    Directory of Open Access Journals (Sweden)

    Federico Iocca

    2015-07-01

    Full Text Available L’articolo porta alla luce alcuni aspetti della vita e dell’opera di Aleksandr Kondratov (1937-1993, singolare protagonista del Samizdat sovietico. Tra gli scrittori più letti in patria durante la seconda metà del secolo scorso grazie alla pubblicazione di dozzine di libri di carattere scientifico- divulgativo, Kondratov fu al contempo autore di un’enorme quantità di testi letterari, che (firmati con lo pseudonimo Sandy Conrad circolavano negli ambienti underground dell’epoca. Tali testi, in cui lo scrittore anticipa idee e procedimenti di correnti letterarie comparse solo in anni e decenni successivi, contribuirono a creare un mito che può risultare per molti aspetti emblematico del fenomeno Samizdat.

  4. Comparison of remnant size in embolized intracranial aneurysms measured at follow-up with DSA and MRA

    Energy Technology Data Exchange (ETDEWEB)

    Serafin, Zbigniew; Strzesniewski, Piotr; Lasek, Wladyslaw [Nicolaus Copernicus University, Department of Radiology and Diagnostic Imaging, Collegium Medicum, Bydgoszcz (Poland); Beuth, Wojciech [University of Humanities and Economics in Wloclawek, Faculty of Health Sciences, Wloclawek (Poland)

    2012-12-15

    The possibility of recanalization and the need for retreatment are the most important limitations of intracranial aneurysm embolization. The purpose of the study was to compare the size of aneurysm remnants measured at follow-up with three-dimensional digital subtracted angiography (3D-DSA) and magnetic resonance angiography (MRA). Twenty-six aneurysms were found incompletely occluded in 72 consecutively examined patients at a follow-up after 3 months. The diameters and volume of aneurysm remnants were compared between 3D-DSA, time-of-flight MRA (TOF-MRA), contrast-enhanced TOF-MRA (CE-TOF-MRA), and contrast-enhanced MRA (CE-MRA) at 1.5 T. There was a significant correlation between remnant volumes calculated based on 3D-DSA and all MRA modalities. The intraobserver variability of the measurements ranged from 3.4 to 4.1 % and the interobserver variability from 5.8 to 7.3 %. There were no significant differences in the variability between the techniques. The mean residual filling volume ranged from 16.3 {+-} 19.0 mm{sup 3} in TOF-MRA to 30.5 {+-} 44.6 mm{sup 3} in 3D-DSA (P < 0.04). Significant differences were found in the volumes measured with 3D-DSA and CE-MRA as compared to TOF-MRA and CE-TOF-MRA (P < 0.01). There was a moderate significant correlation between the residual filling and the relative error of measurement in the case of TOF-MRA and CE-TOF-MRA. TOF-MRA seems to underestimate the size of aneurysm remnants detected at follow-up and should not be used as a sole imaging method to decide on re-embolization. (orig.)

  5. Comparison of remnant size in embolized intracranial aneurysms measured at follow-up with DSA and MRA

    International Nuclear Information System (INIS)

    Serafin, Zbigniew; Strzesniewski, Piotr; Lasek, Wladyslaw; Beuth, Wojciech

    2012-01-01

    The possibility of recanalization and the need for retreatment are the most important limitations of intracranial aneurysm embolization. The purpose of the study was to compare the size of aneurysm remnants measured at follow-up with three-dimensional digital subtracted angiography (3D-DSA) and magnetic resonance angiography (MRA). Twenty-six aneurysms were found incompletely occluded in 72 consecutively examined patients at a follow-up after 3 months. The diameters and volume of aneurysm remnants were compared between 3D-DSA, time-of-flight MRA (TOF-MRA), contrast-enhanced TOF-MRA (CE-TOF-MRA), and contrast-enhanced MRA (CE-MRA) at 1.5 T. There was a significant correlation between remnant volumes calculated based on 3D-DSA and all MRA modalities. The intraobserver variability of the measurements ranged from 3.4 to 4.1 % and the interobserver variability from 5.8 to 7.3 %. There were no significant differences in the variability between the techniques. The mean residual filling volume ranged from 16.3 ± 19.0 mm 3 in TOF-MRA to 30.5 ± 44.6 mm 3 in 3D-DSA (P < 0.04). Significant differences were found in the volumes measured with 3D-DSA and CE-MRA as compared to TOF-MRA and CE-TOF-MRA (P < 0.01). There was a moderate significant correlation between the residual filling and the relative error of measurement in the case of TOF-MRA and CE-TOF-MRA. TOF-MRA seems to underestimate the size of aneurysm remnants detected at follow-up and should not be used as a sole imaging method to decide on re-embolization. (orig.)

  6. Comparison of remnant size in embolized intracranial aneurysms measured at follow-up with DSA and MRA.

    Science.gov (United States)

    Serafin, Zbigniew; Strześniewski, Piotr; Lasek, Władysław; Beuth, Wojciech

    2012-12-01

    The possibility of recanalization and the need for retreatment are the most important limitations of intracranial aneurysm embolization. The purpose of the study was to compare the size of aneurysm remnants measured at follow-up with three-dimensional digital subtracted angiography (3D-DSA) and magnetic resonance angiography (MRA). Twenty-six aneurysms were found incompletely occluded in 72 consecutively examined patients at a follow-up after 3 months. The diameters and volume of aneurysm remnants were compared between 3D-DSA, time-of-flight MRA (TOF-MRA), contrast-enhanced TOF-MRA (CE-TOF-MRA), and contrast-enhanced MRA (CE-MRA) at 1.5 T. There was a significant correlation between remnant volumes calculated based on 3D-DSA and all MRA modalities. The intraobserver variability of the measurements ranged from 3.4 to 4.1 % and the interobserver variability from 5.8 to 7.3 %. There were no significant differences in the variability between the techniques. The mean residual filling volume ranged from 16.3 ± 19.0 mm(3) in TOF-MRA to 30.5 ± 44.6 mm(3) in 3D-DSA (P < 0.04). Significant differences were found in the volumes measured with 3D-DSA and CE-MRA as compared to TOF-MRA and CE-TOF-MRA (P < 0.01). There was a moderate significant correlation between the residual filling and the relative error of measurement in the case of TOF-MRA and CE-TOF-MRA. TOF-MRA seems to underestimate the size of aneurysm remnants detected at follow-up and should not be used as a sole imaging method to decide on re-embolization.

  7. Comparison of application value of DSA and MRA in diagnosis of subacute spontaneous intracerebral hemorrhage

    International Nuclear Information System (INIS)

    Zhou Mingli; Qu Tianrong; Feng Jun

    2012-01-01

    Objective: To explore the clinical value of digital subtraction angiography (DSA) and magnetic resonance angiography (MRA) in diagnosis of cerebral vascular structural abnormalities in the patients with spontaneous cerebral hemorrhage in subacute phase, and to provide clinical basis for detection of cerebral vascular structural abnormalities. Methods: 183 patients with subacute spontaneous intracerebral hemorrhage within 1 week were selected, the vascular structures of the patients were detected by DSA and MRA, and the influence factors were analyzed. Results: The DSA and MRA results showed that the parietal lobe, frontal lobe, and lenticular nucleus had the largest incidence rates of spontaneous intracerebral hemorrhage, and accounted for 17.5% , 16.9% , and 14.2% , respectively. The age and the incidence of the hypertension of the patients with cerebral vascular structural abnormalities were significantly lower than those of the patients without cerebral vascular structural abnormalities (P<0.05). There were positive correlations between subacute spontaneous cerebral hemorrhage and the age and the incidence of hypertension (r=0.43, r=0.46, P<0.05). The rates of cerebrovascular malformation detected with MRA and DSA had no statistically significant difference. The DSA was regarded as detection gold standard, the sensitivities and specificities of MRA in detection of cerebrovascular malformation were 98.8% and 96.9% . Conclusion: The abnormal vascular structures of patients with subacute spontaneous intracerebral hemorrhage can be detected mostly by MRA and DSA. MRA has the advantages of non-invasion, which is worthy to be applied in clinic. (authors)

  8. Comparison of MRA source image and IVUS for evaluating fibrous cap of carotid plaque

    International Nuclear Information System (INIS)

    Sakamoto, Masahiko; Taoka, Toshiaki; Nakagawa, Hiroyuki; Myochin, Kaoru; Yoshikawa, Kimihiko; Takayama, Katsutoshi; Wada, Takeshi; Iwasaki, Satoru; Fukuzumi, Akio

    2007-01-01

    The purpose is evaluating the usefulness of three-dimensional (3D) time of flight (TOF) MR angiography (MRA) source image for investigating fibrous cap of carotid plaque. The percentage of fibrous cap defect of 17 carotid stenotic lesions was calculated on both MRA source images and intravascular ultrasound (IVUS) images. Five lesions were correlated, but 9 had slight gap (10-20%) and 3 had moderate gap (30-40%). There was significant correlation (P<;0.01, r=0.721) by the Pearson's correlation coefficient. MRA source image can evaluate fibrous cap of carotid plaque. (author)

  9. High-resolution motion compensated MRA in patients with congenital heart disease using extracellular contrast agent at 3 Tesla

    Directory of Open Access Journals (Sweden)

    Dabir Darius

    2012-10-01

    Full Text Available Abstract Background Using first-pass MRA (FP-MRA spatial resolution is limited by breath-hold duration. In addition, image quality may be hampered by respiratory and cardiac motion artefacts. In order to overcome these limitations an ECG- and navigator-gated high-resolution-MRA sequence (HR-MRA with slow infusion of extracellular contrast agent was implemented at 3 Tesla for the assessment of congenital heart disease and compared to standard first-pass-MRA (FP-MRA. Methods 34 patients (median age: 13 years with congenital heart disease (CHD were prospectively examined on a 3 Tesla system. The CMR-protocol comprised functional imaging, FP- and HR-MRA, and viability imaging. After the acquisition of the FP-MRA sequence using a single dose of extracellular contrast agent the motion compensated HR-MRA sequence with isotropic resolution was acquired while injecting the second single dose, utilizing the timeframe before viability imaging. Qualitative scores for image quality (two independent reviewers as well as quantitative measurements of vessel sharpness and relative contrast were compared using the Wilcoxon signed-rank test. Quantitative measurements of vessel diameters were compared using the Bland-Altman test. Results The mean image quality score revealed significantly better image quality of the HR-MRA sequence compared to the FP-MRA sequence in all vessels of interest (ascending aorta (AA, left pulmonary artery (LPA, left superior pulmonary vein (LSPV, coronary sinus (CS, and coronary ostia (CO; all p  Conclusions An ECG- and navigator-gated HR-MRA-protocol with infusion of extracellular contrast agent at 3 Tesla is feasible. HR-MRA delivers significantly better image quality and vessel sharpness compared to FP-MRA. It may be integrated into a standard CMR-protocol for patients with CHD without the need for additional contrast agent injection and without any additional examination time.

  10. Internal carotid artery stenosis or occlusion: study of collateral circulation pathways on DSA and MRA

    International Nuclear Information System (INIS)

    Zhao Yunhui; Ma Zhubin; Xu Yikai

    2004-01-01

    Objectives: To evaluate the collateral pathways of internal carotid artery (ICA) stenosis or occlusion on digital subtraction angiography (DSA) and magnetic resonance angiography (MRA), and to compare these two methods in the study for collateral pathways. Methods: Seventy-four patients with ICA stenosis or occlusion were included as the study group. Sixty persons with normal findings on DSA or MRA each served as the control group. DSA, MRA, MRI, CT findings, and clinicall materials were analyzed in the two groups. Results: Stenosis or occlusion over ICA bifurcation was showed clearly in all patients on DSA or MRA. On DSA, the presence rate of ipsilateral posterior communicating artery (PCoA) in the study group (82.5%) was lower significantly than that of the control group (94.2%) (P=0.025). On MRA (3D-TOF), the rate in the study group (59.3%) was higher significantly than that of the controls (30.0%) (P=0.000). On DSA and MRA, the diameter of ipsilateral PCoA in the study group was larger than that of the control group (P=0.000). On DSA, the presence rate of OPhA in the study group was significantly different from that of the control group, and its diameter was larger than that of the control group (P=0.003). On MRA, its presence rate was lower than that of the control group. The presence rate of anterior communicating artery (ACoA) in the study group showed no statistical difference between DSA and MRA. In the study group, the presence rate of PCoA on DSA was significantly higher than that on MRA (P 0.05). The diameters of the three arteries showed no significant differences between DSA and MRA (P>0.05). Conclusion: DSA is highly valuable for the evaluation of collateral pathways of ICA stenosis or occlusion, and it is necessary for preoperative examination. MRA is a non-invasive angiographic method and can evaluate collateral circulation in both morphology and function, and can be the preferred method for the disease. (authors)

  11. Vascular Extraction Using MRA Statistics and Gradient Information

    Directory of Open Access Journals (Sweden)

    Shifeng Zhao

    2018-01-01

    Full Text Available Brain vessel segmentation is a fundamental component of cerebral disease screening systems. However, detecting vessels is still a challenging task owing to their complex appearance and thinning geometry as well as the contrast decrease from the root of the vessel to its thin branches. We present a method for segmentation of the vasculature in Magnetic Resonance Angiography (MRA images. First, we apply volume projection, 2D segmentation, and back-projection procedures for first stage of background subtraction and vessel reservation. Those labeled as background or vessel voxels are excluded from consideration in later computation. Second, stochastic expectation maximization algorithm (SEM is used to estimate the probability density function (PDF of the remaining voxels, which are assumed to be mixture of one Rayleigh and two Gaussian distributions. These voxels can then be classified into background, middle region, or vascular structure. Third, we adapt the K-means method which is based on the gradient of remaining voxels to effectively detect true positives around boundaries of vessels. Experimental results on clinical cerebral data demonstrate that using gradient information as a further step improves the mixture model based segmentation of cerebral vasculature, in particular segmentation of the low contrast vasculature.

  12. Accelerating Time-Resolved MRA With Multiecho Acquisition

    Science.gov (United States)

    Jeong, Hyun J.; Eddleman, Christopher S.; Shah, Saurabh; Seiberlich, Nicole; Griswold, Mark A.; Batjer, H. Hunt; Carr, James C.; Carroll, Timothy J.

    2010-01-01

    A new four-dimensional magnetic resonance angiograpy (MRA) technique called contrast-enhanced angiography with multiecho and radial k-space is introduced, which accelerates the acquisition using multiecho while maintaining a high spatial resolution and increasing the signal-to-noise ratio. An acceleration factor of approximately 2 is achieved without parallel imaging or undersampling by multiecho (i.e., echo-planar imaging) acquisition. SNR is gained from (1) longer pulse repetition times, which allow more time for T1 regrowth; (2) decreased specific absorption rate, which allows use of flip angles that maximize contrast at high field; and (3) minimized effects of a transient contrast bolus signal with a shorter temporal footprint. Simulations, phantom studies, and in vivo scans were performed. Contrast-enhanced angiography with multiecho and radial k-space can be combined with parallel imaging techniques such as Generalized Autocalibrating Partially Parallel Acquisitions to provide additional 2-fold acceleration in addition to higher SNR to trade off for parallel imaging. This technique can be useful in diagnosing vascular lesions where accurate dynamic information is necessary. PMID:20512855

  13. Accelerating time-resolved MRA with multiecho acquisition.

    Science.gov (United States)

    Jeong, Hyun J; Eddleman, Christopher S; Shah, Saurabh; Seiberlich, Nicole; Griswold, Mark A; Batjer, H Hunt; Carr, James C; Carroll, Timothy J

    2010-06-01

    A new four-dimensional magnetic resonance angiography (MRA) technique called contrast-enhanced angiography with multiecho and radial k-space is introduced, which accelerates the acquisition using multiecho while maintaining a high spatial resolution and increasing the signal-to-noise ratio (SNR). An acceleration factor of approximately 2 is achieved without parallel imaging or undersampling by multiecho (i.e., echo-planar imaging) acquisition. SNR is gained from (1) longer pulse repetition times, which allow more time for T(1) regrowth; (2) decreased specific absorption rate, which allows use of flip angles that maximize contrast at high field; and (3) minimized effects of a transient contrast bolus signal with a shorter temporal footprint. Simulations, phantom studies, and in vivo scans were performed. Contrast-enhanced angiography with multiecho and radial k-space can be combined with parallel imaging techniques such as Generalized Autocalibrating Partially Parallel Acquisitions (GRAPPA) to provide additional 2-fold acceleration in addition to higher SNR to trade off for parallel imaging. This technique can be useful in diagnosing vascular lesions where accurate dynamic information is necessary. (c) 2010 Wiley-Liss, Inc.

  14. Magnetic resonance angiography (MRA) in renally impaired patients: When and how

    Energy Technology Data Exchange (ETDEWEB)

    Bongartz, Georg [Department of Radiology, University Hospital Basel, Petersgraben 4, 4031 Basel (Switzerland)], E-mail: gbongartz@uhbs.ch; Mayr, Michael [Clinic for Transplantation Immunology and Nephrology, University Hospital Basel, Petersgraben 4, 4031 Basel (Switzerland); Bilecen, Deniz [Department of Radiology, University Hospital Basel, Petersgraben 4, 4031 Basel (Switzerland)

    2008-05-15

    Magnetic resonance angiography (MRA) and NSF in renally impaired patients have a close relationship due to the frequent coincidence of vascular and renal pathologies, the relatively large amount of contrast media applied and the delayed excretion. The date of the first NSF cases described in literature falls into the development of multi-stationary MRA-an investigation that requested multiple bolus injections or one large bolus of the contrast agent. It is therefore easily understood that NSF was regarded initially as possible complication of MRA. A review on the history of MRA is presented and various techniques for MRA are described. While many neuroradiological indications can be solved by native MRA, most angiographic indications throughout the body rely on the application of intravenous contrast agents. The paper discusses options for alternative methods in vascular imaging and offers guidelines for patients with renal impairment. NSF must always be balanced versus the outcome of an investigation, respectively versus the outcome of a denied MRA. Moreover, in patients with chronic kidney disease (CKD) and a proper justification for a vascular investigation, neither CT angiography nor DSA should replace MRA. Restrictions in contrast media dose for CKD patients are mandatory and obviously reduce the risk of NSF. Gadolinium-based contrast agents with lower stability are now contraindicated in patients with reduced renal function. The role of blood pool agents is under evaluation. Since the awareness of the new disease grew over the last year, radiologists were able to reduce the number of newly diagnosed NSF cases by more careful consideration of contrast application and agent in renally impaired patients, which gives hope that NSF can be avoided by respecting some easy rules.

  15. MraZ from Escherichia coli: cloning, purification, crystallization and preliminary X-ray analysis

    International Nuclear Information System (INIS)

    Adams, Melanie A.; Udell, Christian M.; Pal, Gour Pada; Jia, Zongchao

    2005-01-01

    The crystallization and preliminary X-ray diffraction analysis of MraZ, formerly known as hypothetical protein YabB, from Escherichia coli K-12 is presented. The MraZ family of proteins, also referred to as the UPF0040 family, are highly conserved in bacteria and are thought to play a role in cell-wall biosynthesis and cell division. The murein region A (mra) gene cluster encodes MraZ proteins along with a number of other proteins involved in this complex process. To date, there has been no clear functional assignment provided for MraZ proteins and the structure of a homologue from Mycoplasma pneumoniae, MPN314, failed to suggest a molecular function. The b0081 gene from Escherichia coli that encodes the MraZ protein was cloned and the protein was overexpressed, purified and crystallized. This data is presented along with evidence that the E. coli homologue exists in a different oligomeric state to the MPN314 protein

  16. Validation of a standardized mapping system of the hip joint for radial MRA sequencing

    Energy Technology Data Exchange (ETDEWEB)

    Klenke, Frank M.; Hoffmann, Daniel B.; Cross, Brian J.; Siebenrock, Klaus A. [Bern University Hospital, Department of Orthopedic Surgery, Inselspital, Bern (Switzerland)

    2014-10-14

    Intraarticular gadolinium-enhanced magnetic resonance arthrography (MRA) is commonly applied to characterize morphological disorders of the hip. However, the reproducibility of retrieving anatomic landmarks on MRA scans and their correlation with intraarticular pathologies is unknown. A precise mapping system for the exact localization of hip pathomorphologies with radial MRA sequences is lacking. Therefore, the purpose of the study was the establishment and validation of a reproducible mapping system for radial sequences of hip MRA. Sixty-nine consecutive intraarticular gadolinium-enhanced hip MRAs were evaluated. Radial sequencing consisted of 14 cuts orientated along the axis of the femoral neck. Three orthopedic surgeons read the radial sequences independently. Each MRI was read twice with a minimum interval of 7 days from the first reading. The intra- and inter-observer reliability of the mapping procedure was determined. A clockwise system for hip MRA was established. The teardrop figure served to determine the 6 o'clock position of the acetabulum; the center of the greater trochanter served to determine the 12 o'clock position of the femoral head-neck junction. The intra- and inter-observer ICCs to retrieve the correct 6/12 o'clock positions were 0.906-0.996 and 0.978-0.988, respectively. The established mapping system for radial sequences of hip joint MRA is reproducible and easy to perform. (orig.)

  17. Collateral vessels in moyamoya disease : comparison of MR and MRA with conventional angiography

    International Nuclear Information System (INIS)

    Shim, Joo Eun; Yoon, Dae Young; Yi, Jeong Geun; Kim, Ho Chul; Choi, Chul Sun; Bae, Sang Hoon

    1998-01-01

    To determine the value of magnetic resonance imaging (MR) and magnetic resonance angiography (MRA) in assessing collateral vessels of moyamoya disease. Twenty-four patients with moyamoya disease who underwent MR, 3D TOF MRA, and conventional angiography participated in this study. Two radiologists working independently and with no knowledge of the angiographic findings, interpreted the MR and MRA images. To determine the presence of parenchymal and leptomeningeal collaterals (48 hemispheres) and transdural collaterals (38 hemispheres in 19 patients were depicted by angiography of the external carotid), the findings were compared with those of angiography. Parenchymal, leptomeningeal, and transdural collaterals were depicted by conventional angiography in 34 (71%), 32 (67%), and 11 (29%) hemispheres respectively. The sensitivity and specificity of MR/MRA for collateral vessels were 79.1/88.1 % for parenchymal collaterals, 72.1/88.1 % for leptomeningeal collaterals, and 0.1/18.1 % for transdural collaterals, respectively. Respective sensitivity and specificity of MR/MRA were 88.94/94.1% for leptomeningeal collaterals, and 18.93/55.1 % for transdural collaterals, when the prominent posterior cerebral and external carotid artery were regarded as secondary signs of leptomeningeal and transdural collateral vessels. In moyamoya disease, MR and MRA are useful imaging modalities for the assessment of collateral vessels. The prominent posterior cerebral artery and external carotid artery can be useful secondary signs of leptomeningeal and transdural collateral vessels. (author). 18 refs., 2 figs

  18. Preoperative imaging in 78 living kidney donors using CE-MRA and DSA

    International Nuclear Information System (INIS)

    Lemke, U.; Taupitz, M.; Hamm, B.; Kroencke, T.J.; Kluener, C.; Giessing, M.; Schoenberger, B.

    2008-01-01

    Purpose: to evaluate contrast-enhanced 3D magnetic resonance angiography (CE-MRA) and digital subtraction angiography (DSA) in comparison with the intraoperative findings in living kidney donors. Materials and methods: a total of 156 kidneys in 78 potential kidney donors were prospectively examined using CE-MRA (0.2 mmol Gd/kg, voxel size 1.3 x 0.8 x 2.0) and DSA. Two experienced radiologists assessed the images in consensus regarding the renal vascular anatomy and variants. The results for the 67 candidates accepted for donation were compared to the intraoperative findings. In the other kidneys not accepted for donor nephrectomy, MRA and DSA were compared with each other. Results: nineteen arterial variants were identified intraoperatively, of which 11 (58%) were also detected by preoperative CE-MRA and 10 (53%) by preoperative DSA. Of the 10 venous variants found intraoperatively, CE-MRA detected 8 (80%) and DSA 3 (30%). The agreement (kappa test) between MRI and DSA for all 156 evaluated kidneys was 0.7 for arterial variants (McNemar p = 0.12) and 0.3 for venous variants (McNemar p = 0.01). The preoperative choice of kidney (right or left) made on the basis of the renal vascular anatomy seen on CE-MRA and DSA differed in 22% of the 78 potential donors (McNemar P = 0.3). (orig.)

  19. Improved visualization of intracranial vessels by gradient moment nulling in hybrid of opposite-contrast magnetic resonance angiography (HOP MRA)

    International Nuclear Information System (INIS)

    Azuma, Toshiya; Kodama, Takao; Yano, Takanori; Suzuki, Masayuki; Kimura, Tokunori; Tamaribuchi, Youko

    2010-01-01

    Hybrid of opposite-contrast (HOP) magnetic resonance angiography (MRA) is a new method that combines the advantages of 3-dimensional (3D) time-of-flight (TOF) MRA and black-blood (BB) MRA without prolonging acquisition time. In phantom and clinical studies, we focused on image differences when we applied gradient moment nulling (GMN) to 2 or 3 axes in the first echo. We made an original phantom with a semicircular tube of 3- and 5-mm internal diameter, with flow rate in the tube of 0, 20, 60, 80, or 120 cm/s. In original images of the phantom obtained with TOF MRA and flow-sensitive BB MRA and in filter frequency-weighted subtraction (FWS) processed images acquired with HOP MRA, we measured the contrast-to-noise ratio (CNR) of both the inside and outside of the tubes. In FWS processed images with GMN applied to 2 axes, the CNR was high at various flow rates in both straight and bending portions of the tubes in comparison with TOF images. In a clinical study in 15 patients, we evaluated vessel visualization in images obtained using conventional TOF MRA with magnetization transfer contrast (MTC) and HOP MRA. In clinical studies, visualization scores of HOP MRA were equivalent to those of conventional TOF MRA in the bilateral internal carotid arteries (ICA) and inferior in the basilar arteries. However, visualization of the peripheral portion of the middle cerebral artery (MCA) improved significantly in HOP MRA with GMN applied to 2 and 3 axes. Visualization of the main trunk of the ICA and MCA was superior in HOP MRA with GMN applied to 2 axes. HOP MRA with 2-axis GMN may be useful for excellent visualization of both major arteries and peripheral vessels in the head. (author)

  20. Diagnosis of rotator cuff tears using 3-Tesla MRI versus 3-Tesla MRA: a systematic review and meta-analysis

    Energy Technology Data Exchange (ETDEWEB)

    McGarvey, Ciaran; Harb, Ziad; Smith, Christian; Ajuied, Adil [Guy' s and St Thomas' Hospital, King' s Health Partners, Department of Trauma and Orthopaedics, London (United Kingdom); Houghton, Russell [Guy' s and St Thomas' Hospital, King' s Health Partners, Department of Radiology, London (United Kingdom); Corbett, Steven [Guy' s and St Thomas' Hospital, King' s Health Partners, Department of Trauma and Orthopaedics, London (United Kingdom); Fortius Clinic, London (United Kingdom)

    2016-02-15

    To compare the diagnostic accuracy of magnetic resonance imaging (MRI), 2-dimensional magnetic resonance arthrogram (MRA) and 3-dimensional isotropic MRA in the diagnosis of rotator cuff tears when performed exclusively at 3-T. A systematic review was undertaken of the Cochrane, MEDLINE and PubMed databases in accordance with the PRISMA guidelines. Studies comparing 3-T MRI or 3-T MRA (index tests) to arthroscopic surgical findings (reference test) were included. Methodological appraisal was performed using QUADAS 2. Pooled sensitivity and specificity were calculated and summary receiver-operating curves generated. Kappa coefficients quantified inter-observer reliability. Fourteen studies comprising 1332 patients were identified for inclusion. Twelve studies were retrospective and there were concerns regarding index test bias and applicability in nine and six studies respectively. Reference test bias was a concern in all studies. Both 3-T MRI and 3-T MRA showed similar excellent diagnostic accuracy for full-thickness supraspinatus tears. Concerning partial-thickness supraspinatus tears, 3-T 2D MRA was significantly more sensitive (86.6 vs. 80.5 %, p = 0.014) but significantly less specific (95.2 vs. 100 %, p < 0.001). There was a trend towards greater accuracy in the diagnosis of subscapularis tears with 3-T MRA. Three-Tesla 3D isotropic MRA showed similar accuracy to 3-T conventional 2D MRA. Three-Tesla MRI appeared equivalent to 3-T MRA in the diagnosis of full- and partial-thickness tears, although there was a trend towards greater accuracy in the diagnosis of subscapularis tears with 3-T MRA. Three-Tesla 3D isotropic MRA appears equivalent to 3-T 2D MRA for all types of tears. (orig.)

  1. Diagnosis of rotator cuff tears using 3-Tesla MRI versus 3-Tesla MRA: a systematic review and meta-analysis

    International Nuclear Information System (INIS)

    McGarvey, Ciaran; Harb, Ziad; Smith, Christian; Ajuied, Adil; Houghton, Russell; Corbett, Steven

    2016-01-01

    To compare the diagnostic accuracy of magnetic resonance imaging (MRI), 2-dimensional magnetic resonance arthrogram (MRA) and 3-dimensional isotropic MRA in the diagnosis of rotator cuff tears when performed exclusively at 3-T. A systematic review was undertaken of the Cochrane, MEDLINE and PubMed databases in accordance with the PRISMA guidelines. Studies comparing 3-T MRI or 3-T MRA (index tests) to arthroscopic surgical findings (reference test) were included. Methodological appraisal was performed using QUADAS 2. Pooled sensitivity and specificity were calculated and summary receiver-operating curves generated. Kappa coefficients quantified inter-observer reliability. Fourteen studies comprising 1332 patients were identified for inclusion. Twelve studies were retrospective and there were concerns regarding index test bias and applicability in nine and six studies respectively. Reference test bias was a concern in all studies. Both 3-T MRI and 3-T MRA showed similar excellent diagnostic accuracy for full-thickness supraspinatus tears. Concerning partial-thickness supraspinatus tears, 3-T 2D MRA was significantly more sensitive (86.6 vs. 80.5 %, p = 0.014) but significantly less specific (95.2 vs. 100 %, p < 0.001). There was a trend towards greater accuracy in the diagnosis of subscapularis tears with 3-T MRA. Three-Tesla 3D isotropic MRA showed similar accuracy to 3-T conventional 2D MRA. Three-Tesla MRI appeared equivalent to 3-T MRA in the diagnosis of full- and partial-thickness tears, although there was a trend towards greater accuracy in the diagnosis of subscapularis tears with 3-T MRA. Three-Tesla 3D isotropic MRA appears equivalent to 3-T 2D MRA for all types of tears. (orig.)

  2. Pronkssõduri teisaldamise ainsaks eelduseks on referendum / Kalev Rebane, Roman Zharov, Aleksandr Korobov...[jt.] ; interv. Peeter Ernits, Jüri Aarma, Annika Poldre

    Index Scriptorium Estoniae

    2006-01-01

    Oma seisukohtadest Tallinnas Tõnismäel asuva Teise maailmasõja mälestusmärgi suhtes räägivad isamaaliitlane Kalev Rebane ja vene noorteühenduse Notshnoi Dozor juhid Roman Zharov, Aleksandr Korobov, Oleg Filippov ja Igor Rogo

  3. Geometric modeling of hepatic arteries in 3D ultrasound with unsupervised MRA fusion during liver interventions.

    Science.gov (United States)

    Gérard, Maxime; Michaud, François; Bigot, Alexandre; Tang, An; Soulez, Gilles; Kadoury, Samuel

    2017-06-01

    Modulating the chemotherapy injection rate with regard to blood flow velocities in the tumor-feeding arteries during intra-arterial therapies may help improve liver tumor targeting while decreasing systemic exposure. These velocities can be obtained noninvasively using Doppler ultrasound (US). However, small vessels situated in the liver are difficult to identify and follow in US. We propose a multimodal fusion approach that non-rigidly registers a 3D geometric mesh model of the hepatic arteries obtained from preoperative MR angiography (MRA) acquisitions with intra-operative 3D US imaging. The proposed fusion tool integrates 3 imaging modalities: an arterial MRA, a portal phase MRA and an intra-operative 3D US. Preoperatively, the arterial phase MRA is used to generate a 3D model of the hepatic arteries, which is then non-rigidly co-registered with the portal phase MRA. Once the intra-operative 3D US is acquired, we register it with the portal MRA using a vessel-based rigid initialization followed by a non-rigid registration using an image-based metric based on linear correlation of linear combination. Using the combined non-rigid transformation matrices, the 3D mesh model is fused with the 3D US. 3D US and multi-phase MRA images acquired from 10 porcine models were used to test the performance of the proposed fusion tool. Unimodal registration of the MRA phases yielded a target registration error (TRE) of [Formula: see text] mm. Initial rigid alignment of the portal MRA and 3D US yielded a mean TRE of [Formula: see text] mm, which was significantly reduced to [Formula: see text] mm ([Formula: see text]) after affine image-based registration. The following deformable registration step allowed for further decrease of the mean TRE to [Formula: see text] mm. The proposed tool could facilitate visualization and localization of these vessels when using 3D US intra-operatively for either intravascular or percutaneous interventions to avoid vessel perforation.

  4. 3D morphometry using automated aortic segmentation in native MR angiography: an alternative to contrast enhanced MRA?

    Science.gov (United States)

    Müller-Eschner, Matthias; Müller, Tobias; Biesdorf, Andreas; Wörz, Stefan; Rengier, Fabian; Böckler, Dittmar; Kauczor, Hans-Ulrich; Rohr, Karl; von Tengg-Kobligk, Hendrik

    2014-04-01

    Native-MR angiography (N-MRA) is considered an imaging alternative to contrast enhanced MR angiography (CE-MRA) for patients with renal insufficiency. Lower intraluminal contrast in N-MRA often leads to failure of the segmentation process in commercial algorithms. This study introduces an in-house 3D model-based segmentation approach used to compare both sequences by automatic 3D lumen segmentation, allowing for evaluation of differences of aortic lumen diameters as well as differences in length comparing both acquisition techniques at every possible location. Sixteen healthy volunteers underwent 1.5-T-MR Angiography (MRA). For each volunteer, two different MR sequences were performed, CE-MRA: gradient echo Turbo FLASH sequence and N-MRA: respiratory-and-cardiac-gated, T2-weighted 3D SSFP. Datasets were segmented using a 3D model-based ellipse-fitting approach with a single seed point placed manually above the celiac trunk. The segmented volumes were manually cropped from left subclavian artery to celiac trunk to avoid error due to side branches. Diameters, volumes and centerline length were computed for intraindividual comparison. For statistical analysis the Wilcoxon-Signed-Ranked-Test was used. Average centerline length obtained based on N-MRA was 239.0±23.4 mm compared to 238.6±23.5 mm for CE-MRA without significant difference (P=0.877). Average maximum diameter obtained based on N-MRA was 25.7±3.3 mm compared to 24.1±3.2 mm for CE-MRA (P<0.001). In agreement with the difference in diameters, volumes obtained based on N-MRA (100.1±35.4 cm(3)) were consistently and significantly larger compared to CE-MRA (89.2±30.0 cm(3)) (P<0.001). 3D morphometry shows highly similar centerline lengths for N-MRA and CE-MRA, but systematically higher diameters and volumes for N-MRA.

  5. Diagnosis of rotator cuff tears using 3-Tesla MRI versus 3-Tesla MRA: a systematic review and meta-analysis.

    Science.gov (United States)

    McGarvey, Ciaran; Harb, Ziad; Smith, Christian; Houghton, Russell; Corbett, Steven; Ajuied, Adil

    2016-02-01

    To compare the diagnostic accuracy of magnetic resonance imaging (MRI), 2-dimensional magnetic resonance arthrogram (MRA) and 3-dimensional isotropic MRA in the diagnosis of rotator cuff tears when performed exclusively at 3-T. A systematic review was undertaken of the Cochrane, MEDLINE and PubMed databases in accordance with the PRISMA guidelines. Studies comparing 3-T MRI or 3-T MRA (index tests) to arthroscopic surgical findings (reference test) were included. Methodological appraisal was performed using QUADAS 2. Pooled sensitivity and specificity were calculated and summary receiver-operating curves generated. Kappa coefficients quantified inter-observer reliability. Fourteen studies comprising 1332 patients were identified for inclusion. Twelve studies were retrospective and there were concerns regarding index test bias and applicability in nine and six studies respectively. Reference test bias was a concern in all studies. Both 3-T MRI and 3-T MRA showed similar excellent diagnostic accuracy for full-thickness supraspinatus tears. Concerning partial-thickness supraspinatus tears, 3-T 2D MRA was significantly more sensitive (86.6 vs. 80.5 %, p = 0.014) but significantly less specific (95.2 vs. 100 %, p Tesla 3D isotropic MRA showed similar accuracy to 3-T conventional 2D MRA. Three-Tesla MRI appeared equivalent to 3-T MRA in the diagnosis of full- and partial-thickness tears, although there was a trend towards greater accuracy in the diagnosis of subscapularis tears with 3-T MRA. Three-Tesla 3D isotropic MRA appears equivalent to 3-T 2D MRA for all types of tears.

  6. New Insight into the Catalytic Mechanism of Bacterial MraY from Enzyme Kinetics and Docking Studies*

    Science.gov (United States)

    Liu, Yao; Rodrigues, João P. G. L. M.; Bonvin, Alexandre M. J. J.; Zaal, Esther A.; Berkers, Celia R.; Heger, Michal; Gawarecka, Katarzyna; Swiezewska, Ewa; Breukink, Eefjan; Egmond, Maarten R.

    2016-01-01

    Phospho-MurNAc-pentapeptide translocase (MraY) catalyzes the synthesis of Lipid I, a bacterial peptidoglycan precursor. As such, MraY is essential for bacterial survival and therefore is an ideal target for developing novel antibiotics. However, the understanding of its catalytic mechanism, despite the recently determined crystal structure, remains limited. In the present study, the kinetic properties of Bacillus subtilis MraY (BsMraY) were investigated by fluorescence enhancement using dansylated UDP-MurNAc-pentapeptide and heptaprenyl phosphate (C35-P, short-chain homolog of undecaprenyl phosphate, the endogenous substrate of MraY) as second substrate. Varying the concentrations of both of these substrates and fitting the kinetics data to two-substrate models showed that the concomitant binding of both UDP-MurNAc-pentapeptide-DNS and C35-P to the enzyme is required before the release of the two products, Lipid I and UMP. We built a model of BsMraY and performed docking studies with the substrate C35-P to further deepen our understanding of how MraY accommodates this lipid substrate. Based on these modeling studies, a novel catalytic role was put forward for a fully conserved histidine residue in MraY (His-289 in BsMraY), which has been experimentally confirmed to be essential for MraY activity. Using the current model of BsMraY, we propose that a small conformational change is necessary to relocate the His-289 residue, such that the translocase reaction can proceed via a nucleophilic attack of the phosphate moiety of C35-P on bound UDP-MurNAc-pentapeptide. PMID:27226570

  7. Usefulness of time-resolved projection MRA on evaluation of hemodynamics in cerebral occlusive diseases

    International Nuclear Information System (INIS)

    Oka, Yoshihisa; Kusunoki, Katsusuke; Nochide, Ichiro; Igase, Keiji; Harada, Hironobu; Sadamoto, Kazuhiko; Nagasawa, Kiyoshi

    2001-01-01

    The usefulness for evaluation of cerebral hemodynamics using time-resolved projection MRA was studied in normal volunteers and patients of cerebrovascular diseases. Six normal volunteers and ten patients with cerebrovascular occlusive diseases including 6 of IC occlusion and 4 of post EC/IC bypass surgery underwent time-resolved projection MRA on a 1.5 T clinical MRI system. Projection angiograms are acquired with 2D-fast SPGR sequence with a time resolution of approximately one image per second, 40 images being acquired consecutively before and after bolus injection Gd-DTPA. And all images were calculated by complex subtraction from the background mask in a work station. In normal volunteers, the quality of images of time-resolved projection MRA was satisfactory. The arteries from internal carotid artery through M2 segment of middle cerebral artery and all major venous systems were well portrayed. In 4 cases of IC occlusion who were assessed the collateral flow through the anterior communicating artery and posterior communicating artery, there were delayed to demonstrate the ipsilateral MCA. However, in 2 cases of IC occlusion that were assessed the collateral flow through leptomeningeal anastomosis, ipsilateral MCA and collateral circulation were not demonstrated. In all patients of post EC/IC bypass surgery, the patency of EC/IC bypass could be evaluated as properly with time-resolved projection MRA as 3D-TOF MRA. Although the temporal and spatial resolutions are insufficient, time-resolved projection MRA was power-full non-invasive method to evaluate the cerebral hemodynamics vis the basal communicating arteries in IC occlusion and identify the patency of EC/IC bypass. (author)

  8. Detection and characterization of unruptured intracranial aneurysms: Comparison of 3T MRA and DSA.

    Science.gov (United States)

    Mine, Benjamin; Pezzullo, Martina; Roque, Gonçalo; David, Philippe; Metens, Thierry; Lubicz, Boris

    2015-06-01

    To compare magnetic resonance angiography (MRA) at 3 Tesla (3T) and digital subtraction angiography (DSA) for the detection and characterization of unruptured intracranial aneurysms (UIA). This study has been approved by our local ethical committee. From February to August 2010, 40 consecutive patients with UIA contemporarily underwent MRA at 3T including time-of-flight (TOF-MRA) and contrast enhanced (CE-MRA) techniques and DSA. MR images were independently reviewed by 3 radiologists and DSA images were reviewed by 2 radiologists together. Interobserver and intertechnique agreements were assessed for aneurysm detection and characterization including maximal diameter, neck width and the presence of a bleb or a branch arising from the sac. DS angiography revealed 56 aneurysms. Mean sensitivity and positive predictive value of MRA were 91.4% and 93.4% respectively. For UIA < 3 mm and those ≥ 3 mm, MRA had a mean sensitivity of 74.1% and 100% respectively. Intertechnique and interobserver agreements were substantial for the measurement of UIA maximal diameter (mean κ, 0.607 and 0.601 respectively) and were moderate and fair for neck width measurement respectively (mean κ, 0.456 and 0.285 respectively). For bleb detection, intertechnique and interobserver agreements were fair and slight respectively (mean κ, 0.312 and 0.116 respectively) whereas both were slight for detection of branches arising from the sac (mean κ, 0.151 and 0.070 respectively). MR angiography at 3T has a high sensitivity for the detection of UIA. However, it remains significantly inferior to DSA for morphological characterization of UIA. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  9. Hybrid of opposite-contrast MRA of the brain by combining time-of-flight and black-blood sequences: initial experience in major trunk stenoocclusive diseases.

    Science.gov (United States)

    Tsuchiya, Kazuhiro; Kobayashi, Kuninori; Nitatori, Toshiaki; Kimura, Tokunori; Ikedo, Masato; Takemoto, Shuhei

    2010-01-01

    To assess the feasibility of a new MR angiography (MRA) technique named hybrid of opposite-contrast MRA (HOP MRA) that combined the time-of-flight (TOF) MRA with a flow-sensitive black-blood (FSBB) sequence in the diagnosis of major trunk stenoocclusive diseases. On a 1.5 Tesla imager using a dual-echo three-dimensional (3D)-gradient-echo sequence, we obtained the first echo for TOF MRA followed by the second echo for FSBB. We then subtracted the FSBB data set from that of TOF MRA followed by maximum intensity projection. In four normal volunteers and 19 patients with chronic stenoocclusive disease of the major trunk, we performed HOP MRA along with 3D-TOF MRA and compared the findings. In the volunteer group, the HOP MRA technique improved the demonstration of distal arterial branches. In 12 of the 19 patients, the HOP MRA better visualized branches distal to the lesion as well as distal branches of normal trunks than 3D-TOF MRA, while both techniques provided equivalent depiction of branches distal to the lesion but better depiction of normal distal branches in three patients. The HOP-MRA technique is promising in major trunk stenoocclusive diseases as it better demonstrates distal branches probably representing collaterals than 3D-TOF MRA. (c) 2009 Wiley-Liss, Inc.

  10. Natural Products at Work: Structural Insights into Inhibition of the Bacterial Membrane Protein MraY.

    Science.gov (United States)

    Koppermann, Stefan; Ducho, Christian

    2016-09-19

    Natural(ly) fit: The X-ray crystal structure of the bacterial membrane protein MraY in complex with its natural product inhibitor muraymycin D2 is discussed. MraY catalyzes one of the membrane-associated steps in peptidoglycan biosynthesis and, therefore, represents a promising target for novel antibiotics. Structural insights derived from the protein-inhibitor complex might now pave the way for the development of new antimicrobial drugs. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Usefulness of 2D PC MRA of the circle of willis in the evaluation of acute cerebral infarction

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Oh Han; Lee, Jae Hee; Kim, Ki Ju; Lee, Sung Yong [Our Lady of Mercy Hospital, Seoul (Korea, Republic of); Choi, Kyu Ho [The Catholic Univ. of Korea, Seoul (Korea, Republic of)

    1999-11-01

    To evaluate the usefulness of axial 2-D PC MRA of the circle of Willis in the evaluation of acute cerebral infarction We evaluated 42 patients with acute cerebral infarction who had undergone T2-weighted and diffusion weighted MR imaging (T2WI, DWI) and 2-D PC MRA of the circle of Willis within 72 hours of the onset of symptoms. In conjunction with high-signal lesions on DWI, the findings of 2-D PC MRA were classified as normal, stenotic, or indicative of arterial occlusion;negative 2-D PC MRA was not considered useful. In addition, the signal intensity of T2WI and DWI was compared. (The findings of 2-D PC MRA showed that 15 cases(35.7%) were normal, 13(31%) were stenotic, and that in 14 (33.3%), occlusion was present). Thus, 2-D PC MRA detected vascular abnormality in 27 cases(64.3%). On T2WI, six cases (14.3%) showed no signal change and 36(85.7%) showed high signal change. In six cases without signal change, MR images were obtained within 12 hours of ictus;in one of these patients MRA findings were normal, one had stenosis, and in four, occlusion was noted. 2-D PC MRA is a useful modality for the detection of vascular abnormality in patients with acute cerebral infarct.

  12. A Prospective Comparison of Duplex Ultrasonography, Captopril Renography, MRA, and CTA in Assessing Renal Artery Stenosis

    Energy Technology Data Exchange (ETDEWEB)

    Ekloef, H.; Ahlstroem, H.; Magnusson, A.; Andersson, L.G.; Andren, B.; Haegg, A.; Bergqvist, D.; Nyman, R. [Uppsala Univ. Hospital (Sweden). Depts. of Radiology, Clinical Physiology, Medicine, and Surgery

    2006-10-15

    Purpose: To prospectively compare the diagnostic accuracy of duplex ultrasonography, captopril renography, computed tomography angiography (CTA), and 3D Gd magnetic resonance angiography (MRA) in diagnosing hemodynamically significant renal artery stenosis (RAS). Material and Methods: The standard of reference was measurement of transstenotic pressure gradient. Fifty-eight hypertensive patients with suspicion of RAS were evaluated, when possible, by all five techniques. Sensitivity and specificity to detect RAS were compared for each technique on both a patient and kidney basis. Discrepancies were evaluated separately and classified as borderline, method dependent, or operator dependent. Results: The prevalence of RAS was 77%. The sensitivity/specificity of ultrasonography, captopril renography, CTA, and MRA in detecting kidneys with RAS was 73/71%, 52/63%, 94/62%, and 93/91%, respectively. Ultrasonography had a significantly lower sensitivity than CTA and MRA (P <0.001) but higher than captopril renography (P = 0.013). Borderline RAS was the main cause for discrepancies. Conclusion: MRA and CTA were significantly better than duplex ultrasonography and captopril renography in detecting hemodynamically significant RAS. The ultrasonography criteria for RAS based on the evaluation of renal peak systolic velocity and renal/aortic ratio are questionable. Captopril renography cannot be recommended for assessing RAS.

  13. The Impact of MRA in the IT sector on the Korean Economy

    Directory of Open Access Journals (Sweden)

    Wankeun Oh

    2005-12-01

    Full Text Available In this paper, using partial equilibrium models and input-output analyses, we estimate the effects of MRA in the IT sector on the net exports of Korea as well as on the Korean macro economy in the aspects of production, value-added and employment. It is noted that there are significant increases in both net exports and national income, which is mainly made possible by decreases in certification costs and testing costs and hence by final product prices. We show that the MRA with U.S. and/or China has much larger effects on the Korean economy than the MRA with Japan. Among various IT sub-sectors of Korea, the mobile handset industry sector is found out to be the largest beneficiary of MRA. These results make sense in two reasons: U.S. and China are the largest two trade partners of Korea in the IT sector; the mobile handset sector is the largest contributor of exports in Korea.

  14. MRI/MRA evaluation of sickle cell disease of the brain

    Energy Technology Data Exchange (ETDEWEB)

    Zimmerman, Robert A. [Childrens Hospital, Department of Radiology, Philadelphia, PA (United States)

    2005-03-01

    Sickle cell disease is a major cause of pediatric stroke. Understanding the disease that affects the brain as infarctions, both clinically apparent and silent, requires an understanding of how the blood vessels are affected, the way in which both the brain and the blood vessels are imaged by MRI and MRA and the mechanism of injury. (orig.)

