WorldWideScience

Sample records for alcaligenes eutrophus ch34

  1. Cloning and sequencing of IS1086, an Alcaligenes eutrophus insertion element related to IS30 and IS4351.

    OpenAIRE

    Dong, Q.; Sadouk, A; van der Lelie, D; Taghavi, S; A. Ferhat; Nuyten, J M; Borremans, B; Mergeay, M; Toussaint, A

    1992-01-01

    A new insertion sequence (IS), designated IS1086, was isolated from Alcaligenes eutrophus CH34 by being trapped in plasmid pJV240, which contains the Bacillus subtilis sacB and sacR genes. The 1,106-bp IS1086 element contains partially matched (22 of 28 bp) terminal-inverted repeats and a long open reading frame. Hybridization data suggest the presence of one copy of IS1086 in the strain CH34 heavy-metal resistance plasmid pMOL28 and at least two copies in its chromosome. Analysis of the IS10...

  2. Cloning and expression of plasmid genes encoding resistances to chromate and cobalt in Alcaligenes eutrophus.

    OpenAIRE

    Nies, A; Nies, D H; Silver, S

    1989-01-01

    Resistances to chromate and cobalt were cloned on a 30-kilobase-pair (kb) DNA region from the large Alcaligenes eutrophus plasmid pMOL28 into the broad-host-range mobilizable cosmid vector pVK102. A restriction nuclease map of the 30-kb region was generated. The resistances expressed from the hybrid plasmids after transfer back into A. eutrophus were inducible and conferred the same degree of resistance as the parent plasmid pMOL28. Resistances were expressed in metal-sensitive Alcaligenes st...

  3. Influence of Ammonium Salts and Cane Molasses on Growth of Alcaligenes eutrophus and Production of Polyhydroxybutyrate

    OpenAIRE

    Beaulieu, M.; Beaulieu, Y.; Melinard, J.; Pandian, S.; GOULET, J.

    1995-01-01

    The production of polyhydroxybutyrate (PHB) by Alcaligenes eutrophus DSM 545 was studied in a synthetic medium with 3% glucose at pH 7.0 supplemented with several ammonium substrates and cane molasses. Growth was measured by dry cell weight, and the PHB content was measured by gas chromatography. The effects of ammonium sources such as sulfate, nitrate, phosphate, and chloride salts and those of different ammonium sulfate concentrations were evaluated. The best growth and PHB production were ...

  4. Inducible and constitutive expression of pMOL28-encoded nickel resistance in Alcaligenes eutrophus N9A

    International Nuclear Information System (INIS)

    The nickel and cobalt resistance plasmid pMOL28 was transferred by conjugation from its natural host Alcaligenes eutrophus CH34 to the susceptible A. eutrophus N9A. Strain N9A and its pMOL28-containing transconjugant M220 were studied in detail. At a concentration of 3.0 mM NiCl2, the wild-type N9A did not grow, while M220 started to grow at its maximum exponential growth rate a lag of 12 to 24 h. When grown in the presence of subinhibitory concentrations of nickel salt, M220 grew actively at 3 mM NiCl2 without a lag, indicating that nickel resistance is an inducible property. Expression of nickel resistance required active growth in the presence of nickel salts at a concentration higher than 0.05 mM. Two mutants of M220 were isolated which expressed nickel resistance constitutively. When the plasmids, pMOL28.1 and pMOL28.2, carried by the mutants were transferred to strains H16 and CH34, the transconjugants expressed constitutive nickel resistance. This indicates that the mutation is plasmid located. Both mutants expressed constitutive resistance to nickel and cobalt. Physiological studies revealed the following difference between strain N9A and its pMOL28.1-harboring mutant derivatives. (i) The uptake of 63NiCl2 occurred more rapidly in the susceptible strain and reached a 30- to 60-fold-higher amount than that in the pMOL28.1-harboring mutant; (ii) in intact cells of the susceptible strain N9A, the cytoplasmic hydrogenase was inhibited by 1 to 5 mM NiCl2, whereas 10 mM Ni2+ was needed to inhibit the hydrogenase of mutant cells; (iii) the minimal concentration of nickel chloride for the derepressed synthesis of cytoplasmic hydrogenase was lower in strain N9A than in the constitutive mutant

  5. Transcriptional Organization of the czc Heavy-Metal Homeostasis Determinant from Alcaligenes eutrophus

    OpenAIRE

    Große, Cornelia; Grass, Gregor; Anton, Andreas; Franke, Sylvia; Santos, Alexander Navarrete; Lawley, Blair; Brown, Nigel L; Nies, Dietrich H.

    1999-01-01

    The Czc system of Alcaligenes eutrophus mediates resistance to cobalt, zinc, and cadmium through ion efflux catalyzed by the CzcCB2A cation-proton antiporter. DNA sequencing of the region upstream of the czcNICBADRS determinant located on megaplasmid pMOL30 revealed the 5′ end of czcN and a gene for a MgtC-like protein which is transcribed in the orientation opposite that of czc. Additional open reading frames upstream of czc had no homologs in the current databases. Using oligonucleotide-pro...

  6. Trichloroethylene degradation by two independent aromatic-degrading pathways in Alcaligenes eutrophus JMP134.

    OpenAIRE

    Harker, A R; Kim, Y.

    1990-01-01

    The bacterium Alcaligenes eutrophus JMP134(pJP4) degrades trichloroethylene (TCE) by a chromosomal phenol-dependent pathway and by the plasmid-encoded 2,4-dichlorophenoxyacetic acid pathway. The two pathways were independent and exhibited different rates of removal and capacities for quantity of TCE removed. The phenol-dependent pathway was more rapid (0.2 versus 0.06 nmol of TCE removed per min per mg of protein) and consumed all detectable TCE. The 2,4-dichlorophenoxyacetic acid-dependent p...

  7. Alcaligenes eutrophus JMP134 "2,4-dichlorophenoxyacetate monooxygenase" is an alpha-ketoglutarate-dependent dioxygenase.

    OpenAIRE

    Fukumori, F; Hausinger, R P

    1993-01-01

    The Alcaligenes eutrophus JMP134 tfdA gene, encoding the enzyme responsible for the first step in 2,4-dichlorophenoxyacetic acid (2,4-D) biodegradation, was overexpressed in Escherichia coli, and several enzymatic properties of the partially purified gene product were examined. Although the tfdA-encoded enzyme is typically referred to as 2,4-D monooxygenase, we were unable to observe any reductant-dependent activity. Rather, we demonstrate that this enzyme is a ferrous ion-dependent dioxygena...

  8. Effects of Low Dissolved-Oxygen Concentrations on Poly-(3-Hydroxybutyrate-co-3-Hydroxyvalerate) Production by Alcaligenes eutrophus

    OpenAIRE

    Lefebvre, G.; Rocher, M.; Braunegg, G.

    1997-01-01

    The bacterial copolyester poly-(3-hydroxybutyrate-co-3-hydroxyvalerate) was produced with Alcaligenes eutrophus DSM 545 from glucose and sodium propionate in a fed-batch fermentation with both nitrogen limitation and low dissolved-oxygen concentrations. When the dissolved-oxygen content was kept between 1 and 4% of air saturation during the polymer accumulation phase, the yield of 3-hydroxybutyrate (3HB) monomer from glucose was not affected, but the propionate-to-3-hydroxyvalerate (3HV) mono...

  9. Degradation of Chlorophenols by Alcaligenes eutrophus JMP134(pJP4) in Bleached Kraft Mill Effluent

    OpenAIRE

    Valenzuela, J.; Bumann, U.; Cespedes, R.; Padilla, L.; Gonzalez, B

    1997-01-01

    The ability of Alcaligenes eutrophus JMP134(pJP4) to degrade 2,4-dichlorophenoxyacetic acid, 2,4,6-trichlorophenol, and other chlorophenols in a bleached kraft mill effluent was studied. The efficiency of degradation and the survival of strain JMP134 and indigenous microorganisms in short-term batch or long-term semicontinuous incubations performed in microcosms were assessed. After 6 days of incubation, 2,4-dichlorophenoxyacetate (400 ppm) or 2,4,6-trichlorophenol (40 to 100 ppm) were extens...

  10. Analysis of duplicated gene sequences associated with tfdR and tfdS in Alcaligenes eutrophus JMP134.

    OpenAIRE

    Matrubutham, U; Harker, A R

    1994-01-01

    Plasmid pJP4 of Alcaligenes eutrophus JMP134 encodes the degradation of 2,4-dichlorophenoxyacetic acid. A 1.2-kb BamHI-XhoI region of the restriction fragment BamHI-E has been proposed to contain the regulatory gene tfdR (A. R. Harker, R. H. Olsen, and R. J. Seidler, J. Bacteriol. 171:314-320, 1989; B. Kaphammer, J. J. Kukor, and R. H. Olsen, J. Bacteriol. 172:2280-2286, 1990). When sequenced and analyzed, the region is shown to contain two incomplete open reading frames (ORFs) positioned div...

  11. Duplication of a 2,4-dichlorophenoxyacetic acid monooxygenase gene in Alcaligenes eutrophus JMP134(pJP4).

    OpenAIRE

    Perkins, E J; Lurquin, P F

    1988-01-01

    The Alcaligenes eutrophus JMP134 plasmid pJP4 contains genes necessary for the complete degradation of 2,4-dichlorophenoxyacetic acid (2,4-D) and 3-chlorobenzoic acid. tfdA encodes 2,4-D monooxygenase, the initial enzyme in the 2,4-D catabolic pathway. The tfdA locus has recently been localized to a region on pJP4 13 kilobases away from a cluster of five genes, tfdB to tfdF, which encode the enzymes responsible for the further degradation of 2,4-D to chloromaleylacetic acid (W.R. Streber, K. ...

  12. Evidence for isofunctional enzymes in the degradation of phenol, m- and p-toluate, and p-cresol via catechol meta-cleavage pathways in Alcaligenes eutrophus.

    OpenAIRE

    Hughes, E J; Bayly, R C; Skurray, R A

    1984-01-01

    A study of the degradation of phenol, p-cresol, and m- and p-toluate by Alcaligenes eutrophus 345 has provided evidence that these compounds are metabolized via separate catechol meta-cleavage pathways. Analysis of the enzymes synthesized by wild-type and mutant strains and by strains cured of the plasmid pRA1000, which encodes m- and p-toluate degradation, indicated that two or more isofunctional enzymes mediated several steps in the pathway. The formation of three catechol 2,3-oxygenases an...

  13. Analysis, cloning, and high-level expression of 2,4-dichlorophenoxyacetate monooxygenase gene tfdA of Alcaligenes eutrophus JMP134.

    OpenAIRE

    Streber, W R; Timmis, K N; Zenk, M H

    1987-01-01

    Plasmid pJP4 of Alcaligenes eutrophus JMP134 contains all genes for the degradation of 2,4-dichlorophenoxyacetic acid (2,4-D). Five of these genes, tfdB, tfdC, tfdD, tfdE, and tfdF, have recently been localized and cloned (R. H. Don, A. J. Weightman, H.-J. Knackmuss, and K. N. Timmis, J. Bacteriol. 161:85-90, 1985). Gene tfdA, which codes for the 2,4-D monooxygenase, has now been found by mutagenesis with transposon Tn5. A 3-kilobase fragment of pJP4 cloned in a broad-host-range vector could ...

  14. Combined nickel-cobalt-cadmium resistance encoded by the ncc locus of Alcaligenes xylosoxidans 31A.

    OpenAIRE

    Schmidt, T.; Schlegel, H G

    1994-01-01

    The nickel-cobalt-cadmium resistance genes carried by plasmid pTOM9 of Alcaligenes xylosoxidans 31A are located on a 14.5-kb BamHI fragment. By random Tn5 insertion mutagenesis, the fragment was shown to contain two distinct nickel resistance loci, ncc and nre. The ncc locus causes a high-level combined nickel, cobalt, and cadmium resistance in strain AE104, which is a cured derivative of the metal-resistant bacterium Alcaligenes eutrophus CH34. ncc is not expressed in Escherichia coli. The n...

  15. Uranium and selenium resistance in Cupriavidus metallidurans CH34

    Energy Technology Data Exchange (ETDEWEB)

    Avoscan, L.; Untereiner, G.; Carriere, M.; Gouget, B. [CEA Saclay, CNRS, UMR9956, Lab Pierre Sue, F-91191 Gif Sur Yvette, (France); Degrouard, J. [Univ Paris 11, Ctr Commun Microscopie Elect, CNRS, UMR8080, Orsay, (France)

    2007-07-01

    Cupriavidus metallidurans CH34, a soil bacterium, is known to resist a variety of heavy metals and metalloids. Its capacity to resist, accumulate and transform selenium (Se as selenite or selenate) and uranium (U as uranyl-carbonate and uranyl-citrate) was investigated. C. metallidurans CH34 resists to high U concentrations (up to 10 mM) whatever its speciation. However, no major accumulation could be measured: U-carbonate and U-citrate are not bio-available for the bacteria. The anaerobic response of C. metallidurans CH34 to U will be looked for. C. metallidurans CH34 resists to high Se concentrations (up to 4 mM of selenite and 8 mM of selenate). Bacteria exposed to 2 mM of selenite accumulate 25 times more Se than when they are exposed to same concentration of selenate. Se resistance is characterized by the reduction of oxy-anions in the bacteria. Selenite is reduced to elemental Se by an intracellular process, but the metabolic fate of selenate is unknown. By combining three methods of speciation (X-ray absorption spectroscopy (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGE coupled with particle induced X-ray emission (PIXE)), we both identified and specified the chemical intermediates formed by this bacterium upon exposure to these oxy-anions. Two mechanisms of reduction of Se oxides in C. metallidurans CH34 were highlighted. Assimilation transforms selenite and selenate into organic Se, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental Se. (authors)

  16. Uranium and selenium resistance in Cupriavidus metallidurans CH34

    International Nuclear Information System (INIS)

    Cupriavidus metallidurans CH34, a soil bacterium, is known to resist a variety of heavy metals and metalloids. Its capacity to resist, accumulate and transform selenium (Se as selenite or selenate) and uranium (U as uranyl-carbonate and uranyl-citrate) was investigated. C. metallidurans CH34 resists to high U concentrations (up to 10 mM) whatever its speciation. However, no major accumulation could be measured: U-carbonate and U-citrate are not bio-available for the bacteria. The anaerobic response of C. metallidurans CH34 to U will be looked for. C. metallidurans CH34 resists to high Se concentrations (up to 4 mM of selenite and 8 mM of selenate). Bacteria exposed to 2 mM of selenite accumulate 25 times more Se than when they are exposed to same concentration of selenate. Se resistance is characterized by the reduction of oxy-anions in the bacteria. Selenite is reduced to elemental Se by an intracellular process, but the metabolic fate of selenate is unknown. By combining three methods of speciation (X-ray absorption spectroscopy (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGE coupled with particle induced X-ray emission (PIXE)), we both identified and specified the chemical intermediates formed by this bacterium upon exposure to these oxy-anions. Two mechanisms of reduction of Se oxides in C. metallidurans CH34 were highlighted. Assimilation transforms selenite and selenate into organic Se, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental Se. (authors)

  17. Enhanced Selenate Accumulation in Cupriavidus metallidurans CH34 Does Not Trigger a Detoxification Pathway▿

    OpenAIRE

    Avoscan, Laure; Carrière, Marie; Proux, Olivier; Sarret, Géraldine; Degrouard, Jéril; Covès, Jacques; Gouget, Barbara

    2009-01-01

    Cupriavidus metallidurans CH34 cells grown under sulfate-limited conditions accumulated up to six times more selenate than cells grown in sulfate-rich medium. The products of selenate reduction detected by X-ray absorption spectroscopy, electron microscopy, and energy-dispersive X-ray analysis did not define this strain as being a good candidate for bioremediation of selenate-contaminated environments.