  15. MRI/MRA evaluation of sickle cell disease of the brain

    International Nuclear Information System (INIS)

    Zimmerman, Robert A.

    2005-01-01

    Sickle cell disease is a major cause of pediatric stroke. Understanding the disease that affects the brain as infarctions, both clinically apparent and silent, requires an understanding of how the blood vessels are affected, the way in which both the brain and the blood vessels are imaged by MRI and MRA and the mechanism of injury. (orig.)

  16. Diagnosis of carotid artery stenosis with oculopneumoplethysmography alone and in combination with MRA

    Directory of Open Access Journals (Sweden)

    Wald JT

    2012-11-01

    Full Text Available Richard M Elias,1 John T Wald,2 David F Kallmes21Department of Internal Medicine, 2Department of Radiology, Mayo Clinic, Rochester, MN, USABackground: The purpose of this study was to assess the accuracy of oculopneumoplethysmography (OPG for the diagnosis of carotid artery stenosis both alone and in conjunction with carotid magnetic resonance angiography (MRA.Methods: This retrospective study reviewed patients who had undergone both OPG and digital subtraction angiography (DSA, 90 patients, 174 vessels within two weeks to determine the accuracy of OPG with DSA as the reference standard for the detection of carotid artery stenosis. Three carotid artery stenosis thresholds (≥50%, ≥70%, ≥80% were analyzed. The accuracy of the combination of OPG and MRA was analyzed in a subset of patients who underwent OPG and MRA and DSA (53 patients, 94 vessels.Results: The sensitivity and negative predictive value of OPG increased with higher-degree carotid artery stenoses, and for lesions ≥ 80%, these values were 85.3% and 94.2%, respectively. Specificity and positive predictive values were lower at all thresholds, and were 72.9% and 49.3%, respectively, at the ≥80% stenosis threshold. When OPG and MRA were concordant, the sensitivity and specificity for carotid artery stenoses ≥ 80% were 91.0% and 97.8%, respectively. OPG correctly identified 71.4% of false-positive and 80.0% of false-negative magnetic resonance angiographies for that degree of carotid artery stenosis.Conclusion: OPG appears to be an accurate rule-out test for hemodynamically significant carotid artery stenosis. OPG augments the accuracy of MRA for detection of carotid artery disease.Keywords: oculopneumoplethysmography, carotid artery stenosis, magnetic resonance angiography, diagnosis, stroke

  17. Evaluation of fast highly undersampled contrast-enhanced MR angiography (sparse CE-MRA) in intracranial applications - initial study

    Energy Technology Data Exchange (ETDEWEB)

    Gratz, Marcel; Quick, Harald H. [University of Duisburg-Essen, Erwin L. Hahn Institute for MR Imaging, Essen (Germany); University Hospital Essen, High Field and Hybrid MR Imaging, Essen (Germany); Schlamann, Marc [University Hospital Giessen and Marburg GmbH, Neuroradiology, Giessen (Germany); University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Goericke, Sophia [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Maderwald, Stefan [University of Duisburg-Essen, Erwin L. Hahn Institute for MR Imaging, Essen (Germany)

    2017-03-15

    To assess the image quality of sparsely sampled contrast-enhanced MR angiography (sparse CE-MRA) providing high spatial resolution and whole-head coverage. Twenty-three patients scheduled for contrast-enhanced MR imaging of the head, (N = 19 with intracranial pathologies, N = 9 with vascular diseases), were included. Sparse CE-MRA at 3 Tesla was conducted using a single dose of contrast agent. Two neuroradiologists independently evaluated the data regarding vascular visibility and diagnostic value of overall 24 parameters and vascular segments on a 5-point ordinary scale (5 = very good, 1 = insufficient vascular visibility). Contrast bolus timing and the resulting arterio-venous overlap was also evaluated. Where available (N = 9), sparse CE-MRA was compared to intracranial Time-of-Flight MRA. The overall rating across all patients for sparse CE-MRA was 3.50 ± 1.07. Direct influence of the contrast bolus timing on the resulting image quality was observed. Overall mean vascular visibility and image quality across different features was rated good to intermediate (3.56 ± 0.95). The average performance of intracranial Time-of-Flight was rated 3.84 ± 0.87 across all patients and 3.54 ± 0.62 across all features. Sparse CE-MRA provides high-quality 3D MRA with high spatial resolution and whole-head coverage within short acquisition time. Accurate contrast bolus timing is mandatory. (orig.)

  18. Contrast-enhanced time-resolved 3-D MRA: applications in neurosurgery and interventional neuroradiology

    Energy Technology Data Exchange (ETDEWEB)

    Reinacher, Peter C.; Stracke, Paul; Reinges, Marcus H.T.; Hans, Franz J.; Krings, Timo [University Hospital of the Technical University, Department of Neurosurgery, Aachen (Germany)

    2007-07-15

    The decision-making process in the endovascular treatment of cranial dural AV fistulas and angiomas and their follow-up after treatment is usually based on conventional digital subtraction angiography (DSA). Likewise, acquiring the vascular and hemodynamic information needed for presurgical evaluation of meningiomas may necessitate DSA or different MR-based angiographic methods to assess the arterial displacement, the location of bridging veins and tumor feeders, and the degree of vascularization. New techniques of contrast-enhanced MR angiography (MRA) permit the acquisition of images with high temporal and spatial resolution. The purpose of this study was to evaluate the applicability and clinical use of a newly developed contrast-enhanced 3-D dynamic MRA protocol for neurointerventional and neurosurgical planning and decision making. With a 3-T whole-body scanner (Philips Achieva), a 3-D dynamic contrast-enhanced (MultiHance, Bracco) MRA sequence with parallel imaging, and intelligent k-space readout (keyhole and ''CENTRA'' k-space filling) was added to structural MRI in patients with meningiomas, dural arteriovenous fistulas and pial arteriovenous malformations. The sequence had a temporal resolution of 1.3 s per 3-D volume with a spatial resolution of 0.566 x 0.566 x 1.5 mm per voxel in each 3-D volume and lasted 25.2 s. DSA was performed in selected patients following MRI. In patients with arteriovenous fistulas and malformations, MRA allowed the vascular shunt to be identified and correctly classified. Hemodynamic characteristics and venous architecture were clearly demonstrated. Larger feeding arteries could be identified in all patients. In meningiomas, MRA enabled assessment of the displacement of the cerebral arteries, depiction of the tumor feeding vessels, and evaluation of the anatomy of the venous system. The extent of tumor vascularization could be assessed in all patients and correlated with the histopathological findings that

  19. Contrast-enhanced time-resolved 3-D MRA: applications in neurosurgery and interventional neuroradiology.

    Science.gov (United States)

    Reinacher, Peter C; Stracke, Paul; Reinges, Marcus H T; Hans, Franz J; Krings, Timo

    2007-07-01

    The decision-making process in the endovascular treatment of cranial dural AV fistulas and angiomas and their follow-up after treatment is usually based on conventional digital subtraction angiography (DSA). Likewise, acquiring the vascular and hemodynamic information needed for presurgical evaluation of meningiomas may necessitate DSA or different MR-based angiographic methods to assess the arterial displacement, the location of bridging veins and tumor feeders, and the degree of vascularization. New techniques of contrast-enhanced MR angiography (MRA) permit the acquisition of images with high temporal and spatial resolution. The purpose of this study was to evaluate the applicability and clinical use of a newly developed contrast-enhanced 3-D dynamic MRA protocol for neurointerventional and neurosurgical planning and decision making. With a 3-T whole-body scanner (Philips Achieva), a 3-D dynamic contrast-enhanced (MultiHance, Bracco) MRA sequence with parallel imaging, and intelligent k-space readout (keyhole and "CENTRA" k-space filling) was added to structural MRI in patients with meningiomas, dural arteriovenous fistulas and pial arteriovenous malformations. The sequence had a temporal resolution of 1.3 s per 3-D volume with a spatial resolution of 0.566x0.566x1.5 mm per voxel in each 3-D volume and lasted 25.2 s. DSA was performed in selected patients following MRI. In patients with arteriovenous fistulas and malformations, MRA allowed the vascular shunt to be identified and correctly classified. Hemodynamic characteristics and venous architecture were clearly demonstrated. Larger feeding arteries could be identified in all patients. In meningiomas, MRA enabled assessment of the displacement of the cerebral arteries, depiction of the tumor feeding vessels, and evaluation of the anatomy of the venous system. The extent of tumor vascularization could be assessed in all patients and correlated with the histopathological findings that indicated

  20. Jugular bulb diverticulum combined with high jugular bulb: a case report with CT and MRA findings

    International Nuclear Information System (INIS)

    Ko, Seog Wan

    2004-01-01

    Jugular bulb diverticulum is a rare condition that is characterized by the outpouching of the jugular bulb, and this can lead to hearing loss, tinnitus and vertigo. A few reports have revealed the radiologic findings about jugular bulb diverticulum, but none of them have described the MRA findings concerning this lesion. We present here the CT and MR venography findings in regards to a large high jugular blub and diverticulum we observed in a 47-year-old woman

  1. Jugular bulb diverticulum combined with high jugular bulb: a case report with CT and MRA findings

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Seog Wan [College of Medicine, Chonbuk National Univ., Jeonju (Korea, Republic of)

    2004-12-01

    Jugular bulb diverticulum is a rare condition that is characterized by the outpouching of the jugular bulb, and this can lead to hearing loss, tinnitus and vertigo. A few reports have revealed the radiologic findings about jugular bulb diverticulum, but none of them have described the MRA findings concerning this lesion. We present here the CT and MR venography findings in regards to a large high jugular blub and diverticulum we observed in a 47-year-old woman.

  2. Ruin philosophy, poetic discourse and the collapse of meta-narratives in Aleksandr Kushner's poetry of the 1970s

    Directory of Open Access Journals (Sweden)

    Andreas Schönle

    2017-10-01

    Full Text Available This article offers an analysis of the trope of ruin in the poetry of Aleksandr Kushner (born 1936, in particular through a close reading of two of his poems: “In a slippery graveyard, alone” and “Ruins”. The analysis of these poems is preceded by an overview of ruin philosophy from Burke and Diderot to Simmel and Benjamin, with particular emphasis on the way the trope of ruin contemplation stages a confrontation between the self and what transcends it (death, history, nature, etc.. This philosophical background serves as a heuristic tool to shed light on the poetry of Kushner. Through the trope of ruin, Kushner explores the legitimacy of poetic speech after the collapse of all meta-narratives. Kushner has no truck with Diderot's solipsism, nor with Hegel's bold narrative of progress, nor with Simmel's peaceful reconciliation with the creative forces of nature. Nor, really, does he intend to bear witness to history, the way Benjamin does in the faint anticipation of some miracle. Instead, Kushner posits the endurance of a community united not around a grand project, but around the idea of carrying on in the face of everything, muddling through despite the lack of hopes for a transformational future and making the most of fleeting moments of positivity that emerge out of the fundamental serendipity of history.

  3. Time-resolved imaging of contrast kinetics does not improve performance of follow-up MRA of embolized intracranial aneurysms.

    Science.gov (United States)

    Serafin, Zbigniew; Strześniewski, Piotr; Lasek, Władysław; Beuth, Wojciech

    2012-07-01

    The use of contrast media and the time-resolved imaging of contrast kinetics (TRICKS) technique have some theoretical advantages over time-of-flight magnetic resonance angiography (TOF-MRA) in the follow-up of intracranial aneurysms after endovascular treatment. We prospectively compared the diagnostic performance of TRICKS and TOF-MRA with digital subtracted angiography (DSA) in the assessment of occlusion of embolized aneurysms. Seventy-two consecutive patients with 72 aneurysms were examined 3 months after embolization. Test characteristics of TOF-MRA and TRICKS were calculated for the detection of residual flow. The results of quantification of flow were compared with weighted kappa. Intraobserver and interobserver reproducibility was determined. The sensitivity of TOF-MRA was 85% (95% CI, 65-96%) and of TRICKS, 89% (95% CI, 70-97%). The specificity of both methods was 91% (95% CI, 79-98%). The accuracy of the flow quantification ranged from 0.76 (TOF-MRA) to 0.83 (TRICKS). There was no significant difference between the methods in the area under the ROC curve regarding both the detection and the quantification of flow. Intraobserver reproducibility was very good with both techniques (kappa, 0.86-0.89). The interobserver reproducibility was moderate for TOF-MRA and very good for TRICKS (kappa, 0.74-0.80). In this study, TOF-MRA and TRICKS presented similar diagnostic performance; therefore, the use of time-resolved contrast-enhanced MRA is not justified in the follow-up of embolized aneurysms.

  4. Systolically gated 3D phase contrast MRA of mesenteric arteries in suspected mesenteric ischemia

    Energy Technology Data Exchange (ETDEWEB)

    Wasser, M.N.; Schultze Kool, L.J.; Roos, A. de [Leiden Univ. Hospital (Netherlands)] [and others

    1996-03-01

    Our goal was to assess the value of MRA for detecting stenoses in the celiac (CA) and superior mesenteric (SMA) arteries in patients suspected of having chronic mesenteric ischemia, using an optimized systolically gated 3D phase contrast technique. In an initial study in 24 patients who underwent conventional angiography of the abdominal vessels for different clinical indications, a 3D phase contrast MRA technique (3D-PCA) was evaluated and optimized to image the CAs and SMAs. Subsequently, a prospective study was performed to assess the value of systolically gated 3D-PCA in evaluation of the mesenteric arteries in 10 patients with signs and symptoms of chronic mesenteric ischemia. Intraarterial digital subtraction angiography and surgical findings were used as the reference standard. In the initial study, systolic gating appeared to be essential in imaging the SMA on 3D-PCA. In 10 patients suspected of mesenteric ischemia, systolically gated 3D-PCA identified significant proximal disease in the two mesenteric vessels in 4 patients. These patients underwent successful reconstruction of their stenotic vessels. Cardiac-gated MRA may become a useful tool in selection of patients suspected of having mesenteric ischemia who may benefit from surgery. 16 refs., 6 figs., 4 tabs.

  5. Computer-aided diagnosis improves detection of small intracranial aneurysms on MRA in a clinical setting.

    Science.gov (United States)

    Štepán-Buksakowska, I L; Accurso, J M; Diehn, F E; Huston, J; Kaufmann, T J; Luetmer, P H; Wood, C P; Yang, X; Blezek, D J; Carter, R; Hagen, C; Hořínek, D; Hejčl, A; Roček, M; Erickson, B J

    2014-10-01

    MRA is widely accepted as a noninvasive diagnostic tool for the detection of intracranial aneurysms, but detection is still a challenging task with rather low detection rates. Our aim was to examine the performance of a computer-aided diagnosis algorithm for detecting intracranial aneurysms on MRA in a clinical setting. Aneurysm detectability was evaluated retrospectively in 48 subjects with and without computer-aided diagnosis by 6 readers using a clinical 3D viewing system. Aneurysms ranged from 1.1 to 6.0 mm (mean = 3.12 mm, median = 2.50 mm). We conducted a multireader, multicase, double-crossover design, free-response, observer-performance study on sets of images from different MRA scanners by using DSA as the reference standard. Jackknife alternative free-response operating characteristic curve analysis with the figure of merit was used. For all readers combined, the mean figure of merit improved from 0.655 to 0.759, indicating a change in the figure of merit attributable to computer-aided diagnosis of 0.10 (95% CI, 0.03-0.18), which was statistically significant (F(1,47) = 7.00, P = .011). Five of the 6 radiologists had improved performance with computer-aided diagnosis, primarily due to increased sensitivity. In conditions similar to clinical practice, using computer-aided diagnosis significantly improved radiologists' detection of intracranial DSA-confirmed aneurysms of ≤6 mm. © 2014 by American Journal of Neuroradiology.

  6. [Clinical significance of vertebral artery MRA to vertebral artery type of cervical spondylosis' diagnosis and treatment].

    Science.gov (United States)

    Zhang, Ming-Cai; Shi, Yin-Yu; Chen, Dong-Yu; Huang, Shi-Rong; Chen, Bo; Wang, Xiang; Wang, Hui-Hao; Zhang, Kai-Yong; Guo, Kai; Zhan, Hong-Sheng

    2013-11-01

    To study clinical significance of vertebral artery magnetic resonance angiography (MRA) to vertebral artery type of cervical spondylosis' diagnosis and treatment. There were two groups in the study, which were observation group and control group. There were 53 patients in observation group,including 19 males and 34 females,with a mean age of (52.51 +/- 11.29) years. There were 30 subjects in control group,including 10 males and 20 females,with a mean age of (48.11 +/- 12.21) years. Based on the vertebral artery MRA picture,the course and caliber of vertebral artery were compared between two groups. The abnormal incidence of course and caliber of vertebral artery in observation group was higher than that of control group, which had statistic difference (P=0.000). Furthermore, the patterns of abnormal course and caliber of vertebral artery in observation group were complicated and diverse, but the regional circuity and stegnosis was the most common pattern,about 47.18%(25/53). The cause of circuity and stegnosis was vertebra Gu-Cuofeng,about 43.41% (23/53). The vertebral artery MRA provides a guidance for the diagnosis of abnormal course and caliber of vertebral artery in vertebral artery cervical spondylosis.

  7. Prevalence of renal artery stenosis in flash pulmonary oedema: determination using gadolinium-enhanced MRA.

    LENUS (Irish Health Repository)

    McMahon, Colm J

    2012-02-01

    PURPOSE: The primary purpose was to determine the prevalence of renal artery stenosis (RAS) in patients presenting with acute ("flash") pulmonary oedema (FPE), without identifiable cause using contrast-enhanced magnetic resonance angiography (CE-MRA) of renal arteries. A secondary goal was to correlate clinical parameters at presentation with the presence or absence of RAS. MATERIALS AND METHODS: Patients presenting with acute pulmonary oedema without identifiable cause prospectively underwent CE-MRA. >50% renal artery stenosis was considered significant. Clinical parameters (blood pressure, serum creatinine, history of hypertension\\/hyperlipidaemia) were compared in patients with and without RAS using an unpaired t-test. Results expressed; mean (+\\/-SD). RESULTS: 20 patients (4 male, 16 female, age 78.5+\\/-11 years) underwent CE-MRA. 9 patients (45%) had significant RAS (6 (30%) bilateral, 3 (15%) unilateral). Systolic BP was higher in patients with RAS (192+\\/-38 mm Hg) than those without (134+\\/-30 mm Hg) (p<.005). Diastolic BP was higher in patients with RAS (102+\\/-23 mm Hg) than those without (76+\\/-17 mm Hg) (p<.01). All patients with RAS and 6\\/11(55%) patients without RAS had a history of hypertension. No significant difference in creatinine or hyperlipidaemia history was observed. CONCLUSION: The prevalence of RAS in patients presenting with FPE is 45%. The diagnosis should be considered in patients presenting with unexplained acute pulmonary oedema, particularly if hypertensive at presentation.

  8. MRA of the intracranial circulation in asymptomatic patients with sickle cell disease

    International Nuclear Information System (INIS)

    Gillams, A.R.; McMahon, L.; Weinberg, G.; Carter, A.P.

    1998-01-01

    Background. MR angiography (MRA) provides a mechanism for non-invasively studying blood flow, thus providing a new opportunity to study the intracranial circulation in asymptomatic sickle cell disease (SCD) patients. Although conventional angiography is the gold standard for the depiction of vascular anatomy, this is too invasive for an asymptomatic population. Objective. To establish the range of appearances in asymptomatic SCD patients and to correlate brain MRI results (either sub-clinical abnormalities or normal brain parenchyma) with the MRA findings. Materials and methods. Brain MRI and MRA of the intracranial circulation was performed on 22 patients (13 male and 9 female, median age 7.5 years, range 1.3-20 years). Fourteen were homozygous SS and eight were SC. The median haematocrit at the time of MRI was 25.9 (range 13.8-33.3). Results. On MR imaging, four patients had infarcts in eight vascular territories (six anterior and two posterior). In 3/4 of anterior vascular territories with infarction, long (≥ 6 mm) segments of abnormal signal were seen at the internal carotid artery bifurcation with associated reduced distal flow. Short focal areas of abnormal signal were commonly seen where vessels branched, bifurcated or curved and were not associated with infarcts. These areas probably represent turbulence-related dephasing secondary to high velocity flow found in SCD. Conclusion. Long segments (≥ 6 mm) of abnormal signal with reduced distal flow correlated with sub-clinical infarction. (orig.)

  9. Efficacy and safety of gadobutrol-enhanced MRA of the renal arteries: Results from GRAMS (Gadobutrol-enhanced renal artery MRA study), a prospective, intraindividual multicenter phase 3 blinded study.

    Science.gov (United States)

    Fabrega-Foster, Kelly E; Agarwal, Sheela; Rastegar, Neda; Haverstock, Daniel; Agris, Jacob M; Kamel, Ihab R

    2018-02-01

    To compare the performance of magnetic resonance angiography (MRA) with 1M gadobutrol, a high relaxivity macrocyclic contrast agent, to 2D time-of-flight MRA (ToF-MRA) using computed tomographic angiography (CTA) as the standard of reference. Primary objectives were evaluation for superiority of structural delineation and noninferiority for detection and exclusion of clinically significant disease. In all, 315 subjects underwent unenhanced and contrast-enhanced MRA with 1M gadobutrol (CE-MRA) and were scanned with 1.5T MRI equipped with an at least 6-element body coil. Evaluations were based on both centralized blinded read (BR) performed by six readers as well as investigator site interpretations for the 292 subjects who completed the study. Quantitative evaluations including percent stenosis and normal vessel measurements were also performed. Secondary endpoints included identification of accessory renal arteries, diagnosis of fibromuscular dysplasia (FMD), diagnostic confidence, and need for additional imaging. A total of 292 patients suspected of renal artery disease completed the study. CE-MRA demonstrated statistically significant improvement in assessability of vascular segments compared to ToF: 95.9% vs. 77.6% (P < 0.0001). In the BR, the sensitivity and specificity of CE-MRA were noninferior to ToF-MRA (53.4% vs. 46.6% and 95.1% vs. 85.7%, respectively). There was less error in the CE-MRA stenosis measurements (0.15 mm gadobutrol vs. 0.41 mm ToF, P < 0.05). FMD was correctly diagnosed more frequently, 10% more accessory renal arteries were identified (P < 0.01), diagnostic confidence increased (P < 0.01), and fewer additional imaging studies were recommended (P < 0.01). Gadobutrol-enhanced MRA of the renal arteries has superior visualization, more accurate vessel measurements, and may serve as a CTA alternative without any ionizing radiation. 1 Technical Efficacy: Stage 2 J. Magn. Reson. Imaging 2018;47:572-581. © 2017 International Society for Magnetic

  10. Comparison of high-resolution contrast-enhanced 3D MRA with digital subtraction angiography in the evaluation of hepatic arterial anatomy

    International Nuclear Information System (INIS)

    Matoba, M.; Tonami, H.; Kuginuki, M.; Yokota, H.; Takashima, S.; Yamamoto, I.

    2003-01-01

    AIM: To evaluate the validity of high-resolution contrast-enhanced three-dimensional magnetic resonance angiography (MRA) in defining hepatic arterial anatomy and to compare this with digital subtraction angiography (DSA). MATERIALS AND METHODS: MRA and DSA were performed in 30 patients. MRA was performed with breath-hold, gadolinium-enhanced, three-dimensional, fast low-angle shot sequence with a 512 pixel matrix. MRA was compared with DSA in terms of image quality and depiction of hepatic arterial anatomy. The agreement in image quality between MRA and DSA was determined with the kappa statistic. RESULTS: With respect to image quality, there was excellent or good correlation between MRA and DSA for the common hepatic artery (κ=0.85), proper hepatic artery (κ=0.72), gastroduodenal artery (κ=0.70), left hepatic artery (κ=0.49), left gastric artery (κ=0.50), splenic artery (κ=0.84), and superior mesenteric artery (κ=0.88). Poor correlation was found for the right hepatic artery (κ=0.18) and right gastric artery (κ=0.38). With regard to hepatic arterial anatomy, MRA correlated correctly with DSA in 28 of the 29 cases, i.e. 97% of patients. CONCLUSION: MRA is a useful technique for the evaluation of the hepatic artery, and for the vast majority of patients, MRA can replace intra-arterial DSA

  11. Evaluation by MRA of aortic dilation late after repair of tetralogy of Fallot.

    Science.gov (United States)

    Kay, W Aaron; Cook, Stephen C; Daniels, Curt J

    2013-09-10

    This study evaluated predictors for aortic dilation (AD) in patients with repaired tetralogy of Fallot (rTOF) using magnetic resonance angiography (MRA). AD is common in patients with rTOF and may result in increased morbidity and mortality. There are no guidelines for evaluation of AD for rTOF patients. All adults with rTOF who previously underwent MRA had retrospective aortic measurements at the sinuses of Valsalva (SoV) and ascending aorta (AsAo). Rate of change in diameter was determined in patients with multiple MRAs. Chart review identified risk factors for AD. Univariate and multivariate analyses tested predictors of AD. Of the 87 patients who met the inclusion criteria, 12 (14%) had AD. At baseline, mean diameter was 3.6 ± 0.6 cm and 3.1 ± 0.6 cm at the SoV and AsAo, respectively. The AsAo was larger than the SoV in 17%. Predictors of AD included male gender, age, right aortic arch, pregnancy, older age at complete repair, smoking, and systemic hypertension. Serial studies were available in 55 patients; the rate of growth was slow: 0.4 ± 0.9 mm/year (SoV) and 0.1 ± 0.8mm/year (AsAo). AD is common in rTOF at the SoV and AsAo. Transthoracic echocardiography, which does not always image the AsAo as well as MRA, may not image AD in rTOF in cases in which the AsAo is dilated. Although several risk factors correlate with AD in rTOF, the rate of aortic growth is slow, suggesting that rTOF patients may not require frequent aortic imaging. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  12. Accelerated noncontrast-enhanced pulmonary vein MRA with distributed compressed sensing.

    Science.gov (United States)

    Akçakaya, Mehmet; Hu, Peng; Chuang, Michael L; Hauser, Thomas H; Ngo, Long H; Manning, Warren J; Tarokh, Vahid; Nezafat, Reza

    2011-05-01

    To investigate the efficacy of distributed compressed sensing (CS) to accelerate free-breathing, electrocardiogram (ECG)-triggered noncontrast pulmonary vein (PV) magnetic resonance angiography (MRA). Fully sampled ECG-triggered noncontrast PV MRA, using a spatially selective slab inversion preparation sequence, was acquired on seven healthy adult subjects (27 ± 17 years, range: 19-65 years, 4 women). The k-space data were retrospectively randomly undersampled by factors of 2, 4, 6, 8, and 10 and then reconstructed using distributed CS and coil-by-coil CS methods. The reconstructed images were evaluated by two blinded readers in consensus for assessment of major PV branches as well as the presence of artifacts in left atrium (LA) and elsewhere. Diameters of right inferior and right superior PV branches were measured. Additionally, mean square errors (MSE) of the reconstructions were calculated. Both CS methods resulted in image quality scores similar to the fully sampled reference images at undersampling factors up to 6-fold for distributed CS and 4-fold for coil-by-coil CS reconstructions. There was no difference in the presence of artifacts in LA and freedom from important artifacts elsewhere between the two techniques up to undersampling factors of 10 compared to the fully sampled reconstruction. For the PV diameters, no systematic variation between the reference and the reconstructions were observed for either technique. There were no significant differences in MSE between the two methods when compared at a given rate, but the difference was significant when compared across all rates. The sparsity of noncontrast PV MRA and the joint sparsity of different coil images allow imaging at high undersampling factors (up to 6-fold) when distributed CS is used. Copyright © 2011 Wiley-Liss, Inc.

  13. Accelerated Non-Contrast Enhanced Pulmonary Vein MRA with Distributed Compressed Sensing

    Science.gov (United States)

    Akçakaya, Mehmet; Hu, Peng; Chuang, Michael L.; Hauser, Thomas H.; Ngo, Long H.; Manning, Warren J.; Tarokh, Vahid; Nezafat, Reza

    2011-01-01

    Purpose To investigate the efficacy of distributed compressed sensing (CS) to accelerate free-breathing, ECG-triggered non-contrast pulmonary vein (PV) MR angiography (MRA). Materials and Methods Fully sampled ECG-triggered non-contrast PV MRA, using a spatially-selective slab inversion preparation sequence, was acquired on 7 healthy adult subjects (27±17 years, range: 19–65 years, 4 women). The k-space data were retrospectively randomly under-sampled by factors of 2, 4, 6, 8 and 10 and then reconstructed using distributed CS and coil-by-coil CS methods. The reconstructed images were evaluated by two blinded readers in consensus for assessment of major PV branches as well as presence of artifacts in left atrium (LA) and elsewhere. Diameters of right inferior and right superior PV branches were measured. Additionally, mean square errors (MSE) of the reconstructions were calculated. Results Both CS methods resulted in image quality score similar to the fully-sampled reference images at undersampling factors up to 6-fold for distributed CS and 4-fold for coil-by-coil CS reconstructions. There was no difference in the presence of artifacts in LA and freedom from important artifacts elsewhere between the two techniques up to undersampling factors of 10 compared to the fully sampled reconstruction. For the PV diameters, no systematic variation between the reference and the reconstructions were observed for either technique. There were no significant differences in MSE between the two methods when compared at a given rate, but the difference was significant when compared across all rates. Conclusions The sparsity of non-contrast PV MRA and the joint sparsity of different coil images allow imaging at high undersampling factors (up to 6-fold) when distributed CS is used. PMID:21509886

  14. Sequence comparison for non-enhanced MRA of the lower extremity arteries at 7 Tesla.

    Directory of Open Access Journals (Sweden)

    Sören Johst

    Full Text Available In this study three sequences for non-contrast-enhanced MRA of the lower extremity arteries at 7T were compared. Cardiac triggering was used with the aim to reduce signal variations in the arteries. Two fast single-shot 2D sequences, a modified Ultrafast Spoiled Gradient Echo (UGRE sequence and a variant of the Quiescent-Interval Single-Shot (QISS sequence were triggered via phonocardiogram and compared in volunteer examinations to a non-triggered 2D gradient echo (GRE sequence. For image acquisition, a 16-channel transmit/receive coil and a manually positionable AngioSURF table were used. To tackle B1 inhomogeneities at 7T, Time-Interleaved Acquisition of Modes (TIAMO was integrated in GRE and UGRE. To compare the three sequences quantitatively, a vessel-to-background ratio (VBR was measured in all volunteers and stations. In conclusion, cardiac triggering was able to suppress flow artifacts satisfactorily. The modified UGRE showed only moderate image artifacts. Averaged over all volunteers and stations, GRE reached a VBR of 4.18±0.05, UGRE 5.20±0.06, and QISS 2.72±0.03. Using cardiac triggering and TIAMO imaging technique was essential to perform non-enhanced MRA of the lower extremities vessels at 7T. The modified UGRE performed best, as observed artifacts were only moderate and the highest average VBR was reached.

  15. Systematic assessment and evaluation of sliding interleaved kY (SLINKY) acquisition for 3D MRA.

    Science.gov (United States)

    Liu, K; Lee, D H; Rutt, B K

    1998-01-01

    In comparison with the conventional three-dimensional multiple overlapped thin slab acquisition (MOTSA) for magnetic resonance angiography (MRA), we have developed a novel sliding interleaved kY (SLINKY) acquisition technique, which can eliminate the slab boundary artifact (SBA) or venetian blind artifact without any a priori knowledge of blood flow. This work addresses the systematic assessment and evaluation of the SLINKY technique and verifies the advantages of SLINKY in the following several aspects: (a) scan time efficiency; (b) signal-to-noise ratio (SNR), and signal-difference-to-noise ratio (SDNR); (c) sensitivity to flow velocity range; (d) sensitivity to flow direction; (e) signal loss in slow/reversal flow regions; and (f) reconstruction efficiency and feasibility. Both phantom and in vivo experiments verify the clinical significance of the technique. The new MRA images acquired with this imaging technique in 31 volunteer/patient examinations show highly reliable mapping of vascular morphology without the SBA and reduction of signal voids in complex/slow flow regions.

  16. Congenital diseases of the thoracic aorta. Role of MRI and MRA

    International Nuclear Information System (INIS)

    Russo, Vincenzo; Renzulli, Matteo; Palombara, Cesare la; Fattori, Rossella

    2006-01-01

    Aortic malformations may be associated with other congenital heart abnormalities or may present independently, as incidental findings in asymptomatic patients. For more than 30 years, conventional imaging techniques for detection and assessment of congenital anomalies of the aorta have been chest X-ray, echocardiography and angiography. In recent times, considerable interest in congenital aortic diseases has been shown, due to technical progresses of noninvasive imaging modalities. Among them, magnetic resonance imaging (MRI) almost certainly offers the greatest advantages, especially in young patients in which a radiation exposure must be avoided as much as possible. MRI provides an excellent visualization of vascular structures with a wide field of view, well suited for evaluation of the thoracic aorta malformations. With the implementation of magnetic resonance angiography (MRA) it is also possible to depict any relationship with supra-aortic or mediastinal vessels. Phase contrast technique allows identification of the hemodynamic significance of the aortic alteration. Some technical considerations, which include fast spin-echo, gradient-echo and, especially, MRA techniques with phase-contrast and contrast enhanced methods, are discussed and applied in the evaluation of congenital thoracic aorta diseases. (orig.)

  17. Diagnosis of moyamoya disease using 3-T MRI and MRA: value of cisternal moyamoya vessels

    Energy Technology Data Exchange (ETDEWEB)

    Sawada, Takeshi; Yamamoto, Akira; Okada, Tomohisa; Kanagaki, Mitsunori; Kasahara, Seiko; Togashi, Kaori [Kyoto University, Department of Diagnostic Imaging and Nuclear Medicine, Graduate School of Medicine, Kyoto (Japan); Miki, Yukio [Osaka City University, Department of Radiology, Graduate School of Medicine, Osaka (Japan); Kikuta, Ken-ichiro [Fukui University, Division of Neurosurgery, Department of Sensory and Locomotor Medicine, Faculty of Medical Sciences, Fukui (Japan); Miyamoto, Susumu; Takahashi, Jun C. [Kyoto University, Department of Neurosurgery, Graduate School of Medicine, Kyoto (Japan); Fukuyama, Hidenao [Kyoto University, Human Brain Research Center, Graduate School of Medicine, Kyoto (Japan)

    2012-10-15

    The purpose of this study was to propose new magnetic resonance (MR) criteria of diagnosing moyamoya disease (MMD) from cisternal moyamoya vessels (MMVs) on 3-T magnetic resonance imaging (MRI)/magnetic resonance angiography (MRA) and compare the diagnostic accuracy of the existing MR criteria and the proposed MR criteria. Participants comprised 20 consecutive patients with MMD (4 males, 16 females) diagnosed clinically using conventional angiography and 20 controls (13 male and 7 female arteriosclerosis patients). In these participants, 3-T MRI/MRA was evaluated by the existing MR criteria, which use MMVs in the basal ganglia, and the proposed MR criteria, which use cisternal MMVs, and then these two criteria were statistically compared by McNemar's test. Diagnostic accuracy was 62.5% with the existing MR criteria and 97.5% with the proposed MR criteria. The proposed MR criteria was more sensitive (1.00) than the existing MR criteria (0.45), but less specific (0.95) than the existing MR criteria (1.00). The proposed MR criteria using cisternal MMVs showed significantly higher diagnostic accuracy than the existing MR criteria. We believe that our proposed MR criteria will be beneficial for diagnosing MMD. (orig.)

  18. Computerized detection of unruptured aneurysms in MRA images: reduction of false positives using anatomical location features

    Science.gov (United States)

    Uchiyama, Yoshikazu; Gao, Xin; Hara, Takeshi; Fujita, Hiroshi; Ando, Hiromichi; Yamakawa, Hiroyasu; Asano, Takahiko; Kato, Hiroki; Iwama, Toru; Kanematsu, Masayuki; Hoshi, Hiroaki

    2008-03-01

    The detection of unruptured aneurysms is a major subject in magnetic resonance angiography (MRA). However, their accurate detection is often difficult because of the overlapping between the aneurysm and the adjacent vessels on maximum intensity projection images. The purpose of this study is to develop a computerized method for the detection of unruptured aneurysms in order to assist radiologists in image interpretation. The vessel regions were first segmented using gray-level thresholding and a region growing technique. The gradient concentration (GC) filter was then employed for the enhancement of the aneurysms. The initial candidates were identified in the GC image using a gray-level threshold. For the elimination of false positives (FPs), we determined shape features and an anatomical location feature. Finally, rule-based schemes and quadratic discriminant analysis were employed along with these features for distinguishing between the aneurysms and the FPs. The sensitivity for the detection of unruptured aneurysms was 90.0% with 1.52 FPs per patient. Our computerized scheme can be useful in assisting the radiologists in the detection of unruptured aneurysms in MRA images.

  19. Non-contrast-enhanced imaging of haemodialysis fistulas using quiescent-interval single-shot (QISS) MRA: a feasibility study

    International Nuclear Information System (INIS)

    Okur, A.; Kantarci, M.; Karaca, L.; Yildiz, S.; Sade, R.; Pirimoglu, B.; Keles, M.; Avci, A.; Çankaya, E.; Schmitt, P.

    2016-01-01

    Aim: To assess the efficiency of a novel quiescent-interval single-shot (QISS) technique for non-contrast-enhanced magnetic resonance angiography (MRA) of haemodialysis fistulas. Materials and methods: QISS MRA and colour Doppler ultrasound (CDU) images were obtained from 22 haemodialysis patients with end-stage renal disease (ESRD). A radiologist with extensive experience in vascular imaging initially assessed the fistulas using CDU. Two observers analysed each QISS MRA data set in terms of image quality, using a five-point scale ranging from 0 (non-diagnostic) to 4 (excellent), and lumen diameters of all segments were measured. Results: One hundred vascular segments were analysed for QISS MRA. Two anastomosis segments were considered non-diagnostic. None of the arterial or venous segments were evaluated as non-diagnostic. The image quality was poorer for the anastomosis level compared to the other segments (p<0.001 for arterial segments, and p<0.05 for venous segments), while no significant difference was determined for other vascular segments. Conclusion: QISS MRA has the potential to provide valuable complementary information to CDU regarding the imaging of haemodialysis fistulas. In addition, QISS non-enhanced MRA represents an alternative for assessment of haemodialysis fistulas, in which the administration of iodinated or gadolinium-based contrast agents is contraindicated. - Highlights: • Close monitoring and early intervention in hemodialysis fistulas may prolong longevity fistulas. • DopplerUS, contrast enhanced CT and MRI are using assessment of hemodialysis fistulas. • QISS nonenhanced MR angiography represents an alternative for assessment of hemodialysis fistulas.

  20. The clinical value of MRA at 3.0 T for the diagnosis and therapeutic planning of patients with subarachnoid haemorrhage.

    Science.gov (United States)

    Chen, Yuan-Chang; Sun, Zhen-Kui; Li, Ming-Hua; Li, Yong-Dong; Wang, Wu; Tan, Hua-Qiao; Gu, Bin-Xian; Chen, Shi-Wen

    2012-07-01

    To evaluate the clinical value of unenhanced magnetic resonance angiography (MRA) at 3.0 T for the diagnosis and therapeutic planning of patients with subarachnoid haemorrhage (SAH). A total of 165 patients with SAH were referred for three-dimensional time-of-flight MRA (3D-TOF-MRA) before digital subtraction angiography (DSA). For each aneurysm, 3D-TOF-MRA was used to determine whether the aneurysm was suitable for coil placement with or without balloon/stent-assisted coiling, surgical clipping or conservative treatment. Treatment planning with 3D-TOF-MRA was compared with actual treatment decisions or treatment that had been carried out in each aneurysm decided using DSA. The aneurysm-based evaluation yielded accuracy of 96.9%, sensitivity of 97.6%, specificity of 93.1%, positive predictive value (PPV) of 98.8% and negative predictive value (NPV) of 87.1%, in the detection of intracranial aneurysms. Treatment planning could be correctly made on the basis of aneurysm anatomy and working view by volume rendering (VR) 3D-TOF-MRA with accuracy, sensitivity, specificity, PPV and NPV of 94.9%, 94.0%, 100%, 100% and 74.4%, respectively, on a per aneurysm-based evaluation. VR 3D-TOF-MRA offers high diagnostic accuracy in the detection of ruptured intracranial aneurysms, and appears to be an effective treatment planning tool for most patients with SAH. VR 3D-TOF-MRA offers high diagnostic accuracy for detecting ruptured intracranial aneurysms. • VR 3D-TOF-MRA helps treatment planning for patients with subarachnoid haemorrhage. • 3D-TOF-MRA is non-invasive and avoids using ionising radiation or contrast agents.

  1. Contrast-Enhanced Whole-Heart Coronary MRA at 3T Using Interleaved EPI

    Science.gov (United States)

    Bhat, Himanshu; Yang, Qi; Zuehlsdorff, Sven; Li, Kuncheng; Li, Debiao

    2010-01-01

    Objectives The goal of this work was to reduce the scan time of contrast-enhanced whole-heart coronary magnetic resonance angiography (MRA) by using a gradient echo interleaved echo planar imaging (GRE-EPI) sequence at 3T field strength. Materials and Methods A GRE-EPI sequence was optimized to acquire contrast-enhanced whole-heart coronary MRA at 3T. First order phase correction was used for alignment of the odd and even echoes in the GRE-EPI echo train. Single and dual reference scan techniques for estimation of the linear phase correction parameters were evaluated using both phantom and volunteer studies. The GRE-EPI readout was combined with parallel imaging for a further reduction in scan time. To avoid image distortions, calibration signals for coil sensitivity estimation were acquired in a separate low resolution GRE scan prior to the whole-heart GRE-EPI scan. 8 healthy volunteers were scanned with the optimized contrast-enhanced GRE-EPI sequence. GRE-EPI images were acquired during slow infusion (0.3 ml/sec) of 0.1 mmol/kg body weight of Gd-BOPTA. For comparison purposes, the same 8 volunteers were scanned again in a separate scan session using a traditional GRE sequence with double the dose (0.2 mmol/kg body weight) of the same contrast agent with the same injection rate. The contrast-enhanced GRE-EPI and contrast-enhanced GRE techniques were compared in terms of relative SNR and CNR, image quality scores and visualized vessel lengths. Results Both, phantom and volunteer studies demonstrated that the dual reference scan phase correction technique was a key step for obtaining satisfactory image quality using GRE-EPI at 3T. Whole-heart coronary MRA with a spatial resolution of 1.0 × 1.0 × 2.0 mm3 was acquired with the GRE-EPI sequence in an average scan time of 2.5 ± 0.6 minutes, compared with 8.6 ± 2.7 minutes for the GRE technique. The GRE-EPI technique had lower relative CNR compared with the GRE sequence. The image quality and coronary artery

  2. Evaluation of cerebral blood flow change after cigarette smoking using quantitative MRA.

    Directory of Open Access Journals (Sweden)

    Yunsun Song

    Full Text Available Changes in cerebral blood flow (CBF immediately after cigarette smoking (CS are still unclear. Our purpose was to evaluate the hemodynamic changes in each intracranial vessel after CS by using quantitative magnetic resonance angiography (MRA.Fifteen healthy male smokers less than 45 years old with more than 3 pack-year smoking history were enrolled in this study. The hemodynamic change in the vessels, represented by cerebral flow rate (CFR, ml/s and flow velocity (FV, cm/s, was quantitatively measured in eleven vascular segments of the brain using phase-contrast MRA. Two sets of data at each vessel before and after CS were statistically analyzed by paired t-test. Three of 15 participants, as a control group, followed all the procedures but did not smoke.Total CFR of the distal intracranial vessels (anterior, middle, and posterior cerebral arteries; ACA, MCA, and PCA was significantly reduced after CS by 7.3% (847 vs. 785 ml/s, p = 0.024. Such flow changes were statistically more significant in the anterior circulation (ACA and MCA compared to the posterior circulation (PCA. All distal intracranial vessels did not have significant FV change while peak systolic velocity and mean velocity dropped 7.4 and 4.3% and pulsatility index decreased 10.9% in the internal carotid artery. Regarding cross-sectional areas, all distal intracranial vessels showed diminished, and only MCA had a statistical significance (9.9 vs. 9.3 mm2, p = 0.016.There was a significant decrease of CFR after CS especially in the anterior circulation of twelve young male smokers. Considering the changes of FV and cross-sectional area all together, it can be suggested that cerebrovascular impedance increased after CS especially at the main trunk level of the distal intracranial vessels (ACA, MCA, and PCA.

  3. Long-term MRA follow-up after coiling of intracranial aneurysms: impact on mood and anxiety

    International Nuclear Information System (INIS)

    Ferns, Sandra P.; Nieuwkerk, Pythia T.; Majoie, Charles B.L.M.; Rooij, Willem Jan J. van; Rinkel, Gabriel J.E.

    2011-01-01

    Magnetic resonance angiography (MRA) screening for recurrence of a coiled intracranial aneurysm and formation of new aneurysms long-term after coiling may induce anxiety and depression. In coiled patients, we evaluated effects on mood and level of anxiety from long-term follow-up MRA in comparison to general population norms. Of 162 patients participating in a long-term (>4.5 years) MRA follow-up after coiling, 120 completed the EQ-5D questionnaire, a visual analog health scale and a self-developed screening related questionnaire at the time of MRA. Three months later, the same questionnaires were completed by 100 of these 120 patients. Results were compared to general population norms adjusted for gender and age. Any problem with anxiety or depression was reported in 56 of 120 patients (47%; 95%CI38 56%) at baseline and 42 of 100 patients (42%; 95%CI32 52%) at 3 months, equally for screen-positives and -negatives. Compared to the reference population, participants scored 38% (95%CI9 67%) and 27% (95%CI4 50%) more often any problem with anxiety or depression. Three months after screening, 21% (20 of 92) of screen-negatives and 13% (one of eight) of screen-positives reported to be less afraid of subarachnoid hemorrhage (SAH) compared to before screening. One of eight screen-positives reported increased fear of SAH. Patients with coiled intracranial aneurysms participating in long-term MRA screening reported significantly more often to be anxious or depressed than a reference group. Screening did not significantly increase anxiety or depression temporarily. However, subjectively, patients did report an increase in anxiety caused by screening, which decreased after 3 months. (orig.)

  4. Long-term MRA follow-up after coiling of intracranial aneurysms: impact on mood and anxiety

    Energy Technology Data Exchange (ETDEWEB)

    Ferns, Sandra P.; Nieuwkerk, Pythia T.; Majoie, Charles B.L.M. [Academic Medical Center, Department of Radiology, Amsterdam (Netherlands); Rooij, Willem Jan J. van [St. Elisabeth Ziekenhuis, Department of Radiology, Tilburg (Netherlands); Rinkel, Gabriel J.E. [University Medical Center, Department of Neurology, Rudolf Magnus Institute of Neuroscience, Utrecht (Netherlands)

    2011-05-15

    Magnetic resonance angiography (MRA) screening for recurrence of a coiled intracranial aneurysm and formation of new aneurysms long-term after coiling may induce anxiety and depression. In coiled patients, we evaluated effects on mood and level of anxiety from long-term follow-up MRA in comparison to general population norms. Of 162 patients participating in a long-term (>4.5 years) MRA follow-up after coiling, 120 completed the EQ-5D questionnaire, a visual analog health scale and a self-developed screening related questionnaire at the time of MRA. Three months later, the same questionnaires were completed by 100 of these 120 patients. Results were compared to general population norms adjusted for gender and age. Any problem with anxiety or depression was reported in 56 of 120 patients (47%; 95%CI38<->56%) at baseline and 42 of 100 patients (42%; 95%CI32<->52%) at 3 months, equally for screen-positives and -negatives. Compared to the reference population, participants scored 38% (95%CI9<->67%) and 27% (95%CI4<->50%) more often any problem with anxiety or depression. Three months after screening, 21% (20 of 92) of screen-negatives and 13% (one of eight) of screen-positives reported to be less afraid of subarachnoid hemorrhage (SAH) compared to before screening. One of eight screen-positives reported increased fear of SAH. Patients with coiled intracranial aneurysms participating in long-term MRA screening reported significantly more often to be anxious or depressed than a reference group. Screening did not significantly increase anxiety or depression temporarily. However, subjectively, patients did report an increase in anxiety caused by screening, which decreased after 3 months. (orig.)

  5. Prodolzhajut veselitsja / Aleksandr Suits

    Index Scriptorium Estoniae

    Suits, Aleksandr

    2006-01-01

    Taani ajaleht "Information" avaldas 6 holokausti-teemalist karikatuuri, mis olid väljas näitusel Iraanis. Näitus oli korraldatud vastukaaluks 2005. aastal Taani ajalehes avaldatud satiirilistele piltidele islami teemadel

  6. Problema interpretatsii / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2004-01-01

    Vene Riigiduuma ratifitseeris Venemaa ning Euroopa Liidu vahelise partnerlus- ja koostöölepingu, samuti Venemaa ühinemislepingu Kyoto protokolliga. Autor hindab nende lepingute võimalikku mõju Eesti-Vene suhetele

  7. Dissolved inorganic carbon, pH, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from AKADEMIK ALEKSANDR NESMEYANOV in the North Pacific Ocean and Sea of Okhotsk from 1993-08-08 to 1993-09-21 (NODC Accession 0115169)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0115169 includes discrete sample and profile data collected from AKADEMIK ALEKSANDR NESMEYANOV in the North Pacific Ocean and Sea of Okhotsk from...

  8. Retrospective multi-phase non-contrast-enhanced magnetic resonance angiography (ROMANCE MRA) for robust angiogram separation in the presence of cardiac arrhythmia.

    Science.gov (United States)

    Kim, Hahnsung; Park, Suhyung; Kim, Eung Yeop; Park, Jaeseok

    2018-02-09

    To develop a novel, retrospective multi-phase non-contrast-enhanced MRA (ROMANCE MRA) in a single acquisition for robust angiogram separation even in the presence of cardiac arrhythmia. In the proposed ROMANCE MRA, data were continuously acquired over all cardiac phases using retrospective, multi-phase flow-sensitive single-slab 3D fast spin echo (FSE) with variable refocusing flip angles, while an external pulse oximeter was in sync with pulse repetitions in FSE to record real-time information on cardiac cycles. Data were then sorted into k-bin space using the real-time cardiac information. Angiograms were reconstructed directly from k-bin space by solving a constrained optimization problem with both subtraction-induced sparsity and low rank priors. Peripheral MRA was performed in normal volunteers with/without caffeine consumption and a volunteer with cardiac arrhythmia using conventional fresh blood imaging (FBI) and the proposed ROMANCE MRA for comparison. The proposed ROMANCE MRA shows superior performance in accurately delineating both major and small vessel branches with robust background suppression if compared with conventional FBI. Even in the presence of irregular heartbeats, the proposed method exhibits clear depiction of angiograms over conventional methods within clinically reasonable imaging time. We successfully demonstrated the feasibility of the proposed ROMANCE MRA in generating robust angiograms with background suppression. © 2018 International Society for Magnetic Resonance in Medicine.

  9. Efficacy of patient selection strategies for carotid endarterectomy by contrast-enhanced MRA on a 1 T machine and duplex ultrasound in a regional hospital

    International Nuclear Information System (INIS)

    Korteweg, M.A.; Kerkhoff, H.; Bakker, J.; Elgersma, O.E.H.

    2008-01-01

    Aim: To investigate whether contrast-enhanced magnetic resonance angiography (CE-MRA) and duplex ultrasound (DUS) could replace digital subtraction angiography (DSA) for diagnosing internal carotid artery (ICA) stenosis in regional centres with less specialized technicians and equipment, such as a 1 Tesla MRI machine. Materials and methods: Sixty-six consecutive, symptomatic patients with ICA stenosis, as evidenced using DSA, were included. In the first 34 patients DUS was validated and cut-off criteria were established. Data were analysed by receiver operating characteristic curve and logistic regression. Two observers analysed the DUS and CE-MRA results of 32 patients. Stenoses were categorized in accordance with North American Symptomatic Endarterectomy Trial (NASCET) measurement criteria. Results: Peak systolic velocity (PSV) in the ICA was defined as a better parameter for defining stenosis than end diastolic velocity and the PSV ICA:common carotid artery ratio. The optimal PSV threshold was 230 cm/s. Four ICAs were not interpretable on DUS, and one on CE-MRA. Two patients did not undergo CE-MRA. The sensitivities and specificities were calculated: for DUS these were 100% and 68% respectively; for observer 1 on CE-MRA these were 93% and 89%, respectively; for observer 2 these were 92% and 87%, respectively. The sensitivity and specificity for combined DUS/CE-MRA were 100% and 85%, respectively. Seventy-eight percent of CE-MRA and DUS correlated. The weighted Kappa for CE-MRA and DSA were 0.8 and 0.9, respectively. Conclusion: DUS and CE-MRA are effective non-invasive methods for selecting patients with ICA stenosis for carotid endarterectomy in non-specialized centres using a 1 T machine. The present results suggest that no referrals to more specialized centres for non-invasive diagnostic work-up for carotid artery stenoses will be necessary

  10. Preliminary evaluation of 3D TOF MRA fly-around advantages in the diagnosis of internal carotid artery aneurysms

    International Nuclear Information System (INIS)

    Zhu Yusen; Zhang Lina; Xu Ke; Li Songbai; Huang Yanling; Sun Wenge; Jin Anyu; Qi Xixun; Li Yanliang

    2004-01-01

    Objective: To assess the advantages and the clinical application value of 3D TOF MR angiography fly-around in diagnosing internal carotid artery aneurysms in comparison with multi-slice helical CT three dimensional angiography (MS 3D-CTA) and digital subtraction angiography (DSA). Methods: Eighteen patients with clinical suspected internal carotid artery aneurysms were involved in the study. There were 4 males and 14 females, and their age ranged from 17 to 76 years. 14 patients were with subarachnoid hemorrhage and 4 patients with oculomotor nerve palsy. All these patients underwent 3D TOF MRA and MS 3D-CTA, and 17 patients underwent DSA. All of them accepted operation treatment. 3D TOF MRA was performed with Toshiba 1.5 T MRI system and the parameters of 3D-TOF sequence were: TR 30 ms, TE 6.8 ms, field of view 17 cm x 19 cm, matrix 160 x 256, slab thickness 50-60 mm, section thickness 1.2 mm, flip angle 20 degree. Row data of MS 3D-CTA was acquired by Multi-slice helical CT-Aquilion (Toshiba). The scanning parameters were: image slice thickness 1.0 mm, scan speed 0.5 s/r, helical pitch 3.5, delay time 15-18 sec. Nonionic contrast agent was injected intravenously (2.0 ml/kg) at the speed of 4.0-5.0 ml/s using a power injector. Source images of 3D TOF MRA and MS 3D-CTA were processed into MIP and fly-around using a workstation SGI-O2, with the post-processing software Alatoview (Ver: 1.42). Conventional four-vessel digital subtraction angiography was performed with Siemens Multi-Start OT. Results: 22 aneurysms were detected by both 3D TOF MRA and MS 3D-CTA (1 ACA aneurysm, 3 ACoMA aneurysms, 1 left MCA aneurysm, 2 ICA-cavernous aneurysms, 3 left ICA-PCoM aneurysms, 8 right ICA-PCoM aneurysms, 1 left ICA-AChA aneurysms, 2 right ICA-AChA aneurysms, and 1 superior pituitary artery aneurysm). Among those aneurysms, one was not detected by DSA, and another aneurysm's neck was not clear on the image of DSA. 1 right ICA-PCoM aneurysm was surgically treated according to 3D

  11. Multimodal imaging in the elastase-induced aneurysm model in rabbits: a comparative study using serial DSA, MRA and CTA

    International Nuclear Information System (INIS)

    Doerfler, A.; Becker, W.; Wanke, I.; Goericke, S.; Oezkan, N.; Forsting, M.

    2004-01-01

    Background and Purpose: The elastase-induced aneurysm model in rabbits has proved to be suitable for testing new endovascular occlusion devices. The purpose of this study was to evaluate different imaging modalities for the depiction of anatomy and size of elastase-induced aneurysms and for serial follow-up imaging. Materials and Methods: Elastase-induced aneurysms were created in eight Chinchilla bastard rabbits by endoluminal incubation of porcine elastase. Serial imaging was performed using intravenous DSA (IVDSA), contrast-enhanced MRA (CEMRA), and time-of-flight MRA (TOF) 14 days, 4 weeks and 3 months after aneurysm creation. Intraarterial DSA (IADSA) and CT angiography (CTA) were performed after 3 months. Aneurysm size and geometry (height H, width W, neck width N) were compared. Results: On IVDSA after two weeks mean aneurysm height was 6.2 mm (range 2.8-11.0 mm), mean aneurysm neck width was 2.7 mm (range 2.0-4.2 mm) and mean aneurysm neck width was 2.7 mm (range 2.0-4.2 mm). We did not observed any statistically significant change in aneurysm dimensions during follow-up at 4 weeks (CEMRA: H: 5.4, W: 2.4, N: 2.4; TOF: H: 5.7, W: 2.4, N: 2.7) and 3 months (CEMRA: H: 5.8, W: 2.6, N: 2.6; TOF: H: 6.9, W: 2.8, N: 3.0). Aneurysm dimensions could be best seen on IADSA (H: 6.2, W: 3.0, N: 2.7) with good correlation to CTA (r=0.94; H: 6.1, W: 2.8, N: 2.6), CE-MRA (r=0.92), and TOF (r=0.97). TOF was superior to CEMRA in delineating the aneurysm wall. Conclusions: Serial imaging using MRA, CTA or intravenous and intraarterial angiography is feasible in the elastase-induced aneurysm model. Contrast-enhanced MRA, TOF-MRA and CTA showed good correlation to IADSA and are all suitable for non-invasive pretherapeutic measurement of aneurysm size. (orig.) [de

  12. Correlation of transcranial Doppler ultrasonography with MRI and MRA in the evaluation of sickle cell disease patients with prior stroke

    International Nuclear Information System (INIS)

    Kogutt, M.S.; Goldwag, S.S.; Gupta, K.L.; Kaneko, K.; Humbert, J.R.

    1994-01-01

    We prospectively evaluated a group of patients with sickle cell disease and a clinical history of prior stroke, comparing transcranial Doppler sonography (TCD) to both magnetic resonance imaging (MRI) and magnetic resonance angiography (MRA) to determine its efficacy for the detection of flow abnormalities associated with prior cerebral infarction. Using MRI as the standard examination, there was 94 % sensitivity and 30 % specificity, and using MRA as the standard examination, there was 91 % sensitivity and 22 % specificity. We concur with other reports that the transcranial Doppler examination is a highly sensitive study. In our group of sickle cell disease patients with prior stroke, TCD reliably detected flow abnormalities that correlated to areas of prior cerebral infarction. (orig.)

  13. Correlation of transcranial Doppler ultrasonography with MRI and MRA in the evaluation of sickle cell disease patients with prior stroke

    Energy Technology Data Exchange (ETDEWEB)

    Kogutt, M.S. (Dept. of Radiology SL54, Tulane Univ. Medical Center, New Orleans, LA (United States)); Goldwag, S.S. (Dept. of Radiology SL54, Tulane Univ. Medical Center, New Orleans, LA (United States)); Gupta, K.L. (Dept. of Radiology SL54, Tulane Univ. Medical Center, New Orleans, LA (United States)); Kaneko, K. (Dept. of Radiology SL54, Tulane Univ. Medical Center, New Orleans, LA (United States)); Humbert, J.R. (Dept. of Pediatric Hematology and Oncology, Tulane Univ. Medical Center, New Orleans, LA (United States))

    1994-06-01

    We prospectively evaluated a group of patients with sickle cell disease and a clinical history of prior stroke, comparing transcranial Doppler sonography (TCD) to both magnetic resonance imaging (MRI) and magnetic resonance angiography (MRA) to determine its efficacy for the detection of flow abnormalities associated with prior cerebral infarction. Using MRI as the standard examination, there was 94 % sensitivity and 30 % specificity, and using MRA as the standard examination, there was 91 % sensitivity and 22 % specificity. We concur with other reports that the transcranial Doppler examination is a highly sensitive study. In our group of sickle cell disease patients with prior stroke, TCD reliably detected flow abnormalities that correlated to areas of prior cerebral infarction. (orig.)

  14. Sparse-CAPR: Highly-Accelerated 4D CE-MRA with Parallel Imaging and Nonconvex Compressive Sensing

    Science.gov (United States)

    Trzasko, Joshua D.; Haider, Clifton R.; Borisch, Eric A.; Campeau, Norbert G.; Glockner, James F.; Riederer, Stephen J.; Manduca, Armando

    2012-01-01

    CAPR is a SENSE-type parallel 3DFT acquisition paradigm for 4D contrast-enhanced magnetic resonance angiography (CE-MRA) that has been demonstrated capable of providing high spatial and temporal resolution, diagnostic-quality images at very high acceleration rates. However, CAPR images are typically reconstructed online using Tikhonov regularization and partial Fourier methods, which are prone to exhibit noise amplification and undersampling artifacts when operating at very high acceleration rates. In this work, a sparsity-driven offline reconstruction framework for CAPR is developed and demonstrated to consistently provide improvements over the currently-employed reconstruction strategy against these ill-effects. Moreover, the proposed reconstruction strategy requires no changes to the existing CAPR acquisition protocol, and an efficient numerical optimization and hardware system are described that allow for a 256×160×80 volume CE-MRA volume to be reconstructed from an 8-channel data set in less than two minutes. PMID:21608028

  15. Scanning time efficient slinky for non-contrast MRA at low field.

    Science.gov (United States)

    Liu, K; Tanttu, J; Castrén, A; Rutt, B K

    1999-06-01

    To eliminate slab boundary artifact (SBA) for non-contrast multi-slab three-dimensional time-of-flight magnetic resonance angiogram (3D TOF MRA), we have previously developed a novel technique, termed SLINKY (Sliding Interleaved kY) acquisition in which a thin slab continuously "walks" along the z-axis while data are acquired in an interleaved fashion along the kY-axis. It has been demonstrated in our earlier works that SLINKY can suppress the SBA without any assumption of blood flow behavior, such as velocity or direction. At the same time, SLINKY keeps the same SNR as conventional multiple overlapping thin slab acquisition (MOTSA). Yet, this method is sensitive to any phase error along the ky axis. In our earlier application of SLINKY, we used navigator echoes to measure and correct the phase errors along the kY axis. The cost of using navigator echo collection is an increase in the imaging time. We therefore propose an improved SLINKY technique which does not use navigator echo collection for correcting phase errors, reducing the imaging time while keeping the same suppression of slab boundary artifacts. The present study demonstrates that by using a specifically designed RF pulse, the navigator echo collection can be avoided without incurring any extra ghosting or SNR reduction in the reconstructed images.

  16. Clinical usefulness of MRI and MRA in children with partial epilepsy

    International Nuclear Information System (INIS)

    Zajac, A.; Kacinski, M.; Kubik, A.; Kroczka, S.

    2006-01-01

    Partial epilepsy is a very important problem of epileptology in childhood including clinical and therapeutic aspect especially surgery treatment. The aim of this study is to assess clinical value of neuroimagine techniques (structural MRI, MRI angiography) in partial epilepsy diagnostics in children. The relation between results of examinations with these methods and congenital and acquired risk factors related to partial epilepsy, age of its onset and clinical assessment of patients was analyzed. The study group consisted of 140 children with partial epilepsy hospitalized between 1998 and 2004 in Department of Pediatric Neurology, Collegium Medicum Jagiellonian University, Krakow. The group included 70 girls and 70 boys, the age ranged from 2 months to 17 years. In study group statistical analysis included different factors as which can be related with results of neuroimaging as age, load of pregnancy and birth period, familiar epilepsy, patient's risk factors for appearance of epilepsy, acquired risk factors of epilepsy, results of neurological examination, type of epilepsy, status epilepticus, and signs according epileptic attacks which can be related with neuroimaging results. The primary method of neuroimagine in all patients was structural MRI, in 16 cases Magnetic Resonance Angiography (MRA). The parametric tests (t-student), nonparametric Mann-Whitney's test were used in statistical analysis. The bilateral Fisher test was used to check rate in groups. There was assessed sensitivity, specificity, positive predictive value, negative predictive value; the 95% confidence interval was calculated for these parameters. Abnormalities in neurological examination in children with partial epilepsy were strongly correlated with MRI findings. The structural changes in MRI were found in younger children, whose course of epilepsy was longer than children without MRI changes. Changes in hippocampus ere the most common in children with partial epilepsy with abnormalities in

  17. Collateral circulation via the circle of Willis in patients with carotid artery steno-occlusive disease: evaluation on 3-T 4D MRA using arterial spin labelling

    International Nuclear Information System (INIS)

    Iryo, Yasuhiko; Hirai, Toshinori; Nakamura, Masanobu; Inoue, Yasuteru; Watanabe, Masaki; Ando, Yukio; Azuma, Minako; Nishimura, Shinichiro; Shigematsu, Yoshinori; Kitajima, Mika; Yamashita, Yasuyuki

    2015-01-01

    Aim: To evaluate whether 3-T four-dimensional (4D) arterial spin-labelling (ASL) -based magnetic resonance angiography (MRA) is useful for assessing the collateral circulation via the circle of Willis in patients with carotid artery steno-occlusive disease. Materials and methods: Institutional review board approval and prior written informed consent from all patients were obtained. The inclusion criteria were fulfilled by 13 patients with carotid artery steno-occlusive disease. All underwent 4D-ASL MRA at 3 T and digital subtraction angiography (DSA). The flow-sensitive alternating inversion recovery (FAIR) preparation scheme with look-locker sampling was used for spin labeling. At 300-ms intervals seven dynamic scans were obtained with a spatial resolution of 0.5×0.5×0.6 mm 3 . The collateral flow via the circle of Willis was read on 4D-ASL MRA and DSA images by two sets of two independent readers each. κ statistics were used to assess interobserver and intermodality agreement. Results: On DSA, collateral flow via the anterior communicating artery (AcomA) was observed in six patients, via the posterior communicating artery (PcomA) in four patients, and via both the AcomA and PcomA in three patients. With respect to the qualitative evaluation of 4D-ASL MRA images, interobserver agreement was excellent for all items (κ=1). 4D-ASL MRA and DSA consensus readings agreed on the type of collateral flow pattern in 10 of the 13 patients (77%). Intermodality agreement was good (κ=0.606; 95% confidence interval (CI): 0.215–0.997). Conclusion: 3 T 4D-ASL MRA may be a useful tool for the evaluation of the collateral circulation in patients with carotid artery steno-occlusive disease. -- Highlights: •3-T 4D-ASL MRA has high spatial and temporal resolution. •There is no need for the use of contrast agents in this technique. •4D-ASL MRA is useful for assessing the collateral flow associated with carotid artery stenosis. •Intermodality agreement between 4D

  18. High Spatial and Temporal Resolution Dynamic Contrast-Enhanced Magnetic Resonance Angiography (CE-MRA) using Compressed Sensing with Magnitude Image Subtraction

    Science.gov (United States)

    Rapacchi, Stanislas; Han, Fei; Natsuaki, Yutaka; Kroeker, Randall; Plotnik, Adam; Lehman, Evan; Sayre, James; Laub, Gerhard; Finn, J Paul; Hu, Peng

    2014-01-01

    Purpose We propose a compressed-sensing (CS) technique based on magnitude image subtraction for high spatial and temporal resolution dynamic contrast-enhanced MR angiography (CE-MRA). Methods Our technique integrates the magnitude difference image into the CS reconstruction to promote subtraction sparsity. Fully sampled Cartesian 3D CE-MRA datasets from 6 volunteers were retrospectively under-sampled and three reconstruction strategies were evaluated: k-space subtraction CS, independent CS, and magnitude subtraction CS. The techniques were compared in image quality (vessel delineation, image artifacts, and noise) and image reconstruction error. Our CS technique was further tested on 7 volunteers using a prospectively under-sampled CE-MRA sequence. Results Compared with k-space subtraction and independent CS, our magnitude subtraction CS provides significantly better vessel delineation and less noise at 4X acceleration, and significantly less reconstruction error at 4X and 8X (pMRA with higher spatial and temporal resolution than current clinical TWIST protocol while maintaining comparable image quality (2.8±0.5 vs. 3.0±0.4, p=NS). Conclusion Our technique is promising for dynamic CE-MRA. PMID:23801456

  19. Comparison of vessel enhancement algorithms applied to time-of-flight MRA images for cerebrovascular segmentation.

    Science.gov (United States)

    Phellan, Renzo; Forkert, Nils D

    2017-11-01

    Vessel enhancement algorithms are often used as a preprocessing step for vessel segmentation in medical images to improve the overall segmentation accuracy. Each algorithm uses different characteristics to enhance vessels, such that the most suitable algorithm may vary for different applications. This paper presents a comparative analysis of the accuracy gains in vessel segmentation generated by the use of nine vessel enhancement algorithms: Multiscale vesselness using the formulas described by Erdt (MSE), Frangi (MSF), and Sato (MSS), optimally oriented flux (OOF), ranking orientations responses path operator (RORPO), the regularized Perona-Malik approach (RPM), vessel enhanced diffusion (VED), hybrid diffusion with continuous switch (HDCS), and the white top hat algorithm (WTH). The filters were evaluated and compared based on time-of-flight MRA datasets and corresponding manual segmentations from 5 healthy subjects and 10 patients with an arteriovenous malformation. Additionally, five synthetic angiographic datasets with corresponding ground truth segmentation were generated with three different noise levels (low, medium, and high) and also used for comparison. The parameters for each algorithm and subsequent segmentation were optimized using leave-one-out cross evaluation. The Dice coefficient, Matthews correlation coefficient, area under the ROC curve, number of connected components, and true positives were used for comparison. The results of this study suggest that vessel enhancement algorithms do not always lead to more accurate segmentation results compared to segmenting nonenhanced images directly. Multiscale vesselness algorithms, such as MSE, MSF, and MSS proved to be robust to noise, while diffusion-based filters, such as RPM, VED, and HDCS ranked in the top of the list in scenarios with medium or no noise. Filters that assume tubular-shapes, such as MSE, MSF, MSS, OOF, RORPO, and VED show a decrease in accuracy when considering patients with an AVM

  20. Transcranial Doppler, MRA, and MRI as a screening examination for cerebrovascular disease in patients with sickle cell anemia: an 8-year study

    International Nuclear Information System (INIS)

    Seibert, J.J.; Glasier, C.M.; Allison, J.W.; James, C.A.; Kinder, D.L.; Cox, K.S.; Lairry, F.; Graves, R.A.; Becton, D.L.; Jackson, F.J.

    1998-01-01

    Objective. The authors previously reported five transcranial Doppler ultrasonography (TCD) findings as significant in detecting clinical cerebrovascular disease in a 4-year study in patients with sickle cell disease. This is a follow-up to evaluate the validity of the original findings over another 4-year period during which the study population doubled. A clinical follow-up of the original asymptomatic sickle cell patients with positive TCD, MRA, and MRI was also made. Results. Of the 4 out of original 46 control patients in 1992 who had positive MRA and TCD, 3 have subsequently had clinical stroke. None of the 9 original patients with positive TCD and positive MRI but negative MRA have developed stroke. All five original TCD indicators of disease were still significant (P 35 cm/s, mean velocity in middle cerebral artery (MCA) >170 cm/s, resistive index (RI) in OA 200 cm/s. (orig.)

  1. Sliding interleaved kY (SLINKY) acquisition: a novel 3D MRA technique with suppressed slab boundary artifact.

    Science.gov (United States)

    Liu, K; Rutt, B K

    1998-01-01

    This work addresses the elimination of the slab boundary artifact (SBA) or venetian blind artifact in three-dimensional multiple overlapped thin slab acquisition (3D MOTSA) for magnetic resonance angiography (MRA). Our method uses a sliding-slab, interleaved kY (SLINKY) data acquisition strategy, equalizing flow-related signal intensity weighting across the entire slab dimension. This technique demodulates signal intensity changes along the slab direction and can essentially eliminate the SBA while retaining the same or better imaging time efficiency than that of conventional MOTSA, providing robustness to complicated flow patterns and thereby resulting in more accurate depiction of vascular morphology. In addition, this technique does not need specialized reconstruction and extra computation. The unique penalty of this technique is the sensitivity to phase inconsistency in the data. Both phantom and in vivo experiments verify the clinical significance of the technique. The new MRA images acquired with this imaging technique show highly reliable mapping of vascular morphology without the SBA and reduction of signal voids in complex/slow flow regions.

  2. Automatic 3D Segmentation and Quantification of Lenticulostriate Arteries from High-Resolution 7 Tesla MRA Images.

    Science.gov (United States)

    Wei Liao; Rohr, Karl; Chang-Ki Kang; Zang-Hee Cho; Worz, Stefan

    2016-01-01

    We propose a novel hybrid approach for automatic 3D segmentation and quantification of high-resolution 7 Tesla magnetic resonance angiography (MRA) images of the human cerebral vasculature. Our approach consists of two main steps. First, a 3D model-based approach is used to segment and quantify thick vessels and most parts of thin vessels. Second, remaining vessel gaps of the first step in low-contrast and noisy regions are completed using a 3D minimal path approach, which exploits directional information. We present two novel minimal path approaches. The first is an explicit approach based on energy minimization using probabilistic sampling, and the second is an implicit approach based on fast marching with anisotropic directional prior. We conducted an extensive evaluation with over 2300 3D synthetic images and 40 real 3D 7 Tesla MRA images. Quantitative and qualitative evaluation shows that our approach achieves superior results compared with a previous minimal path approach. Furthermore, our approach was successfully used in two clinical studies on stroke and vascular dementia.

  3. Non-contrast-enhanced 3D volumetric time-resolved MRA combining PCASL for intracranial vessels. President award proceedings

    International Nuclear Information System (INIS)

    Nakamura, Masanobu; Yoneyama, Masami; Tabuchi, Takashi; Tatsuno, Satoshi; Takemura, Atsushi; Obara, Makoto; Takahara, Taro

    2013-01-01

    Hemodynamic information is required for accurate diagnosis, effective treatment, and follow-up examination of numerous cerebrovascular diseases. A recently introduced technique for non-contrast 3-dimensional (3D) volumetric time-resolved magnetic resonance angiography (MRA)-contrast inherent inflow enhanced multi phase angiography (CINEMA)-provides useful qualitative information on the morphologic and dynamic filling of intracranial vessels and requires no catheter insertion or contrast agent. We propose combining CINEMA with pseudo-continuous arterial spin labeling (PCASL). We present a preliminary study of non-contrast time-resolved MRA with time-of-arrival map and discuss its clinical relevance. Studies in all volunteers and patients clearly depicted major intracranial vessels. In patients, CINEMA-PCASL demonstrated the nidus, feeding arteries, and right posterior cerebral artery, and subsequent draining into the superficial venous system was clearly observed with a temporal resolution of 200 ms. Time-of-arrival maps presented the different filling time of every segment vessel in a single colorful image. The expected pattern of delayed transit to more distal vessels is apparent as well as the earlier arrival in central portions of larger vessels. This preliminary study demonstrated the usefulness of the CINEMA-PCASL technique in evaluating the cerebral vasculature. Simultaneous acquisition of high quality temporal and spatial resolutions obviated the need for contrast agent. (author)

  4. Exact monitoring of aortic diameters in Marfan patients without gadolinium contrast: intraindividual comparison of 2D SSFP imaging with 3D CE-MRA and echocardiography

    International Nuclear Information System (INIS)

    Veldhoen, Simon; Behzadi, Cyrus; Derlin, Thorsten; Henes, Frank Oliver; Adam, Gerhard; Bannas, Peter; Rybczinsky, Meike; Kodolitsch, Yskert von; Sheikhzadeh, Sara; Bley, Thorsten Alexander

    2015-01-01

    To assess whether ECG-gated non-contrast 2D steady-state free precession (SSFP) imaging allows for exact monitoring of aortic diameters in Marfan syndrome (MFS) patients using non-ECG-gated contrast-enhanced 3D magnetic resonance angiography (CE-MRA) and echocardiography for intraindividual comparison. Non-ECG-gated CE-MRA and ECG-gated non-contrast SSFP at 1.5 T were prospectively performed in 50 patients. Two readers measured aortic diameters on para-sagittal images identically aligned with the aortic arch at the sinuses of Valsalva, sinotubular junction, ascending/descending aorta and aortic arch. Image quality was assessed on a three-point scale. Aortic root diameters acquired by echocardiography were used as reference. Intra- and interobserver variances were smaller for SSFP at the sinuses of Valsalva (p = 0.002; p = 0.002) and sinotubular junction (p = 0.014; p = 0.043). Image quality was better in SSFP than in CE-MRA at the sinuses of Valsalva (p < 0.0001), sinotubular junction (p < 0.0001) and ascending aorta (p = 0.02). CE-MRA yielded higher diameters than SSFP at the sinuses of Valsalva (mean bias, 2.5 mm; p < 0.0001), and comparison with echocardiography confirmed a higher bias for CE-MRA (7.2 ± 3.4 mm vs. SSFP, 4.7 ± 2.6 mm). ECG-gated non-contrast 2D SSFP imaging provides superior image quality with higher validity compared to non-ECG-gated contrast-enhanced 3D imaging. Since CE-MRA requires contrast agents with potential adverse effects, non-contrast SSFP imaging is an appropriate alternative for exact and riskless aortic monitoring of MFS patients. (orig.)

  5. Exact monitoring of aortic diameters in Marfan patients without gadolinium contrast: intraindividual comparison of 2D SSFP imaging with 3D CE-MRA and echocardiography

    Energy Technology Data Exchange (ETDEWEB)

    Veldhoen, Simon [University Medical Center Wuerzburg, Department of Diagnostic and Interventional Radiology, Bavaria (Germany); University Medical Center Hamburg-Eppendorf, Department of Diagnostic and Interventional Radiology, Hamburg (Germany); Behzadi, Cyrus; Derlin, Thorsten; Henes, Frank Oliver; Adam, Gerhard; Bannas, Peter [University Medical Center Hamburg-Eppendorf, Department of Diagnostic and Interventional Radiology, Hamburg (Germany); Rybczinsky, Meike; Kodolitsch, Yskert von; Sheikhzadeh, Sara [University Medical Center Hamburg-Eppendorf, Department of General and Interventional Cardiology, Hamburg (Germany); Bley, Thorsten Alexander [University Medical Center Wuerzburg, Department of Diagnostic and Interventional Radiology, Bavaria (Germany)

    2014-10-15

    To assess whether ECG-gated non-contrast 2D steady-state free precession (SSFP) imaging allows for exact monitoring of aortic diameters in Marfan syndrome (MFS) patients using non-ECG-gated contrast-enhanced 3D magnetic resonance angiography (CE-MRA) and echocardiography for intraindividual comparison. Non-ECG-gated CE-MRA and ECG-gated non-contrast SSFP at 1.5 T were prospectively performed in 50 patients. Two readers measured aortic diameters on para-sagittal images identically aligned with the aortic arch at the sinuses of Valsalva, sinotubular junction, ascending/descending aorta and aortic arch. Image quality was assessed on a three-point scale. Aortic root diameters acquired by echocardiography were used as reference. Intra- and interobserver variances were smaller for SSFP at the sinuses of Valsalva (p = 0.002; p = 0.002) and sinotubular junction (p = 0.014; p = 0.043). Image quality was better in SSFP than in CE-MRA at the sinuses of Valsalva (p < 0.0001), sinotubular junction (p < 0.0001) and ascending aorta (p = 0.02). CE-MRA yielded higher diameters than SSFP at the sinuses of Valsalva (mean bias, 2.5 mm; p < 0.0001), and comparison with echocardiography confirmed a higher bias for CE-MRA (7.2 ± 3.4 mm vs. SSFP, 4.7 ± 2.6 mm). ECG-gated non-contrast 2D SSFP imaging provides superior image quality with higher validity compared to non-ECG-gated contrast-enhanced 3D imaging. Since CE-MRA requires contrast agents with potential adverse effects, non-contrast SSFP imaging is an appropriate alternative for exact and riskless aortic monitoring of MFS patients. (orig.)

  6. Artefacts at a glance: differentiating features of artefactual stenosis from true stenosis at the genu of the petrous internal carotid artery on TOF MRA

    International Nuclear Information System (INIS)

    Lee, S.K.; Ahn, K.J.; Jang, J.H.; Choi, H.S.; Jung, S.L.; Kim, B.S.

    2016-01-01

    Aim: To investigate the distinguishing features of artefactual stenosis from true stenosis at the genu of the petrous internal carotid artery (ICA) on time of flight (TOF) magnetic resonance angiography (MRA). Materials and methods: Both TOF MRA and digital subtraction angiography (DSA) were performed in 65 patients with 74 vessels who demonstrated artefactual stenosis in 43 patients with 50 vessels and true stenosis in 22 patients with 24 vessels. The following findings of the signal loss were compared between the two groups: (1) margin, (2) darkness, (3) the presence of bilaterality, (4) the presence of tandem arterial stenosis, (5) the location of the epicentre, and (6) length. Results: In five out of the six evaluated items, statistically significant differences were present between the two groups (p<0.00 in all five items). Artefactual stenosis more frequently showed signal loss with ill-defined margins (47/50), less darkness compared to the background darkness (46/50), the absence of tandem arterial stenosis (35/50), epicentre at the genu (34/50), and shorter length (2.57 ± 0.68 mm). No significant difference was noted in the presence of bilaterality of signal loss between the two groups (p=0.706). Conclusion: Several MRA features can be useful for suggesting artefactual stenosis rather than true stenosis at the genu of the petrous ICA on TOF MRA. - Highlights: • TOF MRA is increasingly used for the noninvasive evaluation for imaging the cerebrovascular system. • We investigated several artifacts at the genu of petrous ICA on TOF MRA to prevent misinterpretations as true stenosis. • Short segmental, ill-defined, less dark defect at the epicenter of genu without tandem stenosis is more likely an artifact.

  7. Exact monitoring of aortic diameters in Marfan patients without gadolinium contrast: intraindividual comparison of 2D SSFP imaging with 3D CE-MRA and echocardiography.

    Science.gov (United States)

    Veldhoen, Simon; Behzadi, Cyrus; Derlin, Thorsten; Rybczinsky, Meike; von Kodolitsch, Yskert; Sheikhzadeh, Sara; Henes, Frank Oliver; Bley, Thorsten Alexander; Adam, Gerhard; Bannas, Peter

    2015-03-01

    To assess whether ECG-gated non-contrast 2D steady-state free precession (SSFP) imaging allows for exact monitoring of aortic diameters in Marfan syndrome (MFS) patients using non-ECG-gated contrast-enhanced 3D magnetic resonance angiography (CE-MRA) and echocardiography for intraindividual comparison. Non-ECG-gated CE-MRA and ECG-gated non-contrast SSFP at 1.5 T were prospectively performed in 50 patients. Two readers measured aortic diameters on para-sagittal images identically aligned with the aortic arch at the sinuses of Valsalva, sinotubular junction, ascending/descending aorta and aortic arch. Image quality was assessed on a three-point scale. Aortic root diameters acquired by echocardiography were used as reference. Intra- and interobserver variances were smaller for SSFP at the sinuses of Valsalva (p = 0.002; p = 0.002) and sinotubular junction (p = 0.014; p = 0.043). Image quality was better in SSFP than in CE-MRA at the sinuses of Valsalva (p < 0.0001), sinotubular junction (p < 0.0001) and ascending aorta (p = 0.02). CE-MRA yielded higher diameters than SSFP at the sinuses of Valsalva (mean bias, 2.5 mm; p < 0.0001), and comparison with echocardiography confirmed a higher bias for CE-MRA (7.2 ± 3.4 mm vs. SSFP, 4.7 ± 2.6 mm). ECG-gated non-contrast 2D SSFP imaging provides superior image quality with higher validity compared to non-ECG-gated contrast-enhanced 3D imaging. Since CE-MRA requires contrast agents with potential adverse effects, non-contrast SSFP imaging is an appropriate alternative for exact and riskless aortic monitoring of MFS patients.

  8. View-sharing in keyhole imaging: Partially compressed central k-space acquisition in time-resolved MRA at 3.0 T

    Energy Technology Data Exchange (ETDEWEB)

    Hadizadeh, Dariusch R., E-mail: Dariusch.Hadizadeh@ukb.uni-bonn.de [University of Bonn, Department of Radiology, Sigmund-Freud-Strasse 25, 53127 Bonn (Germany); Gieseke, Juergen [University of Bonn, Department of Radiology, Sigmund-Freud-Strasse 25, 53127 Bonn (Germany); Philips Healthcare, Best (Netherlands); Beck, Gabriele; Geerts, Liesbeth [Philips Healthcare, Best (Netherlands); Kukuk, Guido M. [University of Bonn, Department of Radiology, Sigmund-Freud-Strasse 25, 53127 Bonn (Germany); Bostroem, Azize [Department of Neurosurgery, Sigmund-Freud-Strasse 25, 53127 Bonn, Deutschland (Germany); Urbach, Horst; Schild, Hans H.; Willinek, Winfried A. [University of Bonn, Department of Radiology, Sigmund-Freud-Strasse 25, 53127 Bonn (Germany)

    2011-11-15

    Introduction: Time-resolved contrast-enhanced magnetic resonance (MR) angiography (CEMRA) of the intracranial vasculature has proved its clinical value for the evaluation of cerebral vascular disease in cases where both flow hemodynamics and morphology are important. The purpose of this study was to evaluate a combination of view-sharing with keyhole imaging to increase spatial and temporal resolution of time-resolved CEMRA at 3.0 T. Methods: Alternating view-sharing was combined with randomly segmented k-space ordering, keyhole imaging, partial Fourier and parallel imaging (4DkvsMRA). 4DkvsMRA was evaluated using varying compression factors (80-100) resulting in spatial resolutions ranging from (1.1 x 1.1 x 1.4) to (0.96 x 0.96 x 0.95) mm{sup 3} and temporal resolutions ranging from 586 ms/dynamic scan - 288 ms/dynamic scan in three protocols in 10 healthy volunteers and seven patients (17 subjects). DSA correlation was available in four patients with cerebral arteriovenous malformations (cAVMs) and one patient with cerebral teleangiectasia. Results: 4DkvsMRA was successfully performed in all subjects and showed clear depiction of arterial and venous phases with diagnostic image quality. At the maximum view-sharing compression factor (=100), a 'flickering' artefact was observed. Conclusion: View-sharing in keyhole imaging allows for increased spatial and temporal resolution in time-resolved MRA.

  9. View-sharing in keyhole imaging: Partially compressed central k-space acquisition in time-resolved MRA at 3.0 T

    International Nuclear Information System (INIS)

    Hadizadeh, Dariusch R.; Gieseke, Juergen; Beck, Gabriele; Geerts, Liesbeth; Kukuk, Guido M.; Bostroem, Azize; Urbach, Horst; Schild, Hans H.; Willinek, Winfried A.

    2011-01-01

    Introduction: Time-resolved contrast-enhanced magnetic resonance (MR) angiography (CEMRA) of the intracranial vasculature has proved its clinical value for the evaluation of cerebral vascular disease in cases where both flow hemodynamics and morphology are important. The purpose of this study was to evaluate a combination of view-sharing with keyhole imaging to increase spatial and temporal resolution of time-resolved CEMRA at 3.0 T. Methods: Alternating view-sharing was combined with randomly segmented k-space ordering, keyhole imaging, partial Fourier and parallel imaging (4DkvsMRA). 4DkvsMRA was evaluated using varying compression factors (80-100) resulting in spatial resolutions ranging from (1.1 x 1.1 x 1.4) to (0.96 x 0.96 x 0.95) mm 3 and temporal resolutions ranging from 586 ms/dynamic scan - 288 ms/dynamic scan in three protocols in 10 healthy volunteers and seven patients (17 subjects). DSA correlation was available in four patients with cerebral arteriovenous malformations (cAVMs) and one patient with cerebral teleangiectasia. Results: 4DkvsMRA was successfully performed in all subjects and showed clear depiction of arterial and venous phases with diagnostic image quality. At the maximum view-sharing compression factor (=100), a 'flickering' artefact was observed. Conclusion: View-sharing in keyhole imaging allows for increased spatial and temporal resolution in time-resolved MRA.

  10. Direct comparison of sensitivity encoding (SENSE) accelerated and conventional 3D contrast enhanced magnetic resonance angiography (CE-MRA) of renal arteries: effect of increasing spatial resolution.

    Science.gov (United States)

    Muthupillai, R; Douglas, E; Huber, S; Lambert, B; Pereyra, M; Wilson, G J; Flamm, S D

    2010-01-01

    To assess the effect of attaining higher spatial resolution in contrast-enhanced magnetic resonance angiography (MRA) of renal arteries using parallel imaging, sensitivity encoding (SENSE), by comparing the SENSE contrast-enhanced (CE) MRA against a conventional CE-MRA protocol with identical scan times, injection protocol, and other acquisition parameters. Numerical simulations and a direct comparison of SENSE-accelerated versus conventional acquisitions were performed. A total of 41 patients (18 male) were imaged using both protocols for a direct comparison. Both protocols used fluoroscopic triggering, centric encoding, breath-holding, equivalent injection protocol, and lasted approximately 30 seconds. Simulated point-spread functions were narrower for the SENSE protocol compared to the conventional protocol. In the patient study, although the SENSE protocol produced images with lower signal-to-noise ratio (SNR), image quality was better for all segments of the renal arteries. In addition, ringing of kidney parenchyma and renal artery blurring were significantly reduced in the SENSE protocol. Finally, reader confidence improved with the SENSE protocol. Despite a reduction in SNR, the higher-resolution SENSE CE-MRA provided improved image quality, reduced artifacts, and increased reader confidence compared to the conventional protocol. (c) 2009 Wiley-Liss, Inc.

  11. A systematic review and meta-analysis of diagnostic test of MRA versus MRI for detection superior labrum anterior to posterior lesions type II-VII

    International Nuclear Information System (INIS)

    Arirachakaran, Alisara; Pituckanotai, Kwanchai; Boonard, Manusak; Chaijenkij, Kornkit; Prommahachai, Akom; Kongtharvonskul, Jatupon

    2017-01-01

    To determine the diagnostic performance of magnetic resonance arthrography (MRA) and magnetic resonance imaging (MRI) in superior labrum anterior to posterior lesions (type II-VII) of the shoulder. PubMed and Scopus search engines, an electronic search of articles was performed from inception to February 19, 2016. Diagnostic performance of index tests was compared by the summary area under receiver operator characteristic curve (AUROC). In all, 117 of 493 studies were eligible and 32 studies (2,013 shoulders) and 11 studies (1,498 shoulders) were evaluated with MRA and MRI. The summary sensitivity, specificity, likelihood ratio (positive and negative) and AUROC were 0.87 (95 % confidence interval, CI: 0.82, 0.91), 0.92 (95 %CI: 0.85, 0.95), 10.28 (95 %CI: 5.84, 18.08), 0.14 (95 %CI: 0.10, 0.20) and 0.94 (95 %CI: 0.92, 0.96) respectively for MRA, and 0.76 (95 %CI: 0.61, 0.86), 0.87 (95 %CI: 0.71, 0.95), 5.89 (95 %CI: 2.5, 13.86), 0.28 (95 %CI: 0.17, 0.47) and 0.94 (95 %CI: 0.92, 0.96) respectively for MRI. The diagnostic performance of MRA was superior to MRI by both direct and indirect comparisons for the detection of SLAP lesions. (orig.)

  12. A systematic review and meta-analysis of diagnostic test of MRA versus MRI for detection superior labrum anterior to posterior lesions type II-VII

    Energy Technology Data Exchange (ETDEWEB)

    Arirachakaran, Alisara; Pituckanotai, Kwanchai [Police General Hospital, Orthopedics Department, Bangkok (Thailand); Boonard, Manusak [Khon Kean University, Department of Orthopaedics, Faculty of Medicine, Khonkaen (Thailand); Chaijenkij, Kornkit [Mahidol University, Orthopedics Department, College of Sports Science and Technology, Bangkok (Thailand); Prommahachai, Akom [Udon Thani Hospital, Orthopedic Department, Udonthani (Thailand); Kongtharvonskul, Jatupon [Faculty of Medicine Ramathibodi Hospital, Section for Clinical Epidemiology and Biostatistics, Bangkok (Thailand)

    2017-02-15

    To determine the diagnostic performance of magnetic resonance arthrography (MRA) and magnetic resonance imaging (MRI) in superior labrum anterior to posterior lesions (type II-VII) of the shoulder. PubMed and Scopus search engines, an electronic search of articles was performed from inception to February 19, 2016. Diagnostic performance of index tests was compared by the summary area under receiver operator characteristic curve (AUROC). In all, 117 of 493 studies were eligible and 32 studies (2,013 shoulders) and 11 studies (1,498 shoulders) were evaluated with MRA and MRI. The summary sensitivity, specificity, likelihood ratio (positive and negative) and AUROC were 0.87 (95 % confidence interval, CI: 0.82, 0.91), 0.92 (95 %CI: 0.85, 0.95), 10.28 (95 %CI: 5.84, 18.08), 0.14 (95 %CI: 0.10, 0.20) and 0.94 (95 %CI: 0.92, 0.96) respectively for MRA, and 0.76 (95 %CI: 0.61, 0.86), 0.87 (95 %CI: 0.71, 0.95), 5.89 (95 %CI: 2.5, 13.86), 0.28 (95 %CI: 0.17, 0.47) and 0.94 (95 %CI: 0.92, 0.96) respectively for MRI. The diagnostic performance of MRA was superior to MRI by both direct and indirect comparisons for the detection of SLAP lesions. (orig.)

  13. "Front" hotshet izvinitsja / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2003-01-01

    Põhiliselt vene rahvusest noori ühendava liikumise "Front" esindajad kavatsevad kohtuda USA suursaadikuga Eestis ja vabandada kevadel suursaatkonna ees vägivallatsemisega lõppenud meeleavalduse pärast

  14. Staraja doroga : [luuletused] / Aleksandr Mezhirov

    Index Scriptorium Estoniae

    Mezhirov, Aleksandr

    2001-01-01

    Sisu: Alter ego ; "Tshto mne delat v "Strele"..." ; "V 41-m, v lessah Pervojanu..." ; Za kogo? Za togo li... ; "Ne zabõvai menja, Moskva moja..." ; "Jesli bõ Zoja i Anna..." ; "Vospominanjami ne mutshai..." ; "Mozhet rodina sõna obidet..." ; Nabokov

  15. Topit - ne stroit / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2005-01-01

    Ilmunud ka: Narvskaja Gazeta 3. september lk. 8. Kaitseministeeriumi ja kahe laevaremondiga tegeleva erafirma SRC Laevaremont OÜ ja OÜ BLRT Laevaremont segastest suhetest ja asjaajamistest miinilaeva "Sulev" remonditööde läbiviimisel ning arvete tasumisel

  16. Globanizatsija v miniature / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2002-01-01

    St. Peterburgi 3000. a. ja Kaasani 1000. a. pühendatud rahvusvaheline konverents tõi meile erinevatest rahvustest, erinevate poliitiliste vaadetega inimesi erinevatest riikidest. Konverents "Suur Volga tee"

  17. Velikaja malenkaja strana / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2007-01-01

    Eestit külastas Luksemburgi peaminister Jean Claude Junker. Kohtumisel Eesti peaministri Andrus Ansipiga rõhutati kahe riigi häid suhteid ja koostööd. Jean Claude Junker avaldas lootust, et Eesti liitub eurotsooniga ja ei usu, et Eesti valitsuse otsusele mitte lubada Nord Streamil merepõhja uurida järgneks Euroopa Liidus negatiivseid sanktsioone

  18. "Shmatritsa" piterskogo Goblina / Aleksandr Lukjanov

    Index Scriptorium Estoniae

    Lukjanov, Aleksandr

    2003-01-01

    Peterburi tõlk Dmitri Putshkov on saanud tuntuks omalaadsete tõlkeparoodiatega : tuntud ameerika filmile tehakse oma tõlge-paroodia ja lisatakse vastav muusika. Selliselt töödelduna on saanud kultusfilmist "Matrix" "Shmatritsa". Nende filmide vaatajaskond on organiseerunud "Õige Tõlke Huviliste Klubiks"

  19. Detection of cerebrovascular disease in patients with sickle cell disease using transcranial Doppler sonography: correlation with MRI, MRA and conventional angiography

    International Nuclear Information System (INIS)

    Verlhac, S.; Bernaudin, F.; Tortrat, D.; Brugieres, P.; Mage, K.; Gaston, A.; Reinert, P.

    1995-01-01

    A prospective study of 58 patients with sickle cell disease (SCD) by transcranial Doppler sonography (TCD) included both MRI and MRA in patients over 7 years of age and those with abnormal TCD. Arteriography was performed in cases where a stenosis was suspected on TCD. Middle cerebral artery (MCA) and basilar artery (BA) velocities were significantly higher in the sickle cell hemoglobin SS group than in the hemoglobin SC group. Patients with a MCA mean velocity of over 1.90 m/s had stenoses found by arteriography. Patients with unilaterally undetectable MCA flow had experienced a stroke and MCA thrombosis was confirmed at MRA and arteriography. We concluded that TCD is valuable in detecting arterial stenosis in SCD and will lead to consideration of these patients for intensive therapy, such as bone marrow transplantation (BMT) or transfusion regimes. (orig.)