  18. The stress response of bacterium Cupriavidus metallidurans CH34 into simulated microgravity

    Science.gov (United States)

    van Houdt, Rob; de Boever, Patrick; Coninx, Ilse; Janssen, Ann; Benotmane, Rafi; Leys, Natalie; Mergeay, Max

    The stress response of bacterium Cupriavidus metallidurans CH34 into simulated microgravity R. Van Houdt, P. De Boever, I. Coninx, A. Janssen, M.A. Benotmane, N. Leys, and M. Mergeay Expertise group for Molecular and Cellular Biology, Institute for Environment, Health and Safety, Belgian Nuclear Research Centre (SCK•CEN), Boeretang 200, B-2400 Mol, Belgium. We have studied the response of Cupriavidus (formerly Ralstonia) metallidurans CH34 to simulated microgravity by culturing in a Rotating Wall Vessel (RWV) bioreactor. This bioreactor technology generates a unique Low-Shear Modeled Microgravity (LSMMG) environment and is exploited as analogue for in vivo medical and space environments. Cupriavidus and Ralstonia species are relevant model bacteria since they are often isolated from the floor, air and surfaces of spacecraft assembly rooms and not only contaminate the clean rooms but have also been found prior-to-flight on surfaces of space robots such as the Mars Odyssey Orbiter and even in-flight in ISS cooling water and Shuttle drinking water. In addition, C. metallidurans CH34 is also being used in fundamental space flight experiments aimed to gain a better insight in the bacterial adaptation to space. The first objective was to elucidate the stress response of C. metallidurans CH34 grown in LSMMG compared to a normal gravity control. Transcriptomic analysis revealed that a significant part of the heat shock response was induced in LSMMG. Transcription of d naK, encoding the major heat-shock protein and a prokaryotic homologue of the eukaryotic Hsp70 protein, was induced 6.4 fold in LSMMG. DnaK is assisted by partner chaperones DnaJ and GrpE for which transcription respectively were induced 2.0 and 2.6 fold. Transcription of other chaperones known to belong to the heat shock response was also induced in LSMMG: hslV and hsl U, encoding the HslVU protease, were induced respectively 5.5 and 3.4 fold; htpG, encoding a Hsp90 family chaperone, was induced 4.6 fold

  19. Degradation of indole by Alcaligenes spec.

    Science.gov (United States)

    Claus, G; Kutzner, H J

    1983-01-01

    Alcaligenes spec. strain In 3 was isolated from an enrichment culture with indole inoculated with activated sludge. The organism was able to grow with indole as sole source of carbon and nitrogen. During growth with this substrate indigo and anthranilate accumulated in the culture broth. By measurement of the oxidation of intermediates (O(2)-uptake) and determination of the activity of enzymes responsible for ring cleavage the following pathway for indole degradation could be established: indole → indoxyl → isatin → anthranilate → gentisate → maleyl pyruvate → fumaryl pyruvate → fumarate + pyruvate. - Alcaligenes spec. strain In 3 was also able to grow with various aromatic compounds; these were degraded by ortho- or meta-cleavage or via the gentisinic acid pathway. PMID:23194589

  20. Scleral buckle infection with Alcaligenes xylosoxidans

    Directory of Open Access Journals (Sweden)

    Chih-Kang Hsu

    2014-01-01

    Full Text Available We describe a rare case of extraocular inflammation secondary to scleral buckle infection with Alcaligenes xylosoxidans. A 60-year-old female with a history of retinal detachment repair with open-book technique of scleral buckling presented with purulent discharge and irritation in the right eye that had begun 4 weeks earlier and had been treated ineffectively at another hospital. Conjunctival erosion with exposure of the scleral buckle was noted. The scleral buckle was removed and cultured. The explanted material grew gram-negative rod later identified as A. xylosoxidans. On the basis of the susceptibility test results, the patient was treated by subconjunctival injection and fortified topical ceftazidime. After 4 weeks of treatment, the infection resolved.

  1. The complete genome sequence of Cupriavidus metallidurans strain CH34, a master survivalist in harsh and anthropogenic environments.

    Directory of Open Access Journals (Sweden)

    Paul J Janssen

    Full Text Available Many bacteria in the environment have adapted to the presence of toxic heavy metals. Over the last 30 years, this heavy metal tolerance was the subject of extensive research. The bacterium Cupriavidus metallidurans strain CH34, originally isolated by us in 1976 from a metal processing factory, is considered a major model organism in this field because it withstands milli-molar range concentrations of over 20 different heavy metal ions. This tolerance is mostly achieved by rapid ion efflux but also by metal-complexation and -reduction. We present here the full genome sequence of strain CH34 and the manual annotation of all its genes. The genome of C. metallidurans CH34 is composed of two large circular chromosomes CHR1 and CHR2 of, respectively, 3,928,089 bp and 2,580,084 bp, and two megaplasmids pMOL28 and pMOL30 of, respectively, 171,459 bp and 233,720 bp in size. At least 25 loci for heavy-metal resistance (HMR are distributed over the four replicons. Approximately 67% of the 6,717 coding sequences (CDSs present in the CH34 genome could be assigned a putative function, and 9.1% (611 genes appear to be unique to this strain. One out of five proteins is associated with either transport or transcription while the relay of environmental stimuli is governed by more than 600 signal transduction systems. The CH34 genome is most similar to the genomes of other Cupriavidus strains by correspondence between the respective CHR1 replicons but also displays similarity to the genomes of more distantly related species as a result of gene transfer and through the presence of large genomic islands. The presence of at least 57 IS elements and 19 transposons and the ability to take in and express foreign genes indicates a very dynamic and complex genome shaped by evolutionary forces. The genome data show that C. metallidurans CH34 is particularly well equipped to live in extreme conditions and anthropogenic environments that are rich in metals.

  2. Response of the bacterium Cupriavidus metallidurans CH34 to space flight conditions.

    Science.gov (United States)

    Leys, N.; Wattiez, R.; Rosier, C.; de Boever, P.; Baatout, S.; Mergeay, M.

    Background When man goes to space inevitably microbes hitchhike along some needed others unwanted Knowledge is required to understand the behaviour of bacteria in spaceflight conditions Aim The aim of this work was to investigate the physiological and metabolic response and adaptation of the environmental model bacterium Cupriavidus metallidurans CH34 to space flight conditions The strain was grown in the International Space Station ISS during 2 separated Soyuz missions MESSAGE 1 2 experiments and in the Rotating Wall Vessel RWV mimicking microgravity on ground Results It was clear that pre- in- and post-flight incubation conditions are critical in spaceflight experiments and should be controlled monitored and taken into account as much as possible when comparing space flight with ground grown cells Distinct changes in physiology and metabolism were observed in the cell cultures grown in space flight when compared to correct ground control cultures A total of 12 proteins over-produced in space conditions were identified and divided in functional groups One group are proteins that protect the cell against physical damage such as heat-shock GrpE UspA and oxidative agents AhpC TrxB DpsA Another group of proteins is probably involved in a metabolic pathway to produce the energy-rich Acetyl-CoA Ald ExaC LpsJ CaiA with the help of a de carboxylase AcxABC Higher concentrations of this group of proteins were also detected in cells grown with acetone or 2-propanol as

  3. Transposon mutagenesis and cloning analysis of the pathways for degradation of 2,4-dichlorophenoxyacetic acid and 3-chlorobenzoate in Alcaligenes eutrophus JMP134(pJP4).

    OpenAIRE

    Don, R H; Weightman, A J; Knackmuss, H J; Timmis, K N

    1985-01-01

    Plasmid pJP4 permits its host bacterium, strain JMP134, to degrade and utilize as sole sources of carbon and energy 3-chlorobenzoate and 2,4-dichlorophenoxyacetic acid (R. H. Don and J. M. Pemberton, J. Bacteriol. 145:681-686, 1981). Mutagenesis of pJP4 by transposons Tn5 and Tn1771 enabled localization of five genes for enzymes involved in these catabolic pathways. Four of the genes, tfdB, tfdC, tfdD, and tfdE, encoded 2,4-dichlorophenol hydroxylase, dichlorocatechol 1,2-dioxygenase, chlorom...

  4. The interactions of the bacterium Cupriavidus metallidurans CH34 with basalt rock, on Earth and in Space

    Science.gov (United States)

    Byloos, Bo; Van Houdt, Rob; Leys, Natalie; Ilyin, Vyacheslav; Nicholson, Natasha; Childers, Delma; Cockell, Charles; Boon, Nico

    2016-07-01

    Microbe-mineral interactions have become of interest for space exploration as microorganisms can biomine elements from extra-terrestrial materials, which could be used as nutrients in a life support system. This research is aimed at identifying the molecular mechanisms behind the interaction of Cupriavidus metallidurans CH34 with basalt, a lunar-type rock, and determining the influence of space flight conditions on this interaction. Survival and physiology of CH34 was monitored, with and without basalt, in mineral water over several months by flow cytometry, plate counts, ICP-MS, microscopy and proteomics. To study the influence of space conditions, a flight experiment on board the Russian FOTON-M4 capsule was performed. The results obtained from from water survival experiments on ground showed that CH34 was able to survive in mineral water, in the absence and presence of basalt, for several months. The total cell concentration remained stable but the cultivable fraction dropped to 10%, indicating a transition to a more dormant state. In the presence of basalt, this transition was less pronounced and cultivability was enhanced. In addition, with basalt, CH34 attached to the rock surface and formed a biofilm. The space flight experiment indicated more viable and cultivable cells compared to the ground experiment, both in the absence and presence of basalt, indicating a positive effect of space flight on survival. Chemical analysis indicated that basalt leaches out elements which may contribute to a positive effect of basalt on survival. Basalt may thus enhance survival and viability of CH34 both in ground and space flight experimental conditions. This study hopefully can contribute to a better understanding of microbe-mineral interactions, opening the door to future applications, in space, and on Earth. Acknowledgments: This work is supported by the European Space Agency (ESA-PRODEX) and the Belgian Science Policy (Belspo) through the BIOROCK project. We thank Kai

  5. Novel cyanide-hydrolyzing enzyme from Alcaligenes xylosoxidans subsp. denitrificans.

    OpenAIRE

    Ingvorsen, K.; Højer-Pedersen, B; Godtfredsen, S E

    1991-01-01

    A cyanide-metabolizing bacterium, strain DF3, isolated from soil was identified as Alcaligenes xylosoxidans subsp. denitrificans. Whole cells and cell extracts of strain DF3 catalyzed hydrolysis of cyanide to formate and ammonia (HCN + 2H2O----HCOOH + NH3) without forming formamide as a free intermediate. The cyanide-hydrolyzing activity was inducibly produced in cells during growth in cyanide-containing media. Cyanate (OCN-) and a wide range of aliphatic and aromatic nitriles were not hydrol...

  6. Seleno-l-Methionine Is the Predominant Organic Form of Selenium in Cupriavidus metallidurans CH34 Exposed to Selenite or Selenate†

    OpenAIRE

    Avoscan, Laure; Collins, Richard; Carriere, Marie; Gouget, Barbara; Covès, Jacques

    2006-01-01

    The accumulated organic form of selenium previously detected by X-ray absorption near-edge structure (XANES) analyses in Cupriavidus metallidurans CH34 exposed to selenite or selenate was identified as seleno-l-methionine by coupling high-performance liquid chromatography to inductively coupled plasma-mass spectrometry.

  7. Study of interaction of the bacterium cupriavidus metallidurans with strontium

    International Nuclear Information System (INIS)

    Cupriavidus metallidurans strain Ch34 (previously known as Ralstonia metallidurans, Ralstonia eutropha, and Alcaligenes eutrophus) is an ideal subject to study heavy metal disturbance of cellular processes. Moreover, the capacity of C. metallidurans Ch34 for in situ bioremediation was assessed and proved to be feasible on pilot scale. In this work, the molecular and physiological response to strontium cations (Sr2+) by C.metallidurans Ch34 was studied. Results showed that C. metallidurans Ch34 resisted to high concentrations of Sr (120 m M) and that this resistance is not linked to the presence of its 2 large plasmid pMOL30 or pMOL28. During this study, a tctCBA-dependent tripartite tricarboxylate transport (TTT) system in strain Ch34 was discovered. Transmission Electron Microscopy (TEM) observation of C.metallidurans challenged with strontium confirms the precipitation of Sr2+) directly onto the surface of cells, inside and in the microenvironment around the cells. These results highlight the potential of C. metalliduras Ch34 to endure environmental extremes and suggest that in situ bioremediation of Sr-containing waste with Ch34 might be feasible.

  8. Study of the Cupriavidus metallidurans CH34 resistance of selenite and selenate oxy-anions: accumulation, localisation and transformation of selenium

    International Nuclear Information System (INIS)

    Selenium is an essential trace element for the living organisms but it is very toxic at high concentration. Selenite and selenate oxides, soluble forms, highly toxic and bio-assimilable, are the most prevalent forms in the environment. Some soil micro-organisms play a dominant role and contribute to the natural cycle of selenium. Our study model, Cupriavidus (formerly Ralstonia) metallidurans CH34, a telluric bacterium characteristic of metal-contaminated biotopes, is known to resist selenite by reducing it into elemental selenium, an insoluble and less toxic form of selenium. In order to better understand the mechanisms of selenium reduction in the bacteria, three methods of speciation were combined (XAS (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGEPIXE). They were completed by the direct quantification of selenium accumulated in the bacteria. Speciation analyses highlighted the existence of two mechanisms of reduction of selenium oxides in C. metallidurans CH34. Assimilation transforms selenite and selenate into organic selenium, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental selenium. This way of detoxication is not set up after an exposure to selenate although it is nevertheless possible to detect elemental selenium but in very small amount compared to the exposure of selenite. Seleno-diglutathion is detected in bacteria stressed by an exposure to selenate in medium limited in sulphate. Bacteria exposed to selenite accumulate 25 times more selenium than when they are exposed to selenate. The study of mutants resistant to selenite, which do not express the membrane protein DedA, showed that the accumulation of selenium after exposure to selenite is decreased compared with the wild strain meaning probable link between the transport of selenite and the DedA protein. Finally, selenate would use the sulphate permease

  9. The cnrY gene, a tool to monitor DNA rearrangements by IS translocation in Cupriavidus metallidurans CH34 in response to space flight

    Science.gov (United States)

    Leys, N.; Monchy, S.; Vallaeys, T.; Dams, A.; Mergeay, M.