  20. A Proposal of a Mass Appraisal System in Greece with CAMA System: Evaluating GWR and MRA techniques in Thessaloniki Municipality

    Science.gov (United States)

    Dimopoulos, Thomas; Moulas, Alexandros

    2017-01-01

    Property tax in Greece is levied since 1985 not on Market Values but on the "objective value" of the properties as it is defined by the Ministry of Economics. It forms a non-flexible system, with market-irrelevant and unrealistic values, inducing land-policy practices and potential political cost to each periodical update. Furthermore, instead of adjusting taxation levels to the current economic reality, the real estate market is experiencing further burdening through approximately 40 different property taxes and levies, leading to further shrinking and depreciation. The authors believe that a fairer taxation system could significantly assist the property sector in Greece. Thus, through this paper and by studying and analyzing best practices from other countries, they propose models that can be applied with the use of existing data in Greece. This work aims to identify the critical parameters that affecting property values in Thessaloniki to create a Market Value forecasting tool for a fairer taxation system, to highlight the importance of a GIS system for this purpose and to compare the results of MRA with the use of SPSS with those of GWR in ArcGIS environment. For the purposes of this study, the Municipality of Thessaloniki was chosen due to its very well organized portal with significant and well organized geographical data and because authors manage to access some data from the Central Bank of Greece, regarding property valuations.

  1. A Proposal of a Mass Appraisal System in Greece with CAMA System: Evaluating GWR and MRA techniques in Thessaloniki Municipality

    Directory of Open Access Journals (Sweden)

    Dimopoulos Thomas

    2016-01-01

    Full Text Available Property tax in Greece is levied since 1985 not on Market Values but on the “objective value” of the properties as it is defined by the Ministry of Economics. It forms a non-flexible system, with market-irrelevant and unrealistic values, inducing land-policy practices and potential political cost to each periodical update. Furthermore, instead of adjusting taxation levels to the current economic reality, the real estate market is experiencing further burdening through approximately 40 different property taxes and levies, leading to further shrinking and depreciation. The authors believe that a fairer taxation system could significantly assist the property sector in Greece. Thus, through this paper and by studying and analyzing best practices from other countries, they propose models that can be applied with the use of existing data in Greece. This work aims to identify the critical parameters that affecting property values in Thessaloniki to create a Market Value forecasting tool for a fairer taxation system, to highlight the importance of a GIS system for this purpose and to compare the results of MRA with the use of SPSS with those of GWR in ArcGIS environment. For the purposes of this study, the Municipality of Thessaloniki was chosen due to its very well organized portal with significant and well organized geographical data and because authors manage to access some data from the Central Bank of Greece, regarding property valuations.

  2. Comparison of ultrafast-CT, MRA, and angiography for detection of coronary artery bypass graft patency; Vergleich von ultraschneller Computertomographie, Magnetresonanzangiographie und selektiver Angiographie zum Nachweis der Durchgaengigkeit koronarer Bypasses

    Energy Technology Data Exchange (ETDEWEB)

    Smekal, A. von [Inst. fuer Radiologische Diagnostik, Klinikum Grosshadern, Muenchen Univ. (Germany); Knez, A. [Medizinische Klinik 1, Klinikum Grosshadern, Muenchen Univ. (Germany); Seelos, K.C. [Inst. fuer Radiologische Diagnostik, Klinikum Grosshadern, Muenchen Univ. (Germany); Haberl, R. [Medizinische Klinik 1, Klinikum Grosshadern, Muenchen Univ. (Germany); Spiegl, F. [Inst. fuer Radiologische Diagnostik, Klinikum Grosshadern, Muenchen Univ. (Germany); Reichart, B. [Herzchirurgische Klinik, Klinikum Grosshadern, Muenchen Univ. (Germany); Steinbeck, G. [Medizinische Klinik 1, Klinikum Grosshadern, Muenchen Univ. (Germany); Reiser, M. [Inst. fuer Radiologische Diagnostik, Klinikum Grosshadern, Muenchen Univ. (Germany)

    1997-03-01

    Purpose: Validation of ultrafast-CT and MR-angiography (MRA) in comparison with angiography for detection of early postsurgical arterial and venous coronary artery bypass graft (CABG) patency. Methods: 21 patients with a total of 55 CABG (34 venous and 21 arterial) were studied with angiography, ultrafast-CT (EBT), and MRA. Results: With EBT, patency of 43/45 angiographically patent CABG could be correctly assessed (sensitivity: 96%). With MRA 26 CABG (17 venous and 9 arterial) were identified as patent (sensitivity: 67%). It was not possible to quantify proximal stenosis of three grafts (>40%) and to evaluate the distal bypass anastomosis with both EBT and MRA. Conclusions: Ultrafast-CT is a promising minimal invasive screening method for the evaluation of venous and arterial CABG patency. The diagnostic significance of MRA is remarkably reduced. (orig.) [Deutsch] Ziel: Validierung von ultraschneller Computertomographie und Magnetresonanzangiographie im Vergleich zur selektiven Angiographie fuer die fruehe postoperative Beurteilung der Durchgaengigkeit venoeser und arterieller koronarer Bypasses. Methoden: Vergleichend mit der Angiographie wurden 21 Patienten mit insgesamt 55 Bypasses (34 venoese, 21 arterielle) mittels ultraschneller Computertomographie (Electron Beam Tomography=EBT) und Magnetresonanzangiographie (MRT) untersucht. Ergebnisse: Mit EBT konnten 43 von 45 angiographisch offenen Bypasses korrekt als durchgaengig nachgewiesen werden (Sensitivitaet 96%). Durch MRA wurden 26 von 39 offenen Bypasses (17 venoes und 9 arteriell) eindeutig als durchgaengig beurteilt. Dies entspricht einer Sensitivitaet von 67%. Proximale Stenosen (>40%) von drei Bypasses konnten weder mit EBT noch durch MRA quantifiziert werden. Eine Beurteilung der Insertionsstelle der Bypasses auf das Nativgefaess war mit beiden Verfahren nicht moeglich. Schlussfolgerung: Die ultraschnelle Computertomographie ist ein vielversprechendes, wenig belastendes Screeningverfahren fuer die

  3. Time-resolved magnetic resonance angiography (MRA) at 3.0 Tesla for evaluation of hemodynamic characteristics of vascular malformations: description of distinct subgroups.

    Science.gov (United States)

    Hammer, Simone; Uller, Wibke; Manger, Florentine; Fellner, Claudia; Zeman, Florian; Wohlgemuth, Walter A

    2017-01-01

    Quantitative evaluation of hemodynamic characteristics of arteriovenous and venous malformations using time-resolved magnetic resonance angiography (MRA) at 3.0 Tesla. Time-resolved MRA with interleaved stochastic trajectories (TWIST) at 3.0 Tesla was studied in 83 consecutive patients with venous malformations (VM) and arteriovenous malformations (AVM). Enhancement characteristics were calculated as percentage increase of signal intensity above baseline over time. Maximum percentage signal intensity increase (signal max ), time intervals between onset of arterial enhancement and lesion enhancement (t onset ), and time intervals between beginning of lesion enhancement and maximum percentage of lesion enhancement (t max ) were analyzed. All AVMs showed a high-flow hemodynamic pattern. Two significantly different (p Tesla provides hemodynamic characterization of vascular malformations. VMs can be subclassified into two hemodynamic subgroups due to presence or absence of AVFs. • Time-resolved MRA at 3.0 Tesla provides quantitative hemodynamic characterization of vascular malformations. • Malformations significantly differ in time courses of enhancement and signal intensity increase. • AVMs show a distinctive high-flow hemodynamic pattern. • Two significantly different types of VMs emerged: VMs with and without AVFs.

  4. Time-resolved magnetic resonance angiography (MRA) at 3.0 Tesla for evaluation of hemodynamic characteristics of vascular malformations: description of distinct subgroups

    Energy Technology Data Exchange (ETDEWEB)

    Hammer, Simone; Fellner, Claudia; Wohlgemuth, Walter A. [University Hospital Regensburg, Department of Radiology, Regensburg (Germany); Uller, Wibke [Boston Children' s Hospital and Harvard Medical School, Division of Vascular and Interventional Radiology, Boston, MA (United States); University Hospital Regensburg, Department of Radiology, Regensburg (Germany); Manger, Florentine [University Hospital Wuerzburg, Department of Nuclear Medicine, Wuerzburg (Germany); Zeman, Florian [University Hospital Regensburg, Center for Clinical Trials, Regensburg (Germany)

    2017-01-15

    Quantitative evaluation of hemodynamic characteristics of arteriovenous and venous malformations using time-resolved magnetic resonance angiography (MRA) at 3.0 Tesla. Time-resolved MRA with interleaved stochastic trajectories (TWIST) at 3.0 Tesla was studied in 83 consecutive patients with venous malformations (VM) and arteriovenous malformations (AVM). Enhancement characteristics were calculated as percentage increase of signal intensity above baseline over time. Maximum percentage signal intensity increase (signal{sub max}), time intervals between onset of arterial enhancement and lesion enhancement (t{sub onset}), and time intervals between beginning of lesion enhancement and maximum percentage of lesion enhancement (t{sub max}) were analyzed. All AVMs showed a high-flow hemodynamic pattern. Two significantly different (p < 0.001) types of venous malformations emerged: VMs with arteriovenous fistulas (AVF) (median signal{sub max} 737 %, IQR [interquartile range] = 511 - 1182 %; median t{sub onset} 5 s, IQR = 5 - 10 s; median t{sub max} 35 s, IQR = 26 - 40 s) and without AVFs (median signal{sub max} 284 %, IQR = 177-432 %; median t{sub onset} 23 s, IQR = 15 - 30 s; median t{sub max} 60 s, IQR = 55 - 75 s). Quantitative evaluation of time-resolved MRA at 3.0 Tesla provides hemodynamic characterization of vascular malformations. VMs can be subclassified into two hemodynamic subgroups due to presence or absence of AVFs. (orig.)

  5. The value of true-FISP sequence added to conventional gadolinium-enhanced MRA of abdominal aorta and its major branches

    Energy Technology Data Exchange (ETDEWEB)

    Iozzelli, Andrea [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: andrea.iozzelli@poste.it; D' Orta, Giovanni [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: ammos@tiscali.it; Aliprandi, Alberto [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: a.aliprandi@grupposandonato.it; Secchi, Francesco [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: francisecchi@virgilio.it; Di Leo, Giovanni [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: gianni.dileo77@virgilio.it; Sardanelli, Francesco [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: f.sardanelli@grupposandonato.it

    2009-12-15

    To test true-fast imaging with steady-state precession (true-FISP) added to gadolinium-based MR angiography (Gd-MRA) for imaging abdominal aorta and major abdominal vessels, 35 consecutive patients (age 67 {+-} 11 years) with known or suspected abdominal and/or peripheral vascular disease were studied with sagittal and axial 2D true-FISP during free breathing and coronal 3D fast low-angle shot (FLASH) Gd-MRA (breath-holding, 0.2 mmol/kg of Gd-DOTA at 2 ml/s). We evaluated: suprarenal aorta, celiac trunk, superior mesenteric artery, right renal artery, left renal artery, infrarenal aorta, inferior mesenteric artery, aortic bifurcation/common iliac arteries, lumbar arteries and aortic atheromasia. The possible presence of accessory renal arteries, collateral vasculature and vascular prosthesis/stent was evaluated. A quality four-point score was assigned to each item on both sequences, from 0 (not visible) to 3 (good-to-excellent image quality) and Wilcoxon test was used. Main diagnoses resulted: normal or atheromasic aorta (n = 25); aortic aneurysm (n = 2); patent aorto-iliac surgical prosthesis (n = 2); patent vascular iliac stent (n = 2); aneurysm of iliac artery (n = 1); patent aortic endovascular prosthesis (n = 1); patent aorto-femural bypass (n = 1) and aorto-iliac surgical prosthesis endoleak (n = 1). We also found three patients with accessory renal arteries, two with collateral circulation, and three with surgical aorto-iliac prosthesis. The score of true-FISP (25.9 {+-} 4.1, median 27) was significantly higher (p = 0.003) than that of Gd-MRA (23.9 {+-} 3.6, median 24). True-FISP was superior for visualizing inferior mesenteric artery (score 2.5 {+-} 1.1 vs. 1.0 {+-} 1.4; p < 0.001) and atheromasic plaques (2.5 {+-} 1.1 vs. 1.2 {+-} 1.1; p < 0.001). One collateral vasculature was demonstrated only with Gd-MRA. Summarizing, true-FISP is a power and fast non-breath-hold sequence to be added to Gd-MRA, obtaining an information increase.

  6. 3D Geometric Analysis of the Pediatric Aorta in 3D MRA Follow-Up Images with Application to Aortic Coarctation.

    Science.gov (United States)

    Wörz, Stefan; Schenk, Jens-Peter; Alrajab, Abdulsattar; von Tengg-Kobligk, Hendrik; Rohr, Karl; Arnold, Raoul

    2016-10-17

    Coarctation of the aorta is one of the most common congenital heart diseases. Despite different treatment opportunities, long-term outcome after surgical or interventional therapy is diverse. Serial morphologic follow-up of vessel growth is necessary, because vessel growth cannot be predicted by primer morphology or a therapeutic option. For the analysis of the long-term outcome after therapy of congenital diseases such as aortic coarctation, accurate 3D geometric analysis of the aorta from follow-up 3D medical image data such as magnetic resonance angiography (MRA) is important. However, for an objective, fast, and accurate 3D geometric analysis, an automatic approach for 3D segmentation and quantification of the aorta from pediatric images is required. We introduce a new model-based approach for the segmentation of the thoracic aorta and its main branches from follow-up pediatric 3D MRA image data. For robust segmentation of vessels even in difficult cases (e.g., neighboring structures), we propose a new extended parametric cylinder model that requires only relatively few model parameters. Moreover, we include a novel adaptive background-masking scheme used for least-squares model fitting, we use a spatial normalization scheme to align the segmentation results from follow-up examinations, and we determine relevant 3D geometric parameters of the aortic arch. We have evaluated our proposed approach using different 3D synthetic images. Moreover, we have successfully applied the approach to follow-up pediatric 3D MRA image data, we have normalized the 3D segmentation results of follow-up images of individual patients, and we have combined the results of all patients. We also present a quantitative evaluation of our approach for four follow-up 3D MRA images of a patient, which confirms that our approach yields accurate 3D segmentation results. An experimental comparison with two previous approaches demonstrates that our approach yields superior results. From the

  7. [Guiding values of facial nerve 3D-TOF-MRA and 3D-FIESTA scan for primary hemifacial spasm operation].

    Science.gov (United States)

    Wu, Guo-qing; Wang, Lei; Yin, Wei-ning; Liu, Xian-ming; Li, Chuan-feng; Wu, Guo-hong

    2013-12-03

    To explore the operative guiding values of facial nerve three-dimensional time-of-flight magnetic resonance angiography (3D-TOF-MRA) and three-dimensional fast imaging employing steady state acquisition three-dimensional fast imaging employing steady state acquisition (3D-FIESTA) scan. A total of 125 cases of primary hemifacial spasm was treated at our hospital from 2004 to 2012. Among them, 80 cases received preoperative facial nerve MRA scan. The imaging and intraoperative findings were compared to determine the responsible blood vessels. Responsible blood vessels were found in all 80 cases. Sixty patients (75%) had the involvement of single vessel of anterior inferior cerebellar artery (AICA, n = 57), posterior inferior cerebellar artery (PICA, n = 1), superior cerebellar artery (SCA, n = 1) and vertebral artery (VA, n = 1). Two or more vessels were implicated in 9 patients (11.25%). The culprits were AICA+ internal auditory artery (n = 8) and PICA+ internal auditory artery (n = 1). The source of responsible vessels of 11 cases could not be determined before surgery. Through intraoperative anatomy, 59 patients had single vessel lesions, including AICA (n = 53), PICA (n = 4), SCA (n = 1) and VA (n = 1). Among 14 cases of multiple vessels, there were AICA + internal auditory artery (n = 7), internal auditory artery + PICA (n = 2), AICA + brain stem perforating artery (n = 3) and AICA + vein (n = 2). Seven cases were uncertain. No significant statistical difference existed between two groups. Facial nerve 3D-TOF-MRA and 3D-FIESTA scan can identify the status of responsible blood vessels to guide operations.

  8. MR Angiography (MRA)

    Science.gov (United States)

    ... leg veins) or pulmonary arteriovenous malformations. look at congenital abnormalities in blood vessels, especially arteries in children (e.g., malformations in the heart or other blood vessels due to congenital heart disease). evaluate obstructions of vessels. screen individuals ...

  9. Magnetic resonance angiography (MRA)

    International Nuclear Information System (INIS)

    Arlart, I.P.; Guhl, L.

    1992-01-01

    An account is given in this paper of the physical and technical principles underlying the 'time-of-flight' technique for imaging of vessels by magnetic resonance tomography. Major indications for the new procedure of magnetic resonance angiography at present are intracerebral and extracerebral vessels, with digital subtraction angiography quite often being required to cope with minor alterations (small aneurysms, small occlusions). Magnetic resonance angiography and digital subtraction angiography are compared to each other for advantages and disadvantages. Basically, replacement of radiological angiography by magnetic resonance angiography appears to be possible only within limits, since X-ray diagnostics primarily provides morphological information about vessels, whereas flow dynamics is visualized by the 'time-of-flight' technique. (orig.) [de

  10. Use of Contrast-Enhanced MR Angiography (CE-MRA for the Diagnosis of a Vascular Ring Anomaly in a Dog

    Directory of Open Access Journals (Sweden)

    Silke Hecht

    2012-01-01

    Full Text Available A 4-month-old female mixed breed dog was presented to the University of Tennessee College of Veterinary Medicine with a history of regurgitation and cachexia. Thoracic radiographs revealed focal megaesophagus cranial to the heart base. Magnetic resonance imaging (MRI was performed. True fast imaging with steady-state precession (TrueFISP, fast low angle shot (FLASH, and short tau inversion recovery (STIR sequences were acquired prior to contrast medium administration. Contrast-enhanced magnetic resonance angiography (CE-MRA demonstrated focal megaesophagus and position of the aortic arch to the right of the esophagus. A small ductus diverticulum and an indistinct linear soft tissue band crossing the esophagus were also noted. Surgical exploration confirmed MR diagnosis of a persistent right aortic arch (PRAA with left ligamentum arteriosum. The dog improved following surgery but was unable to be transitioned to dry food. To our knowledge this is the first report describing the use of CE-MRA for preoperative diagnosis and guided surgical treatment of a vascular ring anomaly in a dog.

  11. Novel method of vulnerability assessment of simple landfills area using the multimedia, multipathway and multireceptor risk assessment (3MRA) model, China.

    Science.gov (United States)

    Yuan, Ying; He, Xiao-Song; Xi, Bei-Dou; Wei, Zi-Min; Tan, Wen-Bing; Gao, Ru-Tai

    2016-11-01

    Vulnerability assessment of simple landfills was conducted using the multimedia, multipathway and multireceptor risk assessment (3MRA) model for the first time in China. The minimum safe threshold of six contaminants (benzene, arsenic (As), cadmium (Cd), hexavalent chromium [Cr(VI)], divalent mercury [Hg(II)] and divalent nickel [Ni(II)]) in landfill and waste pile models were calculated by the 3MRA model. Furthermore, the vulnerability indexes of the six contaminants were predicted based on the model calculation. The results showed that the order of health risk vulnerability index was As > Hg(II) > Cr(VI) > benzene > Cd > Ni(II) in the landfill model, whereas the ecology risk vulnerability index was in the order of As > Hg(II) > Cr(VI) > Cd > benzene > Ni(II). In the waste pile model, the order of health risk vulnerability index was benzene > Hg(II) > Cr(VI) > As > Cd and Ni(II), whereas the ecology risk vulnerability index was in the order of Hg(II) > Cd > Cr(VI) > As > benzene > Ni(II). These results indicated that As, Hg(II) and Cr(VI) were the high risk contaminants for the case of a simple landfill in China; the concentration of these in soil and groundwater around the simple landfill should be strictly monitored, and proper mediation is also recommended for simple landfills with a high concentration of contaminants. © The Author(s) 2016.

  12. The diagnostic performance of non-contrast 3-Tesla magnetic resonance imaging (3-T MRI) versus 1.5-Tesla magnetic resonance arthrography (1.5-T MRA) in femoro-acetabular impingement

    Energy Technology Data Exchange (ETDEWEB)

    Crespo-Rodríguez, Ana M., E-mail: anacresporodriguez@gmail.com [Department of Radiology, Hospital Universitario Puerta de Hierro Majadahonda, c/ Joaquín Rodrigo 2, Majadahonda 28222, Madrid (Spain); De Lucas-Villarrubia, Jose C., E-mail: jclucasv@hotmail.com [Department of Orthopaedics and Traumatology at the Hospital Universitario Puerta de Hierro Majadahonda, c/ Joaquín Rodrigo 2, Majadahonda 28222, Madrid (Spain); Pastrana-Ledesma, Miguel, E-mail: m.pastrana@telefonica.net [Department of Radiology, Hospital Universitario Puerta de Hierro Majadahonda, c/ Joaquín Rodrigo 2, Majadahonda 28222, Madrid (Spain); Hualde-Juvera, Ana, E-mail: ana.hualdej@salud.madrid.org [Department of Radiology, Hospital Universitario Puerta de Hierro Majadahonda, c/ Joaquín Rodrigo 2, Majadahonda 28222, Madrid (Spain); Méndez-Alonso, Santiago, E-mail: smendez.sma@gmail.com [Department of Radiology, Hospital Universitario Puerta de Hierro Majadahonda, c/ Joaquín Rodrigo 2, Majadahonda 28222, Madrid (Spain); Padron, Mario, E-mail: mario.padron@clinicacemtro.com [Department of Radiology, Clínica Cemtro, Avda Ventisquero de la Condesa 42 Madrid 28035, Madrid (Spain)

    2017-03-15

    Highlights: • High resolution sequences at 3-T MRI extend accuracy in hip assessment without any need for intra-articular injection of contrast media. • As compared to 1.5-T MRA, 3-T non-contrast MRI of the hip improves the patient experience and avoids the potential risks of an invasive procedure and contrast media. • Avoiding the need for arthrographic procedures in the Radiology Department improves patient throughput and reduces costs. - Abstract: Objective: The aim of this study was to evaluate the diagnostic accuracy of 3-T non-contrast MRI versus 1.5-T MRA for assessing labrum and articular cartilage lesions in patients with clinical suspicion of femoro-acetabular impingement (FAI). Subjects and methods: Fifty patients (thirty men and twenty women, mean age 42.5 years) underwent 1.5-T MRA, 3-T MRI and arthroscopy on the same hip. An optimized high-resolution proton density spin echo pulse sequence was included in the 3-T non-contrast MRI protocol. Results: The 3-T non-contrast MRI identified forty-two of the forty-three arthroscopically proven tears at the labral-chondral transitional zone (sensitivity, 97.7%; specificity, 100%; positive predictive value (PPV), 100%; negative predictive value (NPV), 87.5%; accuracy 98%). With 1.5-T MRA, forty-four tears were diagnosed. However, there was one false positive (sensitivity, 100%; specificity, 85.7%; PPV, 97.7%; NPV, 100%; accuracy 98%). Agreement between arthroscopy and MRI, whether 3-T non-contrast MRI or 1.5-T MRA, as to the degree of chondral lesion in the acetabulum was reached in half of the patients and in the femur in 76% of patients. Conclusion: Non-invasive assessment of the hip is possible with 3-T MR magnet. 3-T non-contrast MRI could replace MRA as the workhorse technique for assessing hip internal damage. MRA would then be reserved for young adults with a strong clinical suspicion of FAI but normal findings on 3-T non-contrast MRI. When compared with 1.5-T MRA, optimized sequences with 3-T non

  13. Peripheral moving-table contrast-enhanced magnetic resonance angiography (CE-MRA) using a prototype 18-channel peripheral vascular coil and scanning parameters optimized to the patient's individual hemodynamics.

    Science.gov (United States)

    Potthast, Silke; Wilson, Gregory J; Wang, Maisie S; Maki, Jeffrey H

    2009-05-01

    To demonstrate that with a priori determination of individual patient hemodynamics, peripheral contrast-enhanced magnetic resonance angiography (pCE-MRA) can be customized to maximize signal-to noise ratio (SNR) and avoid venous enhancement. Using a 1.5T MRI scanner and prototype 18-channel peripheral vascular (PV) coil designed for highly accelerated parallel imaging, geometry (g)-factor maps were determined. SNR-maximized protocols considering the two-dimensional sensitivity encoding (2D SENSE) factor, TE, TR, bandwidth (BW), and flip angle (FA) were precalculated and stored. For each exam, a small aortic timing bolus was performed, followed by dynamic three-dimensional (3D)-MRA of the calf. Using this information, the aorta to pedal artery and calf arteriovenous transit times were measured. This enabled estimation of the maximum upper and middle station acquisition duration to allow lower station acquisition to begin prior to venous arrival. The appropriately succinct SNR-optimized protocol for each station was selected and moving-table pCE-MRA was performed using thigh venous compression and high-relaxivity contrast material. The protocol was successfully applied in 15 patients and all imaging demonstrated good SNR without diagnosis-hindering venous enhancement. By knowing each patient's venous enhancement kinetics, scan parameters can be optimized to utilize maximum possible acquisition time. Some time is added for the timing scans, but in return time-resolved calf CE-MRA, maximized SNR, and decreased risk of venous enhancement are gained.

  14. Vizit prezidenta Litvõ / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2005-01-01

    Baltimaade NATO-sse astumise esimese aastapäeva tähistamise raames viibis Eestis president Arnold Rüütli kutsel Leedu president Valdas Adamkus, kes külastas visiidi käigus Palanga Merevaigumuuseumi näitust Eesti Rahvusraamatukogus ja kohtus Kadriorus president Arnold Rüütliga

  15. Estoniju zhdut v Shengenskoi zone / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2006-01-01

    Euroopa Komisjoni asepresident Franco Frattini külastas Eestit ja kohtus siseminister Kalle Laanetiga, kus põhitähelepanu koondus Schengeni infosüsteemi teise põlvkonna (SIS II) arendamisega seotud probleemidele. Siseministeeriumis peetud ettekandes rääkis Frattini ka ülemaailmsest kuritegevusest ja terrorismiohust. Tema kinnitusel ei saa Eesti ja Venemaa vahel puuduv piirileping takistuseks Eesti liitumisele Schengeni õigusruumiga ning Euroopa Liit üritab ühtlasi veenda Venemaad lepet sõlmima

  16. Mobilnik - drug tshekista / Aleksandr Tshaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2008-01-01

    Autor kirjutab jõustruktuuride viimasel ajal hoogustunud kõrgendatud huvist ühiskonnategelaste ja ajakirjanike vastu. Artiklis on vahendatud ka Riigikogu Rahvaliidu fraktsiooni esimehe Karel Rüütli arvamust

  17. Partii ishtshut anti-Rjuitelja / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2006-01-01

    Res Publica, Isamaaliit, SDE ja Reformierakond kavatsevad esitada ühise presidendikandidaadi, üks võimalikke kandidaate on Tartu Ülikooli rektor Jaak Aaviksoo. Nimetatud parteidel on Riigikogus 65 kohta, presidendi valimiseks on vaja aga 68 parlamendiliikme häält

  18. Nastojashtshih hristjan nelzja prinudit / Aleksandr Men

    Index Scriptorium Estoniae

    Men, Aleksandr

    2001-01-01

    Osa Aleksander Men'i poolt ettevalmistatud Piibli-teemalisest sõnastikust : m ja n täht : vabamüürlus ja Piibel, Dmitri Merezkovski, Methodios, mormoonide Piibli-tõlgendus, Nikolai Morozov, mittekristlikud tunnistused Kristusest

  19. Datskaja svadba Aleksandra Bashirova / Aleksandr Bashirov

    Index Scriptorium Estoniae

    Bashirov, Aleksandr

    2003-01-01

    Vene režissöör räägib oma eelseisvast ühistööst Lars von Trieriga, mille tulemuseks peaks saama Vene-Taani ühisfilm "Armastus pole müüdav", kus stsenarist ja režissöör on Bashirov, produtsent aga von Trier

  20. Biznes-klass Andreja Zhilkina / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2007-01-01

    OÜ K. Trans Pluss direktor Andrei Zhilkin firma algusaastatest, murrangust firma arengus ja praegusest tegevusest, transiitkaubanduse tähtsusest Eestile ning raudteetranspordi eelistest. Vt. samas lühiintervjuud Andrei Zhilkiniga. Lisa

  1. Nasledniki SSSR : druzja ili vragi? / Aleksandr Vassiljev

    Index Scriptorium Estoniae

    Vassiljev, Aleksandr

    2007-01-01

    Autori arvates ei saa eitada ajaloolist fakti Nõukogude Liidu olemasolust, kuid see ei tohi takistada riikide edasist arengut. 27. veebruaril toimub Riias konverents "Nõukogude Liidu pärand: milles seisneb Venemaa ja teiste riikide õigusjärgsus?"

  2. Propaganda i kontrpropaganda / Aleksandr Tshaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2007-01-01

    Europarlamendis esines Öise Vahtkonna liige Juri Zhuravljov informatsiooniga väidetavast politsei vägivallast pronksööl. Riigikogu eurokomisjoni esimees Marko Mihkelson on väitnud, et ürituse organisaatoriks on Läti eurosaadik Tatjana Zhdanok. Europarlamendi liikme Katrin Saksa väiteid

  3. "Vozvrashtshenije domoi" / Irina Stelmach ; interv. Aleksandr Lukjanov

    Index Scriptorium Estoniae

    Stelmach, Irina

    2007-01-01

    Ajakirjanik ja filmi produtsent räägib Maiju Ingmani muusikalisest portreefilmist "Tagasitulek koju" Eesti päritolu Iisraeli heliloojast ja pianistist Avi Nedzvetskist (Iisraelis tuntud kui Avi Benjamin) : Adel TV, 2007

  4. Jehhat mozhno, no ne spesha / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2008-01-01

    Venemaa presidendi ukaas lubab Eesti ja Läti mittekodanikel sõita Venemaale viisata. Välisminister Urmas Paeti sõnul mõjub selline otsus integratsiooni- ja naturalisatsiooniprotsessile negatiivselt

  5. Characterization of arterial stenosis using 3D imaging: comparison between three imaging techniques (MRA, spiral CTA and 3D DSA) and four display methods (MIP, SR, MPVR, VA) in a phantom study

    International Nuclear Information System (INIS)

    Bendib, K.; Poirier, C.; Croisille, P.; Roux, J.P.; Devel, D.; Amiel, M.

    1999-01-01

    Introduction: accurate assessment of arterial stenosis is a major public health issue for the diagnosis and treatment of cardiovascular diseases. The number of imaging techniques and types of software for display of imaging data is increasing. Few studies that compare these different techniques are available in the literature. Materials and methods: using phantoms to reproduce the main types of arterial stenosis, the authors compared three 3D acquisition techniques (MRA, CTA, and 3D DSA) and four types of display methods (MIP, SR, MPVR, and VA). The degree, the shape, and the location of different types of stenoses were analyzed by three experienced observers during two successive readings. Intra- and inter-observer reproducibility were assessed. The results of the various acquisition techniques and display methods also were compared to the digital reference data (CFAO) of the physical phantoms. Results: the degree of intra- and inter-observer reproducibility for the assessment of shape and location of the stenoses was good. Visual assessment of the degree of stenosis showed significant differences between two observers as well as in two readings by one observer. The 3D DSA was the most accurate technique for assessing the degree of stenosis. CTA provided better results than MRA. MPVR provided an accurate assessment of the degree of the stenosis. 3D DSA and CTA assessed stenosis form and localization adequately, with no significant difference; both methods appeared to be more accurate than MRA. SR provided the best information on the eccentric nature of the stenosis. The shape was very well assessed by VA and MPVR. Conclusions: even though 3D DSA is the most accurate acquisition technique for visualization, the combined use of SR and MPVR appears to be the best compromise to describe the morphology and degree of stenosis. Further improvements in automatic 3D image processing could offer a better understanding and increased possibilities for assessing arterial

  6. Improved respiratory self-navigation for 3D radial acquisitions through the use of a pencil-beam 2D-T2 -prep for free-breathing, whole-heart coronary MRA.

    Science.gov (United States)

    Coristine, Andrew J; Chaptinel, Jerome; Ginami, Giulia; Bonanno, Gabriele; Coppo, Simone; van Heeswijk, Ruud B; Piccini, Davide; Stuber, Matthias

    2018-03-01

    In respiratory self-navigation (SN), signal from static structures, such as the chest wall, may complicate motion detection or introduce post-correction artefacts. Suppressing signal from superfluous tissues may therefore improve image quality. We thus test the hypothesis that SN whole-heart coronary magnetic resonance angiography (MRA) will benefit from an outer-volume suppressing 2D-T 2 -Prep and present both phantom and in vivo results. A 2D-T 2 -Prep and a conventional T 2 -Prep were used prior to a free-breathing 3D-radial SN sequence. Both techniques were compared by imaging a home-built moving cardiac phantom and by performing coronary MRA in nine healthy volunteers. Reconstructions were performed using both a reference-based and a reference-independent approach to motion tracking, along with several coil combinations. Signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) were compared, along with vessel sharpness (VS). In phantoms, using the 2D-T 2 -Prep increased SNR by 16% to 53% and mean VS by 8%; improved motion tracking precision was also achieved. In volunteers, SNR increased by an average of 29% to 33% in the blood pool and by 15% to 25% in the myocardium, depending on the choice of reconstruction coils and algorithm, and VS increased by 34%. A 2D-T 2 -Prep significantly improves image quality in both phantoms and volunteers when performing SN coronary MRA. Magn Reson Med 79:1293-1303, 2018. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  7. Evaluation of time-of-flight and phase-contrast MRA sequences at 1.0 T for diagnosis of carotid artery disease. Pt. 1. A phantom and volunteer study

    International Nuclear Information System (INIS)

    Cronqvist, M.; Staahlberg, F.; Larsson, E.M.; Loenntoft, M.; Holtaas, S.

    1995-01-01

    The aim of this work was, firstly, to compare different manufacturer-provided MRA sequences in a 1.0 T MR unit, with respect to the visibility of an artificial stenosis in a flow phantom and, secondly, to evaluate the same sequences in healthy volunteers with respect to S/N ratio levels and practical in vivo implementation routines. The studied sequences were 2D and 3D TOF and sequences with an acquisition time of approximately 10 min. Quantitative signal evaluation was made using single transverse partitions in all phantom experiments. MIP angiograms and MPR reconstructions were made for visual inspection of image quality. In vivo, the images were individually evaluated by visual inspection by experienced neuroradiologists. In the evaluation of the grade and length of a stenosis, a combination of MIP and MPR was seen to be the optimal and necessary procedure. A shortening of TE played an important and significant role in the visualization of the poststenotic flow in the phantom using TOF MRA. However, the shortest TE values gave poor S/N ratio in vivo. The good results achieved in the phantom studies for 3D phase-contrast were somewhat reversed in the volunteer studies, whereas 3D TOF sequences showed good results in both the phantom and the volunteer studies. (orig.)

  8. Assessment and treatment planning of lateral intracranial dural arteriovenous fistulas in 3 T MRI and DSA: A detailed analysis under consideration of time-resolved imaging of contrast kinetics (TRICKS) and ce-MRA sequences

    Energy Technology Data Exchange (ETDEWEB)

    Ertl, L.; Brueckmann, H.; Patzig, M.; Brem, C.; Forbrig, R.; Fesl, G. [Ludwig-Maximilians-University, Grosshadern Campus, Department of Neuroradiology, Institute of Clinical Radiology, Munich (Germany); Kunz, M. [Ludwig-Maximilians-University, Grosshadern Campus, Department of Neurosurgery, Munich (Germany)

    2016-12-15

    The current gold standard in the assessment of lateral intracranial dural arteriovenous fistulas (LDAVF) is digital subtraction angiography (DSA). However, magnetic resonance imaging (MRI) is a non-invasive emerging tool for the evaluation of such lesions. The aim of our study was to compare the DSA to our 3 T MR-imaging protocol including a highly spatial resolved (ce-MRA) and a temporal resolved (''time-resolved imaging of contrast kinetics'', TRICKS) contrast-enhanced MR angiography to evaluate if solely DSA can remain the gold-standard imaging modality for the treatment planning of LDAVF. We retrospectively reviewed matched pairs of DSA and 3 T MRI examinations of 24 patients with LDAVF (03/2008-04/2014) by the same list of relevant criteria for an endovascular LDAVF treatment planning. In particular, we determined intermodality agreement for the Cognard classification, the identifeication of arterial feeders, and the detailed assessment of each venous drainage pattern. Intermodality agreement for the Cognard classification was excellent (k = 1.0). Whereas MRI failed in identifying small arterial feeders, it was superior to the DSA in the assessment of the sinus and the venous drainage pattern. The combination of MRI and DSA is the new gold standard in LDAVF treatment planning. (orig.)

  9. Sobirajem Russkii mir / Aleksandr Tshepurin ; interv. Nelli Kuznetsova

    Index Scriptorium Estoniae

    Tshepurin, Aleksandr

    2007-01-01

    Vene kaasmaalaste Balti regionaalkonverentsil osalenud Venemaa välisministeeriumi kaasmaalaste osakonna direktor Vene kaasmaalaste poliitikast, fondist "Vene maailm", Vene majade rajamisest Balti riikidesse, vene keele staatusest, Venemaa erinevate regioonide osalemisest kaasmaalaste poliitikas, kaasmaalaste Venemaale ümberasumise programmist

  10. Ping-pong tsherez granitsu, kotoroi net / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2006-01-01

    Võrus toimus Saksamaa poolel sõdinud veteranide traditsiooniline kokkutulek, kus esines ka peaminister Andrus Ansip. Venemaa reageeris tavapäraste süüdistustega: katse rehabiliteerida natsismi, Teise maailmasõja tulemuste ümberhindamine, venelaste olukord Baltimaades. Venemaa - Soome suhted

  11. Kinematografistõ ishtshut v Narve russkuju devushku / Aleksandr Mauzer

    Index Scriptorium Estoniae

    Mauzer, Aleksandr

    2008-01-01

    Veiko Õunpuu otsib Narvas ja Tallinnas proovivõtetel üht peaosalistest (25-35-aastane naine) oma filmi "Püha Tõnu kiusamine". Maria Avdjushkol on valminud komöödiafilmistsenaarium "GEP ehk Gorjatshije estonskije parni" USA firma Twentieth Century Fox jaoks, teemaks eestlased Venemaal seiklemas, näitlejateks venelased ja mängupaigaks Sillamäe. Taska Film oleks Eestipoolne osanik

  12. Kuzja Zverev eksponirujetsja v Rige i Tallinne / Aleksandr Mauzer

    Index Scriptorium Estoniae

    Mauzer, Aleksandr

    2008-01-01

    Riia Kunstimuuseumis on avatud eesti kaasaegse graafika näitus. Tööde hulgas on kaks Vladislav Kuznetsovi graafilist lehte. Kuraator Loit Jõekalda. Kuznetsovi töid on ka kujundusgraafikute aastanäitusel Rahvusraamatukogus. Jätkub Kuznetsovi tööde näitus "Liki Narvõ" Narva kunstigaleriis

  13. Russkii aljans v Ljuksemburge / Larissa Semjonova ; interv. Aleksandr Shegedin

    Index Scriptorium Estoniae

    Semjonova, Larissa

    2008-01-01

    Intervjuu Inimõiguste teabekeskuse tegevdirektoriga, kes vastab küsimustele, mis puudutavad tema osavõttu Euroopa Liidu ümarlauast, kus arutati venelaste olukorda liikmesriikides ja rahvussuhteid Eestis

  14. U Portugalii dusha poeta / Ana Paula Zacarias ; interv. Aleksandr Shegedin

    Index Scriptorium Estoniae

    Zacarias, Ana Paula

    2006-01-01

    Äsja avatud Portugali saatkonda juhtiv suursaadik Ana Paula Baptista Grade Zacarias jagab Portugali kogemusi seoses liitumisega Euroopa Liiduga. Eesti-Portugali suhted, suursaadiku esmamuljed Eestist

  15. Dumat po-drugomu hotjat zapretit / Aleksandr Tshaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2007-01-01

    Pronkssõduri teisaldamise järel on valitsus võtnud ülesandeks venekeelset elanikkonda paremini informeerida, luues ETV uudiste venekeelse internetiversiooni, lastes esineda Raadio 4-s mitmetel ametiisikutel, jagades Postimehe venekeelset väljaannet tasuta. Riigikogu esimehe Ene Ergma mõtetest riigi julgeoleku tagamisel, kahe kogukonna vastuolude kõrvaldamisest, venekeelsete koolide eestikeelsele õppele üleminekust

  16. Mõ za zonu stabilnosti na Baltike / Aleksandr Avdejev

    Index Scriptorium Estoniae

    Avdejev, Aleksandr

    2000-01-01

    Venemaa asevälisminister: Venemaa on huvitatud koostööst Baltimaadega ja stabiilsusest selles regioonis. Arvamused teemadel: Vene-Eesti suhted, integratsioonipoliitika, Läti sõjaveteranide marss, kaasmaalaste kaitse Venemaa valitsuse poolt

  17. Koren kvadratnõi iz prazdnikov / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2004-01-01

    Venemaa välisministeeriumi avaldusest seoses AVAKS süsteemi radar-lennuki ülelennuga Venemaa piiri läheduses, süüdistused Eesti ja Läti aadressil jõudsid nõudmisteni venekeelse elanikkonna õiguste kaitseks

  18. Istorija vnov aktualna / Aleksandr Tšaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2007-01-01

    Euroopa Nõukogu Parlamentaarse Assamblee president Rene van der Linden kritiseeris Eestit seoses Teises maailmasõjas Saksa poolel sõdinute kokkutulekuga Sinimägedes. Parlamendiliikmete Marko Mihkelsoni, Peeter Kreitzbergi, Evelin Sepa ja Vladimir Velmani arvamusi

  19. God 1998-i : Groznõi prognoz astrologa / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2006-01-01

    1998. aasta Eestis: Reformierakonna esimehele Siim Kallasele esitati süüdistus seoses 10 miljoni dollari kadumisega Põhja-Eesti Pangast, parteid valmistusid parlamendivalimisteks ning puhkes tüli Vene ja Eesti õigeusu kiriku vahel

  20. Pobedit ukrainskii narod / Pavlo Kiriakov ; interv. Aleksandr Shegedin

    Index Scriptorium Estoniae

    Kiriakov, Pavlo

    2007-01-01

    Ukraina suursaadik Eestis vastab küsimustele, mis puudutavad Ukraina iseseisvumist, SRÜ-d, arutelu riigis EL-i ja NATO-ga liitumise üle, Venemaa Musta mere laevastiku lahkumist 2017. aastaks, vene keele olukorda Ukrainas, oranzhi revolutsiooni, koostööd Eestiga. Suursaadik rõhutab, et Ukraina on ja jääb unitaarseks sõltumatuks riigiks

  1. U Jevropõ - dve skorosti / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2007-01-01

    Endise Euroopa Komisjoni esimehe ja praeguse Itaalia peaministri Romano Prodi intervjuust internetiportaalile EuroActiv. Prodi viitas Euroopa Liidu kahestumisele, rääkis Euroopa põhiseadusleppest ja ühtsest energeetikapoliitikast

  2. Partii ishtshut anti-Rüütelja / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2006-01-01

    Res Publica, Isamaaliit, Sotsiaaldemokraatik Erakond ja Eesti Reformierakond kavatsevad esitada ühise presidendikandidaadi, üks võimalikke kandidaate on Tartu Ülikooli rektor Jaak Aaviksoo. Nimetatud parteidel on Riigikogus 65 kohta, presidendi valimiseks on vaja aga 68 parlamendiliikme häält

  3. Prezident porabotal - za tshetverõhh / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2002-01-01

    Jüriöö ülestõusu tähistamine Jüriöö pargis, millest võtsid osa president A. Rüütel, linnajuhid M. Maripuu ja J. Moks, kaitseväe juhataja T. Kõuts ning Lasnamäe linnaosa vanem O. Laanjärv

  4. Lebed, rak i shtshuka "pojushtshaja revoljutsija"- 2 / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2004-01-01

    Järg 15.,22. sept. lk. 5. Eesti Kongress ja nn vene küsimus. Eesti Komitee rohelise kaardiga kodakondsuse saanud sõjaväelastest. Rahvarinde tegevuse ülevaade. Eesti Vabariigi iseseisvuse taastamise otsuse vastuvõtmisest Ülemnõukogus

  5. Lebed, rak i shtshuka "pojushtshei revoljutsii" / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2004-01-01

    80-ndatel ja 90-ndatel iseseisvuse poole liikuva Eesti poliitilisel areenil tegutsenud nn "Vene vastupanu" moodustanud ühendustest ja poliitikutest. Vt. samas: Lebedevist oleks peaaegu minister saanud

  6. Istorija mojei semi / Aleksandr Stahhovitsh ; per. s frantsuzskogo: Aleksei Gluhhov

    Index Scriptorium Estoniae

    Stahhovitsh, Aleksandr

    1998-01-01

    Vene emigrandi poja, prantsuse diplomaadi mälestused oma suguvõsast, kirjutatud Luxembourgis 1967. a. augustis. Vt. ka Aleksei Gluhhovi artiklit 'S tem zhe dostoinstvom i veroi' (Võshgorod 1998, nr. 4, lk. 6-8)

  7. VKG Energija delajet krupnuju investitsiju v okruzhajushtshuju sredu / Aleksandr Komshin

    Index Scriptorium Estoniae

    Komshin, Aleksandr

    2007-01-01

    Eesmärgiga vähendada väävliaurude sattumist õhku, sõlmis Viru Keemia Grupp AS-i tütarettevõte koostööleppe Rootsi firmaga Alstom väävlipüüdjate ehitamiseks. VKG Energia juhatuse liikme Andres Veske sõnul nõuavad seda Euroopa Liidu direktiivid ning ettevõtte soov kaitsta keskkonda ja Kohtla-Järve elanike tervist

  8. Poslõ napali na druzei Ilvesa / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2006-01-01

    Hans Rebase Euroopa Instituudi ja Euroopa Parlamendi väliskomisjoni aseesimehe Toomas Hendrik Ilvese kutsel esinesid Tallinnas peetud konverentsil energiapoliitika tippteadlased USA-st, Suurbritanniast, Venemaalt, Rootsist ja mujalt. Ülevaade sõnavõttudest

  9. Ob istinnõh razmerah melotshei / Aleksandr Borissov

    Index Scriptorium Estoniae

    Borissov, Aleksandr

    2000-01-01

    Mõisahoonest Keila -Joal (arh. H. Stackenschneider Peterburist), mõisat kujutavast S. Vorobjovi maalist (1837) Tretjakovi galeriis, R. Lepiksoni fotonäitusest Vaal galeriis ja Irina Nahhova (New Yorgist) erootiliste installatsioonide näitusest Tallinna Linnagaleriis

  10. Imperatritsa ili sovetskaja zhenshtshina? / Aleksandr Vassiljev ; interv. N. Rumjantseva

    Index Scriptorium Estoniae

    Vassiljev, Aleksandr

    2002-01-01

    Kunstnik ja moeajaloolane oma intervjuust kuulsa baleriini Maia Plissetskajaga (1925), mille ta tegi detsembris Monte-Carlos esilinastuva baleriini portreefilmi jaoks. Telekanali "Arte" filmi stsenarist on Kristian Lvovski ja stsenarist krahvinna Jelizaveta Kapnist

  11. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Spotlight Recently posted: How ...

  12. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... is a noninvasive test that uses a powerful magnetic field and a computer to produce detailed pictures of the major blood vessels throughout your body. It may be performed with or without contrast material which, if needed, will be injected into a ...

  13. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... of Use | Links | Site Map Copyright © 2018 Radiological Society of North America, Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  14. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... is a noninvasive test that uses a powerful magnetic field and a computer to produce detailed pictures of ... your body as these can interfere with the magnetic field of the MRI unit. The magnetic field is ...

  15. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Radiology and You Take our survey Sponsored by Image/Video Gallery Your Radiologist Explains Magnetic Resonance Angiography ( ... pictures of the major blood vessels throughout your body. It may be performed with or without contrast ...

  16. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... can interfere with the magnetic field of the MRI unit. The magnetic field is not harmful in ... malfunction or cause problems during the examination. Most MRI exams are relatively painless. However, some patients may ...

  17. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... pictures of the major blood vessels throughout your body. It may be performed with or without contrast ... examine blood vessels in key areas of your body and to identify abnormalities and disease. If you’ ...

  18. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Spotlight March is National ...

  19. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Radiology and You Take our survey Sponsored by Image/Video Gallery Your Radiologist Explains Magnetic Resonance Angiography ( ... problems, recent surgeries and allergies. If you’re female and there’s a possibility that you’re pregnant ...

  20. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... and there’s a possibility that you’re pregnant tell your doctor as well. On the day of ... comfortable clothing and leave any jewelry at home. Tell the radiologic technologist if you have medical devices ...

  1. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Site Index A-Z Spotlight February is American Heart Month Recently posted: Carotid Intima-Media Thickness Test ... and for your attention! Spotlight February is American Heart Month Recently posted: Carotid Intima-Media Thickness Test ...

  2. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... of all, discuss with your doctor any serious health problems, recent surgeries and allergies. If you’re ...

  3. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... is National Colorectal Cancer Awareness Month Recently posted: Video: The Basketball Game: An MRI Story Video: Abdominal Ultrasound Video: Pelvic ... is National Colorectal Cancer Awareness Month Recently posted: Video: The Basketball Game: An MRI Story Video: Abdominal Ultrasound Video: Pelvic ...

  4. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Obtain and Share Your Medical Images Movement Disorders Video: The Basketball Game: An MRI Story Radiology and You Take our ... Obtain and Share Your Medical Images Movement Disorders Video: The Basketball Game: An MRI Story Radiology and You Take our ...

  5. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Your Medical Images Movement Disorders Video: The Basketball Game: An MRI Story Radiology and You Take our ... Your Medical Images Movement Disorders Video: The Basketball Game: An MRI Story Radiology and You Take our ...

  6. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... comfortable clothing and leave any jewelry at home. Tell the radiologic technologist if you have medical devices implanted in your body as these can interfere with the magnetic field ...

  7. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... of all, discuss with your doctor any serious health problems, recent surgeries and allergies. If you’re female and there’s a possibility that you’re pregnant tell your doctor as well. On the day of your exam, it’s best to wear loose, ...

  8. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... MRI Story Video: Abdominal Ultrasound Video: Pelvic Ultrasound Medical Imaging Costs Radiology and You Take our survey ... home. Tell the radiologic technologist if you have medical devices implanted in your body as these can ...

  9. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Obtain and Share Your Medical Images Movement Disorders Video: The Basketball Game: An MRI Story Radiology and You Sponsored by ... Obtain and Share Your Medical Images Movement Disorders Video: The Basketball Game: An MRI Story Radiology and You Sponsored by ...

  10. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Spotlight February is American ...

  11. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... the major blood vessels throughout your body. It may be performed with or without contrast material which, ... not harmful in itself; however, some implanted devices may malfunction or cause problems during the examination. Most ...

  12. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Site Index A-Z Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Video: The Basketball Game: ... and for your attention! Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Video: The Basketball Game: ...

  13. MRA of fibromuscular dysplasia in cervical vessels

    International Nuclear Information System (INIS)

    Link, J.; Steffens, J.C.; Mueller-Huelsbeck, S.; Brossmann, J.; Heller, M.

    1996-01-01

    In 386 selective angiograms of cervical vessels fibromuscular dysplasia was revealed in 4 female patients in the age of 30-54 years. FMD was located in the carotid artery (n=5) and in the vertebral artery (n=2) with a total of 8 lesions. 6/8 of the lesions of the seven cervical vessels were located typically in the mid cervical portion of the vessels and 2/6 lesions were located in the atlas loop of the vertebral artery. 4 lesions showed moderate stenosis and 4 vessels showed only mild stenosis. These patterns which demonstrated the typical morphology of fibromuscular dysplasia with alternating irregular zones of widening and narrowing were evaluated well with MR angiography, the others were missed. (orig./MG) [de

  14. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... is American Heart Month Recently posted: Carotid Intima-Media Thickness Test Medical Imaging Costs Video: Abdominal Ultrasound ... is American Heart Month Recently posted: Carotid Intima-Media Thickness Test Medical Imaging Costs Video: Abdominal Ultrasound ...

  15. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Cancer Awareness Month Recently posted: Video: The Basketball Game: An MRI Story Video: Abdominal Ultrasound Video: Pelvic ... Cancer Awareness Month Recently posted: Video: The Basketball Game: An MRI Story Video: Abdominal Ultrasound Video: Pelvic ...

  16. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Index A-Z Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Carotid Intima-Media Thickness ... for your attention! Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Carotid Intima-Media Thickness ...

  17. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... with your doctor any serious health problems, recent surgeries and allergies. If you’re female and there’s ...

  18. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site ...

  19. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... uncomfortable to remain still for long periods of time while others may experience claustrophobia. If this is ... Radiology Info dot org. Thank you for your time and for your attention! Spotlight May is American ...

  20. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Site Index A-Z Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Carotid Intima-Media Thickness ... and for your attention! Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Carotid Intima-Media Thickness ...

  1. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Index A-Z Spotlight March is National Colorectal Cancer Awareness Month Recently posted: How to Obtain and ... for your attention! Spotlight March is National Colorectal Cancer Awareness Month Recently posted: How to Obtain and ...

  2. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... all, discuss with your doctor any serious health problems, recent surgeries and allergies. If you’re female ... however, some implanted devices may malfunction or cause problems during the examination. Most MRI exams are relatively ...

  3. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Video: Abdominal Ultrasound Video: Pelvic Ultrasound Medical Imaging Costs Radiology and You Take our survey Sponsored by ... Video: Abdominal Ultrasound Video: Pelvic Ultrasound Medical Imaging Costs Radiology and You Take our survey Sponsored by ...

  4. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... Index A-Z Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Video: The Basketball Game: ... for your attention! Spotlight March is National Colorectal Cancer Awareness Month Recently posted: Video: The Basketball Game: ...

  5. Your Radiologist Explains Magnetic Resonance Angiography (MRA)

    Medline Plus

    Full Text Available ... uncomfortable to remain still for long periods of time while others may experience claustrophobia. If this is ... Radiology Info dot org. Thank you for your time and for your attention! Spotlight Recently posted: How ...

  6. Noncontrast peripheral MRA with spiral echo train imaging.

    Science.gov (United States)

    Fielden, Samuel W; Mugler, John P; Hagspiel, Klaus D; Norton, Patrick T; Kramer, Christopher M; Meyer, Craig H

    2015-03-01

    To develop a spin echo train sequence with spiral readout gradients with improved artery-vein contrast for noncontrast angiography. Venous T2 becomes shorter as the echo spacing is increased in echo train sequences, improving contrast. Spiral acquisitions, due to their data collection efficiency, facilitate long echo spacings without increasing scan times. Bloch equation simulations were performed to determine optimal sequence parameters, and the sequence was applied in five volunteers. In two volunteers, the sequence was performed with a range of echo times and echo spacings to compare with the theoretical contrast behavior. A Cartesian version of the sequence was used to compare contrast appearance with the spiral sequence. Additionally, spiral parallel imaging was optionally used to improve image resolution. In vivo, artery-vein contrast properties followed the general shape predicted by simulations, and good results were obtained in all stations. Compared with a Cartesian implementation, the spiral sequence had superior artery-vein contrast, better spatial resolution (1.2 mm(2) versus 1.5 mm(2) ), and was acquired in less time (1.4 min versus 7.5 min). The spiral spin echo train sequence can be used for flow-independent angiography to generate three-dimensional angiograms of the periphery quickly and without the use of contrast agents. © 2014 Wiley Periodicals, Inc.

  7. MRA studies of arterial stenosis: improvements by diastolic acquisition.

    Science.gov (United States)

    Saloner, D; Selby, K; Anderson, C M

    1994-02-01

    Cardiac-phase-specific data acquisition is used to reduce signal loss in MR Angiography resulting from disturbed flow. RF pulses are delivered continuously throughout the cardiac cycle, but incrementation of phase-encoding gradients and data storage are enabled only during the chosen part of the cycle. Studies in a stenotic pulsatile flow phantom demonstrate that poststenotic signal loss is primarily determined by the mean flow velocity, and is not appreciably affected by acceleration or deceleration of the mean flow rate. The signal loss is least in diastole. In vivo studies in patients with carotid artery disease show that data acquisition in diastole reduces the apparent degree and extent of carotid bifurcation stenosis and provides a crisper definition of the vascular lumen. The additional time required for cardiac-phase-specific acquisition can be reduced by gating only the lower-order phase-encoding lines while retaining acceptable image quality.

  8. MRA Based Efficient Database Storing and Fast Querying Technique

    Directory of Open Access Journals (Sweden)

    Mitko Kostov

    2017-02-01

    Full Text Available In this paper we consider a specific way of organizing 1D signals or 2D image databases, such that a more efficient storage and faster querying is achieved. A multiresolution technique of data processing is used in order of saving the most significant processed data.

  9. Kogda investitsionnõi dozhd prevratitsja v liven? / Aleksandr Fedotov, Sigitas Pashilaitis, Dmitri Kulikov

    Index Scriptorium Estoniae

    Fedotov, Aleksandr

    2006-01-01

    Ilmunud ka: The Baltic Course 2007 Winter (nr. 24) lk. 20-24. Põhjalik ülevaade välisinvesteeringutest Eestisse, Lätisse ja Leedusse. Diagrammid: Investeeringute struktuurid. Tabelid: Investeerimisprojektid

  10. Shag vlevo i shag vpravo opjat stshitajetsja pobegom / Aleksandr Tshaplõgin, Igor Kuldmaa

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2008-01-01

    Kohtuprotsessist Tallinnas aprillirahutuste korraldamises süüdistatavate Dmitri Linteri, Mark Sirõki, Maksim Reva ja Dimitri Klenski üle. Väidetavalt Kaitsepolitsei avaldab poliitilist survet ja shantazheerib

  11. [Aleksandr Gavrilin: Latvijskie pravoslavnye svjaščennoslužiteli na amerikanskom kontinente] / Tõnu Tannberg

    Index Scriptorium Estoniae

    Tannberg, Tõnu, 1961-

    2014-01-01

    Arvustus: Гаврилин, Александр. Латвийские православные свяченнослужители на Американском континенте (Материалы по истории церкви, 49). Общество любителей церковной истории. Москва 2013

  12. Integratsiooni mõiste ja mida teab elanikkond integratsiooniprogrammist / Aleksandr Plotkin

    Index Scriptorium Estoniae

    Plotkin, Aleksandr

    2001-01-01

    Ilmunud ka: Integratsioon Tallinnas 2001 : sotsioloogilise uuringu andmete analüüs. - Tallinn, 2002, lk. 6-25; Otshjot issledovanija "Problemõ samoidentifikatsii i integratsii nasselenija g. Tallinna". - Tallinn, 2001, lk. 9-42; Integratsija v Tallinne 2001 : analiz dannõhh sotsiologitsheskogo issledovanija. - Tallinn, 2002, lk. 6-27

  13. Rusaj autoroj en "Fundamenta Krestomatio" / Aleksandr D. Dulichenko ; tõlkinud V. Devjatnin

    Index Scriptorium Estoniae

    Dulichenko, Aleksandr D.

    2003-01-01

    Esperantokeelsest kogumikust "Fundamenta Krestomatio de la lingvo Esperanto" (Rickmansworth : The Esperanto Publishing, 1954). Sisaldab M. Lermontovi luuletuse "Ingel" ja A. Puškini luuletuse "Husaar" esperantokeelseid tõlkeid, tlk. V. Devjatnin

  14. Samm efektiivsuse poole - väärtusahela kaardistamine / Aleksandr Miina

    Index Scriptorium Estoniae

    Miina, Aleksandr, 1979-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Promõshlennost 20. veebr. 2008 lk. 7. Väärtusahela kaardistamine on kulusäästliku tootmise meetod, mis koosneb kahest etapist. Esmalt luuakse ettevõtte hetkeseisu kaart (Present State Map), mille analüüsi tulemusena kujundatakse tulevikuseisu kaart (Future State Map). Lisa: Väärtusahela kaardistamine; Asjaolud, mis ei lisa tootmisprotsessi väärtust

  15. Õigeusu kiriku arhitektuur Eestis 16.-18. sajandil / Aleksandr Pantelejev

    Index Scriptorium Estoniae

    Pantelejev, Aleksandr

    2005-01-01

    Tallinna Püha Nikolai kirik. Tallinnas Rootsi Mihkli, Narvas saksa Maarja (ikonostaasi teostas Jacob Leu, u. 1708) ja rootsi Jaani kiriku ümberehitamine õigeusu kirikuteks. Ikonostaaside kavandamisel osalesid Ivan Zarudnõi Tallinnas ja arvatavasti Dominico Trezzini (1670-1734) Narvas. Polgukirikud. Pärnu Püha Jekaterina õigeusu kirik (arhitekt Pjotr Jegorov, 1765-1768). Bibliograafia lk. 460

  16. Armin Karu : "Vakhanalija azarta - tolko v ljubimoi rabote!" / Armin Karu ; interv. Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Karu, Armin, 1965-

    2008-01-01

    ASi Olympic Entertainment Group juhatuse esimees oma sport- ja hasartmängude eelistustest, edukusest, jõukusest, tulevikuplaanidest, kasiinode riigistamisest. Lisad: Armin Karu; Bill Gates on Armin Karust "vaesem"; Armin Karu teatas majanduskonverentsil "Äriplaan 2008": Pokkeriturism kasvab hoogsalt

  17. "Suveöö kui kiisu vagalt ..." : [luuletused] / Aleksandr Martõnov

    Index Scriptorium Estoniae

    Martõnov, Aleksandr

    2004-01-01

    Sisu: "Suveöö kui kiisu vagalt ..." ; "Teede ääres lumehanged ..." ; Kui hea ... ; Las ma lähen ... ; "Võtsin põlluteed ma minna ..." ; "Ei valgus mulle taevast tule ..." ; Tõsta mind, elu! .... Andmeid autori kohta lk. 39. Luuletused paralleelselt eesti ja ersa keeles

  18. V võborahh budut razbiratsja spetssluzhbõ / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2007-01-01

    Riigikogu istungil esitati arupärmine peaminister Andrus Ansipile, kas vastab tõele ärimees Edward Burkhardti väide, et Reformierakond pressis välja raha raudtee taasriigistamise toetamise eest. Siseminister Kalle Laanetile esitati arupärimine, kas KAPO on alustanud uurimist väidetavate Moskva ja Keskerakonna sidemete osas

  19. Splav ostroumija, delovitosti i dobrotõ / Vladimir Volohhonski ; interv. Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Volohhonski, Vladimir, 1948-2013

    2008-01-01

    AS DBT (Dry Bulk Terminal) juhatuse esimees oma senisest karjäärist, Muuga ja Paldiski sadamast, Sillamäe keemiaveoste terminalist, Ust-Luga sadamast, transiitkaubandusest ja reisijateveost, jalgpalli rollist oma elus, heategevusest, perekonnast ja lastest

  20. Zoloto partii : u nas ono ne tonet / Julia Rodina, Aleksandr Tshaplõgin

    Index Scriptorium Estoniae

    Rodina, Julia

    2008-01-01

    Endine valitsusliige, reformierakondlane ja valuutavahetusfirma Tavid nõukokku kuuluv Meelis Atonen soovitab reklaamisõnumis Titanicu uppumisega kullainvesteeringuid. Keskerakondlase Helle Kalda arvamus Reformierakonna ja peaminister Andrus Ansipi majandus- ja rahapoliitika kohta

  1. Kaks humanismi : minimalistlik ja maksimalistlik inimesekäsitlus / Aleksandr Dugin ; tõlk. Haljand Udam

    Index Scriptorium Estoniae

    Dugin, Aleksandr

    2001-01-01

    Humanismi kaks tahku - minimaalne humanism käsitab inimest kui potensiaalset jumalat, minimaalne humanism käsitab inimest kui aktuaalset jäävat suurust. Lisa: A. Dugini loomingu ülevaade ja meelisteemad

  2. Samozvantsev nam ne nado, komandirom budu ja / Maksim Shmeljov, Aleksandr Tshaplõgin, Leivi Sher

    Index Scriptorium Estoniae

    Shmeljov, Maksim

    2007-01-01

    Kas Konstitutsioonipartei nimekirjas parlamendivalimistel kandideeriv Dmitri Linter ja tema kaaslased võivad kasutada liikumise Notshnoi dozor brändi ND omakasupüüdlikel eesmärkidel, küsivad autorid

  3. Paindlik tootearendus läbi tehniliste muudatuste haldamise süsteemi / Aleksandr Miina

    Index Scriptorium Estoniae

    Miina, Aleksandr, 1979-

    2004-01-01

    Autori hinnangul vajab tootearendusprotsess head koostööd tehniliste muudatuste haldamise süsteemiga, mis võimaldab teha kiiresti arendustöid, parandusi ning võtta neid kasutusele ilma lisakuludeta. Skeemid

  4. Sem saperov i tshetõre sobaki - vklad v delo zashtshitõ demokratii / Aleksandr Shegedin

    Index Scriptorium Estoniae

    Shegedin, Aleksandr

    2003-01-01

    Siseministeeriumis toimus pidulik vastuvõtt Afganistanis missioonil viibinud demineerijate autasustamiseks. Üritusel viibisid peaminister Siim Kallas, kaitseminister Sven Mikser ja USA suursaadik Joseph deThomas

  5. Pljusõ i minusõ Jevropeiskogo Sojuza / Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Ikonnikov, Aleksandr

    2002-01-01

    Vene ajakirjanikele korraldatud briifing EL teemadel: EL fonde ja programme tutvustas rahandusministeeriumi asekantsler Rinaldo Mändmets. Eestis elavate vene elanike toetust liitumisele kommenteerib Paavo Palk Riigikantseleist

  6. Evolution of Communal Order of tAleksandr E.he Sarepta Missionary Settlement Throughout the 19th Century

    Directory of Open Access Journals (Sweden)

    [Kuryshev Andrey V.

    2016-09-01

    Full Text Available The article analyzes the social and economic processes that took place in the Sarepta missionary settlement near Tsaritsyn (now Volgograd, Russia in the 19th century. Those processes eventually led to dramatic changes in the life of Sarepta residents and to the loss of status of missionary settlement. Sarepta was founded in 1765 by the Moravians to fulfill missionary activities among the Kalmyks. Initially the life in Sarepta was based on communal principles. The Sarepta Moravians were organized into groups (choirs according to their sex, age, and marital status. The choirs lived by strict rules and were supervised by superiors. The Sarepta economy was organized in a similar way with the single ruling centre and communal distribution of the production. In the course of the 19th century the Sarepta community was gradually disorganized under the pressure of a number of factors. The key factor consisted in the development of capitalism. Facing a severe competition from manufacturers of the region, Sarepta had to respond to the needs of time and introduce private entrepreneurship which was more effective but incompatible to the communal economic system. Another destructing factor was the inflow of non-Moravian population into Sarepta caused by the deficit of workforce in the settlement. Those newcomers were free from the restrictions imposed upon Sarepta Moravians by the community authorities. Alongside with the strengthening of their economic position they made more and more insistent claims on the Moravian communal property. Rights-of-ownership conflicts between Sarepta inhabitants and the Directorate of the Moravian church in Germany eventually led to exclusion of Sarepta from the system of Moravian settlements in 1892.

  7. Jevgeni Onegin. Proloog : [luuletused] / Aleksandr Puškin ; tlk. Betti Alver, August Sang, Paul-Eerik Rummo

    Index Scriptorium Estoniae

    Puškin, Aleksandr

    2006-01-01

    Sisu: Jevgeni Onegin. Proloog ; Tshaadajevile ; Uuestisünd ; "Ju päeva viimne valgus suri..." ; "Ju õhtus aeglaselt kaob kerge pilveviir..." ; Muusa ; Kümnes käsk ; Vang ; "Kes, lained, peatas teie hoo..." ; "Kui lootusrikkalt siis jääks maha maine ring..." ; Deemon ; Eluvanker ; Merele ; Kuulsuse ihaldus ; A. P. Kernile ; Talveõhtu ; Pihtimus ; Hoidjale ; "Mind valdab õnn, kui selja taha jätta..." ; Talvine tee ; "Ööhämarus on juudionnis..." ; "All kaevandeis, kus lasub öö..." ; "Maailma laias, kurvas stepis toovad..." ; Arion ; Poeet ; "Kesk ülikuid poeedi hooleks..." ; 19. oktoobril 1827 ; Talisman ; Sõpradele ; "Veel puhuvad jahedad tuuled..." ; Eelaimus ; Lill ; Ended ; "On talv. Mis teha maal? Ma pärin teenrilt aru..." ; Talvehommik ; "Kui viibin pühakoja pingis..." ; "Mu nimest sinule mis jääb? ; Poeedile ; Eleegia ; Värsid, mis loodud unetul ööl ; Mustlased ; "Ei hinda kalliks ma bakhandi noore hoogu..." ; Kaja ; "Ei endist rõõmu tunne hing..." ; Kaunitar ; "Peas hoidku jumal mõistus mul..." ; Ööbik ; "...Käisin jällegi..." ; "Ausamba rajasin ma endal̀ eluaegu..." ; Jevgeni Onegin XLIX, L, LI : katkendid värssromaanist. Eluloolisi andmeid autori kohta lk. 517

  8. Estonskaja obshtshina poka otstajot ot russkoi, stshitajet premjer-ministr Mart Laar / Mart Laar ; interv. Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Laar, Mart, 1960-

    2001-01-01

    Peaminister Eesti sisepoliitilisest olukorrast: Isamaaliidu rahvuspoliitikast, J. Kogan Eesti poliitikas, Peeter Tulviste shanssidest saada presidendiks, elektrijaamade müügist NRG-le, miks ei toimu M. Laari kohtumist Vene asepeaministriga

  9. Der Diskurs von der Notwendigkeit des Durchbruchs zur Ostsee in der russischen Geschichte und Historiographie / Aleksandr Filjuškin

    Index Scriptorium Estoniae

    Filjuškin, Aleksandr

    2004-01-01

    Venemaa Läänemerele juurdepääsu soovi formuleerimisest ja käsitlusest Lääne-Euroopa allikates ning Venemaa ajalooteaduses ehk "akna läände raiumise" teema arengust 16. - 20. sajandini. Idee teostamisega kaasnenud ideoloogiast Peeter I ajal. Läänemere kaubanduse problemaatikast varauusajal

  10. Estonskoje võssheje obrazovanije : pervõi god v JeS / Mark Levin ; interv. Aleksandr Shegedin

    Index Scriptorium Estoniae

    Levin, Mark

    2005-01-01

    Eesti-Ameerika Ärikolledzhi rektor olukorrast kõrghariduses peale Eesti liitumist Euroopa Liiduga, muudatuste vajalikkusest kõrgharidussüsteemis, rakenduskõrgharidusest ja riigi suhtumisest erarakenduskõrgkoolidesse, praeguste abiturientide haridustasemest

  11. Estonian russification of non-russian ethnic minorities in Estonia? : A policy analysis / Aleksandr Aidarov, Wolfgang Drechsler

    Index Scriptorium Estoniae

    Aidarov, Aleksandr

    2013-01-01

    Aastatel 1945-1990 koos venelastega Eestisse immigreerunud etniliste vähemuste assimileerumisest eesti vene kultuuri peale 1991. aastat. Poliitilistes vahenditest, mida Eesti Valitsus rakendab etniliste vähemuste erisuste säilitamiseks.

  12. Tattow pod Hohlomu ?

    Index Scriptorium Estoniae

    1998-01-01

    Tätoveerimisest ja naha perforeerimisest (body piercing). Uuest stiilist tribal: ornamendid, geomeetrilised joonised. Infot jagavad Tallinna tattoo-salongi meistrid Aleksandr Serov ja Aleksandr Sidorenko

  13. The real-time interactive 3-D-DVA for robust coronary MRA.

    Science.gov (United States)

    Sachs, T S; Meyer, C H; Pauly, J M; Hu, B S; Nishimura, D G; Macovski, A

    2000-02-01

    A graphical user interface (GUI) has been developed which enables interactive feedback and control to the real-time diminishing variance algorithm (DVA). This interactivity allows the user to set scan parameters, view scan statistics, and view image updates during the course of the scan. In addition, the DVA has been extended to simultaneously reduce motion artifacts in three dimensions using three orthogonal navigators. Preliminary in vivo studies indicate that these improvements to the standard DVA allow for significantly improved consistency and robustness in eliminating respiratory motion artifacts from MR images, particularly when imaging the coronary arteries.

  14. Multi Resolution Analysis (MRA of satellite images of oil spill disasters

    Directory of Open Access Journals (Sweden)

    Rashid Hussain

    2014-09-01

    Full Text Available Oil spill disasters monitoring and mitigation requires availability of state of the art applications and tools. Conventional technology gets benefit from latest trends and research in satellite imaginary. This research highlights multi-resolution wavelet analysis of satellite images of oil spill disasters. Multi-resolution analysis is one of the powerful techniques to analyze information content of images. This analysis enables us to have a scale-invariant interpretation of the image. At each resolution level, both smooth and detailed signals carry all the necessary information to reconstruct the smooth signal at the next level. The wavelet decomposition results in detail and approximate threshold coefficients. Multi resolution wavelet decomposition is used to analyze the image in both time and frequency domain. It provides better frequency resolution and poor time resolution for lower frequency; better time resolution and poor frequency resolution for higher frequency. This condition is fortunately suited for real applications; as signals have high frequency components for very short period of the interval and low frequency components for longer durations.

  15. Evaluation of venous MRA in the diagnosis of dural sinus thrombosis

    International Nuclear Information System (INIS)

    Gao Yongan; Li Kuncheng; Wang Xinmin; Du Dongze

    1997-01-01

    Purpose: To evaluate venous MR angiography in the diagnosis and follow-up of dural sinus thrombosis. Material and methods: Twelve patients were examined with venous MR angiography and spin-echo MR imaging, 8 of them had conventional angiography. Venous MR angiographic findings were analysed and compared with MR imaging and conventional angiography. Results: Thrombosed dural sinuses and veins were included superior sagittal sinus 6 cases, torcular herophili 8, transverse sinus 8(10 sinuses), sigmoid sinus 8(9), straight sinus 6, Galen vein 3 and internal cerebral vein 3(6). Direct signs of dural sinus thrombosis on MR angiogram included lack of typical high flow signal from a sinus that did not appear aplastic or hypoplastic and the frayed appearance of the flow signal from a sinus after recanalization. Indirect signs included evidence of formation of collaterals or visualization of emissary veins. Conclusion: Venous MR angiography is the imaging modality of choice in the diagnosis of dural sinus thrombosis. MR angiography provides more information than standard spin-echo MRI, and unlike conventional angiography, it allows direct visualization of thrombotic material

  16. Dual origin of the left vertebral artery: extracranial MRA and CTA findings.

    LENUS (Irish Health Repository)

    Tobin, W Oliver

    2012-02-01

    A 48-year-old man presented with a posterior circulation stroke secondary to left lateral medullary infarction. Contrast-enhanced magnetic resonance angiography (CEMRA) revealed 40-45% intracranial left vertebral artery stenosis, likely atherosclerotic in nature. CEMRA and subsequent computed tomography angiography also identified a duplicate origin of the left vertebral artery. The importance of recognition of this rare anatomical variant, its potential contribution to stroke aetiology, and the advantage of non-invasive vascular imaging prior to catheter angiography is emphasised.

  17. High-resolution variable-density 3D cones coronary MRA.

    Science.gov (United States)

    Addy, Nii Okai; Ingle, R Reeve; Wu, Holden H; Hu, Bob S; Nishimura, Dwight G

    2015-09-01

    To improve the spatial/temporal resolution of whole-heart coronary MR angiography by developing a variable-density (VD) 3D cones acquisition suitable for image reconstruction with parallel imaging and compressed sensing techniques. A VD 3D cones trajectory design incorporates both radial and spiral trajectory undersampling techniques to achieve higher resolution. This design is used to generate a VD 3D cones trajectory with 0.8 mm/66 ms isotropic spatial/temporal resolution, using a similar number of readouts as our previous fully sampled cones trajectory (1.2 mm/100 ms). Scans of volunteers and patients are performed to evaluate the performance of the VD trajectory, using non-Cartesian L1 -ESPIRiT for high-resolution image reconstruction. With gridding reconstruction, the high-resolution scans experience an expected drop in signal-to-noise and contrast-to-noise ratios, but with L1 -ESPIRiT, the apparent noise is substantially reduced. Compared with 1.2 mm images, in each volunteer, the L1 -ESPIRiT 0.8 mm images exhibit higher vessel sharpness values in the right and left anterior descending arteries. Coronary MR angiography with isotropic submillimeter spatial resolution and high temporal resolution can be performed with VD 3D cones to improve the depiction of coronary arteries. © 2015 Wiley Periodicals, Inc.

  18. Whole-body MRA on a rolling table platform (AngioSURF)

    International Nuclear Information System (INIS)

    Ruehm, S.G.; Goyen, M.; Quick, H.H.; Schlepuetz, M.; Schlepuetz, H.; Bosk, S.; Barkhausen, J.; Ladd, M.E.; Debatin, J.F.

    2000-01-01

    Purpose: Development of a technique for whole-body MR angiography based on a rolling table platform and integration of a surface coil. Material and Methods: The developed rolling table platform AngioSURF (System for Unlimited Rolling Field-of-view) with integrated surface coil can be mounted on top of the original patient table of a Siemens Symphony System. Data acquisition was performed with a standard body array surface coil. The system was tested on three volunteers and one patient with angiographically documented vascular pathology. Data acquisition was performed with a 3D-FLASH-sequence (TR/TE 2,1/0,7 ms, flip angle: 20 , FOV 40x40 cm, 80 partitions, matrix 512x420 with zero interpolation). Five data sets were collected in immediate succession during continuous injection of a paramagnetic contrast agent. Time of acquisition per data set was 10 seconds. Table repositioning was performed manually within 3 seconds. Thus, the total acquisition time amounted to 72 seconds. Results: No problems with handling occurred in any of the four cases. The excellent image quality enables detailed assessment of the displayed vascular territories. Conclusions: The rolling table platform with integrated surface coil (AngioSURF) allows diagnostic display of the arterial vascular system from supraaortic vessels to the distal trifurcation arteries in only 72 seconds. (orig.) [de

  19. Kemikaalipoliitika ja regulatsioonide suundumused XXI sajandi algul : [bakalaureusetöö] / Tiina Titma ; Tartu Ülikool, õigusteaduskond ; juhendaja: Aleksandr Popov

    Index Scriptorium Estoniae

    Titma, Tiina

    2010-01-01

    Kemikaalidealaste regulatsioonide mõjuritest ja valdkonna arengust, kemikaalide käitlust ja kasutamist reguleerivatest peamistest riiklikest või rahvusvahelistest organisatsioonidest (Euroopa Toiduohutusamet, Euroopa Ravimiamet, Euroopa Kemikaaliamet, Toidu- ja Ravimiamet, Keskkonnakaitse Amet), rahvusvaheliste regulatsioonide ja kokkulepete arengustmaailmas 20. ja 21. sajandil

  20. Doing new things with language: Narrative language in SLI preschoolers Ingrida Balčiūnienė, Aleksandr N. Kornev

    Directory of Open Access Journals (Sweden)

    Ingrida Balčiūnienė

    2016-05-01

    Full Text Available The paper deals with micro- and macrostructural static and dynamic narrative characteristics in specifically language-impaired (SLI Russian-speaking preschool children and their typically-developing (TD peers. The study was based on experimental data that included storytelling and retelling elicited by means of wordless picture sequences. First, individual measures of story structure, episode com- pleteness, internal state terms, story productivity, lexical diversity, and syntactic complexity, as well as the percentage of linguistic dysfluencies and errors, were evaluated and compared between the experimental and control groups. Second, the impact of such factors as session (1st vs. 2nd, story complexity, and mode (telling vs. retelling on the dynamic variation of micro- and macrostructural narrative measures was evaluated. Our results highlighted essential dynamic differences between the samples from the perspective of narrative structure, structural complexity, grammaticality, and vocabulary.

  1. Senzorická analýza mražených krémů

    OpenAIRE

    Siatková, Monika

    2014-01-01

    The theme of this diploma is sensory analysis of ice creams. This work is divided into theoretical and practical part. In theoretical part, there is described the history of knowledge of ice cream, ingredients, which are needed for the production and requests for quality of this ingrediens. Production, packing, right storing and transportation of ice cream are described in details. In this work, there are also described requests for quality of ice cream, defects, dividing, health aspects conn...

  2. Optimization of imaging before pulmonary vein isolation by radiofrequency ablation: breath-held ungated versus ECG/breath-gated MRA

    Energy Technology Data Exchange (ETDEWEB)

    Allgayer, C.; Haller, S.; Bremerich, J. [University Hospital Basel, Department of Radiology, Basel (Switzerland); Zellweger, M.J.; Sticherling, C.; Buser, P.T. [University Hospital Basel, Department of Cardiology, Basel (Switzerland); Weber, O. [University Hospital Basel, Department of Medical Physics, Basel (Switzerland)

    2008-12-15

    Isolation of the pulmonary veins has emerged as a new therapy for atrial fibrillation. Pre-procedural magnetic resonance (MR) imaging enhances safety and efficacy; moreover, it reduces radiation exposure of the patients and interventional team. The purpose of this study was to optimize the MR protocol with respect to image quality and acquisition time. In 31 patients (23-73 years), the anatomy of the pulmonary veins, left atrium and oesophagus was assessed on a 1.5-Tesla scanner with four different sequences: (1) ungated two-dimensional true fast imaging with steady precession (2D-TrueFISP), (2) ECG/breath-gated 3D-TrueFISP, (3) ungated breath-held contrast-enhanced three-dimensional turbo fast low-angle shot (CE-3D-tFLASH), and (4) ECG/breath-gated CE-3D-TrueFISP. Image quality was scored from 1 (structure not visible) to 5 (excellent visibility), and the acquisition time was monitored. The pulmonary veins and left atrium were best visualized with CE-3D-tFLASH (scores 4.50 {+-} 0.52 and 4.59 {+-} 0.43) and ECG/breath-gated CE-3D-TrueFISP (4.47 {+-} 0.49 and 4.63 {+-} 0.39). Conspicuity of the oesophagus was optimal with CE-3D-TrueFISP and 2D-TrueFISP (4.59 {+-} 0.35 and 4.19 {+-} 0.46) but poor with CE-3D-tFLASH (1.03 {+-} 0.13) (p < 0.05). Acquisition times were shorter for 2D-TrueFISP (44 {+-} 1 s) and CE-3D-tFLASH (345 {+-} 113 s) compared with ECG/breath-gated 3D-TrueFISP (634 {+-} 197 s) and ECG/breath-gated CE-3D-TrueFISP (636 {+-} 230 s) (p < 0.05). In conclusion, an MR imaging protocol comprising CE-3D-tFLASH and 2D-TrueFISP allows assessment of the pulmonary veins, left atrium and oesophagus in less than 7 min and can be recommended for pre-procedural imaging before electric isolation of pulmonary veins. (orig.)

  3. Reduction of respiratory motion artifacts for free-breathing whole-heart coronary MRA by weighted iterative reconstruction.

    Science.gov (United States)

    Forman, Christoph; Piccini, Davide; Grimm, Robert; Hutter, Jana; Hornegger, Joachim; Zenge, Michael O

    2015-05-01

    To combine weighted iterative reconstruction with self-navigated free-breathing coronary magnetic resonance angiography for retrospective reduction of respiratory motion artifacts. One-dimensional self-navigation was improved for robust respiratory motion detection and the consistency of the acquired data was estimated on the detected motion. Based on the data consistency, the data fidelity term of iterative reconstruction was weighted to reduce the effects of respiratory motion. In vivo experiments were performed in 14 healthy volunteers and the resulting image quality of the proposed method was compared to a navigator-gated reference in terms of acquisition time, vessel length, and sharpness. Although the sampling pattern of the proposed method contained 60% more samples with respect to the reference, the scan efficiency was improved from 39.5 ± 10.1% to 55.1 ± 9.1%. The improved self-navigation showed a high correlation to the standard navigator signal and the described weighting efficiently reduced respiratory motion artifacts. Overall, the average image quality of the proposed method was comparable to the navigator-gated reference. Self-navigated coronary magnetic resonance angiography was successfully combined with weighted iterative reconstruction to reduce the total acquisition time and efficiently suppress respiratory motion artifacts. The simplicity of the experimental setup and the promising image quality are encouraging toward future clinical evaluation. © 2014 Wiley Periodicals, Inc.

  4. Free-breathing whole-heart coronary MRA: motion compensation integrated into 3D cartesian compressed sensing reconstruction.

    Science.gov (United States)

    Forman, Christoph; Grimm, Robert; Hutter, Jana Maria; Maier, Andreas; Hornegger, Joachim; Zenge, Michael O

    2013-01-01

    Respiratory motion remains a major challenge for whole-heart coronary magnetic resonance angiography (CMRA). Recently, iterative reconstruction has been augmented with non-rigid motion compensation to correct for the effects of respiratory motion. The major challenge of this approach is the estimation of dense deformation fields. In this work, the application of such a motion-compensated reconstruction is proposed for accelerated 3D Cartesian whole-heart CMRA. Without the need for extra calibration data or user interaction, the nonrigid deformations due to respiratory motion are directly estimated on the acquired image data. In-vivo experiments on 14 healthy volunteers were performed to compare the proposed method with the result of a navigator-gated reference scan. While reducing the acquisition time by one third, the reconstructed images resulted in equivalent vessel sharpness of 0.44 +/- 0.06 mm(-1) and 0.45 +/- 0.05 mm(-1), respectively.

  5. Evaluation of lesions of the internal ligaments of the wrist; conventional magnetic resonance imaging versus MR arthrography (MRA

    Directory of Open Access Journals (Sweden)

    Heba Ahmed Kamal

    2014-09-01

    Conclusion: MR arthrography is a potent additional tool facilitating the diagnosis of different pathologic entities affecting the major internal ligaments of the wrist joint and helps to reduce arthroscopic interventions.

  6. Ves aprel "Aprelju" ver / Lidija Tolmatshova

    Index Scriptorium Estoniae

    Tolmatshova, Lidija

    2001-01-01

    Kunstnike rühmituse "Aprill" - Aleksandr ja Nadezhda Popolitov, Vladislav ja Jelena Kuznetsov, Tatjana Petsheritsa, Igor Lukjanov, Sergei Kolesnikov, Aleksandr Orlov, Eduard Zentshik, Vladimir Zujev, German Jershov - näituse avamisest Sillamäel kehamaalingutega

  7. Golõshom i publitshno / Sofja Bauer, Tiia Linnard

    Index Scriptorium Estoniae

    Bauer, Sofia, 1947-2001

    1998-01-01

    Ida-Virumaa kunstnike kevadnäitusest Jõhvis, kujundas Aleksandr Igonin. Tutvustatakse osalevaid kunstnikke : Kalev Prits (Pump), Aleksandr Igonin, Aira ja Mati Rautso, Ljudmila Maisurjan, Andres Malõgin, Irja Annus, Juri Horev jt.

  8. Die russische baltische Historiographie in der zweiten Hälfte des 19. und zu Beginn des 20. Jahrhunderts / Tiit Rosenberg

    Index Scriptorium Estoniae

    Rosenberg, Tiit, 1946-

    2005-01-01

    Vene balti historiograafiast 19. sajandi teisel poolel ja 20. saj. algul. Evgraf Tsheshihhin, Joann Jürgens, Georgi Forsten, Vassili Blagoveshtshenski, Stepan Sivitski, Vassili Ivanov, Aleksandr Nevzorov, Aleksandr Brückner, Anton Budilovitsh, Aleksandr Tshumikov, Ivan Lutshitski, Konstantin Vojenski jt.

  9. Translations on USSR Science and Technology, Physical Sciences and Technology, Number 51

    Science.gov (United States)

    1978-09-27

    USSR (Kiev) Kovartsev, Aleksandr Nikolayevich, engineer, Kuybyshev Aviation Institute (Kuybyshev) / Kogan , Mark Georgiyevich, candidate of...142-143 [List of authors appearing in UPRAVLYAYUSHCHIYE SISTEMY I MASHINY] [Text] Ayzenberg, Aleksandr Borisovich, senior research associate...IK AN USSR (Kiev) Gumenyuk, Aleksandr Ivanovich, post-graduate student, IK AN USSR (Kiev) Gusev, Vladislav Vladimirovich, candidate of technical

  10. USSR Report, Science and Technology Policy.

    Science.gov (United States)

    1987-01-29

    Vladdmirovich Gorenshteyn, Igor Borisovich Kogan , Valentin Vasilyevich Kuzmenko, Ivan Vasilyevich Liptuga, Aleksandr Nikitovich Mikhaylyuchenko, Abdulla...Academician Aleksandr Aleksandrovich Nikonov, president of the Ail-Union Academy of Agricultural Sciences imeni V.l. Lenin. [begin Nikonov recording...Member of the USSR Academy of Sciences Aleksandr Fedorcvich Andreyev, deputy director of the Institute of Physics Problems imeni S.I. Vavilov of the

  11. Vaidluste lahendamine ning lahendite läbivaatuse eesmärk ICSID süsteemis : [bakalaureusetöö] / Tanel Ader ; Tartu Ülikool, õigusteaduskond ; juhendaja: Aleksandr Popov

    Index Scriptorium Estoniae

    Ader, Tanel

    2012-01-01

    ICSID (Rahvusvaheline Investeerimisvaidluste Lahendamise Keskus = International Centre for Settlement of Investment Disputes) eelsest õiguslikust olukorrast, konventsiooni eesmärkidest, Maailmapanga põhimõtete täitmisest, kahjutasu tunnustamisest ja väljanõudmisest, riikide suveräänsest puutumatusest

  12. Cloud amount/frequency, NITRATE and other data from STRANGER, AKADEMIK ALEKSANDR NESMEYANOV and other platforms in the South China Sea from 1947-12-07 to 1988-03-08 (NODC Accession 9200011)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Serial data in this accession was collected in South China Sea (Nan Hai), TOGA Area - Pacific (30 N to 30 S) as part of Tropical Ocean Global Atmosphere...

  13. On Hungarian and Slavic linguistics in the collection of papers dedicated to Mihály Péter / Aleksandr Dulitšenko, Szilárd Tóth

    Index Scriptorium Estoniae

    Dulitšenko, Aleksandr, 1941-

    1999-01-01

    Arvustus: Nyelv, stílus, irodalom : köszöntö könyv Péter Mihįly 70. születésnapjára / Banczerowski Janusz, Han Anna, Kassai Ilona, Nyomįrkay Istvįn közremuködésével szerkesztette Zoltán András. Budapest : ELTE BTK Keleti Szláv és Balti Filológiai Tanszék, 1998

  14. Aleksandr Dugin’s transformation from a lunatic fringe figure into a mainstream political publicist, 1980–1998: A case study in the rise of late and post-Soviet Russian fascism

    Directory of Open Access Journals (Sweden)

    Andreas Umland

    2010-07-01

    Biographical sketch: CertTransl (Leipzig, MA (Stanford, MPhil (Oxford, DipPolSci, DrPhil (FU Berlin, PhD (Cambridge. Visiting fellow at Stanford’s Hoover Institution in 1997–1999, and Harvard’s Weatherhead Center in 2001–2002. Bosch visiting lecturer at Yekaterinburg’s Urals State University in 1999–2001, and Kyiv’s Mohyla Academy in 2003/2005. In January-December 2004, temporary lecturer in Russian and East European studies at St. Antony’s College Oxford. In 2005–2008, German Academic Exchange Service (DAAD Lecturer Kyiv’s Shevchenko University. Papers in Problems of Post-Communism, East European Jewish Affairs, Osteuropa, Österreichische Zeitschrift für Politikwissenschaft, Politicheskie issledovaniya, European Political Science, Political Studies Review, The Journal of Slavic Military Studies, Voprosy filosofii, Obshchestvennye nauki i sovremennost’, Forum für osteuropäische Ideen- und Zeitgeschichte, Ab Imperio and other journals. Editor of The Implementation of the European Convention on Human Rights in Russia: Philosophical, Legal und Empirical Studies (Stuttgart: Ibidem 2004, Geistes- und Sozialwissenschaftliche Hochschullehre in Osteuropa. Vols. 1, 2, 3 & 4 (Frankfurt a.M. u.a.: Peter Lang 2005, 2006, 2007 & 2009, and, with Roger Griffin and Werner Loh, Fascism Past and Present, West and East: An International Debate on Concepts and Cases in the Comparative Study of the Extreme Right. With an afterword by Walter Laqueur (Stuttgart: Ibidem-Verlag 2006.

  15. STRUCTURE AND THEMES IN THE NOVEL OF NAWAL EL SAADAWİ'S İMRA'E 'INDE NUKTATİ'S-SIFR (WOMAN AT POINT ZERO)

    OpenAIRE

    KÖŞELİ, Yusuf

    2015-01-01

    In almost all her works, dealing with gender discrimination, violence and abuse against women and the current social position of women, Nawal El Saadawi, one of the most important writers of Egypt and the Arab world as well as being, yet in her childhood, due to observing frequently the discrimination between girls and boys both in her family and in her immediate vicinity, come to the fore as a key activist since the twenties, advocating the rights of Arab women and the male-female equality i...

  16. Retears of postoperative knee meniscus: findings on magnetic resonance imaging (MRI) and magnetic resonance arthrography (MRA) by using low and high field magnets

    International Nuclear Information System (INIS)

    Cardello, Paolo; Pofi, Enrico; Gigli, Carlo; Voglino, Nicola; Ricci, Alessandra; Chiatti, Leonardo

    2009-01-01

    The purpose of this study was to determine the diagnostic performance of magnetic resonance (MR) obtained with intra-articular contrast medium in the evaluation of recurrent meniscal tears using low-field extremity-only and high-field whole-body magnets. Postoperative standard MR examinations and MR arthrographies of 95 knees were reviewed. Patients experiencing pain and disability after meniscal repair underwent standard MR and MR arthrography (Gadoterate meglumine 0.0025 mmol/ml) on both a 0.2-T and 1.5-T magnet. In 52 of 95 patients, second-look arthroscopy was performed; in the remaining 43 of 95 patients, clinical follow-up was used as the standard of reference. Sensitivity, specificity, positive and negative predictive values as well as accuracy of MRI/MR arthrographic signs as meniscal morphologic changes and the presence of contrast medium tracking into the tear at T1- and T2-weighted sequences in the detection of recurrent meniscal tears were determined. All MR and MR arthrograpic signs were sensitive in the detection of recurrent tears (range 80-91%). Abnormal meniscal morphology had low specificity [26% (13/50)] for both the 0.2-T and 1.5-T scanner, whereas accuracy was 55% (52/95) and 57% (54/95), respectively. The presence of contrast medium within the meniscus substance on T2-weighted images had higher value of specificity [84% (42/50)] and accuracy [84% (80/95)] by using low field strength magnet than by using high field strength magnet [74% (37/50) and 81% (77/95), respectively]. Whereas, the increased intrameniscal signal intensity extending to the meniscal surface at T1-weighted sequences after intra-articular contrast medium administration had lower specificity and accuracy on 0.2-T images [84% (42/50) and 82% (78/95), respectively] than on 1.5-T images [90% (45/50) and 88% (84/95), respectively]. A diagnosis of recurrent meniscal tear in a previously arthroscopically repaired meniscus can be made both on 0.2-T and 1.5-T magnets on the basis of increased signal on T2-weighted and T1-weighted images in the presence of intra-articular contrast material. (orig.)

  17. Retears of postoperative knee meniscus: findings on magnetic resonance imaging (MRI) and magnetic resonance arthrography (MRA) by using low and high field magnets

    Energy Technology Data Exchange (ETDEWEB)

    Cardello, Paolo; Pofi, Enrico [Belcolle Hospital, Department of Radiodiagnostic, Viterbo (Italy); Gigli, Carlo; Voglino, Nicola [Belcolle Hospital, Division of Knee Surgery and Arthroscopy, Department of Orthopedics and Traumatology, Viterbo (Italy); Ricci, Alessandra; Chiatti, Leonardo [Belcolle Hospital, Department of Medical Physics, Viterbo (Italy)

    2009-02-15

    The purpose of this study was to determine the diagnostic performance of magnetic resonance (MR) obtained with intra-articular contrast medium in the evaluation of recurrent meniscal tears using low-field extremity-only and high-field whole-body magnets. Postoperative standard MR examinations and MR arthrographies of 95 knees were reviewed. Patients experiencing pain and disability after meniscal repair underwent standard MR and MR arthrography (Gadoterate meglumine 0.0025 mmol/ml) on both a 0.2-T and 1.5-T magnet. In 52 of 95 patients, second-look arthroscopy was performed; in the remaining 43 of 95 patients, clinical follow-up was used as the standard of reference. Sensitivity, specificity, positive and negative predictive values as well as accuracy of MRI/MR arthrographic signs as meniscal morphologic changes and the presence of contrast medium tracking into the tear at T1- and T2-weighted sequences in the detection of recurrent meniscal tears were determined. All MR and MR arthrograpic signs were sensitive in the detection of recurrent tears (range 80-91%). Abnormal meniscal morphology had low specificity [26% (13/50)] for both the 0.2-T and 1.5-T scanner, whereas accuracy was 55% (52/95) and 57% (54/95), respectively. The presence of contrast medium within the meniscus substance on T2-weighted images had higher value of specificity [84% (42/50)] and accuracy [84% (80/95)] by using low field strength magnet than by using high field strength magnet [74% (37/50) and 81% (77/95), respectively]. Whereas, the increased intrameniscal signal intensity extending to the meniscal surface at T1-weighted sequences after intra-articular contrast medium administration had lower specificity and accuracy on 0.2-T images [84% (42/50) and 82% (78/95), respectively] than on 1.5-T images [90% (45/50) and 88% (84/95), respectively]. A diagnosis of recurrent meniscal tear in a previously arthroscopically repaired meniscus can be made both on 0.2-T and 1.5-T magnets on the basis of increased signal on T2-weighted and T1-weighted images in the presence of intra-articular contrast material. (orig.)