    Background The beta -Proteobacterium Cupriavidus metallidurans CH34 carries a chromosome 3 9 Mb a megaplasmid 2 6 Mb and many different Mobile Genetic Elements MGEs including 2 large plasmids 234 kb and 170 kb and at least 1 genomic island 7 transposons and 13 IS elements Mobility and rearrangements of these MGEs could play a direct part in genome adaptation and evolution in response to environmental stresses such as space flight conditions Aim In this study a new tool was developed and tested to detect the mobility and functionality of the IS elements in response to environmental stresses such as space flight Method The cnrYXHCBAT gene cluster on the pMOL28 plasmid of CH34 Tibazarwa et al 2000 governs the efficient efflux of Co 2 and Ni 2 and a slight unspecific efflux of Zn 2 Mutations inactivating the cnrY gene 300 bp encoding an antisigma repressor protein allow a constitutive over-expression of nickel cobalt resistance Collard et al 1993 Such cnrY mutants can be positively selected when the medium is supplemented with 0 6mM Zn 2 ZnR mutants As functional test 35 independent cultures of CH34 were incubated on agar containing 0 6mM Zn 2 during 10 days in the International Space Station ISS and on corresponding control plates at the ground From these cultures in total ca 600 ZnR mutants were selected and the promoter- cnrY fragment was amplified and sequenced Result This study revealed that the

  10. Factors influencing the biosorption of gadolinium by micro-organisms and its mobilisation from sand

    International Nuclear Information System (INIS)

    The present work was devoted to the study of the biosorption capacities of various microbial species (Bacillus subtilis, Pseudomonas aeruginosa, Ralstonia metallidurans CH34 previously Alcaligenes eutrophus CH34, Mycobacterium smegmatis, Saccharomyces cerevisiae) for ions of the lanthanide gadolinium (Gd3+). The uptake by sand of this element was also measured. Saturation curves and Scatchard models were established for all biosorbants used in this work. The results enabled us to determine the binding affinities and the maximum capacities for biosorption of Gd3+, which ranged from 350 μmol g-1 for B. subtilis to 5.1 μmol g-1 for S. cerevisiae. This study demonstrated the usefulness of optimisation of experimental conditions in biosorption investigations. Experimental results showed that bisorption could be influenced by the growth stage and by the composition of the growth medium of microbial cells. Finally, particular attention was given to the transfer of gadolinium ions from a loaded sand to a bacterial suspension. (orig.)

  11. Comparison of chemical washing and physical cell-disruption approaches to assess the surface adsorption and internalization of cadmium by Cupriavidus metallidurans CH34

    International Nuclear Information System (INIS)

    Highlights: • Subcellular distribution of cadmium in Cupriavidus metallidurans CH34 cells. • Comparison of a chemical (EDTA washing) and a physical method (physical disruption). • EDTA washings strongly overestimated membrane-bound Cd concentrations. • The physical method revealed surprisingly over 80% of Cd internalization in the cells. • Metal biosorption by bacteria cannot be considered as a surface complexation process. - Abstract: Bacterial biosorption of heavy metals is often considered as a surface complexation process, without considering other retention compartments than cell walls. Although this approach gives a good description of the global biosorption process, it hardly permits the prediction of the fate of biosorbed metals in the environment. This study examines the subcellular distribution of cadmium (Cd) in the metal-tolerant bacterium Cupriavidus metallidurans CH34 through the comparison of an indirect chemical method (washing cells with EDTA) and a direct physical method (physical disruption of cells). The chemical washing approach presented strong experimental biases leading to the overestimation of washed amount of Cd, supposedly bound to cell membranes. On the contrary, the physical disruption approach gave reproducible and robust results of Cd subcellular distribution. Unexpectedly, these results showed that over 80% of passively biosorbed Cd is internalized in the cytoplasm. In disagreement with the common concept of surface complexation of metals onto bacteria the cell wall was poorly reactive to Cd. Our results indicate that metal sorption onto bacterial surfaces is only a first step in metal management by bacteria and open new perspectives on metal biosorption by bacteria in the environment, with implications for soil bioremediation or facilitated transport of metals by bacteria

  12. Comparison of chemical washing and physical cell-disruption approaches to assess the surface adsorption and internalization of cadmium by Cupriavidus metallidurans CH34

    Energy Technology Data Exchange (ETDEWEB)

    Desaunay, Aurélien; Martins, Jean M.F., E-mail: jean.martins@ujf-grenoble.fr

    2014-05-01

    Highlights: • Subcellular distribution of cadmium in Cupriavidus metallidurans CH34 cells. • Comparison of a chemical (EDTA washing) and a physical method (physical disruption). • EDTA washings strongly overestimated membrane-bound Cd concentrations. • The physical method revealed surprisingly over 80% of Cd internalization in the cells. • Metal biosorption by bacteria cannot be considered as a surface complexation process. - Abstract: Bacterial biosorption of heavy metals is often considered as a surface complexation process, without considering other retention compartments than cell walls. Although this approach gives a good description of the global biosorption process, it hardly permits the prediction of the fate of biosorbed metals in the environment. This study examines the subcellular distribution of cadmium (Cd) in the metal-tolerant bacterium Cupriavidus metallidurans CH34 through the comparison of an indirect chemical method (washing cells with EDTA) and a direct physical method (physical disruption of cells). The chemical washing approach presented strong experimental biases leading to the overestimation of washed amount of Cd, supposedly bound to cell membranes. On the contrary, the physical disruption approach gave reproducible and robust results of Cd subcellular distribution. Unexpectedly, these results showed that over 80% of passively biosorbed Cd is internalized in the cytoplasm. In disagreement with the common concept of surface complexation of metals onto bacteria the cell wall was poorly reactive to Cd. Our results indicate that metal sorption onto bacterial surfaces is only a first step in metal management by bacteria and open new perspectives on metal biosorption by bacteria in the environment, with implications for soil bioremediation or facilitated transport of metals by bacteria.

  13. Study of the Cupriavidus metallidurans CH34 resistance of selenite and selenate oxy-anions: accumulation, localisation and transformation of selenium; Etude de la resistance de Cupriavidus metallidurans CH34 aux oxyanions selenite et seleniate: accumulation, localisation et transformation du selenium

    Energy Technology Data Exchange (ETDEWEB)

    Avoscan, L

    2007-06-15

    Selenium is an essential trace element for the living organisms but it is very toxic at high concentration. Selenite and selenate oxides, soluble forms, highly toxic and bio-assimilable, are the most prevalent forms in the environment. Some soil micro-organisms play a dominant role and contribute to the natural cycle of selenium. Our study model, Cupriavidus (formerly Ralstonia) metallidurans CH34, a telluric bacterium characteristic of metal-contaminated biotopes, is known to resist selenite by reducing it into elemental selenium, an insoluble and less toxic form of selenium. In order to better understand the mechanisms of selenium reduction in the bacteria, three methods of speciation were combined (XAS (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGEPIXE). They were completed by the direct quantification of selenium accumulated in the bacteria. Speciation analyses highlighted the existence of two mechanisms of reduction of selenium oxides in C. metallidurans CH34. Assimilation transforms selenite and selenate into organic selenium, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental selenium. This way of detoxication is not set up after an exposure to selenate although it is nevertheless possible to detect elemental selenium but in very small amount compared to the exposure of selenite. Seleno-diglutathion is detected in bacteria stressed by an exposure to selenate in medium limited in sulphate. Bacteria exposed to selenite accumulate 25 times more selenium than when they are exposed to selenate. The study of mutants resistant to selenite, which do not express the membrane protein DedA, showed that the accumulation of selenium after exposure to selenite is decreased compared with the wild strain meaning probable link between the transport of selenite and the DedA protein. Finally, selenate would use the sulphate permease

  14. Lipase expression in Pseudomonas alcaligenes is under the control of a two-component regulatory system

    NARCIS (Netherlands)

    Krzeslak, Joanna; Gerritse, Gijs; van Merkerk, Ronald; Cool, Robbert H.; Quax, Wim J.

    2008-01-01

    Preliminary observations in a large-scale fermentation process suggested that the lipase expression of Pseudomonas alcaligenes can be switched on by the addition of certain medium components, such as soybean oil. In an attempt to elucidate the mechanism of induction of lipase expression, we have set

  15. Unusual causes of peritonitis in a peritoneal dialysis patient: Alcaligenes faecalis and Pantoea agglomerans

    Directory of Open Access Journals (Sweden)

    Arikan Hakki

    2011-04-01

    Full Text Available Abstract An 87 -year-old female who was undergoing peritoneal dialysis presented with peritonitis caused by Alcaligenes faecalis and Pantoea agglomerans in consecutive years. With the following report we discuss the importance of these unusual microorganisms in peritoneal dialysis patients.

  16. Unusual causes of peritonitis in a peritoneal dialysis patient: Alcaligenes faecalis and Pantoea agglomerans

    OpenAIRE

    Arikan Hakki; Ari Elif; Tigen Elif; Asicioglu Ebru; Kahveci Arzu; Odabasi Zekaver; Ozener Cetin

    2011-01-01

    Abstract An 87 -year-old female who was undergoing peritoneal dialysis presented with peritonitis caused by Alcaligenes faecalis and Pantoea agglomerans in consecutive years. With the following report we discuss the importance of these unusual microorganisms in peritoneal dialysis patients.

  17. Potential of Cupriavidus metallidurans CH34 for in situ resource utilization from basalt by determining the molecular micro-mineral interactions

    Science.gov (United States)

    Byloos, Bo; Van Houdt, Rob; Boon, Nico; Leys, Natalie

    In order to maintain a persistent human presence in space, materials must either be provided from Earth or generated from material already present in space, in a process referred to as 'in situ resource utilization (ISRU)'. Microorganisms can biomine useful elements from extra-terrestrial materials for use as nutrients in a life support system or to aid in the creation of soil. To effectively use bacteria in an ISRU process more needs to be known about the molecular mechanisms behind microbe-mineral interaction and the influence of microgravity and radiation that affect bioleaching. The aim of this research project is to define the microbe-mineral interactions on basalt, which is a major constituent of Lunar or Martian regolith, the mechanisms that are important in bioleaching and how this process will be altered by space flight conditions. In particular, the research will be focussed on the determination of the genes and proteins involved in the biosynthesis of metallophores and exopolysaccharides (EPS), and biofilm formation. Iron, copper and phosphate uptake mechanisms are investigated in detail because these have been shown to be essential for life and bacteria are faced with limitation of these nutrients in the environment. In this study the bacterium Cupriavidus metallidurans CH34 is used to study these interactions. C. metallidurans CH34 is a soil bacterium which is resistant to up to 20 different heavy metal ions. Its behaviour in space has already been determined with earlier flight experiments to the ISS. It was recently discovered that C. metallidurans forms a biofilm and is capable of leaching calcium, magnesium and iron from basalt to sustain its growth First, C. metallidurans was grown in conditions with and without basalt, iron, copper and phosphate and the production of EPS and metallophores was examined. The iron, copper and phosphate concentrations which are limiting and optimal to allow C. metallidurans cell proliferation could be determined as

  18. Sulphoacetaldehyde acetyltransferase yields acetyl phosphate : purification from Alcaligenes defragrans and gene clusters in taurine degradation

    OpenAIRE

    Ruff, Jürgen; Denger, Karin; Cook, Alasdair M.

    2003-01-01

    The facultatively anaerobic bacterium Alcaligenes defragrans NKNTAU was found to oxidize taurine (2-aminoethanesulphonate) with nitrate as the terminal electron acceptor. Taurine was transaminated to 2-sulphoacetaldehyde. This was not converted into sulphite and acetate by a "sulphoacetaldehyde sulpho-lyase" (EC 4.4.1.12), but into sulphite and acetyl phosphate, which was identified by three methods. The enzyme, which required the addition of phosphate, thiamin diphosphate and Mg(2+) ions for...

  19. MICROBIAL LIPASES: PRODUCTION OF EXTRACELLULAR LIPASE ENZYME BY ALCALIGENES VISCOSUS (DOGE-1) STRAIN

    OpenAIRE

    P.Sekhar

    2012-01-01

    Industrially important extracellular lipase enzyme production was explored by utilizingmicrobial strain isolated from dairy effluents. Alcaligenes viscosus DOGE-1 strain isolated from dairywaste waters proved to produce extracellular lipase. Various growth factors were attempted to maximizethe lipase production by this strain. Growth factors like NH4PO4, Peptone, Urea coupled with peptone,KH2PO4, Olive oil and pH were found to be favored the maximum lipase production. This microbialstrain was...

  20. Isolation of Indole Utilizing Bacteria Arthrobacter sp. and Alcaligenes sp. From Livestock Waste.

    Science.gov (United States)

    Kim, Minsu; Lee, Jin-Hyung; Kim, Eonmi; Choi, Hyukjae; Kim, Younghoon; Lee, Jintae

    2016-06-01

    Indole is an interspecies and interkingdom signaling molecule widespread in different environmental compartment. Although multifaceted roles of indole in different biological systems have been established, little information is available on the microbial utilization of indole in the context of combating odor emissions from different types of waste. The present study was aimed at identifying novel bacteria capable of utilizing indole as the sole carbon and energy source. From the selective enrichment of swine waste and cattle feces, we identified Gram-positive and Gram-negative bacteria belonging to the genera Arthrobacter and Alcaligenes. Bacteria belonging to the genus Alcaligenes showed higher rates of indole utilization than Arthrobacter. Indole at 1.0 mM for growth was completely utilized by Alcaligenes sp. in 16 h. Both strains produced two intermediates, anthranilic acid and isatin, during aerobic indole metabolism. These isolates were also able to grow on several indole derivatives. Interestingly, an adaptive response in terms of a decrease in cell size was observed in both strains in the presence of indole. The present study will help to explain the degradation of indole by different bacteria and also the pathways through which it is catabolized. Furthermore, these novel bacterial isolates could be potentially useful for the in situ attenuation of odorant indole and its derivatives emitted from different types of livestock waste. PMID:27570307

  1. Growth kinetics of Pseudomonas alcaligenes C-0 relative to inoculation and 3-chlorobenzoate metabolism in soil.

    Science.gov (United States)

    Focht, D D; Shelton, D

    1987-08-01

    Pseudomonas alcaligenes C-0 was isolated from activated sewage sludge by enrichment with 3-chlorobenzoate (3CB) as the sole carbon source. The carbon balance from [14C]3CB in pure culture could be accounted for in substrate, biomass, and CO2 from all sampling periods and inoculum densities (0.012, 0.092, 0.20, and 0.92 micrograms of dry cells X ml-1), and inorganic chloride was produced stoichiometrically. Monod parameters as determined in culture were compared with the kinetics of 3CB metabolism in soil with decreasing inoculum densities (1.9 X 10(-1), 1.9 X 10(-3), and 1.9 X 10(-5) micrograms of cells X g-1). 3CB was refractile to attack in soil by indigenous microflora, but it was completely metabolized upon inoculation with P. alcaligenes C-0. The saturation constant KS was much higher in soil than in culture, but the yield coefficient Y and the growth rate constant were the same in both systems: mu max = 0.32 h-1; Y = 34 micrograms cells X mumol-1; KS = 0.18 mM in culture and 6.0 mM in soil solution (1.1 mumol X g-1 of soil). The parameter estimates obtained from the highest inoculum density could be used for the lower inoculum densities with reasonable agreement between predicted and observed 3CB concentrations in soil, although the residual sum of squares was progressively higher. Since the growth rate of P. alcaligenes C-0 in soil was comparable to its growth rate in culture, inoculation should be a viable strategy for biodegradation of 3CB in soil if indigenous microflora are unable to exploit this metabolic niche. PMID:3662518

  2. Characterization of the Endogenous Plasmid from Pseudomonas alcaligenes NCIB 9867: DNA Sequence and Mechanism of Transfer

    OpenAIRE

    Kwong, Stephen M.; Yeo, Chew Chieng; Suwanto, Antonius; Poh, Chit Laa

    2000-01-01

    The endogenous plasmid pRA2 from Pseudomonas alcaligenes NCIB 9867 was determined to have 32,743 bp with a G+C content of 59.8%. Sequence analysis predicted a total of 29 open reading frames, with approximately half of them contributing towards the functions of plasmid replication, mobilization, and stability. The Pac25I restriction-modification system and two mobile elements, Tn5563 and IS1633, were physically localized. An additional eight open reading frames with unknown functions were als...