  18. Effects of glyceryl trinitrate and calcitonin-gene-related peptide on BOLD signal and arterial diameter –methodological studies by fMRI and MRA

    DEFF Research Database (Denmark)

    Asghar, Mohammed Sohail; Ashina, Messoud

    2013-01-01

    of measuring task-related hemodynamic changes. Pharmacological substances that induce hemodynamic changes can therefore potentially alter the BOLD-signal that in turn falsely can be interpreted as changes in neuronal activity. It is therefore important to characterize possible effects of a pharmacological...... substance on the BOLD-response per see before that substance can be used in an fMRI experiment. Furthermore MR-angiography is useful in determining the vascular site-of-action of vasoactive substances....

  19. Альманах В. Брюсова "Русские символисты": судьбы участников / Евгения Иванова, Рем Щербаков

    Index Scriptorium Estoniae

    Иванова, Евгения

    2000-01-01

    Järgmistest Valeri Brjussovi almanahhi "Русские символисты" (1894-1895, 3 numbrit) kaasautoritest: A. L. Miropolski (õieti Aleksandr Lang), Erla Martov (õieti Andrei Bugon), Viktor Hrissonopulo, N. Novitš (õieti Nikolai Bahtin), Grigori Zaronin (õieti Aleksandr Gippius), Aleksandr Dobroljubov, Vladimir Gippius. Kirjastaja Vladimir Aleksandrovitš Maslov ja osa kaasautoreid olid müstifitseeritud

  20. Dom, kotorõi postroil Iljin / Ella Agranovskaja

    Index Scriptorium Estoniae

    Agranovskaja, Ella, 1950-

    2005-01-01

    Viimased neli aastat on Vene Kultuurikeskuse direktoriks olnud Aleksandr Iljin. Vene Kultuurikeskusest on saanud arvestatav Tallinna kultuurikeskus. Kommenteerivad Riigikogu liikmed Ago-Endrik Kerge ja Jaak Allik

  1. "Tshto zhe budjet s rodinoi s nami?" / Jevgeni Golikov

    Index Scriptorium Estoniae

    Golikov, Jevgeni

    2004-01-01

    Balti Vene Uuringute keskuse korraldatud seminaril "Venemaa aegade rägastikus: autoritarismist totalitarismini". Seminari avas Riigikogu liige Marko Mihkelson. Esinesid Vladimir Jushkin, Jevgeni Volk ja Aleksandr Sharavin

  2. Visitor from a parallel world / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2009-01-01

    Valgevene president Aleksandr Lukashenko kohtus Vilniuses Leedu presidendi Dalia Grybauskaitega . Valgevene opositsioon kohtus Leedu peaministri Andrius Kubiliuse ja Leedu välisministri Vygaudas Usackasega

  3. Avtonomija - delo dobrovolnoje / Josef Kats

    Index Scriptorium Estoniae

    Kats, Josef, 1977-

    2008-01-01

    Ajakirjaniku ja politoloogi Ilja Nikiforovi ning Moskva ajaloolase Aleksandr Ossipovi arvates ei garanteeri rahvuslik kultuurautonoomia staatus kõigi vähemusrahvuste ees seisvate probleemide lahendamist

  4. Last days of East European tyranny / John McCain

    Index Scriptorium Estoniae

    McCain, John

    2004-01-01

    USA senaatori kõne Riias toimunud rahvusvahelisel konverentsil "Demokraatia tulevik Baltimaade piiri taga", milles ta osutas, et Valgevene president Aleksandr Lukashenko on "Euroopa viimane diktaator"

  5. Uvidet heruvima / Boris Bernstein

    Index Scriptorium Estoniae

    Бернштейн, Борис, 1924-2015

    2006-01-01

    Inglite kujundi loomisest euroopalike traditsioonide baasil. Inglite kujutamine Euroopa kunstis. Vaadeldud Jean Fouquet, Benozzo Gozzoli, Raffaeli, Luigi Bernini, Aleksandr Ivanovi, Alek Rapoporti töid

  6. Printsessa badenskaja - tsaritsa russkaja / Larisa von Treiden

    Index Scriptorium Estoniae

    Treiden, Larisa von

    2008-01-01

    Venemaa pankurid kinkisid Baden-Badeni printsessi Louise ja Venemaa keisrinna Jelizaveta Aleksejevna (keiser Aleksander I abikaasa) skulptuuri Baden-Badeni linnale. Autor on Moskva skulptor Aleksandr Shtsherbakov

  7. J.A.P. Style - killuke rõivailu / Kai Ilustrumm

    Index Scriptorium Estoniae

    Ilustrumm, Kai

    2004-01-01

    Moekunstnike Janina Pasti (õppinud arhitektuuri, sisekujundust, graafikat) ja Aleksandr Pasti (ka ajakirjanik, fotoreporter) firmast J.A.P.Style ja uuest kollektsioonist. Inspiratsiooni saavad Versace loomingust

  8. Abiks algajatele anarhistidele / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2000-01-01

    Moskvas kirjastuselt "Gileia" 1999. a. ilmunud Aleksandr Breneri ja Barbara Schurzi raamatust "Mida teha? 54 tehnoloogiat kultuuriliseks vastupanuks võimusuhetele hilises kapitalismis". Vastupanu Eestis

  9. Doktor Zhivago iznossil 10 palto / Aleksandra Ovikova

    Index Scriptorium Estoniae

    Ovikova, Aleksandra

    2006-01-01

    10. mail algab Venemaa telekanalil NTV Aleksandr Proshkini 11-osaline seriaal Boriss Pasternaki romaani "Doktor Zhivago" ainetel, kesksetes rollides Oleg Menshikov, Tshulpan Hamatova; helilooja on Eduard Artemjev

  10. "Grazhdanstvo võprashivat ne sobirajus" / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2003-01-01

    Kodakondsus- ja Migratsiooniamet keeldus kodakondsust andmast Aleksandr Morzhakovile, motiveerides seda ebalojaalsusega. A. Morzhakov kommenteerib oma interneti lehekülje Russia Rules Eestit puudutavat rubriiki

  11. Mees, kes pistis läbi raudse värava pilu esimese peotäie tõtt / Triin Tael

    Index Scriptorium Estoniae

    Tael, Triin

    2008-01-01

    Vene kirjanikust Aleksandr Solzhenitsõnist, kes oma teoses "Gulagi arhipelaag" paljastas Nõukogude sunnitöölaagrite õudused. Lisa: Aleksandr Solzhenitsõn (1918-2008); "Gulagi arhipelaag" - riigireetmine!; Väljavõte raamatust "Gulagi arhipelaag". Vt. samas: Allar Viivik. Solzhenitsõn kirjutas "Gulagi arhipelaagi" end Eestis varjates

  12. Ukraina president peab spiikrit reeturiks / Taras Burnos

    Index Scriptorium Estoniae

    Burnos, Taras

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 14. juuni 2007, lk. 7. Ukraina poliitilisest kriisist seoses ennetähtaegsete valimiste väljakuulutamisega ja parlamendi spiikri Aleksandr Morozi soovist oma kohta hoida. President Viktor Jushtshenko ja Aleksandr Morozi seisukohti

  13. Russian-Belarusian propaganda war and Vilnius / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2010-01-01

    Venemaa-Valgevene konfliktist, mille käigus tsenseeritakse meediat ning kritiseeritakse president Aleksandr Lukašenkot ja peaminister Vladimir Putinit, põhjuseks on maagaasi hind. 27. juulil toimunud Leedu peaministri Andrius Kubiliuse ja Valgevene peaministri Sergei Sidorski kohtumisel räägiti vedeldatud gaasi terminali projektist. 26. juunil toimunud Andrius Kubiliuse ja Aleksandr Lukašenko kohtumisest

  14. "Aprel" v aprele ! / Aala Gitt

    Index Scriptorium Estoniae

    Gitt, Aala

    2000-01-01

    Sillamäe kunstnike rühmituse "Aprel" [Aprill] tegevusest 1999. aastal ja nende valmistumisest aprilli-näituseks Sillamäe näitusesaalis, kus osalevad grupi liikmed Aleksandr Popolitov, Aala Gitt, Igor Lukjanov, Tatjana Petsheritsa, Sergei Kolesnikov, German Jershov, Aleksandr Orlov, Nadezhda Popolitova, Eduard Zentshik, Jelena ja Vladislav Kuznetsovid

  15. Value of high spatial and high temporal resolution magnetic resonance angiography for differentiation between idiopathic and thromboembolic pulmonary hypertension: initial results

    Energy Technology Data Exchange (ETDEWEB)

    Ley, Sebastian; Eichinger, Monika [DKFZ, Department of Radiology (E010), Heidelberg (Germany); Johannes Gutenberg-University, Department of Radiology, University Hospital Mainz, Mainz (Germany); Fink, Christian; Zaporozhan, Julia; Puderbach, Michael; Plathow, Christian; Kauczor, Hans-Ulrich [DKFZ, Department of Radiology (E010), Heidelberg (Germany); Borst, Mathias M.; Meyer, F. Joachim; Gruenig, Ekkehard [University Heidelberg, Department of Internal Medicine, Heidelberg (Germany); Kreitner, Karl-Friedrich [Johannes Gutenberg-University, Department of Radiology, University Hospital Mainz, Mainz (Germany)

    2005-11-01

    Differentiation between different forms of pulmonary hypertension (PH) is essential for correct disease management. The goal of this study was to elucidate the clinical impact of high spatial resolution MR angiography (SR-MRA) and time-resolved MRA (TR-MRA) to differentiate between patients with chronic thromboembolic PH (CTEPH) and idiopathic pulmonary arterial hypertension (IPAH). Ten PH patients and five volunteers were examined. Twenty TR-MRA data sets (TA 1.5 s) and SR-MRA (TA 23 s) were acquired. TR-MRA data sets were subtracted as angiography and perfusion images. Evaluation comprised analysis of vascular pathologies on a segmental basis, detection of perfusion defects, and bronchial arteries by two readers in consensus. Technical evaluation comprised evaluation of image quality, signal-to-noise ratio (SNR) measurements, and contrast-media passage time. Visualization of the pulmonary arteries was possible down to a subsegmental (SR-MRA) and to a segmental (TR-MRA) level. SR-MRA outperformed TR-MRA in direct visualization of intravascular changes. Patients with IPAH predominantly showed tortuous pulmonary arteries while in CTEPH wall irregularities and abnormal proximal-to-distal tapering was found. Perfusion images showed a diffuse pattern in IPAH and focal defects in CTEPH. TR-MRA and SR-MRA resulted in the same final diagnosis. Both MRA techniques allowed for differentiation between IPAH and CTEPH. Therefore, TR-MRA can be used in the clinical setting, especially in dyspneic patients. (orig.)

  16. By-law no 36/MRA/SG/ANEA from 29 july 2004 on the role, organisation and functioning of l'Autorite Nationale de l'Energie Atomique

    International Nuclear Information System (INIS)

    2004-01-01

    The text called Arrete approaches in its general provisions the organization, attributions of the various parts (secretariat and various services) and their operation. The provisions emphasize the institutional anchoring of the Authority as well as the details of implementation of its mechanisms of operation [fr

  17. Brána mračnem posetá. Laser pomáhá geodetům, archeologům i hydrologům

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kuda, František

    2015-01-01

    Roč. 94, č. 12 (2015), s. 692-694 ISSN 0042-4544 Institutional support: RVO:68145535 Keywords : natural science * laser scanning method * Pravčická Rock Arch Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  18. Pilot Trial of Selecting Molecularly-Guided Therapy for Patients with non-V600 BRAF Mutant Metastatic Melanoma: Experience of the SU2C/MRA Melanoma Dream Team

    Science.gov (United States)

    LoRusso, Patricia M.; Boerner, Scott A.; Pilat, Mary Jo; Forman, Karen M.; Zuccaro, Clarice Y.; Kiefer, Jeffrey A.; Liang, Winnie S.; Hunsberger, Sally; Redman, Bruce G.; Markovic, Svetomir N.; Sekulic, Aleksandar; Bryce, Alan H.; Joseph, Richard W.; Cowey, C. Lance; Fecher, Leslie Anne; Sosman, Jeffrey Alan; Chapman, Paul B.; Schwartz, Gary K.; Craig, David W.; Carpten, John D.; Trent, Jeffrey M.

    2017-01-01

    Targeted therapies and immunotherapies have led to significant improvements in the treatment of advanced cancers, including metastatic melanoma. However, new strategies are desperately needed to overcome therapeutic resistance to these agents, as well as to identify effective treatment approaches for cancer patients that fall outside major targetable mutational subtypes (e.g. non-V600 BRAF melanoma). One such strategy is to extend the paradigm of individually tailored, molecularly targeted therapy into a broader spectrum of melanoma patients, particularly those bearing tumors without commonly recognized therapeutic targets, as well as having failed or were ineligible for immunotherapy. In this non-treatment pilot study, next-generation sequencing (NGS) technologies were utilized, including whole genome and whole transcriptome sequencing, to identify molecular aberrations in patients with non-V600 BRAF Metastatic Melanoma (MM). This information was then rationally matched to an appropriate clinical treatment from a defined pharmacopeia. Five patients with advanced non-V600 BRAF MM were enrolled. We demonstrated successful performance of the following during a clinically relevant time period: patient tumor biopsy, quality DNA/RNA extraction, DNA/RNA-based sequencing for gene expression analysis, analysis utilizing a series of data integration methodologies, report generation, and tumor board review with formulated treatment plan. Streamlining measures were conducted based on the experiences of enrolling, collecting specimens, and analyzing the molecular signatures of patients. We demonstrated the feasibility of using NGS to identify molecular aberrations and generate an individualized treatment plan in this patient population. A randomized treatment study utilizing lessons learned from the conduct of this pilot study is currently underway. PMID:26063764

  19. The role of MR angiography before transjugular placement of a portosystemic stent shunt (TIPS)

    International Nuclear Information System (INIS)

    Mueller, M.F.; Siewert, B.; Kim, D.; Edelman, R.R.; Stokes, K.R.; Finn, J.P.

    1994-01-01

    The authors employed magnetic resonance angiography (MRA) to guide catheter placement for transjugular intrahepatic portosystemic stent shunt (TIPS) procedures in 14 of 24 patients, and compared the results to the 10 patients who did not have prior panning based on MRA. Two-dimensional time-of-flight venography was performed during breath holding, and projection venograms were formatted in sagittal, coronal and axial planes. MRA defined venous anatomy sufficiently well to shorten the procedure and helped to minimize invasiveness. With MRA guidance, intrahepatic needle punctures were significantly fewer (without MRA guidance: mean 12.1; with MRA guidance: mean 3.5, p [de

  20. Evaluation of Contrast MR Angiography in the Study of Internal Carotid Artery Stenosis. Systematic Review of the Literature; Evaluacion de la estenosis de la arteria carotida interna por angiografia REM con contraste: revision sistematica de la bibliografia

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Perez, P.; Martinez Cantarero, J. [Hospital Universitario 12 de Octubre. Madrid (Spain); Ruiz Diaz, M.; Blazquez Morera, J. A. [Universidad Autonoma de Madrid (Spain); Llano Senaris, J. E. de [Fundacion Gaspar Casal. Madrid (Spain)

    2004-07-01

    To evaluate the diagnostic benefit of using contrast MR Angiography (MRA) in the study of extracranial internal carotid artery stenosis as opposed to intraarterial digital subtraction arteriography (LADSA). A search for relevant articles from 1990 to 2000 using MDLINE and EMBASE databases. Initial selection criteria: 1. articles which compare MRA and IADSA in the study of extracranial internal carotid artery stenosis; and 2, sample size of 10 or more subjects. Studies employing contrast MRA were subsequently selected. Contrast MRA diagnostic results were studied, as were those of non-contrast MRA (TOF) if included. Roc curves and 95% confidence intervals were calculated. In the studies, 324 patients and 648 extracranial internal carotid arteries were evaluated (12 articles). The diagnostic results in carotid artery stenosis discrimination using contrast MRA as opposed to IADSA were sensitivity and specificity=97.28% and 96.08%. With regard to contrast MRA vs. non-contrast MRA (TOF), significant differences favoring contrast MRA in both sensitivity and specificity were observed. (p=0.08 and p<0.001, respectively). MRA techniques demonstrate very high diagnostic capabilities in the detection of carotid stenosis, with contrast MRA being more effective than non-contrast. MRA. In spite of not being superior to IADSA, given the morbimortality risk which the latter is associated (0.7-1.2%). many authors defend contrast MRA (in association with Doppler echography) having become the method of choice for presurgical study of extracranial internal carotid artery stenosis. (Author) 53 refs.

  1. Evaluation of Contrast MR Angiography in the Study of Internal Carotid Artery Stenosis. Systematic Review of the Literature

    International Nuclear Information System (INIS)

    Rodriguez Perez, P.; Martinez Cantarero, J.; Ruiz Diaz, M.; Blazquez Morera, J. A.; Llano Senaris, J. E. de

    2004-01-01

    To evaluate the diagnostic benefit of using contrast MR Angiography (MRA) in the study of extracranial internal carotid artery stenosis as opposed to intraarterial digital subtraction arteriography (LADSA). A search for relevant articles from 1990 to 2000 using MDLINE and EMBASE databases. Initial selection criteria: 1. articles which compare MRA and IADSA in the study of extracranial internal carotid artery stenosis; and 2, sample size of 10 or more subjects. Studies employing contrast MRA were subsequently selected. Contrast MRA diagnostic results were studied, as were those of non-contrast MRA (TOF) if included. Roc curves and 95% confidence intervals were calculated. In the studies, 324 patients and 648 extracranial internal carotid arteries were evaluated (12 articles). The diagnostic results in carotid artery stenosis discrimination using contrast MRA as opposed to IADSA were sensitivity and specificity=97.28% and 96.08%. With regard to contrast MRA vs. non-contrast MRA (TOF), significant differences favoring contrast MRA in both sensitivity and specificity were observed. (p=0.08 and p<0.001, respectively). MRA techniques demonstrate very high diagnostic capabilities in the detection of carotid stenosis, with contrast MRA being more effective than non-contrast. MRA. In spite of not being superior to IADSA, given the morbimortality risk which the latter is associated (0.7-1.2%). many authors defend contrast MRA (in association with Doppler echography) having become the method of choice for presurgical study of extracranial internal carotid artery stenosis. (Author) 53 refs

  2. Huligan Kolka otkrõl dorogu Okudzhave / Margarita Golovanova

    Index Scriptorium Estoniae

    Golovanova, Margarita

    2006-01-01

    Noortefilm "Minu sõber Kolka" ("Drug moi, Kolka!") : režissöörid Aleksei Saltõkov, Aleksandr Mitta; osades Sasha Kobozev, Saveli Kramarov, Anatoli Kuznetsov; Mosfilm 1961. Tegijad meenutavad filmivõtteid

  3. Valgevenest Iraanini : Venezuela liider koob USA-vastas ühisrinnet / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2006-01-01

    Venezuela president Hugo Chavez külastab mitmeid Ameerika Ühendriikidele probleemseid riike. Kohtumine Valgevene presidendi Aleksandr Lukashenkoga, eelseisvast visiidist Venemaale. Lisa: Chavez tahab julgeolekunõukogusse

  4. Duell diktaatoriga / Juri Hashtshevatski ; interv. Kelly Grossthal, Maari Ross

    Index Scriptorium Estoniae

    Hashtshevatski, Juri

    2007-01-01

    Tallinnas linastub esimene Eesti-Valgevene ühistöö "Kalinovski väljak", dokumentaalfilm Valgevene kuulsaima režissööri pikalt kestnud ja ohtlikust konfliktist diktaator Lukashenkaga. Poliitilisest olukorrast Valgevenes, president Aleksandr Lukashenkast

  5. Irina Muravjova nabila sinjakov na rolikahh / Oksana Truhhan

    Index Scriptorium Estoniae

    Truhhan, Oksana

    2006-01-01

    Muusikaline komöödia "Karneval" : režissöör Tatjana Lioznova : osades Irina Muravjova, Aleksandr Abdulov, Jekaterina Zhemtshuzhnaja : NSV Liit 1981. Lavastaja ja näitlejad meenutavad filmi valmimise käiku

  6. Sevastopolski marsh / Zoja Igumova

    Index Scriptorium Estoniae

    Igumova, Zoja

    2008-01-01

    Sevastoopolis toimus pidulikult 15-osalise, veel töös oleva seriaali "Sevastoopoli jutustused" ("Sevastopolskije rasskazõ") esimese osa linastus. Seriaal kujutab linna 225-aastast ajalugu, režissööriks on Aleksandr Brunkovski

  7. Tshtobõ v dome bõlo ujutno / Voldemar Tombu

    Index Scriptorium Estoniae

    Tombu, Voldemar

    2001-01-01

    Moodsa ruumikujunduse tendentse tutvustavad tuntud vene disainerid Aleksandr Taldõkin, Alla Tshubarova, Gulja Ahmetshina ja arhitektid Igor Kotshanov, Dmitri Velitshkin, Eduard Zabuga, Pavel Romanov (Moskva ajakirja "Domovoi" küsitlus).

  8. Sasha, ja gorda, tshto ja tvoi utshitel! / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2001-01-01

    18. mail toimub Vene Draamateatris rahvusvahelist stepipäeva tähistav kontsert. Korraldajaks on Duff-tap studio, mida juhendab Aleksandr Ivashkevitsh. Kontserdil osalevad Barbara Duffy (USA) ja Vladimir Kirsanov (Venemaa)

  9. Tänavused "Eesti lood" / K[adri] S[undja

    Index Scriptorium Estoniae

    Sundja, Kadri

    2009-01-01

    Kolmandat aastat linastuvad ETV-s dokumentaalfilmid sarjast "Eesti lood". Tutvustused kolmele filmile : Liina Triškina "Siim, Samuli ja Dolce Vita", Kullar Viimse "Ultravennikased", Aleksandr Kheyfetsi ja Karin Reinbergi "Võõras omade seas"

  10. Solzhenitsõni teekond Putini Venemaale / Udo Uibo

    Index Scriptorium Estoniae

    Uibo, Udo, 1956-

    2007-01-01

    Ajalehes The Times Litterary Supplement ilmunud Zinovi Ziniku artiklist Aleksandr Solzhenitsõni loomingust, mis ilmus aasta tagasi kogumikus The Solzhenitsyn Reader. New and essential writings 1947-2005

  11. MPs question reports of citizenship bribery / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2005-01-01

    Reformierakonna väitel on alusetu seostada rahvastikuminister Paul-Erik Rummo ettepanekut anda teenete eest kodakondsus ärimeestele Sergei Sergejenkovile ja Aleksandr Frolovile ning viimaste soovi ühineda Reformierakonnaga. Mitte-eestlaste osakaal Reformierakonnas

  12. Vene Kultuurikeskus = The Russian Culture Centre / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Mere puiestee 5 asuva hoone (arhitekt A. Kuznetsov, 1954) restaureerimisest. Arhitekt Niina Mäger, sisearhitekt Anne Tamverk. Ajaloolane Aleksandr Pantelejev. Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud hoonele

  13. Za gospostavkami u nas glaz da glaz nuzhen / Margarita Kornõsheva

    Index Scriptorium Estoniae

    Kornõsheva, Margarita, 1957-

    2008-01-01

    Riigihangete ameti järelevalvetalituse juhataja Aleksandr Bakirov riigihangete järelevalvest, talituse tööst. Diagrammid: Postavshtshiki, proverennõje v 2007 godu; Narushenija zakona postavshtshikami

  14. Telefilm toob venelasteni Solzhenitsõni Gulagi-romaani / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Vene telekanal hakkab näitama Gleb Panfilovi uut teleseriaali Aleksandr Solzhenitsõni "Esimeses ringis" järgi, kus kirjanik on stsenaariumi autor ja loeb ka kaadritagust jutustavat teksti. Peaosas Jevgeni Mironov

  15. Solzhenitsõn moltshit... : Otkrõtoje pismo velikomu russkomu pisatelju / Olga Tshaikovskaja

    Index Scriptorium Estoniae

    Tshaikovskaja, Olga

    1995-01-01

    Otvet : Solzhenitsõn, Aleksandr. A gde ne 'gorjatshie obstojatelstva?': Otvet O.G.Tshaikovskoi : [1 ijunja 1995 : Perepetshatano iz ezhenedelnika 'Russkaja mõsl'] // Estonia. - 1995. - 11.juuli. - Lk.5

  16. Pöffihunt ulub juba 15. korda / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2011-01-01

    15. Pimedate Ööde Filmifestivali tutvustus. Põhiprogrammist, filmiturust, animafilmide festivalist Animated Dreams, laste- ja noortefilmide festivalist Just Film. Elutööpreemia saavad Rein Raamat, Rein Maran, Aleksandr Sokurov ja Fridrik Thor Fridriksson

  17. Manifestically correct / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2000-01-01

    Euroopa kaasaegse kunsti biennaal Manifesta 3 Ljubljanas deviisi all "Piirijoone sündroom. Kaitsmise energiad". Eestit esindab Ene-Liis Semper videoinstallatsiooniga "FF / Rew". Aleksandr Breneri aktsioonist. Bosnia-Hersegoviina kunstniku Sejla Kamerici tööst jm

  18. От Екатерингофа до Екатеринталя / Г. Прошин

    Index Scriptorium Estoniae

    Прошин, Г.

    2006-01-01

    Sakslased Venemaal. Sakslastest tegelaskujud vene kirjanduses: Deniss Fonvizini "Äbarikus", Aleksandr Puškini "Padaemandas", Nikolai Gogoli "Nevski prospektis", Ivan Turgenevi "Aadlipesas", Ivan Gontšarovi "Oblomovis", Nikolai Leskovi "Raudses tahtes" ning Fjodor Dostojevski teostes

  19. Po sledam Jantarnoi komnatõ / Jelena Nikiforova

    Index Scriptorium Estoniae

    Nikiforova, Jelena

    2000-01-01

    Peeter I-le kingitud (1716) merevaigutoast, mis 1755-1757 V. Rastrelli juhtimisel paigutati Tsarskoje Selo (Pushkin) Jekaterina lossi. Merevaigutoa saamislugu, selle saatusest ja taastamisplaanidest (projekti autor arh. Aleksandr Kedrinski)

  20. Вручены премии Eesti Kultuurkapital

    Index Scriptorium Estoniae

    2007-01-01

    Eesti venekeelsete autorite kirjandusauhinna said Jelena Skulskaja (pikaajalise eduka kirjandusliku tegevuse ja vene kirjanduselu seikade tutvustamise eest eestikeelsele lugejale) ja Aleksandr Uris (jututsükkel "Pood", Baltika, 2006, nr. 1-3)

  1. Неожиданная награда / Анна Литвинюк

    Index Scriptorium Estoniae

    Литвинюк, Анна

    2007-01-01

    Eesti venekeelsete autorite kirjandusauhinna said Jelena Skulskaja (pikaajalise eduka kirjandusliku tegevuse ja vene kirjanduselu seikade tutvustamise eest eestikeelsele lugejale) ja Aleksandr Uris (jututsükkel "Pood", Baltika, 2006, nr. 1-3)

  2. Eesti Kultuurkapital вручил премии года

    Index Scriptorium Estoniae

    2007-01-01

    Eesti venekeelsete autorite kirjandusauhinna said Jelena Skulskaja (pikaajalise eduka kirjandusliku tegevuse ja vene kirjanduselu seikade tutvustamise eest eestikeelsele lugejale) ja Aleksandr Uris (jututsükkel "Pood", Baltika, 2006, nr. 1-3)

  3. Depth, chemical, and temperature from bottle casts in the Sea of Okhotsk from 29 June 1990 to 31 August 1997 (NODC Accession 0000385)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Depth, chemical, and temperature data were collected from the SAMOED, AKADEMIK ALEKSANDR NESMEYANOV, AKADEMIK M.A. LAVRENTYEV, and PROFESSOR LEVANIDOV from June 29,...

  4. Estoniju reklamirujut uzhe dva brenda / Andrei Babin

    Index Scriptorium Estoniae

    Babin, Andrei

    2007-01-01

    Eestit tutvustava logo "Welcome to Estonia" kõrval on kasutusel alternatiivne bränd "Balti võti" (Baltic Key). Projekti arendab eraettevõtja Aleksandr Neson. Kaubamärgi visuaalsest lahendusest. Autor on disainer Arturas Kiselius

  5. "Pikovõje damõ" Pushkina ja Shahhovskogo / Ljubov Kisseljova

    Index Scriptorium Estoniae

    Kisseljova, Ljubov, 1950-

    2000-01-01

    Bibl. märkustes, lk. 201-203. Kokkuvõte inglise k. lk. 442. Aleksandr Shahhovskoi (1777-1846) dramatiseering A. Pushkini jutustuse "Padaemand" järgi (1836), dramatiseeringu pealkiri: "Hrizomanija, ili strast dengam"

  6. Muutunud Euroopa / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2009-01-01

    Mihhail Vladislavlev ja Aleksandr Zukerman kordasid 15 aasta tagust reisi taksoga mööda Euroopat. Sellest, mis on muutunud Poolas, Horvaatias, Essenis, Linzis ja Eestis "Subboteja" tegijate omil sõnul

  7. Театральная радуга в городе белых ночей / Борис Тух

    Index Scriptorium Estoniae

    Тух, Борис, 1946-

    2015-01-01

    16. teatrifestival Vikerkaar toimus Peterburis mais-juunis 2015, korraldas Aleksandr Brjantsevi nimeline Noorsooteater. Pikemalt Brjantsevi nim. Noorsooteatri lavastusest Ray Bradbury romaani "Võilillevein" ainetel (lavastaja Adolf Šapiro)

  8. Фотограф из Эстонии назван лучшим / Лилия Крысина

    Index Scriptorium Estoniae

    Крысина, Лилия

    2010-01-01

    Tallinnas sündinud, 2006. aastast Venemaal elav fotograaf Aleksandr Gronski võitis Amsterdami fotomuuseumi Foam korraldatud rahvusvahelise fotokonkursi Foam Paul Huff Award 2010 ja sai võimaluse oma töid eksponeerida Amsterdami fotomuuseumis. Fotograafist

  9. Eesti dokumentaalfilm võitis USAs auhinna

    Index Scriptorium Estoniae

    2003-01-01

    Renita ja Hannes Lintropi dokumentaalfilm "Läbi pimeduse" Sompa kaevanduse kaevurist Aleksandr Gomanist sai Texases toimunud 36th Annual WorldFest-Huston filmifestivalil dokumentaalfilmide võistlussarjas Silver Remi auhinna

  10. Kapo vahistas pistise pakkumise kahtlusega Narva linnavoliniku / Tanel Mazur

    Index Scriptorium Estoniae

    Mazur, Tanel, 1971-

    2008-01-01

    Ilmunud ka: Narva Postiljon 30. aug. lk. 1. Kaitsepolitsei pidas 28.augustil altkäemaksu andmises kahtlustatavana kinni Narva linnavolikogu liikme, keskerakondlase Aleksandr Moissejevi. Vahistamise asjaolusid kaitsepolitsei ei kommenteeri. Lisa: Äripartner hämmastunud

  11. Valgevene riigipea pikendab veelgi oma ametiaega / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2004-01-01

    Valgevene president Aleksandr Lukashenko kuulutas välja rahvahääletuse, et saada võimalus olla president ka kolmanda ametiaja jooksul. 1996. aastal pikendas ta referendumi tulemusel oma ametiaega viielt aastalt seitsmele. Lisa: Nõukogulikud despootidest juhid

  12. Прошло награждение премией "Хрустальная Турандот"

    Index Scriptorium Estoniae

    2009-01-01

    Moskvas toimus teatripreemia "Kristalne Turandot" laureaatide tasustamise XVIII tseremoonia. Preemiad said : kauaaegse teatritegevuse eest Aleksandr Širvindt, parima naisostäitmise eest Tšulpan Hamatova ja parima meesosatäitmise eest Jevgeni Mironov

  13. Mira Sorvino : võpusknitsa Garvarda v blokadnom Leningrade / Liza Zolotõhh

    Index Scriptorium Estoniae

    Zolotõhh, Liza

    2007-01-01

    4-osaline telefilm Leningradi blokaadist "Leningrad" : stsenarist ja režissöör Aleksandr Buravski : Venemaa (PBK) - Suurbritannia, 2006. Osatäitjate valikust, filmivõtetest, 1. osa esilinastusest blokaadis osalenutele

  14. Ilmamere lainetel / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2009-01-01

    Režissöör Goro Miyazaki poolt ulmekirjanik Ursula K. Le Guini "Meremaa lugude" põhjal tehtud joonisfilmist "Ilmamere lood" (Studio Ghibili, Jaapan, 2006). Samas pealkirja all "Tappev humaansus" Aleksandr Melniku filmist "Uus maa" (Venemaa, 2008)

  15. Lennujaamast ja parunist puu otsas : [lugemiselamustest] / Ülar Ploom

    Index Scriptorium Estoniae

    Ploom, Ülar

    2007-01-01

    Maailmaklassikast: Mark Twaini "Huckelberry Finni seiklused", Jules Verne'i "Saladuslik saar", Gabriel García Márquezi "Sada aastat üksildust", Aleksandr Erteli "Gardeninid", Italo Calvino "Parun puu otsas"

  16. Ajaloo traageldustega vene blockbuster'id / Jüri Laulik

    Index Scriptorium Estoniae

    Laulik, Jüri, 1959-

    2008-01-01

    Vene ajalugu mängufilmides: "Admiral" (rezh. Andrei Kravtshuk : Venemaa 2008), "Aleksandr. Nevskaja bitva" (rezh. Igor Kalenov : Venemaa 2008), "1612" (rezh. Vladimir Hotinenko : Venemaa 2007), "Mongol" (rezh. Sergei Bodrov : Venemaa - Saksamaa - Kasahstan - Mongoolia 2007)

  17. Kas keegi on kodus? : oma varju jälil / Zinovi Zinik ; inglise keelest tõlkinud Märt Väljataga

    Index Scriptorium Estoniae

    Zinik, Zinovi

    2007-01-01

    Ettekanne Euroopa kultuuriajakirjade 20. kohtumisel Sibius 2007. aastal. Eksiilkirjanikest ja kuuluvustundest. Käsitletakse Aleksandr Asarkarinit, Jevgeni Shvartsi, Albert von Chamissot, Hannah Arendti ja Joseph Conradit ning nende loomingut. Orig.: Anyone at home? In pursuit of one's own shadow.

  18. Mihhail Zharov ustroil amerikantsam "Vesjoluju voinu" / Oleg Peranov

    Index Scriptorium Estoniae

    Peranov, Oleg

    2006-01-01

    Muusikaline komöödia "Rahutu majapidamine" ("Bespokoinoje hozjaistvo") : režissöör Mihhail Zharov : osades Ljudmila Tselikovskaja, Aleksandr Grave, Sergei Filippov, Mihhail Zharov : Mosfilm 1946. Tegijad meenutavad filmivõtteid

  19. Odna prostaja plastilinovaja skazka pro voronu / Nadezhda Guzheva

    Index Scriptorium Estoniae

    Guzheva, Nadezhda

    2007-01-01

    Kirjanik Eduard Uspenski meenutab, kuidas 26 aastat tagasi valmis NSV Liidus esimene plastiliinist nukkudega animafilm "Plastiliinist vares" ("Plastilinovaja vorona"), mille värsid tema kirjutas : režissöör Aleksandr Tatarski : helilooja Grigori Gladkov

  20. Perekonnatüli võttis ELK Lennuliinide juhilt koha / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2000-01-01

    Eile keskpäeval võttis ELK Lennuliinid nõukogu esimees Rita Lillipuu oma senise elukaaslase Aleksandr Beloussovi juhatuse esimehe kohalt maha ja kompanii peakontorit asusid valvama ESS-i turvamehed

  1. Obraz Stalina v tvortshestve A. Solzhenitsõna, V. Maksimova, J. Druzhnikova / Lucjan Suchanek ; poola keelest tõlkinud autor

    Index Scriptorium Estoniae

    Suchanek, Lucjan

    2002-01-01

    Bibl. märkustes, lk. 138. Stalin tegelaskujuna Aleksandr Solzhenitsõni "Esimeses ringis" ning Vladimir Maksimovi ("Kovtsheg dlja nezvanõh") ja Juri Druzhnikovi ("Angelõ na kontshike iglõ") teostes

  2. Narvitjanin Andrei Ivanen napisal knigu o dramatitsheskoi sudbe tserkvi Shtiglitsa / Irina Tokareva

    Index Scriptorium Estoniae

    Tokareva, Irina

    2004-01-01

    Narva koduloolane Andrei Ivanen raamatu "Ivangorodskaja-Svjato-Troitskaja tserkov barona Aleksandra Stiglitsa" saamisloost. Arhitekt Aleksandr Krakau kavandatud Ivangorodi Püha Kolmainsuse kiriku hoonest ja selle taastamisest. Kiriku altarimaal on Fjodor Brunilt. Raamatu fotod Leonid Lashkevitshilt

  3. Korduvalt põlenud majja Kadriorus Narva maanteel võib tulla restoran / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2004-01-01

    Tallinnas Narva maantee 26 asuv korduvalt põlenud muinsuskaitsealune puithoone restaureeritakse. Eritingimused koostas ajaloolane Aleksandr Pantelejev. Ala detailplaneeringu lähteülesande väljastas linn osaühingule Arhitektid Muru & Pere 2002. aastal

  4. О группе "AveNue" сняли фильм

    Index Scriptorium Estoniae

    2009-01-01

    4. novemril esilinastusus Tallinna kinos "Sõprus" kinofestivali "Eesti lood" raames muusikaline dokumentaalfilm Narva venekeelsest rokkgrupist AveNue "Võõras omade seas", režissöörid Aleksandr Kheyfets ja Karin Reinberg. Tootja Revolver Film, Eesti 2009

  5. Kirikumehed sõid näituselt kalamarja välja / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2005-01-01

    Vene avangardisti Aleksandr Kosolapovi kaaviarist Jumalaema ikooni kujutav teos eemaldati usuringkondade survel näituselt Uues Tretjakovi galeriis Moskvas. Lisatud repro. Autorist ja tema loomingust. Emigreerus 1975. a. Ameerikasse

  6. Vino Dionisiiskihh prazdnestv / Jelena Skulskaja

    Index Scriptorium Estoniae

    Skulskaja, Jelena, 1950-

    2001-01-01

    Rahvusvahelise teatripäeva tähistamine Vene Draamateatris, küsimustele vastavad näitlejad Lembit Ulfsak, Aleksandr Ivashkevitsh, Julia Popova, lavastajad Eduard Toman ja Svetlana Krassman ning Venemaa saadik Eestis Konstantin Provalov

  7. Semper lõi Manifestal laineid / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2000-01-01

    Manifesta 3, euroopa kaasaegse kunsti biennaal "Piirisündroom" Ljubljanas kuni 24. septembrini. Eestit esindas Ene-Liis Semperi video "FF/Rew". Järjekordse skandaali - piserdas pulverisaatorist presiidiumilauda ja videoekraani - korraldas venelane Aleksandr Brener

  8. Kalamaja põhikooli rekonstrueerimine = Renovation of Kalamaja basic school / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2009-01-01

    Tallinnas Vabriku 18 asuva Kalamaja põhikooli hoone (arhitekt Georg Hellat, 1915) muinsuskaitse eritingimused koostas Aleksandr Pantelejev, arhitekt on Andres Põime, sisearhitekt Reet Põime (Studio 3). Žürii hinnang kultuurkapitali aastapreemiale esitatud hoonele

  9. "Budjem nazhimat" / Allan Martinson ; interv. Petr Birger

    Index Scriptorium Estoniae

    Martinson, Allan, 1966-

    2006-01-01

    Allan Martinson oma asutatud infotehnoloogia ettevõtetest Eestis ja Baltimaades, investeerimisfirma Martinson Trigon Venture Partners investeeringust Vene tarkvarafirmasse Reksoft ning Eesti IT arengust tervikuna. Vt. samas intervjuud Reksoft'i peadirektori Aleksandr Jegoroviga

  10. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  11. Bagatellid : maailm / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2008-01-01

    Suri pianist Aleksandr Slobodjanik. Opera News jagas preemiaid. Ajulained kohtuvad helilainetega. Luciano Pavarotti mälestus. Stradivari tšello oksjonil. Õuduslugu "Kärbes" uues ooperikuues. Anna Netrebko tagasitulek

  12. Nüüdis-Venemaa näitab end laval / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2009-01-01

    Vene teatrifestivali "Kuldne mask Eestis" raames nähtud kahest lavastusest - William Shakespeare`i "Kaheteistkümnes öö" Declan Donnellani lavastuses ja Aleksandr Ostrovski "Äike" Lev Erenburgi lavastuses

  13. Noored ootavad revolutsiooni / Silver Meikar

    Index Scriptorium Estoniae

    Meikar, Silver, 1978-

    2006-01-01

    Valgevenes on noored tulnud tänavale, et protestida presidendivalimiste tulemuste vastu. Vt. samas: Venemaa võimud toetavad avalikult Valgevene presidenti Aleksandr Lukashenkat; Lukashenka ülisuur võit

  14. Politics and history: Lithuania and the Slavs / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2011-01-01

    Poliitilised ja ajaloolised suhted Leedu ja slaavlastest naaberrahvaste vahel. 15. novembril Delfi.lt-le antud intervjuus on vene filosoof Aleksandr Dugin öelnud, et Venemaa võib Baltimaid uuesti okupeerida. Kaart

  15. Jeewanu, or theparticles of life'The approach of Krishna Bahadur in ...

    Indian Academy of Sciences (India)

    2011-08-16

    -20th century research on the origin of life, notably the so-called `coacervate theory' of the Soviet biochemist Aleksandr I Oparin. The concepts of life proposed by Bahadur, Oparin and others are discussed from a historical ...

  16. Zhenihh Balzaminov, skrõvajas ot svahh, zanimalsja jogoi / Oleg Peranov

    Index Scriptorium Estoniae

    Peranov, Oleg

    2004-01-01

    Mängufilm Aleksandr Ostrovski teoste alusel "Balsaminovi abiellumine" ("Zhenitba Balzaminova") : stsenarist ja režissöör Konstantin Voinov : Nõukogude Liit 1964. Osavõtjate mälestusi filmi võtetelt

  17. Liblikad on vallutanud kollektsionäärihinge / Kadri Tamm

    Index Scriptorium Estoniae

    Tamm, Kadri

    2004-01-01

    Naftasaadustega tegeleva firma Infast Oil juhatuse esimehe Aleksandr Pototski harrastusteks on liblikate ja veiniaksessuaaride kogumine. Lisa: Liblikapüük on kulukas hobi. Vt. samas: Liina Leiten. Korgitser viib viimase takistuse enne naudingut

  18. Viktor Rõzhakov : teatr - eto bezdonnoje prostrantstvo / Viktor Rõzhakov ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Rõžakov, Viktor

    2006-01-01

    Vene Teatri väikeses saalis esietendus Aleksandr Volodini näidend "Kallimast ei lahkuta", mille lavastas teistkordselt V. Rõzhakov. Eesti Draamateatris on plaanis lavastada Ivan Võrõpajevi "Valentinipäev"

  19. Whole-body MR angiography with body coil acquisition at 3 T in patients with peripheral arterial disease using the contrast agent gadofosveset trisodium

    DEFF Research Database (Denmark)

    Nielsen, Yousef W; Eiberg, Jonas P; Løgager, Vibeke B

    2009-01-01

    Whole-body magnetic resonance angiography (WB-MRA) at 3 T with body coil acquisition has not previously been investigated. In this study, WB-MRA was performed in this manner using the blood pool contrast agent gadofosveset trisodium....

  20. JPRS Report, Soviet Union, Political Affairs, On Stalin and Stalinism: Historical Essays by Roy Medvedev

    Science.gov (United States)

    1989-07-05

    Aleksandr were arrested. In 1917, when they were still boys, they helped hide Lenin in Razliv. A. V. Shotman, an old Bolshevik who led the famous...Bratanovskiy, Ye. S. Kogan , N. V. Margolin, N. I. Dedikov, V. S. Yegorov, M. M. Kulkov and S. Z. Korytnyy, chairman of the Moscow Oblast...secretary of the Komsomol from 1924-1928, perished. Aleksandr Milchakov, the general secretary of the Cen- tral Committee of the Komsomol during 1928

  1. JPRS Report, Science & Technology, USSR: Space.

    Science.gov (United States)

    1988-08-17

    Reconstruction of Inner Coma of Halley’s Comet Determined Using TV Information From ’Vega’ Spacecraft [A. Yu. Kogan , V. N. Kheyfets; KOSMICHESKIYE...Romanenko and Aleksandr Laveykin had unfolded during two strenuous egresses in June, had to be replaced. From the standpoint of rate of deteriora- tion...as compared with your own egress?," I asked Aleksandr Laveykin, who was watching his friends with interest as they repeated well-known operations

  2. Study of Adversarial and Defensive Components in an Experimental Machinery Control Systems Laboratory Environment

    Science.gov (United States)

    2014-09-01

    http://www.digitalbond.com/tools/quickdraw/ s7_brute_offline.py Aleksandr Timorin Cross- platform (Python) S7 offline password bruteforce based...scada-tools s7-1500_brute_offline.py Aleksandr Timorin Cross- platform (Python) Offline password bruteforce based on challenge-response data...ECOM Bruteforce auxiliary/scanner/scada/koyo_login.rb modicon_command.rb x Digital Bond Schneider Modicon Quantum Crendential Disclosure

  3. Magnetic Resonance Angiography Using Fresh Blood Imaging in Oral and Maxillofacial Regions

    OpenAIRE

    Oda, Masafumi; Tanaka, Tatsurou; Kito, Shinji; Habu, Manabu; Kodama, Masaaki; Kokuryo, Shinya; Miyamoto, Ikuya; Yoshiga, Daigo; Yamauchi, Kensuke; Nogami, Shinnosuke; Wakasugi-Sato, Nao; Matsumoto-Takeda, Shinobu; Ishikawa, Ayataka; Nishida, Ikuko; Saeki, Katsura

    2012-01-01

    The present paper provides general dentists with an introduction to the clinical applications and significance of magnetic resonance angiography (MRA) in the oral and maxillofacial regions. Specifically, the method and characteristics of MRA are first explained using the relevant MR sequences. Next, clinical applications to the oral and maxillofacial regions, such as identification of hemangiomas and surrounding vessels by MRA, are discussed. Moreover, the clinical significance of MRA for oth...

  4. Diagnostic accuracy of contrast-enhanced MR angiography and unenhanced proton MR imaging compared with CT pulmonary angiography in chronic thromboembolic pulmonary hypertension

    International Nuclear Information System (INIS)

    Rajaram, Smitha; Swift, Andrew J.; Wild, Jim M.; Capener, David; Telfer, Adam; Davies, Christine; Hill, Catherine; Condliffe, Robin; Elliot, Charles; Kiely, David G.; Hurdman, Judith

    2012-01-01

    To evaluate the diagnostic accuracy of contrast-enhanced MR angiography (CE-MRA) and the added benefit of unenhanced proton MR angiography compared with CT pulmonary angiography (CTPA) in patients with chronic thromboembolic disease (CTE). A 2 year retrospective study of 53 patients with chronic thromboembolic pulmonary hypertension who underwent CTPA and MRI for suspected pulmonary hypertension and a control group of 36 patients with no CT evidence of pulmonary embolism. The MRI was evaluated for CTE and the combined diagnostic accuracy of ce-MRA and unenhanced proton MRA was determined. CE-MRA generated lung perfusion maps were also assessed. The overall sensitivity and specificity of CE-MRA in diagnosing proximal and distal CTE were 98% and 94%, respectively. The sensitivity improved from 50% to 88% for central vessel disease when CE-MRA images were analysed with unenhanced proton MRA. The CE-MRA identified more stenoses (29/18), post-stenosis dilatation (23/7) and occlusions (37/29) compared with CTPA. The CE-MRA perfusion images showed a sensitivity of 92% for diagnosing CTE. CE-MRA has high sensitivity and specificity for diagnosing CTE. The sensitivity of CE-MRA for visualisation of adherent central and lobar thrombus significantly improves with the addition of unenhanced proton MRA which delineates the vessel wall. (orig.)

  5. Diagnostic accuracy of contrast-enhanced MR angiography and unenhanced proton MR imaging compared with CT pulmonary angiography in chronic thromboembolic pulmonary hypertension

    Energy Technology Data Exchange (ETDEWEB)

    Rajaram, Smitha [Unit of Academic Radiology, University of Sheffield, Sheffield (United Kingdom); Academic Unit of Radiology, C Floor, Royal Hallamshire Hospital, Sheffield (United Kingdom); Swift, Andrew J.; Wild, Jim M. [Unit of Academic Radiology, University of Sheffield, Sheffield (United Kingdom); Sheffield Cardiovascular Biomedical Research Unit, Sheffield (United Kingdom); Capener, David; Telfer, Adam [Unit of Academic Radiology, University of Sheffield, Sheffield (United Kingdom); Davies, Christine; Hill, Catherine [Sheffield Teaching Hospitals Trust, Department of Radiology, Sheffield (United Kingdom); Condliffe, Robin; Elliot, Charles; Kiely, David G. [Sheffield Pulmonary Vascular Disease Unit, Royal Hallamshire Hospital, Sheffield Teaching Hospitals NHS Foundation Trust, Sheffield (United Kingdom); Sheffield Cardiovascular Biomedical Research Unit, Sheffield (United Kingdom); Hurdman, Judith [Sheffield Pulmonary Vascular Disease Unit, Royal Hallamshire Hospital, Sheffield Teaching Hospitals NHS Foundation Trust, Sheffield (United Kingdom)

    2012-02-15

    To evaluate the diagnostic accuracy of contrast-enhanced MR angiography (CE-MRA) and the added benefit of unenhanced proton MR angiography compared with CT pulmonary angiography (CTPA) in patients with chronic thromboembolic disease (CTE). A 2 year retrospective study of 53 patients with chronic thromboembolic pulmonary hypertension who underwent CTPA and MRI for suspected pulmonary hypertension and a control group of 36 patients with no CT evidence of pulmonary embolism. The MRI was evaluated for CTE and the combined diagnostic accuracy of ce-MRA and unenhanced proton MRA was determined. CE-MRA generated lung perfusion maps were also assessed. The overall sensitivity and specificity of CE-MRA in diagnosing proximal and distal CTE were 98% and 94%, respectively. The sensitivity improved from 50% to 88% for central vessel disease when CE-MRA images were analysed with unenhanced proton MRA. The CE-MRA identified more stenoses (29/18), post-stenosis dilatation (23/7) and occlusions (37/29) compared with CTPA. The CE-MRA perfusion images showed a sensitivity of 92% for diagnosing CTE. CE-MRA has high sensitivity and specificity for diagnosing CTE. The sensitivity of CE-MRA for visualisation of adherent central and lobar thrombus significantly improves with the addition of unenhanced proton MRA which delineates the vessel wall. (orig.)

  6. Endothelin-1 and endothelin-2 initiate and maintain contractile responses by different mechanisms in rat mesenteric and cerebral arteries

    DEFF Research Database (Denmark)

    Compeer, M. G.; Janssen, G. M. J.; De Mey, J. G. R.

    2013-01-01

    , but relaxed ET-1-induced contractions in MRA. A PLC inhibitor prevented contractile responses to ET-1 and ET-2 in MRA and BA, and relaxed ET-1- and ET-2-induced responses in MRA and ET-1 effects in BA. A Rho-kinase inhibitor did not modify sensitivity, maximum and maintenance of responses to both peptides...... in both arteries but relaxed ET-2, but not ET-1, effects in MRA and ET-1 effects in BA. Conclusions and ImplicationsPLC played a key role in arterial contractile responses to ETs, but ET-1 and ET-2 initiated and maintained vasoconstriction through different mechanisms, and these differed between MRA...

  7. Magnetic Resonance Angiography Using Fresh Blood Imaging in Oral and Maxillofacial Regions

    Science.gov (United States)

    Oda, Masafumi; Tanaka, Tatsurou; Kito, Shinji; Habu, Manabu; Kodama, Masaaki; Kokuryo, Shinya; Miyamoto, Ikuya; Yoshiga, Daigo; Yamauchi, Kensuke; Nogami, Shinnosuke; Wakasugi-Sato, Nao; Matsumoto-Takeda, Shinobu; Ishikawa, Ayataka; Nishida, Ikuko; Saeki, Katsura; Morikawa, Kazumasa; Matsuo, Kou; Seta, Yuji; Yamashita, Yoshihiro; Maki, Kenshi; Tominaga, Kazuhiro; Morimoto, Yasuhiro

    2012-01-01

    The present paper provides general dentists with an introduction to the clinical applications and significance of magnetic resonance angiography (MRA) in the oral and maxillofacial regions. Specifically, the method and characteristics of MRA are first explained using the relevant MR sequences. Next, clinical applications to the oral and maxillofacial regions, such as identification of hemangiomas and surrounding vessels by MRA, are discussed. Moreover, the clinical significance of MRA for other regions is presented to elucidate future clinical applications of MRA in the oral and maxillofacial regions. PMID:23118751

  8. Magnetic Resonance Angiography Using Fresh Blood Imaging in Oral and Maxillofacial Regions

    Directory of Open Access Journals (Sweden)

    Masafumi Oda

    2012-01-01

    Full Text Available The present paper provides general dentists with an introduction to the clinical applications and significance of magnetic resonance angiography (MRA in the oral and maxillofacial regions. Specifically, the method and characteristics of MRA are first explained using the relevant MR sequences. Next, clinical applications to the oral and maxillofacial regions, such as identification of hemangiomas and surrounding vessels by MRA, are discussed. Moreover, the clinical significance of MRA for other regions is presented to elucidate future clinical applications of MRA in the oral and maxillofacial regions.

  9. Accuracy of 3 T MR angiography in vertebral artery stenosis and coincidence with other cerebrovascular stenoses

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hyun Seok; Kim, Dong Ik; Kim, Dong Joon; Kim, Jinna; Kim, Eun Soo; Lee, Seung-Koo [Yonsei University College of Medicine, Department of Radiology, Seoul (Korea, Republic of)

    2010-10-15

    Ostium of vertebral artery (VA) is a common site of pseudostenosis on contrast-enhanced MR angiography (CE-MRA). The purpose of this study was to determine the diagnostic accuracy of CE-MRA at 3 T in the evaluation of ostial stenosis of VA and to find associated coincidental stenoses using logistic regression analysis. One hundred and thirty-five VA ostial regions from 72 patients who received CE-MRA of neck vessels, intracranial time of flight (TOF) MRA, and digital subtraction angiography (DSA) were retrospectively reviewed. The sensitivity and specificity of the CE-MRA in detection of ostial stenosis were calculated with reference standard of DSA. Ostial stenosis on MRA was correlated with coincidental lesions in intracranial and cervical arteries by logistic regression analysis. The sensitivity and specificity of the CE-MRA were 100% and 80.4% for detection of significant stenosis. In case of significant stenoses, CE-MRA showed a tendency of overestimation with a false-positive rate of 52.5%. Logistic regression analysis showed that the stenoses of middle cerebral artery (MCA) on TOF MRA was associated with significant stenoses of VA ostia (OR = 5.84, 95% confidence intervals 1.41-24.17). CE-MRA is sensitive in detection of VA ostial stenosis although it has high false-positive rate. True positive ostial stenosis should be considered in cases of coincidental stenoses of MCA on TOF MRA. (orig.)

  10. Accuracy of 3 T MR angiography in vertebral artery stenosis and coincidence with other cerebrovascular stenoses

    International Nuclear Information System (INIS)

    Choi, Hyun Seok; Kim, Dong Ik; Kim, Dong Joon; Kim, Jinna; Kim, Eun Soo; Lee, Seung-Koo

    2010-01-01

    Ostium of vertebral artery (VA) is a common site of pseudostenosis on contrast-enhanced MR angiography (CE-MRA). The purpose of this study was to determine the diagnostic accuracy of CE-MRA at 3 T in the evaluation of ostial stenosis of VA and to find associated coincidental stenoses using logistic regression analysis. One hundred and thirty-five VA ostial regions from 72 patients who received CE-MRA of neck vessels, intracranial time of flight (TOF) MRA, and digital subtraction angiography (DSA) were retrospectively reviewed. The sensitivity and specificity of the CE-MRA in detection of ostial stenosis were calculated with reference standard of DSA. Ostial stenosis on MRA was correlated with coincidental lesions in intracranial and cervical arteries by logistic regression analysis. The sensitivity and specificity of the CE-MRA were 100% and 80.4% for detection of significant stenosis. In case of significant stenoses, CE-MRA showed a tendency of overestimation with a false-positive rate of 52.5%. Logistic regression analysis showed that the stenoses of middle cerebral artery (MCA) on TOF MRA was associated with significant stenoses of VA ostia (OR = 5.84, 95% confidence intervals 1.41-24.17). CE-MRA is sensitive in detection of VA ostial stenosis although it has high false-positive rate. True positive ostial stenosis should be considered in cases of coincidental stenoses of MCA on TOF MRA. (orig.)

  11. Intraindividual assessment of the thoracic aorta using contrast and non-contrast-enhanced MR angiography

    International Nuclear Information System (INIS)

    Tengg-Kobligk, Hendrik von; Gruenberg, K.M.; Giesel, F.L.; Ley-Zaporozhan, J.; Ley, S.; Henninger, V.; Kauczor, H.U.; Radiologische Universitaetsklinik Heidelberg; Boeckler, D.; Krummenauer, F.

    2009-01-01

    To avoid intravenous contrast media application, new MRA sequences using inherent blood contrast are available. The clinical use of these non-contrast-enhanced MRA (non-CE-MRA) sequences is still limited for the aorta. Thus, the goal was to compare a standard CE-MRA with a non-CE-MRA for the thoracic aorta. Ethics committee approval and informed consent were obtained. CE-MRA and non-CE-MRA (1.5T) were performed in the same 50 healthy volunteers (mean age: 48). CE-MRA: GRE-Turbo-Flash-3D (1.2 x 1.2 x 1.6 mm 3 ), 0.15 mmol Gd/kg, TA 22 ± 2sec. Non-CE-MRA: Respiratory-and cardiac-gated, T 2-prepared 3D-trueFISP (1.2 x 1.2 x 1.3 mm 3 ), TA 14 ± 5 min. Assessment included (3 readers, consensus): image quality (sharpness of vessel wall, signal homogeneity, artifacts) at the ascending aorta, arch, descending aorta and supra-aortic vessels. The image quality in the ascending aorta was rated 'excellent' in 78 %, 'moderate' in 22 %, 'poor' in 0 % for non-CE-MRA versus 22 %, 50 %, and 28 % for CE-MRA (Cohen's kappa = 29 %, McNemar p < 0.001). In a comparison of non-CE-MRA versus CE-MRA, the aortic arch and descending aorta showed no significant difference (kappa = 58 %/p = 0.250 and kappa = 100 %/p 1.000, respectively). Supra-aortic vessels were rated 'excellent' 45 %/49 %, 'moderate' 30 %/49 % and 'poor' 13 %/2 %, 12 % of supra-aortic vessels were visualized < 1 cm at non-CE-MRA. (orig.)

  12. Non-enhanced MR angiography of renal arteries - Comparison with contrast-enhanced MR angiography

    Energy Technology Data Exchange (ETDEWEB)

    Angeretti, M. G.; Lumia, D.; Cani, A.; Barresi, M.; Cardim, L Nocchi; Piacentino, F.; Genovese, E. A.; Fugazzola, C. [Dept. of Radiology, Insubria Univ., Ospedale di Circolo e Fondazione Macchi, Varese (Italy)], e-mail: laranocchi@gmail.com; Maresca, A. M. [Dept. of Internal Medicine, Insubria Univ., Ospedale di Circolo e Fondazione Macchi, Varese (Italy); Novario, R. [Dept. of Medical Physics, Insubria Univ., Ospedale di Circolo e Fondazione Macchi, Varese (Italy)

    2013-09-15

    Background: The main causes of renal artery stenosis (RAS) are atherosclerosis and fibromuscular dysplasia. Despite contrast-enhanced magnetic resonance angiography (CE-MRA) being a safe and reliable method for diagnosis of RAS especially in young individuals, recently it has been possible to adopt innovative technologies that do not require paramagnetic contrast agents. Purpose: To assess the accuracy of steady-state free-precession (SSFP) non-contrast-enhanced magnetic resonance angiography (NC-MRA) by using a 1.5 T MR scanner for the detection of renal artery stenosis, in comparison with breath-hold CE-MRA as the reference standard. Material and Methods: Sixty-three patients (33 men, 30 women) with suspected renovascular hypertension (RVHT) were examined by a 1.5T MR scanner; NC-MRA with an electrocardiography (ECG)-gated SSFP sequence was performed in 58.7% (37/63) of patients; in 41.3% (26/63) of patients a respiratory trigger was used in addition to cardiac gating. CE-MRA, with a three-dimensional gradient echo (3D-GRE) T1-weighted sequence, was performed in all patients within the same session. Maximum intensity projection (MIP) image quality, number of renal arteries, and the presence of stenosis were assessed by two observers (independently for NC-MRA and together for CE-MRA). The agreement between NC-MRA and CE-MRA as well as the inter-observer reproducibility were calculated with Bland-Altman plots. Results: MIP image quality was considered better for NC-MRA. NC-MRA identified 143 of 144 (99.3%) arteries detected by CE-MRA (an accessory artery was not identified). Fourteen stenoses were detected by CE-MRA (11 atherosclerotic, 3 dysplastic) with four of 14 (28.5%) significant stenosis. Bland-Altman plot demonstrated an excellent concordance between NC-MRA and CE-MRA; particularly, the reader A evaluated correctly all investigated arteries, while over-estimation of two stenoses occurred for reader B. Regarding NC-MRA, inter-observer agreement was excellent

  13. ECG-gated quiescent-interval single-shot MR angiography of the lower extremities: Initial experience at 3 T

    International Nuclear Information System (INIS)

    Knobloch, G.; Gielen, M.; Lauff, M.-T.; Romano, V.C.; Schmitt, P.; Rick, M.; Kröncke, T.J.; Huppertz, A.; Hamm, B.; Wagner, M.

    2014-01-01

    Aim: To evaluate the feasibility of unenhanced electrocardiography (ECG)-gated quiescent-interval single-shot magnetic resonance angiography (QISS-MRA) of the lower extremities at 3 T. Materials and methods: Twenty-five patients with known or suspected peripheral arterial disease underwent ECG-gated QISS-MRA and contrast-enhanced MRA (CE-MRA) at 3 T. Two independent readers performed a per-segment evaluation of the MRA datasets. Image quality was rated on a four-point scale (1 = excellent to 4 = non-diagnostic; presented as medians with interquartile range). Diagnostic performance of QISS-MRA was evaluated using CE-MRA as the reference standard. Results: QISS-MRA and CE-MRA of all patients were considered for analysis, resulting in 807 evaluated vessel segments for each MRA technique. Readers 1 and 2 rated image quality of QISS-MRA as diagnostic in 97.3% and 97% of the vessel segments, respectively. CE-MRA was rated diagnostic in all vessel segments. Image quality of the proximal vessel segments, including the infrarenal aorta, iliac arteries, and common femoral artery, was significantly lower on QISS-MRA compared to CE-MRA [image quality score across readers: 2 (1,3) versus 1 (1,1) p < 0.001]. In the more distal vessel segments, image quality of QISS-MRA was excellent and showed no significant difference compared to CE-MRA [image quality score across readers: 1 (1,1) versus 1 (1,1) p = 0.036]. Diagnostic performance of QISS-MRA was as follows (across readers): sensitivity: 87.5% (95% CI: 80.2–92.4%); specificity: 96.1% (95% CI: 93.6–97.6%); diagnostic accuracy: 94.9% (95% CI: 92.6–96.5%). Conclusions: QISS-MRA of the lower extremities is feasible at 3 T and provides high image quality, especially in the distal vessel segments

  14. Magnetic resonance angiography of the carotid arteries: comparison of unenhanced and contrast enhanced techniques

    Energy Technology Data Exchange (ETDEWEB)

    Kramer, Harald; Nikolaou, Konstantin; Reiser, Maximilian F. [Ludwig Maximilians University, Department of Clinical Radiology, University Hospitals Munich, Grosshadern Campus, Munich (Germany); Runge, Val M. [University of Texas Medical Branch, Department of Radiology, Galveston, TX (United States); Morelli, John N.; Williams, Kenneth D.; Naul, L.G. [Scott and White Memorial Hospital, Department of Radiology, Temple, TX (United States); Wintersperger, Bernd J. [Ludwig Maximilians University, Department of Clinical Radiology, University Hospitals Munich, Grosshadern Campus, Munich (Germany); University of Toronto, Department of Medical Imaging, UHN, MSH and WCH, Toronto (Canada)

    2011-08-15

    To compare different techniques for carotid imaging including contrast-enhanced, unenhanced and dynamic techniques to find an alternative to contrast-enhanced MRA. 43 patients referred for imaging of the carotids were enrolled in this IRB-approved study. Imaging included dark-blood, time-of-flight, ECG-gated SSFP and dynamic and static contrast-enhanced MRA. Two radiologists evaluated all datasets in terms of image quality (vessel lumen, signal homogeneity, diagnostic confidence, preferred technique) on a four-point Likert-scale and in measuring the vessel area. Of the 43 included patients the first 8 subjects served for protocol optimisation and 4 individuals discontinued the examination. Thus 31 datasets served for evaluation. CE-MRA revealed best results for delineation of vessel lumen, signal homogeneity and diagnostic confidence with values of 3.61, 3.42 and 3.77. It was also rated as the most preferred technique. SSFP-MRA was rated second in all categories with values of 3.1, 2.9 and 3.11. This unenhanced technique was the only one showing non-significantly different results in quantitative analysis. SSFP-MRA, an unenhanced form of MRA, represents an alternative to CE-MRA, particularly in patients where administration of gadolinium for CE-MRA may be contraindicated. In contrast to other techniques, SSFP-MRA serves with not significant different results compared to standard CE-MRA. (orig.)

  15. Compressed Sensing 3-Dimensional Time-of-Flight Magnetic Resonance Angiography for Cerebral Aneurysms: Optimization and Evaluation.

    Science.gov (United States)

    Fushimi, Yasutaka; Fujimoto, Koji; Okada, Tomohisa; Yamamoto, Akira; Tanaka, Toshiyuki; Kikuchi, Takayuki; Miyamoto, Susumu; Togashi, Kaori

    2016-04-01

    The aims of this study were to optimize parameters for Nesterov algorithm (NESTA) in reconstruction of 3-dimensional time-of-flight (TOF) magnetic resonance angiography (MRA) at 3 T by performing an exhaustive search and to validate the performance of compressed sensing (CS) by applying it to data from cerebral aneurysms and evaluating diagnostic quality. Three-dimensional TOF-MRA was obtained using a 3 T MR system with a 32-channel head coil for both healthy volunteers and 10 patients (11 aneurysms). No undersampling was applied for imaging parameters, including parallel imaging or other partial Fourier sampling. In the first step, the experimental setup was for healthy subjects to optimize CS parameters of NESTA and the undersampling mask pattern, so 24,696 different reconstruction conditions were surveyed for sampling rates of 8.0X and 5.0X. Mean square error (MSE) was calculated for each image reconstructed with the undersampling pattern and CS parameter sets. Evaluation was by normalized MSE, edge sharpness for MRA reconstructed using fully sampled data (MRA-full), zero-filled MRA (ZF-MRA) with Poisson disk undersampling mask, and CS-MRA (5.0X and 8.0X) with iterations of 5, 10, 15, 20, 25, 30, 35, 40, 45, and 50. CS-MRA (5.0X and 8.0X) with 5, 10, and 50 iterations of the sampling pattern and CS parameter set with the lowest MSE were visually inspected by 2 neuroradiologists to check the diagnostic quality. The sampling pattern and CS parameter set with the lowest MSE were identical for both CS-MRA 5.0X and CS-MRA 8.0X. At the initial 5 to 15 iterations, MSE of both sampling rates greatly decreased from that of ZF-MRA. For subsequent iterations, the decrease in MSE was relatively small. For CS-MRA, sharpness greatly increased from that of ZF-MRA within the initial 5 to 15 iterations, followed by slight increases with further iterations. Two neuroradiologists graded most aneurysms as excellent, with the exception of 1 to 4 aneurysms recognized as good by 1

  16. Magnetic resonance arthrography in chronic wrist pain

    International Nuclear Information System (INIS)

    Valeri, G.; Ferrara, C.; Carloni, S.

    1999-01-01

    The purpose of this paper is to investigate the clinical role of Magnetic Resonance Arthrography (MRA) of the wrist in subjects with chronic pain. Thirty-five patients complaining of wrist pain for more than 6 months were submitted to MRI an MRA. All patients received and intra-articular injection of 2-10 mL of a 10 mmol saline solution of Gd-DPTA. The overall diagnostic accuracy rates of MRI and MRA were 40% and 81% respectively, with sensitivity and specificity of 63% and 39% (MRI) and of 82% and 79% (MRA). The conclusion is that compared with MRI, MRA can be considered a useful tool for the visualization of interosseus carpal ligaments and of the triangular fibrocartilage complex. MRA also helps detect injuries in these structures [it

  17. Three-dimensional black blood MR angiography of the liver during breath holding. A comparison with two-dimensional time-of-flight MR angiography

    International Nuclear Information System (INIS)

    Suto, Y.; Ohuchi, Y.; Kimura, T.; Shirakawa, T.; Mizuuchi, N.; Takizawa, O.; Yamane, T.; Kamba, M.; Moriyama, S.; Ohta, Y.

    1994-01-01

    In 2-D time-of-flight MR angiography (2-D TOF MRA) of the liver, artifacts caused by respiratory motion are unavoidable. Therefore, a 3-D black blood MRA of the liver was attempted in 7 healthy volunteers, using a 3-D gradient echo sequence which allows imaging during breath holding. 2-D TOF MRA was performed as well. In all subjects, 3-D MRA allowed visualization of the trunk, 1st-, and 2nd-order branches of the portal vein without interruption. Right 3rd-order branches were visualized without interruption in 6 of 7 subjects (85%). However, with 2-D MRA, the transverse portion of the left main portal vein could not be visualized in any subject, and the periphery of the portal vein was less clear than with 3-D MRA. (orig.)

  18. Non-contrast-enhanced MR angiography in critical limb ischemia: performance of quiescent-interval single-shot (QISS) and TSE-based subtraction techniques

    International Nuclear Information System (INIS)

    Altaha, Mustafa A.; Jaskolka, Jeffrey D.; Tan, Kongteng; Menezes, Ravi J.; Rick, Manuela; Schmitt, Peter; Wintersperger, Bernd J.

    2017-01-01

    The aim of this study was to evaluate diagnostic performance of non-contrast-enhanced 2D quiescent-interval single-shot (QISS) and 3D turbo spin-echo (TSE)-based subtraction magnetic resonance angiography (MRA) in the assessment of peripheral arteries in patients with critical limb ischemia (CLI). Nineteen consecutive patients (74 % male, 72.8 ± 9.9 years) with CLI underwent 2D QISS and 3D TSE-based subtraction MRA at 1.5 T. Axial-overlapping QISS MRA (3 mm/2 mm; 1 x 1 mm 2 ) covered from the toes to the aortic bifurcation while coronal 3D TSE-based subtraction MRA (1.3 x 1.2 x 1.3 mm 3 ) was restricted to the calf only. MRA data sets (two readers) were evaluated for stenosis (≥50 %) and image quality. Results were compared with digital subtraction angiography (DSA). Two hundred and sixty-seven (267) segments were available for MRA-DSA comparison, with a prevalence of stenosis ≥50 % of 41.9 %. QISS MRA was rated as good to excellent in 79.5-96.0 % of segments without any nondiagnostic segments; 89.8-96.1 % of segments in 3D TSE-based subtraction MRA were rated as nondiagnostic or poor. QISS MRA sensitivities and specificities (segmental) were 92 % and 95 %, respectively, for reader one and 81-97 % for reader two. Due to poor image quality of 3D TSE-based subtraction MRA, diagnostic performance measures were not calculated. QISS MRA demonstrates excellent diagnostic performance and higher robustness than 3D TSE-based subtraction MRA in the challenging patient population with CLI. (orig.)

  19. State of the science: does the theory of maternal role attainment apply to African American motherhood?

    Science.gov (United States)

    Fouquier, Katherine Ferrell

    2013-01-01

    This article reviews the current state of knowledge of the theory of maternal role attainment (MRA) and its relevance in describing African American motherhood. EBSCOhost Research Databases that included PubMed, CINAHL plus, MEDLINE, PsycINFO, SCOPUS, and Web of Science were searched for journal articles that examined maternal identity and MRA. Keyword searches included maternal identity, maternal role attainment, becoming a mother, prenatal attachment, maternal-fetal attachment, and maternal-infant attachment. Inclusion criteria for this review were published journal articles of studies conducted in the United States, with a clear delineation of the theoretical framework of MRA. Journal articles that measured MRA among women with depression or medically fragile infants were excluded. Two hundred and twelve studies were reviewed; 25 studies, published between 1975 and 2007, met the inclusion criteria. Nine articles described the theory of MRA, 11 articles measured variables thought to influence MRA, and 6 articles described maternal-fetal attachment, a construct of MRA. Studies were reviewed, categorized, and analyzed to determine current knowledge of how the theory of MRA describes African American motherhood. Categories included studies describing the theoretical framework of maternal identity and MRA, studies measuring key variables thought to impact MRA, and studies measuring maternal-fetal attachment and maternal-infant attachment. The studies were limited by homogenous samples of upper-middle-class white women and low-income, single, African American adolescents. Study results of MRA cannot be generalized to African American women. Further research is essential to identify attributes influencing MRA, specifically among larger samples of African American women with demographics similar to that of the white populations that have been included in studies thus far. © 2013 by the American College of Nurse-Midwives.

  20. Non-contrast-enhanced MR angiography in critical limb ischemia: performance of quiescent-interval single-shot (QISS) and TSE-based subtraction techniques

    Energy Technology Data Exchange (ETDEWEB)

    Altaha, Mustafa A. [University Health Network, Department of Medical Imaging, Peter Munk Cardiac Centre, Toronto, Ontario (Canada); Jaskolka, Jeffrey D.; Tan, Kongteng; Menezes, Ravi J. [University Health Network, Department of Medical Imaging, Peter Munk Cardiac Centre, Toronto, Ontario (Canada); University of Toronto, Department of Medical Imaging, Toronto, Ontario (Canada); Rick, Manuela; Schmitt, Peter [Siemens Healthcare, Erlangen (Germany); Wintersperger, Bernd J. [University Health Network, Department of Medical Imaging, Peter Munk Cardiac Centre, Toronto, Ontario (Canada); University of Toronto, Department of Medical Imaging, Toronto, Ontario (Canada); Toronto General Hospital, Department of Medical Imaging, Toronto, Ontario (Canada)

    2017-03-15

    The aim of this study was to evaluate diagnostic performance of non-contrast-enhanced 2D quiescent-interval single-shot (QISS) and 3D turbo spin-echo (TSE)-based subtraction magnetic resonance angiography (MRA) in the assessment of peripheral arteries in patients with critical limb ischemia (CLI). Nineteen consecutive patients (74 % male, 72.8 ± 9.9 years) with CLI underwent 2D QISS and 3D TSE-based subtraction MRA at 1.5 T. Axial-overlapping QISS MRA (3 mm/2 mm; 1 x 1 mm{sup 2}) covered from the toes to the aortic bifurcation while coronal 3D TSE-based subtraction MRA (1.3 x 1.2 x 1.3 mm{sup 3}) was restricted to the calf only. MRA data sets (two readers) were evaluated for stenosis (≥50 %) and image quality. Results were compared with digital subtraction angiography (DSA). Two hundred and sixty-seven (267) segments were available for MRA-DSA comparison, with a prevalence of stenosis ≥50 % of 41.9 %. QISS MRA was rated as good to excellent in 79.5-96.0 % of segments without any nondiagnostic segments; 89.8-96.1 % of segments in 3D TSE-based subtraction MRA were rated as nondiagnostic or poor. QISS MRA sensitivities and specificities (segmental) were 92 % and 95 %, respectively, for reader one and 81-97 % for reader two. Due to poor image quality of 3D TSE-based subtraction MRA, diagnostic performance measures were not calculated. QISS MRA demonstrates excellent diagnostic performance and higher robustness than 3D TSE-based subtraction MRA in the challenging patient population with CLI. (orig.)

  1. Comparison of MR angiography with conventional angiography in cervical and intracranial vascular disease

    International Nuclear Information System (INIS)

    Choi, D. S.; Chang, K. H.; Jung, H. W.; Han, M. H.

    1995-01-01

    To assess the usefulness of magnetic resonance angiography (MRA) in evaluation of stenosis of carotid and large cerebral vessels and cerebral aneurysm. Twenty-seven patients with either arterial stenosis in cervical or intracranial major vessels (n = 18) or cerebral aneurysm (n = 8) or both (n 1) were examined with both MRA and conventional angiography (CA). MRA was performed with 3D TOF technique with magnetization transfer suppression at 1.5T system (Magnetom, Siemens, Germany); both intracranial MRA and cervical MRA in 16 patients, intracranial MRA only in the remaining patients. For evaluation of arterial stenosis, 32 carotid bifurcations and 383 segments of intracranial major vessels were assessed in blind fashion, and were compared with those of CA. Each arterial segment was arbitrarily classified into one of five grades (< 10, 10-49, 50-74, 75-99, 100%) for carotid bifurcation and one of four (< 10, 10-49, 50-99, 100%) for intracranial vessels. For aneurysm, its location, size shape and direction were compared. For arterial stenosis, concordance rate between MRA and CA was 88% (28/32) in carotid bifurcation and 89% (340/383) in intracranial vessels. All discordant cases were overgraded on MRA. For aneurysm, 7 of 9 were demonstrated on both MRA and CA, one of which was partially demonstrated on MRA. One of the other two patients showed aneurysm only on MRA, whereas the remaining one revealed aneurysm only on CA. MRA may be performed as a screening test for occlusive disease of cervical and major intracranial vessels and cerebral aneurysm

  2. USSR and Eastern Europe Scientific Abstracts, Cybernetics, Computers and Automation Technology, Number 34

    Science.gov (United States)

    1978-07-26

    pp Ul-ljlt manuscript received 9 Mar 77 D0LG0P0L0V, ALEKSANDR SERGYEVICH, senior engineer, Pskov Radio Components Plant (Pskov) and...Jul 76 B0R0DKIN, A. M., B0R0DKIN, L. I., GURIN, N. N., KOGAN , YA. A., LYAPICHEVA, N. G. and MUCHNIK, I. B., Moscow [Abstract] The optimal speed...Kiev); GULYAYEV, ALEKSANDR IVANOVICH, candidate in technical sciences, RIUTs, Ministry of Public Health UkrSSR (Kiev); and DEMENTKOVA, ANNA

  3. MRI of the Chest

    Medline Plus

    Full Text Available ... Angiography (MRA) Magnetic Resonance Imaging (MRI) Safety Contrast Materials MRI Safety During Pregnancy Images related to Magnetic Resonance Imaging (MRI) - Chest Sponsored by Please note ...

  4. Detection of the delayed cerebral vasospams by MR angiography

    Energy Technology Data Exchange (ETDEWEB)

    Ueyama, Takehiko; Kuwamura, Keiichi; Saitoh, Minoru; Mandai, Kazuhiro; Takaishi, Yoshiyuki (Hyogo Prefectural Awaji Hospital, Sumoto (Japan))

    1994-05-01

    The usefulness of MR angiography (MRA) for the detection of the cerebral vasospasm after subarachnoid hemorrhage (SAH) was studied. Fourteen out of 69 patients of SAH between Jan 1992 and Dec 1993 underwent both CAG and MRA at the time of pre-spasm, spasm and postspasm period. MRA was performed using an MRT-200FXII(Toshiba Corp., Tokyo. 1.5T). Most images were obtained using the 3D-TOF subtraction method. Cerebral arteries were divided into 4 portions, which consisted of A[sub 1], A[sub 2] and M[sub 1], M[sub 2]. The angiographical findings of both CAG and MRA were studied at each divided area (such as M[sub 1] or M[sub 2]) in the view of the presence or absence of vasospasm. Cerebral vasospasm on CAG and MRA were defined as arteries with a caliber less than 75% and 50% of the original size respectively. The compatibilities between the findings of MRA and CAG were 98% at the territory of ACA and 91% at MCA. The territory of 22% of the arteries was not visualized on MRA due to the artifact caused by aneurysmal clips. However, the total compatibility of MRA and CAG was 94%. The MRA is useful and will become the noninvasive diagnostic tool for the detection of the cerebral vasospasm. (author).

  5. Translational value of mechanical and vasomotor properties of mouse isolated mesenteric resistance-sized arteries

    DEFF Research Database (Denmark)

    Outzen, Emilie Middelbo; Zaki, Marina; Abdolalizadeh, Bahareh

    2015-01-01

    Mice are increasingly used in vascular research for studying perturbations and responses to vasoactive agents in small artery preparations. Historically, small artery function has preferably been studied in rat isolated mesenteric resistance-sized arteries (MRA) using the wire myograph technique...... for maximal active force development in mouse MRA were not significantly different to those determined in rat MRA. Furthermore, we found that the observed concentration-dependent vasomotor responses of mouse MRA to noradrenaline, phenylephrine, angiotensin II, sarafotoxin 6c, 5-hydroxytryptamine, carbachol...

  6. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... MraW [Rickettsia typhi str. Wilmington] ... Length = 304 ... Query: 2 ... SQYHIPVMLSEVLEVLAPKGYESYLDCTFGAGGYSNAIL...KSCYCSVTSLDCDPHVIERVE 61 ... SQYHIPVMLSEVLEVLAPKGYESYLDCTFGAGGYSNAIL...KSCYCSVTSLDCDPHVIERVE Sbjct: 1 ... SQYHIPVMLSEVLEVLAPKGYESYLDCTFGAGGYSNAILKSCYCSVTSLDCDPHVIERVE 60

  7. Nonenhanced MR angiography techniques

    International Nuclear Information System (INIS)

    Lanzman, R.S.; Kroepil, P.; Blondin, D.; Schmitt, P.

    2011-01-01

    Especially in regard to the potential risks for the development of nephrogenic systemic fibrosis (NSF) following the administration of Gadolinium-based contrast material, nonenhanced MR angiography (MRA) methods are becoming ever more important. Besides well-established time-of-flight (TOF) and phase-contrast (PC) MRA, alternative imaging techniques based on balanced steady-state free precession (bSSFP) and turbo-spin-echo (TSE) sequences are increasingly used in combination with or without arterial spin labeling (ASL) strategies. This article provides an overview of the principles and clinical values of different nonenhanced MRA techniques. In addition, recent nonenhanced MRA developments are presented. (orig.)

  8. Association of Lumbar Arterial Stenosis with Low Back Symptoms: A Cross-Sectional Study Using Two-Dimensional Time-of-Flight Magnetic Resonance Angiography

    Energy Technology Data Exchange (ETDEWEB)

    Korkiakoski, A.; Niinimaeki, J.; Karppinen, J.; Korpelainen, R.; Haapea, M.; Natri, A.; Tervonen, O. (Inst. of Clinical Sciences, Dept. of Physical and Rehabilitation Medicine, Univ. of Oulu, Oulu (Finland))

    2009-01-15

    Background: Recent studies indicate that diminished blood flow may cause low back symptoms and intervertebral disc degeneration. Purpose: To explore the association between lumbar arterial stenosis as detected by two-dimensional time-of-flight magnetic resonance angiography (2D TOF-MRA) and lumbar pain symptoms in an occupational cohort of middle-aged Finnish males. Material and Methods: 228 male subjects aged 36 to 55 years (mean 47 years) were imaged with 2D TOF-MRA. Additionally, 20 randomly selected subjects were scanned with contrast-enhanced MRA (ceMRA). In each subject, the first (L1) to fourth (L4) segmental lumbar arteries were evaluated for lumbar artery stenosis using a dichotomic scale. One subject was excluded because of poor image quality, reducing the study population to 227 subjects. Logistic regression analysis was used to evaluate the association between arterial stenosis in 2D TOF-MRA and low back pain and sciatica symptoms (intensity, duration, frequency). Results: Comparing 2D TOF-MRA and ceMRA images, the kappa value (95% confidence interval) was 0.52 (0.31-0.73). The intraobserver reliability kappa value for 2D TOF-MRA was 0.85 (0.77-0.92), and interobserver kappa was 0.57 (0.49-0.65). The sensitivity of 2D TOF-MRA in detecting stenosis was 0.58, the accuracy 0.89, and the specificity 0.94. In 97 (43%) subjects all arteries were normal, whereas 130 (57%) had at least one stenosed artery. The left L4 artery was most often affected. The degree of arterial stenosis was associated with intensity of low back and sciatic pain, and sciatica pain duration during the past 3 months. Conclusion: 2D TOF-MRA is an acceptable imaging method for arterial stenosis compared to ceMRA. Arterial stenosis was associated with subjective pain symptoms, indicating a role of decreased nutrition in spinal disorders

  9. Association of lumbar arterial stenosis with low back symptoms: a cross-sectional study using two-dimensional time-of-flight magnetic resonance angiography.

    Science.gov (United States)

    Korkiakoski, A; Niinimäki, J; Karppinen, J; Korpelainen, R; Haapea, M; Natri, A; Tervonen, O

    2009-01-01

    Recent studies indicate that diminished blood flow may cause low back symptoms and intervertebral disc degeneration. To explore the association between lumbar arterial stenosis as detected by two-dimensional time-of-flight magnetic resonance angiography (2D TOF-MRA) and lumbar pain symptoms in an occupational cohort of middle-aged Finnish males. 228 male subjects aged 36 to 55 years (mean 47 years) were imaged with 2D TOF-MRA. Additionally, 20 randomly selected subjects were scanned with contrast-enhanced MRA (ceMRA). In each subject, the first (L1) to fourth (L4) segmental lumbar arteries were evaluated for lumbar artery stenosis using a dichotomic scale. One subject was excluded because of poor image quality, reducing the study population to 227 subjects. Logistic regression analysis was used to evaluate the association between arterial stenosis in 2D TOF-MRA and low back pain and sciatica symptoms (intensity, duration, frequency). Comparing 2D TOF-MRA and ceMRA images, the kappa value (95% confidence interval) was 0.52 (0.31-0.73). The intraobserver reliability kappa value for 2D TOF-MRA was 0.85 (0.77-0.92), and interobserver kappa was 0.57 (0.49-0.65). The sensitivity of 2D TOF-MRA in detecting stenosis was 0.58, the accuracy 0.89, and the specificity 0.94. In 97 (43%) subjects all arteries were normal, whereas 130 (57%) had at least one stenosed artery. The left L4 artery was most often affected. The degree of arterial stenosis was associated with intensity of low back and sciatic pain, and sciatica pain duration during the past 3 months. 2D TOF-MRA is an acceptable imaging method for arterial stenosis compared to ceMRA. Arterial stenosis was associated with subjective pain symptoms, indicating a role of decreased nutrition in spinal disorders.

  10. Association of Lumbar Arterial Stenosis with Low Back Symptoms: A Cross-Sectional Study Using Two-Dimensional Time-of-Flight Magnetic Resonance Angiography

    International Nuclear Information System (INIS)

    Korkiakoski, A.; Niinimaeki, J.; Karppinen, J.; Korpelainen, R.; Haapea, M.; Natri, A.; Tervonen, O.

    2009-01-01

    Background: Recent studies indicate that diminished blood flow may cause low back symptoms and intervertebral disc degeneration. Purpose: To explore the association between lumbar arterial stenosis as detected by two-dimensional time-of-flight magnetic resonance angiography (2D TOF-MRA) and lumbar pain symptoms in an occupational cohort of middle-aged Finnish males. Material and Methods: 228 male subjects aged 36 to 55 years (mean 47 years) were imaged with 2D TOF-MRA. Additionally, 20 randomly selected subjects were scanned with contrast-enhanced MRA (ceMRA). In each subject, the first (L1) to fourth (L4) segmental lumbar arteries were evaluated for lumbar artery stenosis using a dichotomic scale. One subject was excluded because of poor image quality, reducing the study population to 227 subjects. Logistic regression analysis was used to evaluate the association between arterial stenosis in 2D TOF-MRA and low back pain and sciatica symptoms (intensity, duration, frequency). Results: Comparing 2D TOF-MRA and ceMRA images, the kappa value (95% confidence interval) was 0.52 (0.31-0.73). The intraobserver reliability kappa value for 2D TOF-MRA was 0.85 (0.77-0.92), and interobserver kappa was 0.57 (0.49-0.65). The sensitivity of 2D TOF-MRA in detecting stenosis was 0.58, the accuracy 0.89, and the specificity 0.94. In 97 (43%) subjects all arteries were normal, whereas 130 (57%) had at least one stenosed artery. The left L4 artery was most often affected. The degree of arterial stenosis was associated with intensity of low back and sciatic pain, and sciatica pain duration during the past 3 months. Conclusion: 2D TOF-MRA is an acceptable imaging method for arterial stenosis compared to ceMRA. Arterial stenosis was associated with subjective pain symptoms, indicating a role of decreased nutrition in spinal disorders

  11. "Jääminek" 40 aastat hiljem / Veste Paas

    Index Scriptorium Estoniae

    Paas, Veste, 1931-2002

    2002-01-01

    Mängufilm "Jääminek" : stsenarist Aadu Hindi teose järgi Aleksandr Bortšagovski : režissöör Kaljo Kiisk : Tallinnfilm 1962. Filmi võrreldakse 1943. a. valminud ukraina režissööri Mark Donskoi filmiga "Vikerkaar" ("Raduga")

  12. An Examination of the Current Revolution in Soviet Military Affairs.

    Science.gov (United States)

    1988-03-01

    Aleksandr M. Nekrich, Utopia in Power (New York, NY: Summit Books, 1986), pp. 719-720; Roman Kolkowicz and Ellen Propper Mickiewicz , ed., The Soviet Calculus...Up Against." The A/antic Motahly, June 1987. pp. 2 9- 43. Kolkowicz. Romaal. and Mickiewicz . Ellen Propper. ed. The Soviet Calculus on NVuclear WTar

  13. Kaks kiirpilku festivalile "Credo" / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    Rahvusvahelise õigeusu vaimuliku muusika festivali "Credo" raames toimunud kahest kontserdist: 21. septembril Kaarli kirikus toimunud müsteeriumist "Jumalaema palve", esitajaks festivali "Credo" meesansambel Stanislav Šeljahhovski dirigeerimisel ja 13. septembril Tallinna Jaani kirikus toimunud Pariisi Neeva vaga suurvürsti Aleksandri paekiriku koori kontserdist ülemdiakon Aleksandr Kedrovi juhatusel

  14. Baltic region going nuclear

    Index Scriptorium Estoniae

    2011-01-01

    Läti keskkonnaminister Raimonds Vejonis leiab, et Läti ei peaks investeerima Leetu rajatava tuumaelektrijaama ehitusse ja võiks panustada hoopis taastuvenergiale. Venemaa peaminister Vladimir Putin ja Valgevene president Aleksandr Lukašenko allkirjastasid kokkuleppe Valgevene ja Leedu piiri lähistele uue tuumajaama ehitamise kohta. Leedu ei ole selle projektiga nõus

  15. Saladusliku Sandu Hubani miljonid / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2005-01-01

    Eesti ühe edukaima hokiklubi Välk 494 rahastaja Sandu Hubani alias Aleksandr Gubani tegevusest, ettevõtlusest ja äritegevusest. Lisad: Hubani osalused firmades; Ettevõtted, millega Huban enam seotud ei ole; Välk 494 seob Hubani ja tema äripartnereid. Kommenteerivad Meelis Birk, Enriko Lukecha, Aivo Pärn

  16. Svet "Tjomnõh notshei" / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2002-01-01

    Pimedate Ööde Filmifestivali filme - Lukas Moodyssoni "Lilja 4-ever", Aleksandr Mitta "Kõrvetav laupäev" ("Raskalennaja subbota"), Valeri Fokini "Metamorfoos" ("Prevrashtshenije") ja Andrei Kontshalovski "Hullumaja" ("Dom durakov"), millega seoses andis režissöör ka pressikonverentsi Sakala keskuses

  17. Алиса в Заэстонье / Николай Караев

    Index Scriptorium Estoniae

    Караев, Николай, 1978-

    2010-01-01

    „Alice" on omanäoline live perfomance, mis koosneb kaasaegsest koreograafiast, originaalsest autorimuusikast, kunstilisest videost, traditsioonilisest animatsioonist, VJ setist ja varjude teatrietendusest. Lavastuse autoriteks on MTÜ Fat Snail, MTÜ Vastik Sipsik, MTÜ HeliTelg, Olga Privis ja Aleksandr Žedeljov. Lavastus põhineb Lewis Carrolli teosel „Alice Imedemaal", kuid pole otseselt autori tekstide ümberjutustus

  18. Golosa manezhnogo Peterburga / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2004-01-01

    Peterburi kaasaegsest kunstist seoses kunstiteadlase Larissa Skobkina kureeritud näitusega Tallinna Vene saatkonna galeriis. Tutvustatakse underground-kunstnikke Anatoli Basinit, Vjatsheslav Mihhailovit, Valeri Lukkat, Vladimir Vidermani, Gleb Bogomolovit, Gennadi Ustjugovit, Natalja Zhilinat, rühmitust Mitki ja selle liikmeid Vladimir Shinkarjovi, Aleksandr Florenskit, Olga Florenskajat ning Peterburi fotokoolkonda esindavat Andrei Tshezhinit

  19. Arhitektuur pärast kommunismi : uus vene arhitektuur / Bart Goldhoorn

    Index Scriptorium Estoniae

    Goldhoorn, Bart

    2007-01-01

    Sissejuhatus Bart Goldhoorni raamatule "Capitalist Realism. New Architecture in Russia" (2007). Vene arhitektide osalemisest rahvusvahelistel võistlustel, linnauuendusest Nižni Novgorodis (peaarhitekt Aleksandr Haritonov), arhitektuurielust Moskvas, sisearhitektuurist, uuest arhitektide põlvkonnast, huvist välismaiste arhitektide vastu, vene arhitektuurist. Bibliograafia lk. 25

  20. "Medvezhii" ugol Jevrosojuza / Jevgeni Ashihmin

    Index Scriptorium Estoniae

    Ashihmin, Jevgeni

    2007-01-01

    Regionaalminister Vallo Reimaa, Ida-Virumaa maavanem Riho Breivel, Kirde-Eesti piirivalveülem Aimar Kess, Alajõe vallavanem Natalja Varkki, Vasknarva külavanem Vadim Ivanov ja kohalik aktivist Aleksandr Petuhhov arutasid Alajõe valla ja Vasknarva küla probleeme

  1. Kiwa Frankfurdis : great big fuck!

    Index Scriptorium Estoniae

    1999-01-01

    Frankfurdis 20.-21. XI toimunud kongressil Ida-Euroopa kunstist näitas kuraator Dmitry Vilensky enne oma ettekannet "Sõnum idast" Kiwa videot "Euro-Antivisioon. Kollase lipu all". D. Vilensky korraldatud illegaalsel posterite "näitusel" plankudel, kus Ida-Euroopa kunstnikud said avaldada arvamust Lääne kunstiinstitutsioonide strateegiate kohta, osalesid Aleksandr Brener, Oleg Kulik

  2. Esietendus

    Index Scriptorium Estoniae

    2000-01-01

    22. sept. esietendused teatrites - Eesti Draamateatris "Mälestused. Ainult ei tea millest" Mikk Mikiveri lavastuses, Tallinna Linnateatris "Clavigo" saksa külalislavastaja Andrea Mosese lavastuses ja Vene Draamateatris "Lavalised segadused", mille tõi lavale vene külalislavastaja Aleksandr Issakov

  3. Ljubimaja zhenshtshina artista Viktora Bõtshkova / Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Hrustaljov, Nikolai

    2003-01-01

    Parima filmi auhinna "Zolotoi Oven" sai Aleksandr Rogozhkini "Kägu" ("Kukushka"), parima režissööri auhinna sai Kira Muratova filmiga "Tšehhovi motiivid" ("Tshehhovskije motivõ"). Lähemalt auhinnatseremooniast. Lisatud ka laureaatide nimekiri

  4. "Meistri ja Margarita" seriaal purustas naispeaosatäitja abielu? / Triin Tael

    Index Scriptorium Estoniae

    Tael, Triin

    2005-01-01

    Kümneosaline telefilm M. Bulgakovi romaani "Meister ja Margarita" ainetel. Stsenarist ja režissöör Vladimir Bortko, peaosades Aleksandr Galibin ja Anna Kovaltshuk. Lisa "Meister ja Jeshua räägivad ühe häälega" seriaali osatäitjatest

  5. Kalendar nedeli / Leta Gureli

    Index Scriptorium Estoniae

    Gureli, Leta

    1996-01-01

    Iz soderzh.: 14 ijunja 185-letnii jubilei Garriet Bitsher-Stou; 14 ijunja 110 let nazad umer Aleksandr Ostrovski; 17 junja russkomu pisatelju-frontoviku Viktoru Nekrasovu ispolnilos bõ 85 let; 18 ijunja 60 let nazad umer Maksim Gorki; 19 ijunja ispolnjajetsja 210 let so dnja rozhdenia russkogo poeta Fjodora Glinki; 20 ijunja ispolnjajetsja 60 let Enn Vetemaa

  6. Vene saadik Rootsis - gaasitorust ja Birmast / Evelyn Höglund

    Index Scriptorium Estoniae

    Höglund, Evelyn

    2007-01-01

    Venemaa Rootsi suursaadiku Aleksandr Kadakini esinemisest Rootsi televisiooni populaarses telesaates, kus ta avaldas oma seisukohti Birma sündmuste, Vene-Saksa rajatava gaasijuhtme teemadel, samuti Rootsi meedia kohta. Vt. samas: Valitsust ei kritiseeri, küll aga meediat; Demokraatia on Venemaal olemas