  3. Growth kinetics of Pseudomonas alcaligenes C-0 relative to inoculation and 3-chlorobenzoate metabolism in soil.

    OpenAIRE

    Focht, D. D.; Shelton, D

    1987-01-01

    Pseudomonas alcaligenes C-0 was isolated from activated sewage sludge by enrichment with 3-chlorobenzoate (3CB) as the sole carbon source. The carbon balance from [14C]3CB in pure culture could be accounted for in substrate, biomass, and CO2 from all sampling periods and inoculum densities (0.012, 0.092, 0.20, and 0.92 micrograms of dry cells X ml-1), and inorganic chloride was produced stoichiometrically. Monod parameters as determined in culture were compared with the kinetics of 3CB metabo...

  4. Evidence for 4-chlorobenzoic acid dehalogenation mediated by plasmids related to pSS50. [Alcaligenes

    Energy Technology Data Exchange (ETDEWEB)

    Layton, A.C.; Sanseverino, J.; Wallace, W.; Corcoran, C.; Sayler, G.S. (Univ. of Tennessee, Knoxville (United States))

    1992-01-01

    The potential for polychlorinated biphenyl biodegradation is of environmental interest because of the toxicity and bioaccumulation of these compounds. Biodegradation studies on 4-chlorobiphenyl (4CB), a model for polychlorinated biphenyl degradation, have focused mainly on the genes and enzymes that permit the degradation of 4CB to 4-chlorobenzoate (4CBA). Most biphenyl- and polychlorinated biphenyl-degrading strains accumulate the corresponding chlorobenzoic acids without degrading the chlorobenzoate to CO{sub 2}. The study demonstrated that the 4-chlorobiphenyl-degrading Alcaligenes sp. strain ALP83 can degrade 4-chlorobenzoate to 4-hydroxybenzoate. The dehalogenase activity is correlated with a 10-kb fragment carried on plasmid pSS70.

  5. Cloning and expression of the transposable chlorobenzoate-3,4-dioxygenase genes of Alcaligenes sp. strain BR60.

    OpenAIRE

    Nakatsu, C. H.; Wyndham, R. C.

    1993-01-01

    Growth on 3-chlorobenzoate was found to induce the enzymes of the protocatechuate meta ring fission pathway in Alcaligenes sp. strain BR60. The chlorobenzoate catabolic genes, designated cba, were localized to a 3.7-kb NotI-EcoRI fragment within the nonrepeated region of the composite transposon Tn5271. The cba genes were cloned onto two broad-host-range vectors and expressed in Escherichia coli and Alcaligenes sp. strain BR6024. In E. coli, expression of the cba genes with the IPTG (isopropy...

  6. Proton translocation during denitrification by a nitrifying--denitrifying Alcaligenes sp.

    Science.gov (United States)

    Castignetti, D; Hollocher, T C

    1983-04-01

    A heterotrophic nitrifying Alcaligenes sp. from soil was grown as a denitrifier on nitrate and subjected to oxidant pulse experiments to ascertain the apparent efficiencies of proton translocations during O2 and nitrogen-oxide respirations. With endogenous substrate as the reducing agent the leads to H+/2e- ratios, extrapolated to zero amount of oxidant per pulse, were 9.4, 3.7, 4.3 and 3.5 for O2, nitrate, nitrite and N2O, respectively. The value for O2 and those for the N-oxides are, respectively, somewhat larger and smaller than corresponding values for Paracoccus denitrificans. None of the three permeant ions employed with the Alcaligenes sp. (valinomycin-K+, thiocyanate and triphenylmethylphosphonium) was ideal for all purposes. Thiocyanate provided highest ratios for O2 but abolished the oxidant pulse response for nitrate and N2O. Valinomycin was slow to penetrate to the cytoplasmic membrane and relatively high concentrations were required for optimal performance. Triphenylmethylphosphonium enhanced passive proton permeability and diminished proton translocation at concentrations required to realize the maximal oxidant pulse response. PMID:6311094

  7. Potential application of Alcaligenes faecalis strain No. 4 in mitigating ammonia emissions from dairy wastewater.

    Science.gov (United States)

    Neerackal, George M; Ndegwa, Pius M; Joo, Hung-Soo; Wang, Xiang; Frear, Craig S; Harrison, Joseph H; Beutel, Marc W

    2016-04-01

    This research examined the potential mitigation of NH3 emissions from dairy manure via an enhanced aerobic bio-treatment with bacterium Alcaligenes faecalis strain No. 4. The studies were conducted in aerated batch reactors using air and pure oxygen. Aeration with air and oxygen removed approximately 40% and 100% total ammoniacal nitrogen (TAN), respectively. Intermittent oxygenation (every 2 or 4 h) reduced oxygen consumption by 95%, while attaining nearly identical TAN removal to continuous aeration. The results revealed that adequate oxygen supply and supplementing dairy wastewater with carbon are essential for this bioprocess. Based on the nitrogen mass balance, only 4% of TAN was released as NH3 gas, while the majority was retained in either the microbial biomass (58%) or converted to nitrogen gas (36%). The mass balance results reveal high potential for environmentally friendly bio-treatment of dairy wastewater using A. faecalis strain No. 4 with respect to NH3 emissions. PMID:26845217

  8. Tributyltin chloride (TBTCl)-enhanced exopolysaccharide and siderophore production in an estuarine Alcaligenes faecalis strain.

    Science.gov (United States)

    Khanolkar, Dnyanada; Dubey, S K; Naik, Milind Mohan

    2015-05-01

    Tributyltin chloride (TBTCl) has been used extensively as an antifouling agent in ship paints, which results in the contamination of aquatic sites. These contaminated sites serve as enrichment areas for TBTCl-resistant bacterial strains. One TBTCl-resistant bacterial strain was isolated from the sediments of Zuari estuary, Goa, India, which is a major hub of various ship-building activities. Based on biochemical characteristics and 16S rDNA sequence analysis, this bacterial strain was identified as Alcaligenes faecalis and designated as strain SD5. It could degrade ≥3 mM TBTCl by using it as a sole carbon source and transform it into the less toxic dibutyltin chloride, which was confirmed by nuclear magnetic resonance and mass spectroscopy. Interestingly, this bacterial strain also showed enhanced exopolysaccharide and siderophore production when cells were exposed to toxic levels of TBTCl, suggesting their involvement in conferring resistance to this antifouling biocide as well as degradative capability respectively. PMID:25612551

  9. Etude de la résistance de Cupriavidus metallidurans CH34 aux oxyanions sélénite et séléniate : accumulation, localisation et transformation du sélénium.

    OpenAIRE

    Avoscan, Laure

    2007-01-01

    Le sélénium est un élément trace essentiel pour les organismes vivants mais à forte concentration, il est très toxique. Les oxyanions sélénite et séléniate sont les formes les plus toxiques et prédominantes dans l'environnement. Certains micro-organismes jouent un rôle prépondérant en contribuant au cycle naturel du sélénium. Notre modèle d'étude Cupriavidus (anciennement Ralstonia) metallidurans CH34, bactérie tellurique issue de biotopes contaminés en métaux, est connu pour résister au sélé...

  10. Efficacy of polysaccharide from Alcaligenes xylosoxidans MSA3 administration as protection against γ-radiation in female rats

    OpenAIRE

    Hassan, Amal I; Ghoneim, Mona A. M.; Mahmoud, Manal G.; Asker, Mohsen M. S.; Mohamed, Saher S.

    2015-01-01

    Damage to normal tissues is a consequence of both therapeutic and accidental exposures to ionizing radiation. A water-soluble heteropolysaccharide called AXEPS, composed of glucose, galactose, rhamnose and glucouronic acid in a molar ratio of nearly 1.0:1.6:0.4:2.3, respectively, was isolated from culture medium of strain Alcaligenes xylosoxidans MSA3 by ethanol precipitation followed by freeze-drying. Chemical analysis, Fourier-transform infrared (FTIR) and chromatographic studies revealed t...

  11. Identification of a New Alcaligenes faecalis Strain MOR02 and Assessment of Its Toxicity and Pathogenicity to Insects

    OpenAIRE

    Rosa Estela Quiroz-Castañeda; Ared Mendoza-Mejía; Verónica Obregón-Barboza; Fernando Martínez-Ocampo; Armando Hernández-Mendoza; Felipe Martínez-Garduño; Gabriel Guillén-Solís; Federico Sánchez-Rodríguez; Guadalupe Peña-Chora; Laura Ortíz-Hernández; Paul Gaytán-Colín; Edgar Dantán-González

    2015-01-01

    We report the isolation of a bacterium from Galleria mellonella larva and its identification using genome sequencing and phylogenomic analysis. This bacterium was named Alcaligenes faecalis strain MOR02. Microscopic analyses revealed that the bacteria are located in the esophagus and intestine of the nematodes Steinernema feltiae, S. carpocapsae, and H. bacteriophora. Using G. mellonella larvae as a model, when the larvae were injected with 24,000 CFU in their hemocoel, more than 96% mortalit...

  12. Characterization of the novel dimethyl sulfide-degrading bacterium Alcaligenes sp. SY1 and its biochemical degradation pathway.

    Science.gov (United States)

    Sun, Yiming; Qiu, Jiguo; Chen, Dongzhi; Ye, Jiexu; Chen, Jianmeng

    2016-03-01

    Recently, the biodegradation of volatile organic sulfur compounds (VOSCs) has become a burgeoning field, with a growing focus on the reduction of VOSCs. The reduction of VOSCs encompasses both organic emission control and odor control. Herein, Alcaligenes sp. SY1 was isolated from active sludge and found to utilize dimethyl sulfide (DMS) as a growth substrate in a mineral salt medium. Response surface methodology (RSM) analysis was applied to optimize the incubation conditions. The following conditions for optimal degradation were identified: temperature 27.03°C; pH 7.80; inoculum salinity 0.84%; and initial DMS concentration 1585.39 μM. Under these conditions, approximately 99% of the DMS was degraded within 30 h of incubation. Two metabolic compounds were detected and identified by gas chromatography-mass spectrometry (GC-MS): dimethyl disulfide (DMDS) and dimethyl trisulfide (DMTS). The DMS degradation kinetics for different concentrations were evaluated using the Haldane-Andrews model and the pseudo first-order model. The maximum specific growth rate and degradation rate of Alcaligenes sp. SY1 were 0.17 h(-1) and 0.63 gs gx(-1)h(-1). A possible degradation pathway is proposed, and the results suggest that Alcaligenes sp. SY1 has the potential to control odor emissions under aerobic conditions. PMID:26623933

  13. Structure of the 2, 4′-dihydroxyacetophenone dioxygenase from Alcaligenes sp. 4HAP

    Energy Technology Data Exchange (ETDEWEB)

    Keegan, R.; Lebedev, A. [RAL, Harwell Oxford, Didcot OX11 0FA (United Kingdom); Erskine, P.; Guo, J.; Wood, S. P. [UCL Division of Medicine (Royal Free Campus), Rowland Hill Street, London NW3 2PF (United Kingdom); Hopper, D. J. [Aberystwyth University, Penglais, Aberystwyth SY23 3DA Wales (United Kingdom); Rigby, S. E. J. [University of Manchester, 131 Princess Street, Manchester M1 7DN (United Kingdom); Cooper, J. B., E-mail: jon.cooper@ucl.ac.uk [UCL Division of Medicine (Royal Free Campus), Rowland Hill Street, London NW3 2PF (United Kingdom); RAL, Harwell Oxford, Didcot OX11 0FA (United Kingdom)

    2014-09-01

    The first X-ray structure of a 2, 4′-dihydroxyacetophenone dioxygenase from Alcaligenes sp. 4HAP at a resolution of 2.2 Å is reported. This structure establishes that the enzyme adopts the cupin-fold, forming compact dimers with a pronounced hydrophobic interface between the monomers. Each monomer possesses a catalytic ferrous iron that is coordinated by three histidines (76, 78 and 114) and an additional ligand which has been putatively assigned as a carbonate, although formate and acetate are possibilities. The enzyme 2, 4′-dihydroxyacetophenone dioxygenase (DAD) catalyses the conversion of 2, 4′-dihydroxyacetophenone to 4-hydroxybenzoic acid and formic acid with the incorporation of molecular oxygen. Whilst the vast majority of dioxygenases cleave within the aromatic ring of the substrate, DAD is very unusual in that it is involved in C—C bond cleavage in a substituent of the aromatic ring. There is evidence that the enzyme is a homotetramer of 20.3 kDa subunits, each containing nonhaem iron, and its sequence suggests that it belongs to the cupin family of dioxygenases. In this paper, the first X-ray structure of a DAD enzyme from the Gram-negative bacterium Alcaligenes sp. 4HAP is reported, at a resolution of 2.2 Å. The structure establishes that the enzyme adopts a cupin fold, forming dimers with a pronounced hydrophobic interface between the monomers. The catalytic iron is coordinated by three histidine residues (76, 78 and 114) within a buried active-site cavity. The iron also appears to be tightly coordinated by an additional ligand which was putatively assigned as a carbonate dianion since this fits the electron density optimally, although it might also be the product formate. The modelled carbonate is located in a position which is highly likely to be occupied by the α-hydroxyketone group of the bound substrate during catalysis. Modelling of a substrate molecule in this position indicates that it will interact with many conserved amino acids in

  14. Aspartate beta-decarboxylase from Alcaligenes faecalis: carbon-13 kinetic isotope effect and deuterium exchange experiments

    International Nuclear Information System (INIS)

    The authors have measured the 13C kinetic isotope effect at pH 4.0, 5.0, 6.0, and 6.5 and in D2O at pH 5.0 and the rate of D-H exchange of the alpha and beta protons of aspartic acid in D2O at pH 5.0 for the reaction catalyzed by the enzyme aspartate beta-decarboxylase from Alcaligenes faecalis. The 13C kinetic isotope effect, with a value of 1.0099 +/- 0.0002 at pH 5.0, is less than the intrinsic isotope effect for the decarboxylation step, indicating that the decarboxylation step is not entirely rate limiting. The authors have been able to estimate probable values of the relative free energies of the transition states of the enzymatic reaction up to and including the decarboxylation step from the 13C kinetic isotope effect and the rate of D-H exchange of alpha-H. The pH dependence of the kinetic isotope effect reflects the pKa of the pyridine nitrogen of the coenzyme pyridoxal 5'-phosphate but not that of the imine nitrogen. A mechanism is proposed for the exchange of aspartate beta-H that is consistent with the stereochemistry suggested earlier

  15. Aspartate beta-decarboxylase from Alcaligenes faecalis: carbon-13 kinetic isotope effect and deuterium exchange experiments

    Energy Technology Data Exchange (ETDEWEB)

    Rosenberg, R.M.; O' Leary, M.H.