  7. V "Ovode" Oleg Strizhenov fehtoval bez shpagi / Oleg Peranov

    Index Scriptorium Estoniae

    Peranov, Oleg

    2005-01-01

    Mängufilm "Kiin" ("Ovod") Ethel Lilian Voynichi romaani järgi : režissöör Aleksandr Faintsimmer : helilooja Dmitri Shostakovitsh : peaosas Oleg Strizhenov : NSV Liit 1955. Filmivõtetest ja vastuvõtust esilinastuse 50. aastapäeva puhul

  8. Moskva pisaraid ei usu : 5. Venemaa rahvuslik teatrifestival "Zolotaja Maska" 10. märtsist 5. aprillini 1999 Moskvas / Juri Ljubimov, Kadi Herkül ; interv. Olga Jero

    Index Scriptorium Estoniae

    Ljubimov, Juri, 1917-2014

    1999-01-01

    Vaadeldakse lavastusi - A. Tshehhovi "Tatjana Repina" (lav. Valeri Fokin), W. Shakespeare'i "Talvemuinasjutt" (lav. Declan Donnellan), A. Ostrovski "Äike" (lav.Henrietta Janovskaja), A. Krutshjonõhhi "Võit päikese üle" (lav. Aleksandr Ponomarjov), W. Gombrowiczi "Iwona, Burgundia printsess" (lav. Oleg Rõbkin) ja H. Pinteri "Majahoidja" (lav. Juri Butussov)

  9. Scotland Yard gotov nazvat ubiits Litvinenko

    Index Scriptorium Estoniae

    2007-01-01

    Scotland Yard on lähedal sellele, et öelda Aleksandr Litvinenko mõrvas kahtlustatavate nimed. Samas ei kavatse Vene võimud kahtlustatavaid kohtuprotsessist osavõtuks välja anda. Vene uurija väitel tahtis A. Litvinenko šantažeerida tuntud vene oligarhi ja Briti kompaniid

  10. Hotel kak lutshshe, a... / Margarita Kornõsheva

    Index Scriptorium Estoniae

    Kornõsheva, Margarita, 1957-

    2006-01-01

    OÜ Amphenol Eesti tegevdirektor Aleksandr Antonov suunas seoses tellimuste vähesusega 50 töötajat ajutiselt tööle firmasse Elcoteq. Mitmed töötajatest leiavad, et direktor rikkus töölepingu seadust ja on pöördunud Töövaidluskomisjoni poole

  11. Mida Putin Rüütlile ütles? / Vladimir Socor

    Index Scriptorium Estoniae

    Socor, Vladimir

    2005-01-01

    Jamestown Foundation'i vanemanalüütiku arvates ei ole president Vladimir Putini uus poliitika jõudnud Venemaa välisministeeriumi esindaja Aleksandr Jakovenkoni või vajab presidendi tegelik sõnakasutus erakohtumisel tema- ja president Rüütli-poolset selgitamist

  12. Mida Putin Rüütlile ütles? / Vladimir Socor

    Index Scriptorium Estoniae

    Socor, Vladimir

    2005-01-01

    Jamestown Foundation'i vanemanalüütiku arvates ei ole president Vladimir Putini uus poliitika jõudnud Venemaa välisministeeriumi esindaja Aleksandr Jakovenkoni või vajab presidendi tegelik sõnakasutus erakohtumisel tema- ja president Arnold Rüütli-poolset selgitamist

  13. Lenini kaitseks / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2002-01-01

    Ilmunud ka: Vaher, Vaapo. Kokaiin Balti jaama turult: miniatuure vene kultuurist. Tallinn : Sirp, 2003, lk. 157-159. Mängufilm "Taurus" ("Telets") : stsenarist Juri Arabov : režissöör ja operaator Aleksandr Sokurov : Venemaa 2000. Autor pole rahul Lenini kujutamise kontseptsiooniga filmis

  14. Boris Akunin zombiroval Marinu Nejolovu, no... / Grigori Tshartishvili ; interv. Sergo Kuhianidze

    Index Scriptorium Estoniae

    Tshartishvili, Grigori

    2002-01-01

    Mängufilm "Azazel" : stsenarist oma romaani järgi Grigori Tshartishvili (pseudonüüm Boriss Akunin) : režissöör Aleksandr Adabashjan : Venemaa 2002. Romaani autor filmist ja selle ekraniseerimise käigust

  15. Ivan Groznõi vozvrashtshajetsja! / Jaroslav Shtshedrov

    Index Scriptorium Estoniae

    Shtshedrov, Jaroslav

    2008-01-01

    Vene režissöör Pavel Lungin koos operaator Tom Sterniga alustasid Suzdalis mängufilmi "Ivan Groznõi ja metrpoliit Filipp" võtteid. Osalevad Pjotr Mamonov (Ivan IV), Oleg Jankovski (Filipp), Ivan Ohlobõstin, Aleksandr Domogarov jt

  16. "Святому братству верен я..." / Валерия Бобылева, Марат Гайнуллин

    Index Scriptorium Estoniae

    Бобылева, Валерия, 1945-

    1999-01-01

    A. Puškin ja Tsarskoje Selo lütseum: rektoritest Vassili Malinovskist ja Jegor Engelhardtist, lütseistidest Vladimir Volhovskist, Fjodor Matjuškinist, Mihhail Jakovlevist, Wilhelm Küchelbeckerist, Aleksandr Gortšakovist ja Aleksei Illitševskist. Ka nende sidemetest Eestiga (reisid, suguvõsad)

  17. Kirjanduse aastapreemiad

    Index Scriptorium Estoniae

    2007-01-01

    Eesti Kultuurkapitali aastapreemiad: Mats Traadi romaan "Naised ja pojad", Indrek Ryytle luulekogu "Inglid rokijaamas", Jim Ashilevi näidend "Nagu poisid vihma käes", Peeter Sauteri "Laiskade laste raamat". Esseistikapreemia Hasso Krullile "Loomise mõnu ja kiri". Tõlkepreemia said Kalle Kasemaa, Eric Dickens. Vabaauhind: Cornelius Hasselblatt. Venekeelse autori kirjandusauhind: Jelena Skulskaja, Aleksandr Uris. Artikliauhind: Toomas Haug

  18. Mats Traat sai kultuurkapitali proosapreemia / Mari Peegel

    Index Scriptorium Estoniae

    Peegel, Mari, 1978-

    2007-01-01

    Eesti Kultuurkapitali aastapreemiad: Mats Traadi romaan "Naised ja pojad", Indrek Ryytle luulekogu "Inglid rokijaamas", Jim Ashilevi näidend "Nagu poisid vihma käes", Peeter Sauteri "Laiskade laste raamat". Esseistikapreemia Hasso Krullile "Loomise mõnu ja kiri". Tõlkepreemia said Kalle Kasemaa, Eric Dickens. Vabaauhind: Cornelius Hasselblatt. Venekeelse autori kirjandusauhind: Jelena Skulskaja, Aleksandr Uris. Artikliauhind: Toomas Haug

  19. Kirsteins kicked out of People's Party / Aaron Eglitis

    Index Scriptorium Estoniae

    Eglitis, Aaron

    2005-01-01

    Läti parlamendiliige Aleksandrs Kirsteins visati erakonnast välja, kuna parteikaaslaste arvates olid tema kommentaarid juutide kohta antisemiitlikud ja riigi mainele halvasti mõjuvad. Vt. ka samas lk. 18 intervjuud Margers Vestermanisega Herberts Cukurs'i teemadel

  20. Lastemuuseum Miia-Milla-Manda = The Miia-Milla-Manda Children's Museum / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Koidula 21A asuva hoone restaureerimisest, lastemuuseumi sisekujundusest. Kadrioru Lastepargi paviljoni (arhitekt Villem Seidra, 1937) renoveerimisprojekti tegi arhitekt Katrin Etverk, sisearhitektid ja ekspositsiooni kujundus: Maile Grünberg, Eliina Grünberg (Grünberg oü). Ajaloolane Aleksandr Pantelejev. Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud hoonele

  1. Poeetilisest mõõtmest / Aare Pilv

    Index Scriptorium Estoniae

    Pilv, Aare, 1976-

    2016-01-01

    Luule tõlkimisest, selgitades mõistet "poeetiline mõõde". Artikli teises pooles käsitletakse ka sama keeleruumi klassikaliste luuletuste tõlkimist tänapäeva keelde, kasutades Aleksandr Puškini luuletuse "A. P. Kernile" näidet

  2. Estonian leader voices worry over Russia / Michael Abramowitz

    Index Scriptorium Estoniae

    Abramowitz, Michael

    2006-01-01

    USA presidendi George W. Bushi 28. novembril 2006. a. toimunud Eesti visiidi ajal oli presidentide vahelise vestluse läbivaks probleemiks Venemaa aina kasvav autokraatia ja despotism, mis on välja viinud juba esimeste arvatavate poliitmõrvadeni Kremli tuliste kriitikute Anna Politkovskaja ja Aleksandr Litvinenko näol

  3. High court orders Lavents retrial / Ib Alken

    Index Scriptorium Estoniae

    Alken, Ib

    2003-01-01

    Pärast Euroopa Inimõiguste Kohtu otsust, mille kohaselt rikkus Läti riik Banka Baltija endise juhi Aleksandrs Lavents'i kohtuasja menetlemisel tema põhiõigusi, mõistis Läti Riigikohus asja uuesti läbivaatamisele

  4. Matti Klaari nimeline puuetega noorte toetuseks asutatud sti pendium

    Index Scriptorium Estoniae

    2016-01-01

    16. aprillil toimus Sokos Hotell Merineitsi restoranis Lionsite pidulik Galaõhtusöök. Üritusel anti üle iga-aastane Matti Klaari nimeline stipendium, mille eesmärgiks on pöörata tähelepanu puuetega noorte saavutustele, ja mida annab välja klubi LC Tallinna Vanalinn. Stipendiumi sai Aleksandr Zakirov

  5. Чужие и свои Avenue / Роман Старапопов

    Index Scriptorium Estoniae

    Старапопов, Роман

    2009-01-01

    Dokumentaalfilm "Eesti lood: Võõras omade seas", režissöörid Aleksandr Kheyfets ja Karin Reinberg. Film räägib rock-ansamblist "AveNue", ansambli juht on Vladimir Tšerdakov. Esilinastus 4. nov. kinos "Sõprus"

  6. Restoran Kaerajaan = Kaerajaan Restaurant / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2009-01-01

    Tallinnas Raekoja plats 17 asuva restorani rahvuslikel motiividel baseeruvast sisekujundusest. Sisearhitektid Janno Roos ja Andres Labi (Ruumilabor). Arhitektuuriajaloolised eritingimused koostas Aleksandr Pantelejev. Lakke ja seinale maalitud muster (Loovool) pälvis Red Dot'i auhinna. Žürii hinnang kultuurikapitali aastapreemiale esitatud sisekujundusele

  7. "Dialog" Zapad-Vostok / Igor Zabel

    Index Scriptorium Estoniae

    Zabel, Igor

    1998-01-01

    Sloveenia kunstiajaloolane Igor Zabel - konflikti säilimisest Ida- ja Lääne-Euroopa kunsti vahel, kunstnikevahelise võrdse dialoogi puudumisest. Analüüsitakse seoses Aleksandr Breneri ja Nikolai Kuliku (Venemaa) "Interpolil" (Stokholm, 1996) esinemisega tekkinud skandaaliga. Lühivariant ettekandest sümpoosionil "The Edge" (Zagrebis, nov. 1996).

  8. Drama Russkogo teatra : posledni akt / Jaanus Kukk, Jevgeni Golikov ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Kukk, Jaanus

    2008-01-01

    Vene Teatri kunstiline juht Mihhail Tshumatshenko lahkus ametist. Vene teatri olukorrast räägivad ja avaldavad oma arvamust ka Aivar Mägi, Jaak Allik, Laine Jänes, Artjom Garejev, Aleksandr Ivashkevitsh, Julia Jablonskaja. Lühendatult on avaldatud Ugala teatri lavastaja Peeter Tammearu avalik pöördumine

  9. "Idiot" polutshil premiju

    Index Scriptorium Estoniae

    2004-01-01

    Fjodor Dostojevski romaani "Idioot" ekraniseeringus Venemaa televisioonis mängib Jevgeni Mironov vürst Mõshkinit : režissöör Vladimir Bortko : Venemaa 2003. Nende tööde eest said J. Mironov ja V. Bortko Aleksandr Solzhenitsõni kirjanduspreemia

  10. Monument / Toomas Raag

    Index Scriptorium Estoniae

    Raag, Toomas, 1983-

    2004-01-01

    Tallinna Linnavalitsuse pressiosakonna juhataja sõnul kavandati raha eraldamine Relva-SS'is sõdinud eestlaste memoriaali rajamiseks linna eelarvesse Tõnis Paltsi linnapeaks oleku ajal ja Keskerakonna linnavalitsust ei tohiks selles süüdistada. Vastus Aleksandr Shegedini artiklile ajalehes Den za Dnjom, 9. juuli, lk. 6

  11. Cintilações de neutro nas imagens de mãe e filho

    Directory of Open Access Journals (Sweden)

    Rosana Cacciatore Silveira

    2007-01-01

    Full Text Available The present essay discusses Mãe e filho (Mother and son — 1997, a film by Aleksandr Sokurov, a contemporary Russian film director, which argument is the mother’s death. I approach the film, through the Barthesian concept of neuter dialoguing with other concepts, as image-affection, in Deleuze, and Interface, in Ranciére.

  12. Pelevini ja Bulgakovi mängib üle Tšernobõl / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2011-01-01

    Venemaal ekraanile jõudnud Viktor Ginzburgi filmist "Generation "P"" ja Juri Kara filmist "Meister ja Margarita" (1994). Tšernobõli tuumajaama katastroofist rääkivast Aleksandr Mindadze filmist "Laupäeval". Peatselt valmib film Vladimir Võssotskist. Stsenaariumi on kirjutanud Nikita Võssotski

  13. Council tackles border crossing delays

    Index Scriptorium Estoniae

    2010-01-01

    Eesti Tööandjate Keskliidu juhi Enn Veskimägi ja Venemaa Töösturite ja Ettevõtjate Liidu esindajate kohtumisel räägiti järjekordadest Eesti-Vene piiril. President Toomas Hendrik Ilves kohtus organisatsiooni juhi Aleksandr Šohhiniga

  14. Russki Otello / Konstantin Artjuhhov ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Artjuhhov, Konstantin

    2002-01-01

    Vene režissöör Konstantin Artjuhhov vestleb Gatshina festivalil "Kirjandus ja kino" ajaloolise dokumentaalfilmist, lähemalt oma festivalil žürii eripreemia saanud filmist "Annibali imelik elu" ("Strannaja zhizn Annibala"). Film jutustab Aleksandr Pushkini vaarisast Abram Hannibalist (1696-1781), kelle elust suur osa möödus Eestis

  15. Spetsnaz likvideeris Minski meeleavalduse / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2006-01-01

    24. märtsil arreteeriti Minski opositsionääride meeleavaldusel ligi 300 inimest. Opositsiooniliider Aleksandr Milinkevitsh kutsus tuhandeid inimesi kogu riigist 25. märtsiks uuele massimeeleavaldusele, et märkida 1918. aastal lühiajaliselt eksisteerinud Valgevene Rahvavabariigi väljakuulutamist

  16. Загадочное исчезновение акций / Артур Тооман

    Index Scriptorium Estoniae

    Тооман, Артур, 1971-

    2009-01-01

    Zircon Technologies AS-i ostu jaoks Gate Capital OÜ loonud isikud väidavad, et üks ettevõtte loojatest - Aleksandr Kuzin, olles ainus juhatuse liige mõlemas ettevõttes, kandis 51% aktsiatest oma ettevõttele Pidev OÜ ja kandib ettevõtte vara oma firmadele

  17. Театральным проектам дали субсидии / Лилия Крысина

    Index Scriptorium Estoniae

    Крысина Лилия

    2010-01-01

    Eesti Kultuuriministreerium toetab rahaliselt kaheksat teatriprojekti, millede hulgas on Rotermanni kvartalis asuvas Nisu- ja rukkiveskis toimuv performance "Live News Project" (projekti autor-lavastaja on Aleksandr Dzjuba); Eesti Draamateatri lavastustele venekeelse sünkroontõlke subsideerimine; Vene Teatri teatristuudio ja Nuku- ja Noorsooteatri noortestuudio ühisprojekt "Võimalused"

  18. "Мы звучим для иностранцев - как музыка" / Валентина Белецкая ; интервьюировала Тийа Линнард

    Index Scriptorium Estoniae

    Белецкая, Валентина, 1947-

    2009-01-01

    Näitleja, teatripedagoogi ja lavastaja Valentina Beletskajaga Lev Timofejevi näidendi "Москва. Моление о чаше" lavastusest, abikaasast - näitlejast Aleksandr Markovist. Beletskaja ja Markov on Peterburi erateatri ja kooli "Russkije Notši" asutajad

  19. Ahmed Zakajev: Litvinenko tapeti, sest ta abistas omakasupüüdmatult tšetšeene / Tõnis Erilaid

    Index Scriptorium Estoniae

    Erilaid, Tõnis, 1943-

    2007-01-01

    Vene ajalehes Kommersant ilmus intervjuu endise Itškeeria ministri Ahmed Zakajeviga, kes ei kahtle, et Aleksandr Litvinenko tapmisega on seotud Andrei Lugovoi. Suurbritannia politsei tegutseb täie tõsidusega, et sundida Venemaad Andrei Lugovoid välja andma

  20. Litvinenko mõrva uurib Interpol / Tuuli Aug, Ravil Khair Al-Din

    Index Scriptorium Estoniae

    Aug, Tuuli

    2006-01-01

    Seoses Aleksandr Litvinenko mürgitamisega Londonis kuulati Venemaal üle ärimees Andrei Lugovoi. Saksa uurijad on veendunud, et polooniumi tõi Moskvast Saksamaale Dmitri Kovtun. Vene uurijad kavatsevad mõningatel andmetel Suurbritannias üle kuulata Boriss Berezovski ja Ahmed Zakajevi. Lisa: Polooniumijälg kui buldooserivagu

  1. Ossipenko vplotnuju vzjalsja za Narvu / Artur Tooman

    Index Scriptorium Estoniae

    Tooman, Artur, 1971-

    2008-01-01

    Ajakirjanduses Narva linna halliks kardinaliks nimetatud Aleksandr Moissejevit süüdistatakse altkäemaksu andmises. Tähelepanuta jäänud kaadrimuudatustest Narva linnavalitsuses. Vt. samas: Narva võtab krediiti; Väited, et tegemist on võimuvõitlusega

  2. Eesti-Ameerika ühisfilm lõpuks kohal

    Index Scriptorium Estoniae

    2001-01-01

    Eilsest linastub kobarkinos Coca-Cola Plaza "Virtuoos" ("Out of the Cold") : režissöör Aleksandr Bulavsky : operaator Vladimir Klimov : peaosas Keith Carradine : Ameerika Ühendriigid - Eesti 1999. Väiksemates rollides teeb kaasa mitmeid eesti näitlejaid

  3. Poslanije ot propavshih ekspeditsi / Aleksandra Manukjan

    Index Scriptorium Estoniae

    Manukjan, Aleksandra

    2001-01-01

    Kadunud ekspeditsioonidele pühendatud näitusest (mereteemalised pildid ja paberist jäämäed peidetud proviandiga) Tallinna Meremuuseumis, autoriteks Roman Matkiewicz ja Aleksandr Belanov (Moskva, rühmitus MEKVA). Lühidalt rühmitusest Mekva.

  4. Kirsteins survives vote, but doesn't escape criticism

    Index Scriptorium Estoniae

    2005-01-01

    Läti parlamendi väliskomisjoni esimehe Aleksandrs Kirsteins umbusaldushääletus kukkus läbi, kuna 53 parlamendiliiget hääletas esimehe tagandamise vastu. Umbusalduse põhjuseks sai Kirsteinsi intervjuu, kus ta tegi ettepanku sõlmida piirileping Venemaaga sarnaselt 1940. aastal Saksamaaga sõlmitud leppele

  5. Kas Venemaa ülemrabil on õigus?

    Index Scriptorium Estoniae

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 20. juuli 2004, lk. 2. Venemaa ülemrabi Berl Lazar pöördus Euroopa Komisjoni presidendi Romano Prodi poole üleskutsega anda hinnang Eesti võimude tegevusele, mis rabi meelest soosib kohalikke natse. Küsimusele vastab Ida-Viru juudi kogukonna juht Aleksandr Dusman

  6. KGB skandaal lämmatab Itaalia peaministrit / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2006-01-01

    FSB kindralpolkovnik Anatoli Trofimov olevat kinnitanud Itaalia peaministri Romano Prodi sidemeid KGB-ga. Autori väitel kuulis itaallane Mario Scaramella Aleksandr Litvinenkolt ilmselt uusi fakte R. Prodi kohta. M. Scaramella organismist leiti jälgi poloonium 210 isotoopidest, polooniumi jäljed viivad Moskvasse. Lisa: Mürgitamise uurimine Venemaale

  7. Писатели-эстонцы в русской литературе и писатели русского происхождения в эстонской литературе (о литературном билингвизме и "билитера

    Index Scriptorium Estoniae

    Бассель, Нафтолий, 1932-2016

    2007-01-01

    Eesti kirjanikest vene kirjanduses ja vene kirjanikest eesti kirjanduses: Aleksandr Šeller-Mihhailov , Valmar Adams, Boriss Taggo-Novossadov, Juri Ivask, Jelizaveta Roos, Meta Roos, Liidia Toom, Leon Toom, Romuald Minna, Hans Leberecht, Ahto Levi (tegelikult Levi Lippu), Jaan Kaplinski, Aleksis Rannit (tegelikult Aleksei Dolgošov, Juri Šumakov, Valeria Ränik (tegelikult Poprjanik)

  8. Писатели-эстонцы в русской литературе и писатели русского происхождения в эстонской литературе (о литературном билингвизме и "билитера

    Index Scriptorium Estoniae

    Бассель, Нафтолий, 1932-2016

    2006-01-01

    Eesti kirjanikest vene kirjanduses ja vene kirjanikest eesti kirjanduses: Aleksandr Sheller-Mihhailov, Valmar Adams, Boriss Taggo-Novossadov, Juri Ivask, Jelizaveta Roos, Meta Roos, Liidia Toom, Leon Toom, Romuald Minna, Hans Leberecht, Ahto Levi (tegelikult Levi Lippu), Jaan Kaplinski, Aleksis Rannit (tegelikult Aleksei Dolgošov), Juri Šumakov, Valeria Ränik (tegelikult Poprjanik)

  9. 17. oktoober 1905 - 1. märts 1917 / Karl Ast Rumor

    Index Scriptorium Estoniae

    Ast Rumor, Karl

    2007-01-01

    Üheteistkümneaastasest perioodist Karl Asti tagasivaatava isikliku pilgu läbi. Autor vabanes Riia vanglast oktoobrimanifesti põhjal. Ees ootasid uued vangistused. K. Asti isiklik mälestus Aleksandr Kerenskist. Varem ilmunud : "Pealinna Teataja" 9. märts 1917, nr. 3

  10. Moskvas tasub vaadata vene filme / Kristiina Davidjants

    Index Scriptorium Estoniae

    Davidjants, Kristiina, 1974-

    2009-01-01

    Moskva 31. rahvusvahelise filmifestivalist. Auhinnatud filmidest : peauhinna Püha Jüri saajast Nikolai Dostali mängufilmist "Petja teel taevariiki", FIPRESCI poolt auhinnatud Kira Muratova filmist "Meloodia väntorelile",eriauhinna saanud Aleksandr Proškini filmist "Ime", Karen Šahnazarovi Tšehhovi ekraniseeringust "Palat nr. 6". Lisatud peaauhindade nimekiri

  11. Natsikütt Zuroffil Eestist kuus kahtlusalust / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2003-01-01

    Simon Wiesenthali Keskuse Jeruusalemma büroo direktori Efraim Zuroffi poolt algatatud infokogumiskampaania, mille käigus pakutakse raha andmete eest sõjaroimades kahtlustatavate isikute kohta. Vt. sama lk. 15 küsimustele vastavad: Enn Soosaar, Lauri Vahtre, Aleksandr Zukerman, Eerik-Niiles Kross

  12. Vranja v filme ne budjet / Peeter Simm ; interv. Vladimir Odintsov

    Index Scriptorium Estoniae

    Simm, Peeter, 1953-

    2006-01-01

    Režissöör oma tööst uue mängufilmiga "Georg", mis on Eesti, Venemaa ja Soome ühisprojekt lauljast Georg Otsast (stsenaristid Mati Põldre, Aleksandr Borodjanski, nimiosas Marko Matvere). Filmi võtted algavad septembris

  13. XVI "Baltiiski dom" : klassika v raznõhh izmerenijahh / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2006-01-01

    16. rahvusvahelisest teatrifestivalist "Baltiiski dom" Peterburis. Pikemalt vaadeldakse lavastusi : Anton Tshehhovi "Onu Vanja" (Belgia teater "Toneelhuis", lavastaja Luk Perceval), "Kolm õde" (lavastaja Rimas Tuminas), Goethe "Faust" (lavastaja Eimuntas Nekroshius), "Kosmos" (Witold Gombrowiczi romaani järgi lavastanud Jerzy Jarocki), Aleksandr Ostrovski "Mets" (Moskva Kunstiteater, lavastaja Kirill Serebrjannikov). Mainitakse, et festivalil osales ka Ugala teater Oleg Titovi lavastusega "Libahunt"

  14. The Soviet Union and Iran Strategic Implications for the United States Navy.

    Science.gov (United States)

    1981-06-01

    Models and Cases. 4th ed. Homewood: Richard D. Irwin, 1979. 121 Bovin, Aleksandr . "Iran: Consequences and Reasons." Literaturnaya Gazeta, 25 October...New York: St. Martin’s Press, 1979. Park, Daniel. Oil and Gas in Comecon Countries. London: Kogan Page, 1979. Parker, Laurie. "JCS Plan Rejected

  15. USSR and Eastern Europe Scientific Abstracts, Electronics and Electrical Engineering, Number 36

    Science.gov (United States)

    1978-01-20

    manuscript received 15 Aug 76 KOGAN , S. S. [Abstract] A successful design of communication systems which transmit image signals in digital form requires...Sciences, Ukr SSR; and PYZHOV, ALEKSANDR ARKAD’YEVICH, graduate student, Institute of Electrodynamics, Academy of Sciences, Ukr SSR [Abstract

  16. USSR and Eastern Europe Scientific Abstracts. Geophysics, Astronomy and Space, Number 430

    Science.gov (United States)

    1978-10-02

    IZVESTIYA AKADEMII NAUK SSSR, FIZIKA ATMOSFERY I OKEANA in Russian Vol 14, No 8, 1978 pp 876-886 [Article by Ye. L. Kogan , Central Aerological Observatory...of necessity, at any moment. That is why Vladimir Kovalenok and Aleksandr Ivanchenkov were engaged in redocking soon after the departure of Valeriy

  17. JPRS Report, Soviet Union Economic Affairs.

    Science.gov (United States)

    1988-09-19

    in UGOL UKRAINY No 5, 1988, pp 16-18] Results of Industrial Tests of the SPTs-162 Flight Conveyor [Abstract of article by K. K. Kogan and G. A...especially when one realizes that the described sin of planners is not the only one and by no means the most terrible. Aleksandr Avanesyan, deputy general

  18. USSR Report, Sociological Studies.

    Science.gov (United States)

    1983-10-21

    34 [Workbook of the Sociologist], Moscow, Nauka, 1978, p 208. 2. Kogan , L. N. and Merenkov, A. V., "Multiple-Skill Brigades: Opinions, Apprais- als, the...Sep 83 (signed to press 22 Jul 83) pp 114-121 [Article by Aleksandr Borisovich Borzenko, student of the Academy of the National Economy attached to

  19. Translations on USSR Military Affairs, Number 1261

    Science.gov (United States)

    1977-02-16

    public principles by DOSAAF activist M. Kogan . She selects the materials from the newspapers of KRASNAYA ZVESDA and SOVETSKIY PATRIOT and from the...aktivists carefully. Both Aleksandr Mikhaylovich and the members of the DOSAAF raykom are constantly on the spot. They provide effective help to the

  20. Attitudes of Major Soviet Nationalities. Volume V. Other Nationalities. The Jews, The Tatars, Moldavia, Comparative Tables.

    Science.gov (United States)

    1973-06-01

    combine harvester. Soviet-Jewish musicians, such as D. Oistrakh, L. Gillels, and L. Kogan are known all over the world much as the "Russian" masters of...Pasternak and Samuil Marshak to Yuli Daniel, Aleksandr Galich and Mikhail Vysotsky. Among the Jews who have been active in Soviet creative arts are Sergei

  1. JPRS Report Soviet Union Political Affairs.

    Science.gov (United States)

    1990-07-20

    Kogan depicts it in the USSR Supreme Soviet. It is definitely not so simple. A sociological survey shows that no more than 20-25 percent of the non...SOVETSKAYA KULTURA in Russian No 19, 12 May 90 p 3 [Article by Aleksandr Kapto, deputy chief of the Ideo- logical Department of the CPSU Central

  2. Sots-art - Nõukogude Liit kuubis / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2007-01-01

    Sots-arti (pop-arti ja sotsialistliku realismi irooniline ühendus) sünnist ja arengust Venemaal. Termini leiutamine omistatakse Vitali Komarile ja Aleksandr Melamidile. Eestis kasutas nõukogulikku atribuutikat Leonhard Lapin, kes kasutas terminit liit-pop

  3. Ukrainas tüli Veneetsia pärast / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2001-01-01

    Kahe kuraatori konfliktist Veneetsia biennaalil osalemise pärast. Ilmselt osalevad biennaalil Valentin Rajevski ametlik esindus (Arsen Savadov, Oleg Tistol, Olga Melenti, Juri Solomko, Sergei Panihh), rühmitus Masoch Fund (Igor Podoltshak, Igor Djurõhh, Roman Viktjuk, kuraator Jerzy Onuch) ning H. Szeemanni kuraatorinäitusel Aleksandr Rotõburd, Viktor Marushenko, Ilja ja Emilia Kabakov

  4. Nõmme Lunastaja kirik = The Saviour's Lutheran Church in Nõmme / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Õie 10 asuva kirikuhoone (arhitekt Robert Natus, 1932) restaureerimisest. Arhitekt Fredi-Armand Tomps, sisearhitekt Anne Koppel, ehitusjärelevalve: Rein Joller, ajaloolane Aleksandr Pantelejev. Žürii liikme Mait Summataveti hinnang EK arhitektuuri sihtkapitali 2009. a. restaureerimispreemia pälvinud hoonele

  5. Toompea komandandimaja = The Commandant's House in Toompea / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Toompea 1 asuva hoone restaureerimisest. Arhitekt Raul Vaiksoo, kaasautor Kristo Vaiksoo (Raul Vaiksoo Arhitektuuribüroo), sisearhitektid Priit Põldme, Rita Rahu (SAB Joonprojekt), Raul Vaiksoo, ajaloolased Raul Vaiksoo, Aleksandr Pantelejev. Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud hoonele

  6. Mõtteid raamatust / Koost. Heigi Aaviste

    Index Scriptorium Estoniae

    1995-01-01

    Aut.: Maire Liivamets, Paul Luhtein, Paul-Eerik Rummo, Maksim Gorki, Johannes Semper, R.Descartes, Valmar Adams, Lilli Promet, Paul Rummo, Cicero, Honoré de Balzac, Aleksandr Pushkin, Epikuros, Debora Vaarandi, Arvi Siig, Helene Johani, Juhan Smuul, Friedebert Tuglas

  7. Nevozvrashtshentsõ / Aleksei Andrejev, Irina Baramidze

    Index Scriptorium Estoniae

    Andrejev, Aleksei

    2007-01-01

    Välisriikidest Venemaale ümberasumiseks on soovi avaldanud vaid 20 000 inimest. Autorite väitel pole Vene riik loonud peaaegu mingeid tingimusi inimeste tagasitulekuks oma ajaloolisele kodumaale. Ümberasujatele ettenähtud toetustest. Vt. samas Aleksandr Minejevi, Zhanna Zahharova ja Rafael Mustafajevi artiklid

  8. Järgmine mürgiohver endisel Nõukogudemaal / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2007-01-01

    Väidetavalt üritati mürgitada Kõrgõzstani peaministrit Almaz Atambajevit. Mõnede Vene ajalehtede väitel mürgitati ka Türkmenistani president Saparmurat Nijazov. Aleksandr Litvinenko tapmisest. Lisa: Üks mõrv iga nelja aasta kohta

  9. Wit-Rusland: dictatuur en legitimiteit tussen Rusland en Europa

    NARCIS (Netherlands)

    Gerrits, A.; Meijer, K.

    2009-01-01

    André Gerrits & Kirsten Meijer focus on Belarus that is stereotypically presented as Europe's last dictatorship. President Aleksandr Lukashenka has established an authoritarian order, based on political stability and a relatively high standard of living, which all in all provides more than a modicum

  10. The Russian Way of War: Post Soviet Adaptations in the Russian Military

    Science.gov (United States)

    2013-12-13

    93 Abkhazia Action...about an independent Abkhazia and South Ossetia and to block further Russian support for these aims. Unlike the Russians, Georgian forces demonstrated...Law 1, no. 2 (2009), 345. 208Aleksandr Iashvili, “Georgia Demands Withdrawl of Peacekeepers from Abkhazia and South Ossetia,” in Countdown to War in

  11. Täna esilinastub USA-Eesti koostööfilm / Artur Veeber ; interv. Valdo Jahilo

    Index Scriptorium Estoniae

    Veeber, Artur

    2001-01-01

    Filmist "Virtuoos" ("Out of the Cold"), režissöör Aleksandr Buravsky : Ameerika Ühendriigid - Eesti 1999. Samas toodud andmed filmi ja tegijate kohta. Eraldi lühike intervjuu Tõnu Aavaga "Tõnu Aav ülemteenri rollis"

  12. Grozdja razvesistoi kljukvõ / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2001-01-01

    Mängufilm "Virtuoos" ("Out of the Cold") : režissöör Aleksandr Buravsky : operaator Vladimir Klimov : peaosas Keith Carradine : Ameerika Ühendriigid - Eesti 1999. Väiksemates rollides teeb kaasa mitmeid eesti näitlejaid

  13. Ameeriklaste "Virtuoos" tõlgendab Eesti ajalugu / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2001-01-01

    Mängufilm "Virtuoos" ("Out of the Cold") : režissöör Aleksandr Bulavsky : operaator Vladimir Klimov : peaosas Keith Carradine : Ameerika Ühendriigid - Eesti 1999. Väiksemates rollides teeb kaasa mitmeid eesti näitlejaid

  14. Lõuendi avastamine EKA galeriis

    Index Scriptorium Estoniae

    2000-01-01

    Tõstamaal Suti talus 1999. a. suvel noorte kunstnike maalilaagris tehtud tööde näitus 9.-18. II EKA galeriis. Osalejaiks Eesti Kunstiakadeemia lõpetanud ja tudengid (loetletud). Korraldajad Mari Loit, Helene Tedre. Maalikunsti tehnilisi oskusi õpetas EKA restauraator Aleksandr Jurjev

  15. Ida-Euroopa kunstnikud koostöövalmis

    Index Scriptorium Estoniae

    2002-01-01

    21. II-31. III Tallinna Kunstihoones Viinis ja Budapestis tegutseva galeristi ja kuraatori Hans Knolli koostatud näitus "An artist who does not speak English is not an artist". Osalevad Lucehezar Boyadijev (Sofia), Aleksandr Brener, Barbara Schurz (Moskva, Viin), Rza El-Hassan (Budapest), Kai Kaljo, Roman Ondák (Bratislava), Mladen Stilinovic (Zagreb), Milica Tomic (Belgrad). Avamisel K. Kaljo performance

  16. MIFF 2002 / Marianne Kõrver

    Index Scriptorium Estoniae

    Kõrver, Marianne, 1980-

    2002-01-01

    Moskva 24. rahvusvahelise filmifestivali filme. Nikolai Baturini romaani "Karu süda" põhjal vändatud Arvo Iho filmi näitamisele järgnenud pressikonverentsist. Ka FIPRESCI auhinna saanud Aleksandr Rogozhkini filmist "Kägu". Lisatud laureaatide nimekiri

  17. Pööras võimu / Aivar Hundimägi

    Index Scriptorium Estoniae

    Hundimägi, Aivar, 1975-

    2010-01-01

    Paldiskis kohalikud valimised võitnud Aleksei Tšuletsile ja tema äripartnerile Aleksandr Nakonetšnõile kuulunud osalus firmades Saurix Petroleum ja Infast Oil liikus Hollandi Antillidel registreeritud ettevõttele CNP Investment N.V. Olulisest muutusest Tšuletsi ja Nakonetšnõigaga seotud ettevõtete omanikeringis 2006. a

  18. Кто у нас не самозванец? / Борис Тух

    Index Scriptorium Estoniae

    Тух, Борис, 1946-

    2009-01-01

    Lavastaja, dramaturg ja pedagoog Urmas Alliku teatriprojekt Vene Teatri näitlejatega Aleksandr Puškini tragöödia "Boriss Godunov" motiividel "Vale sünd", autor Märt Meos. Mängib Loominguline ühendus "Teine laine"

  19. Kui ma oleksin rahvas... / Jürgen Rooste

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2007-01-01

    Anders Härmi kuraatorinäitus "Poliitiline/Poeetiline" Tallinna IV graafikatriennaali raames Tallinna Kunstihoones kuni 25. XI. Abel Abidini, Michael Baersi, Johansoni ja Johansoni, Jakob Koldingu, Teemu Mäki, Dan Perjovschi, Hanno Soansi ning Aleksandr Breneri & Barbara Schurzi töödest

  20. Alates 13. XII on Vaala galeriis avatud "Talvesalong"

    Index Scriptorium Estoniae

    2004-01-01

    Väljas on Ellinor Aiki, Valdur Ohaka, Herman Talviku, Jaak Arro, Raoul Kurvitza, Andres Toltsi, Laurentsiuse, Lembit Saartsi, Rait Rosina, Merike Estna, Maarit Murka ning Aleksandr Breneri ja Barbara Schurzi tööd. 17. XII Anna Litvinova, Ilmar Kruusamäe ja Lembit Sarapuu ühised maaliseansid

  1. Tougher times for the ruling center-right / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2010-01-01

    Viimaste sisepoliitiliste muutuste tagajärjel on Leedus praegu võimul vähemusvalitsus. Kui parlament avaldab umbusaldust Linas Karaliusele ja Aleksandr Sacharukile, kellest esimene puudus istungitelt ja teine hääletas parlamendis tema eest, võib koalitsioon saada parlamendis kaks lisakohta. Endise Leedu suursaadiku Gruusias arvamus

  2. Larissa Kaidalova : svobodnoje slovo / Larissa Kaidalova ; interv. Jelena Skulskaja

    Index Scriptorium Estoniae

    Kaidalova, Larissa

    2008-01-01

    Venemaa Teatrikunsti Akadeemia lavakõne õppejõud Larissa Kaidalova tuli Vene Teatrisse, et abistada näitlejaid Aleksandr Gribojedovi värsirütmi omandamisel. Lavastus "Häda mõistuse pärast" avab teatri juubelihooaja

  3. Elu mütoloogilises psühhoruumis / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2009-01-01

    Tutvustus: Lukjanenko, Sergei. Öine Vahtkond / tlk. Tanel Rõigas. Tallinn : Varrak, 2008 ; Rubina, Dina. Päikeselisel tänavapoolel / tlk. Veronika Einberg. Tallinn : Tänapäev, 2008 ; Suhhotšev, Aleksandr. Goa sündroom / tlk. Veronika Einberg. Tallinn : Tänapäev, 2008

  4. Bogohulnaja ballada : [luuletused] / Heiti Talvik ; lühibiograafia: S. S. [Svetlan Semenenko

    Index Scriptorium Estoniae

    Talvik, Heiti, 1904-1947

    1999-01-01

    Sisu: Bogohulnaja ballada ; Notsh ; Mõsli s pohmelja ; V etu ossen ; Trjassina 1 ; Kogda vsjo istsheznet... ; Osvobozhdenije / tlk. Svetlan Semenenko ; Posle revoljutsii 1-2 ; Hor rabov / tlk. Aleksandr Levin. Orig.: Blasfeemiline ballaad ; Öö ; Pohmeluslikke mõlgutusi ; Oli sügis ; Rabas 1 ; Kui mustavad udud ; Vabanemine ; Järel revolutsiooni 1-2 ; Orjade koor 1-2

  5. Rice targets Lukashenko during NATO meeting in Vilnius / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Ameerika Ühendriikide välisminister Condoleezza Rice kritiseeris NATO tippkohtumisel Valgevene presidenti Aleksandr Lukashenkot, nimetades tema režiimi Euroopa viimaseks diktatuuriks. NATO tippkohtumisest Leedus. Lisad: NATO foorumi kultuuriline programm; NATO peasekretär Jaap de Hoop Scheffer

  6. Tshelovek bez litsa vtjanul BABa v ubiistvo

    Index Scriptorium Estoniae

    2007-01-01

    Vene peaprokuratuuri esindajad küsitlesid Aleksandr Litvinenko surma asjus Londonis Boriss Berezovskit ja Ahmed Zakajevit. B. Berezovski oma vestlusest Vene uurijatega. Artiklis väidetakse, et telesaates "Vesti nedeli" avalikustatud Vene eriteenistuse endise kaastöötaja ülestunnistused viivad mõttele, et A. Litvinenko surma võib olla segatud B. Berezovski ise

  7. "By Taste and the Spirit of the Times …" The Professor as Slave

    Science.gov (United States)

    Kabatskov, A. N.; Leybovich, O. L.

    2017-01-01

    The authors examine how the social status of the university professor has evolved in Russia in recent centuries in light of the historical concepts about the enslavement and emancipation of social groups proposed by Sergey Solovyov and Aleksandr Gradovsky. They use the metaphor of the "slave" [nevol'nik] to describe the dependent…

  8. Русский "Национальный бестселлер" достался Латвии

    Index Scriptorium Estoniae

    2003-01-01

    Aleksandr Garros ja Aleksei Jevdokimov (mõlevad elavad ja töötavad Riias) said kolmandana Venemaa kirjanduspreemia "Национальный бестселлер" põnevusromaani "Peamurdja" ("Голово[ломка]") eest

  9. "Национальный бестселлер" / Александр Гаррос, Алексей Евдокимов ; интервьюировал Борис Тух

    Index Scriptorium Estoniae

    Гаррос, Александр

    2003-01-01

    Aleksandr Garros ja Aleksei Jevdokimov (mõlevad elavad ja töötavad Riias) said kolmandana Venemaa kirjanduspreemia "Национальный бестселлер" põnevusromaani "Peamurdja" ("Головоломка") eest

  10. Margarita Terehhova : Miledi, iskupajushtshaja grehhi / Margarita Terehhova ; interv. Aljona Strizhenova

    Index Scriptorium Estoniae

    Terehhova, Margarita, 1942-

    2005-01-01

    25. veebruarist 3. märtsini toimus Tallinnas Vene Kino Festival : näitleja Margarita Terehhova rezžissööridebüüt "Kajakas" Anton Tšehhovi näidendi järgi. Filmis mängisid ka näitlejanna lapsed Aleksandr ja Anna

  11. Tshto delajet klassiku klassikoi / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2006-01-01

    16. rahvusvahelisest teatrifestivalist "Baltiiski dom" ("Balti kodu") Peterburis : Anton Tshehhovi "Onu Vanja" (Belgia teater "Toneelhuis", lavastaja Luk Perceval), "Kolm õde" (lavastaja Rimas Tuminas), Goethe "Faust" (lavastaja Eimuntas Nekroshius), "Kosmos" (Witold Gombrowiczi romaani järgi lavastanud Jerzy Jarocki), Aleksandr Ostrovski "Mets" (Moskva Kunstiteater, lavastaja Kirill Serebrjannikov), Sergei Korobkovi "Phaidra. Kuldne koloss" (Moskva Rahvuste Teatri projekt, lavastaja Andrii Zholdak)

  12. Muzei bez sten / Tatjana Pissareva

    Index Scriptorium Estoniae

    Pissareva, Tatjana

    2005-01-01

    Skulptori, graafiku ja maalikunstniku Rafael Arutjunjani loomingut kajastavast raamatust "Rafael Arutjunjan. Proizvedenija iskusstva" räägib raamatu väljaandja Areg Arutjunjan. Reprod ja fotod on Valeri Baretalt ja Sergei Didõkilt. Artiklite autorid on Boris Bernshtein, Aleksandr Sidorov ja Emma Darvis

  13. Korterelamud Haapsalus : Kastani 28 ja 36 = Apartment buildings in Haapsalu : Kastani 28 and 36 / Liina Jänes

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2008-01-01

    Nõukogude ajal lõpetamata jäänud majakarpide ümberehitus. Arhitektid: Urmas Muru, Peeter Pere, ksaasa töötasid Reet Viigipuu, Berit Freivald, Doris Orasi ja Aleksandr Zverev. Peatöövõtja: Mapri Projekt OÜ. 2 põhiplaani, 2 värv. välisvaadet

  14. Tsheloveku nuzhen drugoi tshelovek / Jevgeni Tsõmbal ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Tsõmbal, Jevgeni

    2008-01-01

    Režissöör Jevgeni Tsõmbal räägib intervjuus oma tööst, Aleksandr Kaidanovskist, kellele ta pühendas dokumentaalfilmi "Snõ Stalkera", Andrei Tarkovskist ja tema filmidest "Stalker" ja "Solaris"

  15. Ozarenije, ili lesnitsa, vedushtshaja k ikone / Valentina Siig

    Index Scriptorium Estoniae

    Siig, Valentina

    2007-01-01

    Ikooninäitus "Õigeusklik ikoon Eestis" Vene kultuurikeskuse galeriis Tallinnas, eksponeeritud 18-20. sajandist 97 ikooni. Näituse külastatavusest. Ikoonimaalija Aleksandr Balajevi (1947) eluloost, maalitud ikoonidest. Ill. lk. 217 ja 219 kunstniku 7 ikooni

  16. Артисты рассказали о "Дяде Ване" / Ксения Репсон

    Index Scriptorium Estoniae

    Репсон, Ксения

    2009-01-01

    Mossoveti Akadeemilise Teatri näitlejad Pavel Derevjanko, Irina Kartaševa, Julia Võssotskaja ja Aleksandr Filippenko räägivad, kuidas kulges töö Andrei Kontšalovski lavastusega "Onu Vanja", mida näidati algul Itaalias ja nüüd Eestis

  17. Grybauskaite's historic visit to Belarus / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2010-01-01

    Minskis toimunud presidentide Dalia Grybauskaite ja Aleksandr Lukašenko kohtumisel räägiti 19. detsembril toimuvatest Valgevene presidendivalimistest ja idapartnerlusest. Leedu president kohtus ka opositsiooni liikmetega. Visiidi ajal allkirjastasid riikide välisministrid Audronius Azubalis ja Sergei Martõnov lepingu, mis lihtsustab kahe riigi piiriäärsete elanike piiriületust

  18. Mis teeb klassikast klassika / Eteri Kekelidze ; tõlk. Virge Harak

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2007-01-01

    16. rahvusvahelisest teatrifestivalist "Baltiiski dom" ("Balti kodu") Peterburis : Anton Tshehhovi "Onu Vanja" (Belgia teater "Toneelhuis", lavastaja Luk Perceval), "Kolm õde" (lavastaja Rimas Tuminas), Goethe "Faust" (lavastaja Eimuntas Nekroshius), "Kosmos" (Witold Gombrowiczi romaani järgi lavastanud Jerzy Jarocki), Aleksandr Ostrovski "Mets" (Moskva Kunstiteater, lavastaja Kirill Serebrjannikov), Sergei Korobkovi "Phaidra. Kuldne koloss" (Moskva Rahvuste Teatri projekt, lavastaja Andrii Zholdak)

  19. Актерский тренинг в режиме нон-стоп / Лилия Крысина

    Index Scriptorium Estoniae

    Крысина, Лилия

    2010-01-01

    5. septembril (5.00-24.00) on Rotermanni kvartalis asuvas Nisu- ja rukkiveskis performance "live news project". Projekti autor ja lavastaja on Aleksandr Dzjuba, kes ka performance'i mõtet tutvustab. Eesti Draamateatri näitleja Mari-Liis Lill räägib kuidas toimuvad proovid

  20. Vanalinna Hariduskolleegiumi Gümnaasiumi õppehoone restaureerimine = Restoration of the academic building of the Old Town Educational College / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2009-01-01

    Tallinnas Vene 22 asuva hoone muinsuskaitse eritingimused koostas Aleksandr Pantelejev. Arhitekt Marie Hammer, sisearhitekt Tiiu Lõhmus (Vana Tallinn), arheoloog Villu Kadakas ja muinsuskaitselist järelevalvet teostanud Helve Ilves pälvisid restaureerimistöö eest arhitektuuri sihtkapitali aastapreemia 2008. Žürii hinnang