    1985-03-26

    The authors have measured the /sup 13/C kinetic isotope effect at pH 4.0, 5.0, 6.0, and 6.5 and in D/sub 2/O at pH 5.0 and the rate of D-H exchange of the alpha and beta protons of aspartic acid in D/sub 2/O at pH 5.0 for the reaction catalyzed by the enzyme aspartate beta-decarboxylase from Alcaligenes faecalis. The /sup 13/C kinetic isotope effect, with a value of 1.0099 +/- 0.0002 at pH 5.0, is less than the intrinsic isotope effect for the decarboxylation step, indicating that the decarboxylation step is not entirely rate limiting. The authors have been able to estimate probable values of the relative free energies of the transition states of the enzymatic reaction up to and including the decarboxylation step from the /sup 13/C kinetic isotope effect and the rate of D-H exchange of alpha-H. The pH dependence of the kinetic isotope effect reflects the pKa of the pyridine nitrogen of the coenzyme pyridoxal 5'-phosphate but not that of the imine nitrogen. A mechanism is proposed for the exchange of aspartate beta-H that is consistent with the stereochemistry suggested earlier.

  16. Nitrogen removal characteristics of heterotrophic nitrification-aerobic denitrification by Alcaligenes faecalis C16

    Institute of Scientific and Technical Information of China (English)

    Yuxiang Liu; Yao Wang; Yi Li; Hua An; Yongkang Lv

    2015-01-01

    Alcaligenes faecalis C16 was found to have the ability to heterotrophically nitrify and aerobical y denitrify. In order to further understand its nitrogen removal ability and mechanism, the growth and ammonium removal response were investigated at different C/N ratios and ammonium concentrations in the medium with citrate and acetate as carbon source separately. Furthermore, experiments of nitrogen sources, production of nitrogen gas and enzyme assay were conducted. Results show that the bacterium converts NH4+-N and produces NH2OH during the growing phase and nitrite accumulation is its distinct metabolic feature. A. faecalis C16 is able to tolerate not only high ammonium concentration but also high C/N ratio, and the ammonium tolerance is associated with carbon source and C/N ratio. The nitrogen balance under different conditions shows that approximately 28%–45%of the initial ammonium is assimilated into the cells, 44%–60%is denitrified and several percent is converted to nitrification products. A. faecalis C16 cannot utilize hydroxylamine, nitrite or nitrate as the sole nitrogen source for growth. However, nitrate can be used when ammonium is simultaneously present in the medium. A possible pathway for nitrogen removal by C16 is suggested. The preliminary enzyme assay provides more evidence for this nitrogen removal pathway.

  17. Factors influencing the biosorption of gadolinium by micro-organisms and its mobilisation from sand

    Energy Technology Data Exchange (ETDEWEB)

    Andres, Y. [SUBATECH, Nantes (France); Thouand, G. [IUT Genie Biologique, Lab. de Microbiologie de l' Environnement, La Roche sur Yon (France); Boualam, M. [SUBATECH, Nantes (France); IUT Genie Biologique, Lab. de Microbiologie de l' Environnement, La Roche sur Yon (France); Mergeay, M. [Lab. de Microbiologie, SCK/CEN-VITO, Mol (Belgium)

    2000-07-01

    The present work was devoted to the study of the biosorption capacities of various microbial species (Bacillus subtilis, Pseudomonas aeruginosa, Ralstonia metallidurans CH34 previously Alcaligenes eutrophus CH34, Mycobacterium smegmatis, Saccharomyces cerevisiae) for ions of the lanthanide gadolinium (Gd{sup 3+}). The uptake by sand of this element was also measured. Saturation curves and Scatchard models were established for all biosorbants used in this work. The results enabled us to determine the binding affinities and the maximum capacities for biosorption of Gd{sup 3+}, which ranged from 350 {mu}mol g{sup -1} for B. subtilis to 5.1 {mu}mol g{sup -1} for S. cerevisiae. This study demonstrated the usefulness of optimisation of experimental conditions in biosorption investigations. Experimental results showed that bisorption could be influenced by the growth stage and by the composition of the growth medium of microbial cells. Finally, particular attention was given to the transfer of gadolinium ions from a loaded sand to a bacterial suspension. (orig.)

  18. Sulphoacetaldehyde acetyltransferase yields acetyl phosphate: purification from Alcaligenes defragrans and gene clusters in taurine degradation.

    Science.gov (United States)

    Ruff, Jürgen; Denger, Karin; Cook, Alasdair M

    2003-01-15

    The facultatively anaerobic bacterium Alcaligenes defragrans NKNTAU was found to oxidize taurine (2-aminoethanesulphonate) with nitrate as the terminal electron acceptor. Taurine was transaminated to 2-sulphoacetaldehyde. This was not converted into sulphite and acetate by a "sulphoacetaldehyde sulpho-lyase" (EC 4.4.1.12), but into sulphite and acetyl phosphate, which was identified by three methods. The enzyme, which required the addition of phosphate, thiamin diphosphate and Mg(2+) ions for activity, was renamed sulphoacetaldehyde acetyltransferase (Xsc; EC 2.3.1.-). Inducible Xsc was expressed at high levels, and a three-step 11-fold purification yielded an essentially homogeneous soluble protein, which was a homotetramer in its native form; the molecular mass of the subunit was found to be between about 63 kDa (SDS/PAGE) and 65.3 kDa (matrix-assisted laser-desorption ionization-time-of-flight MS). The N-terminal and two internal amino acid sequences were determined, and PCR primers were generated. The xsc gene was amplified and sequenced; the derived molecular mass of the processed protein was 65.0 kDa. The downstream gene presumably encoded the inducible phosphate acetyltransferase (Pta) found in crude extracts. The desulphonative enzymes ("EC 4.4.1.12") from Achromobacter xylosoxidans NCIMB 10751 and Desulfonispora thiosulfatigenes GKNTAU were shown to be Xscs. We detected at least three subclasses of xsc in Proteobacteria and in Gram-positive bacteria, and they comprised a distinct group within the acetohydroxyacid synthase supergene family. Genome sequencing data revealed xsc genes in Burkholderia fungorum (80% sequence identity) and Sinorhizobium meliloti (61%) with closely linked pta genes. Different patterns of regulation for the transport and dissimilation of taurine were hypothesized for S. meliloti and B. fungorum. PMID:12358600

  19. Inhibition of Serratia marcescens Smj-11 biofilm formation by Alcaligenes faecalis STN17 crude extract

    Energy Technology Data Exchange (ETDEWEB)

    Lutfi, Zainal; Ahmad, Asmat [School of Biosciences and Biotechnology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia (UKM), 43600 Bangi, Selangor (Malaysia); Usup, Gires [School of Environmental and Natural Resources Sciences, Faculty of Science and Technology, Universiti Kebangsaan Malaysia (UKM), 43600 Bangi, Selangor (Malaysia)

    2014-09-03

    Serratia marcescens biofilms are formed when they are bound to surfaces in aqueous environments. S. marcescens utilizes N-acylhomoserine lactone (AHL) as its quorum sensing signal molecule. The accumulation of AHL indicates the bacteria to produce matrices to form biofilms. Prodigiosin (2-methyl-3-pentyl-6-methoxyprodigiosin), which causes red pigmentation in the colonies, are also produced when the AHL reaches a certain threshold. The Alcaligenes faecalis STN17 crude extract is believed to inhibit quorum sensing in the S. marcescens Smj-11 and, thus, impedes its biofilm formation ability. A. faecalis STN17 was grown in marine broth, and ethyl acetate extraction was carried out. The crude compound of A. faecalis STN17 was diluted at high concentration (0.2-6.4 mg/mL) and was taken to confirm anti-biofilm activity through the crystal violet method in 96-wells plate. Then, the crude extract underwent purification using simple solvents partitioning test to discern the respective compounds that had the anti-biofilm activity under the crystal violet method. The crystal violet test showed that the crude did have anti-biofilm activity on S. marcescens Smj-11, but did not kill the cells. This finding signifies that the suppression of biofilm formation in S. marcescens by A. faecalis STN17 has a strong correlation. The partitioning test showed that A. faecalis STN17 crude extract has several compounds and only the compound(s) in chloroform showed activities. In conclusion, the crude extract of A. faecalis STN17 has the ability to inhibit S. marcescens Smj-11 biofilm formation.

  20. Inhibition of Serratia marcescens Smj-11 biofilm formation by Alcaligenes faecalis STN17 crude extract

    International Nuclear Information System (INIS)

    Serratia marcescens biofilms are formed when they are bound to surfaces in aqueous environments. S. marcescens utilizes N-acylhomoserine lactone (AHL) as its quorum sensing signal molecule. The accumulation of AHL indicates the bacteria to produce matrices to form biofilms. Prodigiosin (2-methyl-3-pentyl-6-methoxyprodigiosin), which causes red pigmentation in the colonies, are also produced when the AHL reaches a certain threshold. The Alcaligenes faecalis STN17 crude extract is believed to inhibit quorum sensing in the S. marcescens Smj-11 and, thus, impedes its biofilm formation ability. A. faecalis STN17 was grown in marine broth, and ethyl acetate extraction was carried out. The crude compound of A. faecalis STN17 was diluted at high concentration (0.2-6.4 mg/mL) and was taken to confirm anti-biofilm activity through the crystal violet method in 96-wells plate. Then, the crude extract underwent purification using simple solvents partitioning test to discern the respective compounds that had the anti-biofilm activity under the crystal violet method. The crystal violet test showed that the crude did have anti-biofilm activity on S. marcescens Smj-11, but did not kill the cells. This finding signifies that the suppression of biofilm formation in S. marcescens by A. faecalis STN17 has a strong correlation. The partitioning test showed that A. faecalis STN17 crude extract has several compounds and only the compound(s) in chloroform showed activities. In conclusion, the crude extract of A. faecalis STN17 has the ability to inhibit S. marcescens Smj-11 biofilm formation

  1. Enhanced Alcaligenes faecalis Denitrification Rate with Electrodes as the Electron Donor.

    Science.gov (United States)

    Wang, Xin; Yu, Ping; Zeng, Cuiping; Ding, Hongrui; Li, Yan; Wang, Changqiu; Lu, Anhuai

    2015-08-15

    The utilization by Alcaligenes faecalis of electrodes as the electron donor for denitrification was investigated in this study. The denitrification rate of A. faecalis with a poised potential was greatly enhanced compared with that of the controls without poised potentials. For nitrate reduction, although A. faecalis could not reduce nitrate, at three poised potentials of +0.06, -0.06, and -0.15 V (versus normal hydrogen electrode [NHE]), the nitrate was partially reduced with -0.15- and -0.06-V potentials at rates of 17.3 and 28.5 mg/liter/day, respectively. The percentages of reduction for -0.15 and -0.06 V were 52.4 and 30.4%, respectively. Meanwhile, for nitrite reduction, the poised potentials greatly enhanced the nitrite reduction. The nitrite reduction rates for three poised potentials (-0.06, -0.15, and -0.30 V) were 1.98, 4.37, and 3.91 mg/liter/h, respectively. When the potentials were cut off, the nitrite reduction rate was maintained for 1.5 h (from 2.3 to 2.25 mg/liter/h) and then greatly decreased, and the reduction rate (0.38 mg/liter/h) was about 1/6 compared with the rate (2.3 mg/liter/h) when potential was on. Then the potentials resumed, but the reduction rate did not resume and was only 2 times higher than the rate when the potential was off. PMID:26048940

  2. Purification and characterization of chitinase from Alcaligenes faecalis AU02 by utilizing marine wastes and its antioxidant activity

    OpenAIRE

    Annamalai, Neelamegam; Veeramuthu Rajeswari, Mayavan; Vijayalakshmi, Shanmugam; Balasubramanian, Thangavel

    2011-01-01

    Marine waste is an abundant renewable source for the recovery of several value added metabolites with potential industrial applications. This study describes the production of chitinase on marine waste, with the subsequent use of the same marine waste for the extraction of antioxidants. A chitinase-producing bacterium isolated from seafood effluent was identified as Alcaligenes faecalis AU02. Optimal chitinase production was obtained in culture conditions of 37°C for 72 h in 100 ml medium con...

  3. Optimization of biodemulsifier production from Alcaligenes sp. S-XJ-1 and its application in breaking crude oil emulsion.

    Science.gov (United States)

    Liu, Jia; Huang, Xiang-Feng; Lu, Li-Jun; Xu, Jing-Cheng; Wen, Yue; Yang, Dian-Hai; Zhou, Qi

    2010-11-15

    A biodemulsifier-producing strain of Alcaligenes sp. S-XJ-1, isolated from petroleum-contaminated soil of the Karamay Oilfield, exhibited excellent demulsifying ability. The application of this biodemulsifier significantly improved the quality of separated water compared with the chemical demulsifier, polyether, which clearly indicates that it has potential applications in the crude oil extraction industry. To optimize its biosynthesis, the impacts of carbon sources, nitrogen sources and pH were studied in detail. Paraffin, a hydrophobic carbon source, favored the synthesis of this cell wall associated biodemulsifier. The nitrogen source ammonium citrate stimulated the production and demulsifying performance of the biodemulsifier. An alkaline environment (pH 9.5) of the initial culture medium favored the strain's growth and improved its demulsifying ability. The results showed paraffin, ammonium citrate and pH had significant effects on the production of the biodemulsifier. These three variables were further investigated using a response surface methodology based on a central composite design to optimize the biodemulsifier yield. The optimal yield conditions were found at a paraffin concentration of 4.01%, an ammonium citrate concentration of 8.08 g/L and a pH of 9.35. Under optimal conditions, the biodemulsifier yield from Alcaligenes sp. S-XJ-1 was increased to 3.42 g/L. PMID:20702035

  4. Exogenous cofactors for the improvement of bioremoval and biotransformation of sulfamethoxazole by Alcaligenes faecalis.

    Science.gov (United States)

    Zhang, Yi-Bi; Zhou, Jiao; Xu, Qiu-Man; Cheng, Jing-Sheng; Luo, Yu-Lu; Yuan, Ying-Jin

    2016-09-15

    Sulfamethoxazole (SMX), an extensively prescribed or administered antibiotic pharmaceutical product, is usually detected in aquatic environments, because of its incomplete metabolism and elimination. This study investigated the effects of exogenous cofactors on the bioremoval and biotransformation of SMX by Alcaligenes faecalis. High concentration (100mg·L(-1)) of exogenous vitamin C (VC), vitamin B6 (VB6) and oxidized glutathione (GSSG) enhanced SMX bioremoval, while the additions of vitamin B2 (VB2) and vitamin B12 (VB12) did not significantly alter the SMX removal efficiency. Globally, cellular growth of A. faecalis and SMX removal both initially increased and then gradually decreased, indicating that SMX bioremoval is likely dependent on the primary biomass activity of A. faecalis. The decreases in the SMX removal efficiency indicated that some metabolites of SMX might be transformed into parent compound at the last stage of incubation. Two transformation products of SMX, N-hydroxy sulfamethoxazole (HO-SMX) and N4-acetyl sulfamethoxazole (Ac-SMX), were identified by a high-performance liquid chromatograph coupled with mass spectrometer. High concentrations of VC, nicotinamide adenine dinucleotide hydrogen (NADH, 7.1mg·L(-1)), and nicotinamide adenine dinucleotide (NAD(+), 6.6mg·L(-1)), and low concentrations of reduced glutathione (GSH, 0.1 and 10mg·L(-1)) and VB2 (1mg·L(-1)) remarkably increased the formation of HO-SMX, while VB12 showed opposite effects on HO-SMX formation. In addition, low concentrations of GSH and NADH enhanced Ac-SMX formation by the addition of A. faecalis, whereas cofactors (VC, VB2, VB12, NAD(+), and GSSG) had no obvious impact on the formation of Ac-SMX compared with the controls. The levels of Ac-SMX were stable when biomass of A. faecalis gradually decreased, indicating the direct effect of biomass on the formation of Ac-SMX by A. faecalis. In sum, these results help us understand the roles played by exogenous cofactors in

  5. Biodegradation and detoxification of melanoidin from distillery effluent using an aerobic bacterial strain SAG5 of Alcaligenes faecalis

    International Nuclear Information System (INIS)

    Highlights: → The Alcaligenes faecalis strain SAG5 decolorizes 72.6 ± 0.56% of melanoidins. → The decolorization was achieved at pH 7.5 and temperature 37 oC on 5th day. → The distillery effluent after biological treatment is environmentally safe. - Abstract: Distillery effluent retains very dark brown color even after anaerobic treatment due to presence of various water soluble, recalcitrant and coloring compounds mainly melanoidins. In laboratory conditions, melanoidin decolorizing bacteria was isolated and optimized the cultural conditions at various incubation temperatures, pH, carbon sources, nitrogen sources and combined effect of both carbon and nitrogen sources. The optimum decolorization (72.6 ± 0.56%) of melanoidins was achieved at pH 7.5 and temperature 37 oC on 5th day of cultivation. The toxicity evaluation with mung bean (Vigna radiata) revealed that the raw distillery effluent was environmentally highly toxic as compared to biologically treated distillery effluent, which indicated that the effluent after bacterial treatment is environmentally safe. This proves to be novel biological treatment technique for biodegradation and detoxification of melanoidin from distillery effluent using the bacterial strain SAG5.

  6. Associations of Eu(III) with Gram-negative bacteria, Alcaligenes faecalis, Shewanella putrefaciens, and Paracoccus denitrificans

    International Nuclear Information System (INIS)

    We studied the association of Eu(III) with Gram-negative bacteria, Alcaligenes faecalis, Shewanella putrefaciens, and Paracoccus denitrificans by a batch method and time-resolved laser-induced fluorescence spectroscopy (TRLFS). The kinetics study showed that the Eu(III) adsorption on the bacteria rapidly proceeded. The Eu(III) adsorption on A. faecalis and P. denitrificans at pHs 3, 4, and 5, and that on S.putrefaciens at pHs 4 and 5 reached a maximum within 5 minutes after contact. For P. denitrificans, the percent adsorption of Eu(III) decreased after the maximum percent adsorption was attained, which suggests the existence of exudates with an affinity with Eu(III). TRLFS showed that the coordination of Eu(III) on these bacteria is multidentate through an inner-spherical process. The ligand field of Eu(III) on P. denitrificans was as strong as the ones observed for halophilic microorganisms, while that of A. faecalis and S. putrefaciens was the typical one observed for non-halophilic microorganisms. The coordination environment of Eu(III) on the bacteria differed from each other, though they are categorized as Gram-negative bacteria with the similar cell wall components. (author)

  7. Phenazine-1-carboxylic acid mediated anti-oomycete activity of the endophytic Alcaligenes sp. EIL-2 against Phytophthora meadii.

    Science.gov (United States)

    Abraham, Amith; Philip, Shaji; Jacob, Manoj Kurian; Narayanan, Sunilkumar Puthenpurackel; Jacob, C Kuruvilla; Kochupurackal, Jayachandran

    2015-01-01

    The oomycete pathogen, Phytophthora meadii, causes various diseases in Hevea brasiliensis at different stages of its life cycle. The study reports the structural characterization of the active principle from the culture filtrate of Alcaligenes sp. EIL-2 (GenBank ID: HQ641257) offering antagonistic activity against P. meadii. Gas Chromatography Mass Spectroscopy (GC-MS) analysis showed the similarity of the compound with phenazine derivatives. The specific representations of FT-IR spectrum such as 3200 cm(-1) (OH stretching, NH stretching and presence of aromatic ring), 1737 cm(-1) (carboxylic acid), 2200-2400 cm(-1) (conjugated dienes) and 1467 cm(-1), and 1422 cm(-1) (CN bonds) were an indicative of phenazine-1-carboxylic acid (PCA). The structure of the compound was further confirmed by (1)H NMR/(13)C NMR spectroscopy, DEPT experiments, and two-dimensional NMR spectral studies, including (1)H-(1)H COSY and (1)H-(13)C HSQC as PCA with the molecular formula of C₁₃H₈N₂O₂. P. meadii was sensitive to purified PCA extract from the endophyte and a concentration of 5 μg/ml completely inhibited the mycelia growth. PCA also showed zoosporicidal activity against P. meadii zoospores. This is the first study of this kind where PCA from an endophyte of H. brasiliensis is being confirmed to carry antagonistic activity against P. meadii. PMID:24985092

  8. Biodegradation and detoxification of melanoidin from distillery effluent using an aerobic bacterial strain SAG{sub 5} of Alcaligenes faecalis

    Energy Technology Data Exchange (ETDEWEB)

    Santal, Anita Rani, E-mail: anita.gangotra@gmail.com [Department of Microbiology, Maharshi Dayanand University, Rohtak-124001, Haryana (India); Singh, N.P. [Centre for Biotechnology, Maharshi Dayanand University, Rohtak-124001, Haryana (India); Saharan, Baljeet Singh [Department of Microbiology, Kurukshetra University, Kurukshetra-136119, Haryana (India)

    2011-10-15

    Highlights: {yields} The Alcaligenes faecalis strain SAG{sub 5} decolorizes 72.6 {+-} 0.56% of melanoidins. {yields} The decolorization was achieved at pH 7.5 and temperature 37 {sup o}C on 5th day. {yields} The distillery effluent after biological treatment is environmentally safe. - Abstract: Distillery effluent retains very dark brown color even after anaerobic treatment due to presence of various water soluble, recalcitrant and coloring compounds mainly melanoidins. In laboratory conditions, melanoidin decolorizing bacteria was isolated and optimized the cultural conditions at various incubation temperatures, pH, carbon sources, nitrogen sources and combined effect of both carbon and nitrogen sources. The optimum decolorization (72.6 {+-} 0.56%) of melanoidins was achieved at pH 7.5 and temperature 37 {sup o}C on 5th day of cultivation. The toxicity evaluation with mung bean (Vigna radiata) revealed that the raw distillery effluent was environmentally highly toxic as compared to biologically treated distillery effluent, which indicated that the effluent after bacterial treatment is environmentally safe. This proves to be novel biological treatment technique for biodegradation and detoxification of melanoidin from distillery effluent using the bacterial strain SAG{sub 5}.

  9. Production and characterization of poly(3-hydroxybutyrate) generated by Alcaligenes latus using lactose and whey after acid protein precipitation process.

    Science.gov (United States)

    Berwig, Karina Hammel; Baldasso, Camila; Dettmer, Aline

    2016-10-01

    Whey after acid protein precipitation was used as substrate for PHB production in orbital shaker using Alcaligenes latus. Statistical analysis determined the most appropriate hydroxide for pH neutralization of whey after protein precipitation among NH4OH, KOH and NaOH 10%w/v. The results were compared to those of commercial lactose. A scale-up test in a 4L bioreactor was done at 35°C, 750rpm, 7L/min air flow, and 6.5 pH. The PHB was characterized through Fourier Transform Infrared Spectroscopy, thermogravimetry and differential scanning calorimetry. NH4OH provided the best results for productivity (p), 0.11g/L.h, and for polymer yield, (YP/S), 1.08g/g. The bioreactor experiment resulted in lower p and YP/S. PHB showed maximum degradation temperature (291°C), melting temperature (169°C), and chemical properties similar to those of standard PHB. The use of whey as a substrate for PHB production did not affect significantly the final product quality. PMID:27347795

  10. Characterization of diverse 2,4-dichlorophenoxyacetic acid-degradative plasmids isolated from soil by complementation.

    OpenAIRE

    Top, E. M.; Holben, W E; Forney, L J

    1995-01-01

    The diversity of 2,4-dichlorophenoxyacetic acid (2,4-D)-degradative plasmids in the microbial community of an agricultural soil was examined by complementation. This technique involved mixing a suitable Alcaligenes eutrophus (Rifr) recipient strain with the indigenous microbial populations extracted from soil. After incubation of this mixture, Rifr recipient strains which grow with 2,4-D as the only C source were selected. Two A. eutrophus strains were used as recipients: JMP228 (2,4-D-), whi...

  11. Efficacy of polysaccharide from Alcaligenes xylosoxidans MSA3 administration as protection against γ-radiation in female rats.

    Science.gov (United States)

    Hassan, Amal I; Ghoneim, Mona A M; Mahmoud, Manal G; Asker, Mohsen M S; Mohamed, Saher S

    2016-03-01

    Damage to normal tissues is a consequence of both therapeutic and accidental exposures to ionizing radiation. A water-soluble heteropolysaccharide called AXEPS, composed of glucose, galactose, rhamnose and glucouronic acid in a molar ratio of nearly 1.0:1.6:0.4:2.3, respectively, was isolated from culture medium of strain Alcaligenes xylosoxidans MSA3 by ethanol precipitation followed by freeze-drying. Chemical analysis, Fourier-transform infrared (FTIR) and chromatographic studies revealed that the molecular weight was 1.6 × 10(4) g mol(-1). This study was designed to investigate the radioprotective and biological effects of AXEPS in alleviating the toxicity of ionizing radiation in female albino rats. A total of 32 female albino rats were divided into four groups. In the control group, rats were administered vehicle by tube for four weeks. The second group was administered AXEPS (100 mg/kg) orally by gavage for four weeks. Animals in the third group were exposed to whole-body γ-rays (5 Gy) and remained for 2 weeks without treatment. The fourth group received AXEPS (100 mg/kg) orally by gavage for two weeks before being exposed to whole-body γ-rays (5 Gy), then 24 h post γ-rays, they received AXEPS (100 mg/kg) in a treatment continuing till the end of the experiment (15 days after the whole-body γ-irradiation). Oral administration of AXEPS (100 mg/kg) significantly reversed the oxidative stress effects of radiation, as evidenced by the decrease in DNA damage in the bone marrow. Assessment of apoptosis and cell proliferation markers revealed that caspase-3 significantly increased in the irradiated group. Moreover, a significant decrease in the hematological constituents of peripheral blood, the chemotactic index and CD8+ T cells were observed in animals in the irradiation-only group, whereas an increase in the lymphocyte index was observed in animals in that group. In contrast, AXEPS treatment prevented these alterations. From our results, we conclude that

  12. GenBank blastx search result: AK060606 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060606 001-025-B10 U09865.1 Alcaligenes eutrophus pyruvate dehydrogenase (pdhA), ...dihydrolipoamide acetyltransferase (pdhB), dihydrolipoamide dehydrogenase (pdhL), and ORF3 genes, complete cds.|BCT BCT 6e-14 +2 ...

  13. GenBank blastx search result: AK104832 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104832 001-042-A09 U09865.1 Alcaligenes eutrophus pyruvate dehydrogenase (pdhA), ...dihydrolipoamide acetyltransferase (pdhB), dihydrolipoamide dehydrogenase (pdhL), and ORF3 genes, complete cds.|BCT BCT 2e-31 +1 ...

  14. GenBank blastx search result: AK242902 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242902 J090081N15 U09865.1 AEU09865 Alcaligenes eutrophus pyruvate dehydrogenase (pdh...A), dihydrolipoamide acetyltransferase (pdhB), dihydrolipoamide dehydrogenase (pdhL), and ORF3 genes, complete cds. BCT 4e-26 1 ...

  15. Antibacterial and toxicological evaluation of beta-lactams synthesized by immobilized beta-lactamase-free penicillin amidase produced by Alcaligenes sp.

    Science.gov (United States)

    Gayen, Jiaur R; Majee, Sutapa B; Das, Shuvendu; Samanta, Timir B

    2007-12-01

    Search for anti-beta-lactamase and synthesis of newer penicillin were suggested to overcome resistance to penicillin in chemotherapy. It was found that clavulanic acid, an ant-beta-lactamase was ineffective due to its structural modification by bacteria. Thus, there is a need for the synthesis of newer pencillins. Retro-synthesis was inspired by the success of forward reaction i.e.conversion of penicillin G to 6-aminopenicillanic acid (6-APA) by biological process. In the present study a better enzymatic method of synthesis of newer pencillin by a beta-lactamase-free penicillin amidase produced by Alcaligenes sp. is attempted. Antibacterial and toxicological evaluation of the enzymatically synthesized beta-lactams are reported. Condensation of 6-APA with acyl donor was found to be effective when the reaction is run in dimethyl formamide (DMF 50% v/v) in acetate buffer (25 mM pH 5.0) at 37 degrees C. Periplasm entrapped in calcium alginate exihibited the highest yield (approximately 34%) in synthesis. The minimum inhibitory concentration of the synthetic products against Staphylococcus aureus and Salmonella typhi varied between 20-80 microg/ml. Some of the products exhibited antibacterial activity against enteric pathogens. It was interesting to note that product A was potent like penicillin G. LD50 value of three products (product A, B and C) was more than 12 mg/kg. Furthermore, these synthetic beta-lactams did not exihibit any adverse effect on house keeping enzymes viz., serum glutamate oxalacetate-trans-aminase, serum glutamate pyruvate -trans-aminase, acid phosphatase, alkaline phosphatase of the test animals. The hematological profile (RBC and WBC) of the test animals also remained unaffected. PMID:18254214

  16. Phenoxyacetic acid degradation by the 2,4-dichlorophenoxyacetic acid (TFD) pathway of plasmid pJP4: mapping and characterization of the TFD regulatory gene, tfdR.

    OpenAIRE

    Harker, A R; Olsen, R H; Seidler, R J

    1989-01-01

    Plasmid pJP4 enables Alcaligenes eutrophus JMP134 to degrade 3-chlorobenzoate and 2,4-dichlorophenoxyacetic acid (TFD). Plasmid pRO101 is a derivative of pJP4 obtained by insertion of Tn1721 into a nonessential region of pJP4. Plasmid pRO101 was transferred by conjugation to several Pseudomonas strains and to A. eutrophus AEO106, a cured isolate of JMP134. AEO106(pRO101) and some Pseudomonas transconjugants grew on TFD. Transconjugants with a chromosomally encoded phenol hydroxylase also degr...

  17. Targeting of the polyhydroxybutyrate biosynthetic pathway to the plastids of Arabidopsis thaliana results in high levels of polymer accumulation.

    OpenAIRE

    Nawrath, C; Poirier, Y; Somerville, C

    1994-01-01

    In the bacterium Alcaligenes eutrophus, three genes encode the enzymes necessary to catalyze the synthesis of poly[(R)-(-)-3-hydroxybutyrate] (PHB) from acetyl-CoA. In order to target these enzymes into the plastids of higher plants, the genes were modified by addition of DNA fragments encoding a pea chloroplast transit peptide, a constitutive plant promoter, and a poly(A) addition sequence. Each of the modified bacterial genes was introduced into Arabidopsis thaliana by Agrobacterium-mediate...

  18. Characterization of the first enzyme in 2,4-dichlorophenoxyacetic acid metabolism.

    OpenAIRE

    Hausinger, R P; Fukumori, F

    1995-01-01

    This paper reviews the properties of the Alcaligenes eutrophus JMP134 tfdA gene product, the enzyme responsible for the first step in 2,4-dichlorophenoxyacetic acid (2,4-D) biodegradation. The gene was overexpressed in Escherichia coli and several of its enzymatic properties were characterized. Although this enzyme catalyzes a hydroxylation reaction, it is not a monooxygenase. Rather, TfdA is an Fe(II) and alpha-ketoglutarate-dependent dioxygenase that metabolizes the latter cosubstrate to su...

  19. Characterization of an Indole-3-Acetamide Hydrolase from Alcaligenes faecalis subsp. parafaecalis and Its Application in Efficient Preparation of Both Enantiomers of Chiral Building Block 2,3-Dihydro-1,4-Benzodioxin-2-Carboxylic Acid.

    Directory of Open Access Journals (Sweden)

    Pradeep Mishra

    Full Text Available Both the enantiomers of 2,3-dihydro-1,4-benzodioxin-2-carboxylic acid are valuable chiral synthons for enantiospecific synthesis of therapeutic agents such as (S-doxazosin mesylate, WB 4101, MKC 242, 2,3-dihydro-2-hydroxymethyl-1,4-benzodioxin, and N-[2,4-oxo-1,3-thiazolidin-3-yl]-2,3-dihydro-1,4-benzodioxin-2-carboxamide. Pharmaceutical applications require these enantiomers in optically pure form. However, currently available methods suffer from one drawback or other, such as low efficiency, uncommon and not so easily accessible chiral resolving agent and less than optimal enantiomeric purity. Our interest in finding a biocatalyst for efficient production of enantiomerically pure 2,3-dihydro-1,4-benzodioxin-2-carboxylic acid lead us to discover an amidase activity from Alcaligenes faecalis subsp. parafaecalis, which was able to kinetically resolve 2,3-dihydro-1,4-benzodioxin-2-carboxyamide with E value of >200. Thus, at about 50% conversion, (R-2,3-dihydro-1,4-benzodioxin-2-carboxylic acid was produced in >99% e.e. The remaining amide had (S-configuration and 99% e.e. The amide and acid were easily separated by aqueous (alkaline-organic two phase extraction method. The same amidase was able to catalyse, albeit at much lower rate the hydrolysis of (S-amide to (S-acid without loss of e.e. The amidase activity was identified as indole-3-acetamide hydrolase (IaaH. IaaH is known to catalyse conversion of indole-3-acetamide (IAM to indole-3-acetic acid (IAA, which is phytohormone of auxin class and is widespread among plants and bacteria that inhabit plant rhizosphere. IaaH exhibited high activity for 2,3-dihydro-1,4-benzodioxin-2-carboxamide, which was about 65% compared to its natural substrate, indole-3-acetamide. The natural substrate for IaaH indole-3-acetamide shared, at least in part a similar bicyclic structure with 2,3-dihydro-1,4-benzodioxin-2-carboxamide, which may account for high activity of enzyme towards this un-natural substrate. To

  20. Characterization of an Indole-3-Acetamide Hydrolase from Alcaligenes faecalis subsp. parafaecalis and Its Application in Efficient Preparation of Both Enantiomers of Chiral Building Block 2,3-Dihydro-1,4-Benzodioxin-2-Carboxylic Acid.

    Science.gov (United States)

    Mishra, Pradeep; Kaur, Suneet; Sharma, Amar Nath; Jolly, Ravinder S

    2016-01-01

    Both the enantiomers of 2,3-dihydro-1,4-benzodioxin-2-carboxylic acid are valuable chiral synthons for enantiospecific synthesis of therapeutic agents such as (S)-doxazosin mesylate, WB 4101, MKC 242, 2,3-dihydro-2-hydroxymethyl-1,4-benzodioxin, and N-[2,4-oxo-1,3-thiazolidin-3-yl]-2,3-dihydro-1,4-benzodioxin-2-carboxamide. Pharmaceutical applications require these enantiomers in optically pure form. However, currently available methods suffer from one drawback or other, such as low efficiency, uncommon and not so easily accessible chiral resolving agent and less than optimal enantiomeric purity. Our interest in finding a biocatalyst for efficient production of enantiomerically pure 2,3-dihydro-1,4-benzodioxin-2-carboxylic acid lead us to discover an amidase activity from Alcaligenes faecalis subsp. parafaecalis, which was able to kinetically resolve 2,3-dihydro-1,4-benzodioxin-2-carboxyamide with E value of >200. Thus, at about 50% conversion, (R)-2,3-dihydro-1,4-benzodioxin-2-carboxylic acid was produced in >99% e.e. The remaining amide had (S)-configuration and 99% e.e. The amide and acid were easily separated by aqueous (alkaline)-organic two phase extraction method. The same amidase was able to catalyse, albeit at much lower rate the hydrolysis of (S)-amide to (S)-acid without loss of e.e. The amidase activity was identified as indole-3-acetamide hydrolase (IaaH). IaaH is known to catalyse conversion of indole-3-acetamide (IAM) to indole-3-acetic acid (IAA), which is phytohormone of auxin class and is widespread among plants and bacteria that inhabit plant rhizosphere. IaaH exhibited high activity for 2,3-dihydro-1,4-benzodioxin-2-carboxamide, which was about 65% compared to its natural substrate, indole-3-acetamide. The natural substrate for IaaH indole-3-acetamide shared, at least in part a similar bicyclic structure with 2,3-dihydro-1,4-benzodioxin-2-carboxamide, which may account for high activity of enzyme towards this un-natural substrate. To the best of

  1. Purification and Biochemical Characteristics of Cyanide-degrading Enzyme from Alcaligenes sp.DN25%产碱杆菌DN25中降氰酶的分离纯化及生化特性

    Institute of Scientific and Technical Information of China (English)

    汪艳华; 刘幽燕; 唐爱星; 李青云; 王顺成

    2012-01-01

    The cyanide-degrading enzyme from Alcaligenes sp. DN25 was purified through ultrafiltration, precipitation with 30 mg/mL protamine sulfate, 30%~70% fractional ammonium sulphate precipitation and hydrophobic chromatography on Phenyl-Toyopearl 650M, and the pure enzyme with the specific activity of 44 U/mg was obtained. After the proper reaction conditions including enzyme concentration and reaction time were determined for the cyanide-degrading activity assay, the purified enzyme properties were then studied in order to provide a theoretical basis for the future researches on cyanide-degradation mechanism and genetic engineering of strain DN2S. The results showed that the optimal pH and temperature were 8.0 and 30℃, respectively. Good stability of the enzyme was observed at pH 7.6-8.0 and its activity decreased quickly when pH reached up to 9.0. The activity of the purified enzyme could keep stable when preserved at 30 t for 10 h while fast deactivation happened at 60 CC. However, with glycine added, the enzyme activity still remained 19.6% after incubated at 60 ℃ for 20 min. The degradation of cyanide by the purified enzyme followed a typical Michaelis-Menten kinetics, with Km of 3.11 mmol/L and Vmax of 0.23 mmol L-1 min-1. Fig 11, Tab 1, Ref 23%以一株可降氰的产碱杆菌DN25为酶来源,通过超滤、30 mg/mL硫酸鱼精蛋白沉淀、30%~70%硫酸铵盐析和Phenyl-Toyopearl 650M疏水层析等步骤,获得比活力为44 U/mg的纯化酶制剂.在确定酶浓度、反应时间等氰降解活力测定条件后开展酶学性质研究,试图为将来氰降解代谢机理的深入研究和菌株的基因工程改造提供理论基础.研究结果表明,此纯化酶催化氰化物水解的最适pH值为8.0,最适温度为30℃.该酶在pH 7.0~8.0区域稳定,而在pH>9时会很快失活;在30℃保存10 h,酶活力保持稳定,高于60℃,酶快速失活.加入甘氨酸稳定剂,在60℃下保存20 min酶活仍可保留19.6%.酶促反应动

  2. 2,4-Dichlorophenoxyacetic acid-degrading bacteria contain mosaics of catabolic genes.

    OpenAIRE

    Fulthorpe, R R; McGowan, C; Maltseva, O V; Holben, W E; Tiedje, J M

    1995-01-01

    DNA from 32 2,4-dichlorophenoxyacetic acid (2,4-D)-degrading bacteria from diverse locations was probed with the first three genes of the well-known 2,4-D degradation pathway found in Alcaligenes eutrophus JMP134(pJP4). The majority of strains did not show high levels of homology to the first three genes of the 2,4-D degradation pathway, tfdA, -B, and -C. Most strains showed combinations of tfdA-, B-, and C-like elements that exhibited various degrees of homology to the gene probes. Strains h...

  3. Capture of a catabolic plasmid that encodes only 2,4-dichlorophenoxyacetic acid:alpha-ketoglutaric acid dioxygenase (TfdA) by genetic complementation.

    OpenAIRE

    Top, E. M.; Maltseva, O V; Forney, L J

    1996-01-01

    The modular pathway for the metabolism of 2,4-dichlorophenoxyacetic acid (2,4-D) encoded on plasmid pJP4 of Alcaligenes eutrophus JMP134 appears to be an example in which two genes, tfdA and tfdB, have been recruited during the evolution of a catabolic pathway. The products of these genes act to convert 2,4-D to a chloro-substituted catechol that can be further metabolized by enzymes of a modified ortho-cleavage pathway encoded by tfdCDEF. Given that modified ortho-cleavage pathways are compa...

  4. Organization and sequence analysis of the 2,4-dichlorophenol hydroxylase and dichlorocatechol oxidative operons of plasmid pJP4.

    OpenAIRE

    Perkins, E J; Gordon, M P; Caceres, O.; Lurquin, P F

    1990-01-01

    Growth of Alcaligenes eutrophus JMP134 on 2,4-dichlorophenoxyacetate requires a 2,4-dichlorphenol hydroxylase encoded by gene tfdB. Catabolism of either 2,4-dichlorophenoxyacetate or 3-chlorobenzoate involves enzymes encoded by the chlorocatechol oxidative operon consisting of tfdCDEF, which converts 3-chloro- and 3,5-dichlorocatechol to maleylacetate and chloromaleylacetate, respectively. Transposon mutagenesis has localized tfdB and tfdCDEF to EcoRI fragment B of plasmid pJP4 (R. H. Don, A....

  5. The tfdR gene product can successfully take over the role of the insertion element-inactivated TfdT protein as a transcriptional activator of the tfdCDEF gene cluster, which encodes chlorocatechol degradation in Ralstonia eutropha JMP134(pJP4)

    OpenAIRE

    Leveau, J H; van der Meer, J.R.

    1996-01-01

    The tfdT gene is located upstream of and transcribed divergently from the tfdCDEF chlorocatechol-degradative operon on plasmid pJP4 of Ralstonia eutropha (formerly Alcaligenes eutrophus) JMP134. It is 684 bp long and encodes a 25-kDa protein. On the basis of its predicted amino acid sequence, the TfdT protein could be classified as a LysR-type transcriptional regulator. It has the highest degree of similarity with the proteins TcbR, ClcR, and TfdR, which are involved in the regulation of chlo...

  6. Acetylene is an active-site-directed, slow-binding, reversible inhibitor of Azotobacter vinelandii hydrogenase

    International Nuclear Information System (INIS)

    The inhibition of purified and membrane-bound hydrogenase from Azotobacter vinelandii by dihydrogen-free acetylene was investigated. The inhibition was a time-dependent process which exhibited first-order kinetics. Both H2 and CO protected against the inhibition by acetylene. K/sub protect(app)/ values of 0.41 and 24 μM were derived for these gases, respectively. Both H2-oxidizing activity and the tritium exchange capacity of the purified enzyme were inhibited at the same rate by acetylene. Removal of acetylene reversed the inhibition for both the purified and the membrane-associated form of the enzyme. The purified hydrogenases from both Rhizobium japonicum and Alcaligenes eutrophus H16 were also inhibited by acetylene in a time-dependent fashion. These findings suggest that acetylene is an active-site-directed, slow-binding, reversible inhibitor of some membrane-bound hydrogenases from aerobic bacteria

  7. Interaction of nanosecond laser pulse with tetramethyl silane (Si(CH34 clusters: Generation of multiply charged silicon and carbon ions

    Directory of Open Access Journals (Sweden)

    Purav M. Badani

    2011-12-01

    Full Text Available Present work reports significantly high levels of ionization, eventually leading to Coulomb explosion of Tetramethyl silane (TMS clusters, on interaction with laser pulses of intensity ∼109 W/cm2. Tetramethyl silane clusters, prepared by supersonic expansion were photoionized at 266, 355 or 532 nm and the resultant ions were detected using time-of-flight mass spectrometer. It is observed that wavelength of irradiation and the size of the cluster are crucial parameters which drastically affect the nature of charge species generated upon photoionization of cluster. The results show that clusters absorb significantly higher energy from the laser field at longer wavelengths (532 nm and generate multiply charged silicon and carbon ions which have large kinetic energies. Further, laser-cluster interaction at different wavelengths has been quantified and charge densities at 266, 355 and 532 nm are found to be 4x 1010, 5x 1010 and 5x 1011 charges/cm3 respectively. These unusual results have been rationalized based on dominance of secondary ionization processes at 532 nm ultimately leading to Coulomb explosion of clusters. In another set of experiments, multiply charged ions of Ar (up to +5 state and Kr (up to +6 state were observed when TMS doped inert gas clusters were photoionized at 532 and 355 nm. The extent of energy absorption at these two wavelengths is clearly manifested from the charge state of the atomic ions generated upon Coulomb disintegration of the doped cluster. These experiments thus demonstrate a novel method for generation of multiply charged atomic ions of inert gases at laser intensity of ∼ 109 W/cm2. The average size of the cluster exhibiting Coulomb explosion phenomena under giga watt intensity conditions has been estimated to be ∼ 6 nm. Experimental results obtained in the present work agree qualitatively with the model proposed earlier [D. Niu, H. Li, F. Liang, L. Wen, X. Luo, B. Wang, and H. Qu, J. Chem. Phys. 122, 151103(2005] and point towards interaction of quasi-free electrons, generated during primary multiphoton ionization step, with a given wavelength in the presence of Coulombic field.

  8. The emulsifying effect of biosurfactants produced by food spoilage organisms in Nigeria

    Directory of Open Access Journals (Sweden)

    Christianah O. Ogunmola

    2016-04-01

    Full Text Available Food spoilage organisms were isolated using standard procedures on Nutrient Agar, Cetrimide Agar and Pseudomonas Agar Base (supplemented with CFC. The samples were categorized as animal products (raw fish, egg, raw chicken, corned beef, pasteurized milk and plant products (vegetable salad, water leaf (Talinium triangulare, boiled rice, tomatoes and pumpkin leaf (Teifairia occidentalis.They were characterised as Pseudomonas putida, Pseudomonas aeruginosa, Pseudomonas stutzeri, Burkholderia pseudomallei, Serratia rubidaea, Corynebacterium pilosum, Bacillus subtilis, Bacillus mycoides, Bacillus laterosporus, Bacillus laterosporus, Serratia marcescens, Bacillus cereus, Bacillus macerans, Alcaligenes faecalis and Alcaligenes eutrophus. Preliminary screening for biosurfactant production was done using red blood haemolysis test and confirmed by slide test, drop collapse and oil spreading assay. The biosurfactant produced was purified using acetone and the composition determined initially using Molisch’s test, thin layer chromatography and gas chromatography mass spectrometry. The components were found to be ethanol, amino acids, butoxyacetic acid, hexadecanoic acid, oleic acid, lauryl peroxide, octadecanoic acid and phthalic acid. The producing organisms grew readily on several hydrocarbons such as crude oil, diesel oil and aviation fuel when used as sole carbon sources.  The purified biosurfactants produced were able to cause emulsification of kerosene (19.71-27.14% as well as vegetable oil (16.91-28.12% based on the emulsification index. This result suggests that the isolates can be an asset and further work can exploit their optimal potential in industries.

  9. Decreasing ammonium generation using hydrogenotrophic bacteria in the process of nitrate reduction by nanoscale zero-valent iron

    International Nuclear Information System (INIS)

    An integrated nitrate treatment using nanoscale zero-valent iron (NZVI) and Alcaligenes eutrophus, which is a kind of hydrogenotrophic denitrifying bacteria, was conducted to remove nitrate and decrease ammonium generation. Within 8 days, nitrate was removed completely in the reactors containing NZVI particles plus bacteria while the proportion of ammonium generated was only 33%. That is a lower reduction rate but a smaller proportion of ammonium relative to that in abiotic reactors. It was also found that ammonium generation experienced a biphasic process, involving an increasing period and a stable period. After domestication of the bacteria, the combined NZVI-cell system could remove all nitrate without ammonium released when the refreshed nitrate was introduced. Nitrate reduction and the final product distribution were also studied in batch reactors amended with different initial NZVI contents and biomass concentrations, respectively. Both the nitrate removal rate and the ammonium yield decreased when the initial content of NZVI reduced and the initial biomass concentration increased. However, about 27% of the nitrate was converted to ammonium when excess bacteria (OD422 = 0.026) were used, which was higher than that with appropriate amount of bacteria.

  10. Trends of bio-hydrogen research and development in Europe. Report for the Research Institute of Innovative Technology for the Earth (RITE), Tokyo, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Huesing, B.

    1997-03-01

    Research into applied aspects of biological hydrogen production is carried out on a much lower level in Europe than basic hydrogenase research. However, the screening for good H{sub 2} producers, their cultivation, and the development of optimised culture and bioreactor systems has never been a strength in Europe. Although there are a few good groups in Europe major contributions in this field traditionally come from countries outside Europe. However, in the nineties a special application-oriented research subfield has begun to evolve in Europe: the use of genetic enginering to rationally optimise H{sub 2} producing organisms. The most important players who focus on green algae, cyanobacteria, and purple bacteria can be found in Germany, France, and Sweden. In European biohydrogen research, a large and diverse variety of organisms is investigated. Among the organisms most thoroughly studied are Alcaligenes eutrophus, Escherichia coli, Rhodobacter capsulatus, sulfate-reducing bacteria, and methanogenic bacteria. Moreover, a leading position has been obtained with respect to molecular genetics of green algae and cyanobacteria, albeit on a low level. The fact that such a broad range of diverse organisms is studied has advantages and disadvantages. A positive aspect is that the multitude of different approaches had led to several unexpected results which had otherwise been overlooked. On the other hand, an obvious link to biohydrogen production is often lacking. Moreover, there are many 'me-too' approaches and results in which previous findings are only reproduced for another organism as well. (orig.)

  11. Bioavailability of zinc in runoff water from roofing materials.

    Science.gov (United States)

    Heijerick, D G; Janssen, C R; Karlèn, C; Wallinder, I Odnevall; Leygraf, C

    2002-06-01

    Corrosion and runoff from zinc-coated materials and outdoor structures is an important source for the dispersion of zinc in the environment. Being part of a large inter-disciplinary research project, this study presents the bioavailability of zinc in runoff water immediately after release from the surface of 15 different commercially available zinc-based materials exposed to the urban environment of Stockholm, Sweden. Runoff water was analysed chemically and evaluated for its possible environmental impact, using both a biosensor test with the bacteria Alcaligenes eutrophus (Biomet) and the conventional 72 h growth inhibition test with the green alga Raphidocelis subcapitata. Chemical speciation modelling revealed that most zinc (94.3-99.9%) was present as the free Zn ion, the most bioavailable speciation form. These findings were confirmed by the results of the biosensor test (Biomet) which indicated that all zinc was indeed bioavailable. Analysis of the ecotoxicity data also suggested that the observed toxic effects were due to the presence of Zn2+ ions. Finally, regression analysis showed that, for this type of runoff samples, the rapid screening biosensor was capable of predicting (a) the total amount of zinc present in the runoff samples (R2 of 0.93-0.98; p < 0.05) and (b) the observed 72 h-EbC50s (R2 of 0.69-0.97; p < 0.05). PMID:12137040

  12. Decreasing ammonium generation using hydrogenotrophic bacteria in the process of nitrate reduction by nanoscale zero-valent iron

    Energy Technology Data Exchange (ETDEWEB)

    An, Yi; Li, Tielong [College of Environmental Science and Engineering/Tianjin Key Laboratory of Environmental Remediation and Pollution Control/Ministry of Education Key Laboratory of Pollution Processed and Environmental Criteria, Nankai University, Tianjin 300071 (China); Jin, Zhaohui, E-mail: jinzh@nankai.edu.cn [College of Environmental Science and Engineering/Tianjin Key Laboratory of Environmental Remediation and Pollution Control/Ministry of Education Key Laboratory of Pollution Processed and Environmental Criteria, Nankai University, Tianjin 300071 (China); Dong, Meiying; Li, Qianqian; Wang, Shuaima [College of Environmental Science and Engineering/Tianjin Key Laboratory of Environmental Remediation and Pollution Control/Ministry of Education Key Laboratory of Pollution Processed and Environmental Criteria, Nankai University, Tianjin 300071 (China)

    2009-10-15

    An integrated nitrate treatment using nanoscale zero-valent iron (NZVI) and Alcaligenes eutrophus, which is a kind of hydrogenotrophic denitrifying bacteria, was conducted to remove nitrate and decrease ammonium generation. Within 8 days, nitrate was removed completely in the reactors containing NZVI particles plus bacteria while the proportion of ammonium generated was only 33%. That is a lower reduction rate but a smaller proportion of ammonium relative to that in abiotic reactors. It was also found that ammonium generation experienced a biphasic process, involving an increasing period and a stable period. After domestication of the bacteria, the combined NZVI-cell system could remove all nitrate without ammonium released when the refreshed nitrate was introduced. Nitrate reduction and the final product distribution were also studied in batch reactors amended with different initial NZVI contents and biomass concentrations, respectively. Both the nitrate removal rate and the ammonium yield decreased when the initial content of NZVI reduced and the initial biomass concentration increased. However, about 27% of the nitrate was converted to ammonium when excess bacteria (OD{sub 422} = 0.026) were used, which was higher than that with appropriate amount of bacteria.

  13. Cloning, nucleotide sequence, and expression of the chromate resistance determinant of Pseudomonas aeruginosa plasmid pUM505.

    Science.gov (United States)

    Cervantes, C; Ohtake, H; Chu, L; Misra, T K; Silver, S

    1990-01-01

    The chromate resistance determinant of Pseudomonas aeruginosa plasmid pUM505 was cloned into broad-host-range vector pSUP104. The hybrid plasmid containing an 11.1-kilobase insert conferred chromate resistance and reduced uptake of chromate in P. aeruginosa PAO1. Resistance to chromate was not expressed in Escherichia coli. Contiguous 1.6- and 6.3-kilobase HindIII fragments from this plasmid hybridized to pUM505 but not to P. aeruginosa chromosomal DNA and only weakly to chromate resistance plasmids pLHB1 and pMG6. Further subcloning produced a plasmid with an insert of 2,145 base pairs, which was sequenced. Analysis of deletions revealed that a single open reading frame was sufficient to determine chromate resistance. This open reading frame encodes a highly hydrophobic polypeptide, ChrA, of 416 amino acid residues that appeared to be expressed in E. coli under control of the T7 promoter. No significant homology was found between ChrA and proteins in the amino acid sequence libraries, but 29% amino acid identity was found with the ChrA amino acid sequence for another chromate resistance determinant sequenced in this laboratory from an Alcaligenes eutrophus plasmid (A. Nies, D. Nies, and S. Silver, submitted for publication). Images FIG. 3 FIG. 5 PMID:2152903

  14. Class 1 integrons and tetracycline resistance genes in Alcaligenes, Arthrobacter, and Pseudomonas spp. isolated from pigsties and manured soil

    DEFF Research Database (Denmark)

    Agersø, Yvonne; Sandvang, Dorthe

    2005-01-01

    The presence of tetracycline resistance (Tc-r) genes and class I integrons (in-1), and their ability to cotransfer were investigated in Tc-r gram-negative (185 strains) and gram-positive (72 strains) bacteria from Danish farmland and pigsties. The isolates belonged to the groups or species...... and/or Pseudomonas putida. We conclude that soil bacteria in close contact to manure or pigsty environment may thus have an important role in horizontal spread of resistance. Use of tetracyclines in food animal production may increase not only Tc-r but also multidrug resistance (caused by the presence...

  15. Biodegradation and detoxification of melanoidin from distillery effluent using an aerobic bacterial strain SAG5 of Alcaligenes faecalis.

    Science.gov (United States)

    Santal, Anita Rani; Singh, N P; Saharan, Baljeet Singh

    2011-10-15

    Distillery effluent retains very dark brown color even after anaerobic treatment due to presence of various water soluble, recalcitrant and coloring compounds mainly melanoidins. In laboratory conditions, melanoidin decolorizing bacteria was isolated and optimized the cultural conditions at various incubation temperatures, pH, carbon sources, nitrogen sources and combined effect of both carbon and nitrogen sources. The optimum decolorization (72.6 ± 0.56%) of melanoidins was achieved at pH 7.5 and temperature 37 °C on 5th day of cultivation. The toxicity evaluation with mung bean (Vigna radiata) revealed that the raw distillery effluent was environmentally highly toxic as compared to biologically treated distillery effluent, which indicated that the effluent after bacterial treatment is environmentally safe. This proves to be novel biological treatment technique for biodegradation and detoxification of melanoidin from distillery effluent using the bacterial strain SAG(5). PMID:21880418

  16. Runoff rates and ecotoxicity of zinc induced by atmospheric corrosion.

    Science.gov (United States)

    Karlén, C; Wallinde, I O; Heijerick, D; Leygraf, C; Janssen, C R

    2001-09-28

    Initiated by regulatory restrictions on the use of zinc for various building and construction applications, together with a lack of knowledge related to the release of zinc induced by atmospheric corrosion, a major interdisciplinary research project was implemented to generate data to be used in future risk assessment. Runoff rates from a large number of commercially available zinc-based materials have been determined on panels inclined 45 degrees from the horizon, facing south, during a 1-year atmospheric exposure in an urban environment in Sweden. Possible environmental effects of runoff water immediately after leaving the surface of the various materials have been evaluated during two different sampling periods of varying season and zinc concentration, using the standard growth inhibition test with algae. Raphidocelis subcapitata (formerly Selenastrum capricornutum). Zinc-specific biosensors with the bacterial strain of Alcaligenes eutrophus, and computer modeling using the water-ligand model MINTEQA2 and the humic aquatic model WHAM, have been used to assess the bioavailability and chemical speciation of zinc in the runoff water. An excellent consistency between the different methods was observed. The results show considerably lower runoff rates of zinc (0.07-3.5 g m(-2) year(-1)) than previously being used for regulatory restrictions, and the concentration of zinc to be predominantly responsible for the observed toxicity of the runoff water towards the green algae. The majority of the released zinc quantity was found to be present as free hydrated zinc ions and, hence, bioavailable. The data do not consider changes in bioavailability and chemical speciation or dilution effects during entry into the environment, and should therefore only be used as an initial assessment of the potential environmental effect of zinc runoff from building applications. This interdisciplinary approach has the potential for studies on the environmental fate of zinc in soil or

  17. The synthesis of Polyhydroxybutyrate (PHB) by Transgenic Chlamydomonas Reinhardtii%利用转基因衣藻合成聚-β-羟基丁酸的研究

    Institute of Scientific and Technical Information of China (English)

    王潮岗; 胡章立

    2005-01-01

    聚-β-羟基丁酸(polyhydroxybutyric acid,PHB)是发现最早且研究最透彻的一种生物可降解塑料.莱茵衣藻(Chlamydomonas reinhardtii)素有"光合酵母"之称,是理想的转基因受体生物.通过转基因技术将PHB生物合成的关键酶基因导入莱茵衣藻,利用光合作用合成PHB,降低PHB的生产成本.从真养产碱杆菌(Alcaligenes eutrophus)分离出phbB和phbC基因,然后构建phbB和phbC基因的衣藻表达载体p105B124和pH105C124.通过"珠磨法"遗传转化技术共转化p105B124和pH105C124,获得了二价转基因衣藻.分子检测结果表明phbB和phbC基因均已整合到莱茵衣藻基因组中.随后进行结晶紫染色和显微镜观察转基因藻,发现二价转化子的核区和细胞膜附近分布有白色空泡;进一步的电子显微镜观察结果表明白色空泡是由细胞中合成的PHB聚集而成,电镜下观察到由PHB形成的明亮的圆形颗粒.光照(90μE/m2/s)条件下培养转基因藻,出现生长受抑制现象,这可能是由于PHB颗粒在藻细胞内随机分布,干扰了细胞正常的生命活动.

  18. Runoff rates, chemical speciation and bioavailability of copper released from naturally patinated copper.

    Science.gov (United States)

    Karlén, C; Wallinder, I Odnevall; Heijerick, D; Leygraf, C

    2002-01-01

    The release of copper, induced by atmospheric corrosion, from naturally patinated copper of varying age (0 and 30 years) has been investigated together with its potential ecotoxic effect. Results were generated in an interdisciplinary research effort in which corrosion science and ecotoxicology aspects were combined. The aim of the investigation was to elucidate the situation when copper-containing rainwater leaves a roof in terms of runoff rate, chemical speciation, bioavailability and ecotoxicity effects. Data have been collected during a three-year field exposure conducted in the urban environment of Stockholm, Sweden. The potential environmental effects have been evaluated using a combination of a copper specific biosensor test with the bacterium Alcaligenes eutrophus and the conventional 72-h growth inhibition test with the green alga Raphidocelis subcapitata. The results show annual runoff rates between 1.0 and 1.5 g/m2 year for naturally patinated copper of varying age. The runoff rate increased slightly with patina age, which mainly is attributed to the enhanced first flush effect observed on thicker patina layers. The total copper concentration in investigated runoff samplings ranged from 0.9 to 9.7 mg/l. Both computer modeling and experimental studies revealed that the majority (60-100%) of released copper was present as the free hydrated cupric ion, Cu(H2O)6(2+), the most bioavailable copper species. However, other copper species in the runoff water, such as, e.g. Cu(OH)+ and Cu2(OH)2(2+), were also bioavailable. The copper-containing runoff water, sampled directly after release from the roof, caused significant reduction in growth rate of the green alga. It should be emphasized that the results describe the runoff situation immediately after release from the copper roof and not the real environmental ecotoxicity. Therefore the data should only be used as an initial assessment of the potential environmental effect of copper runoff from building

  19. Widespread occurrence of the tfd-II genes in soil bacteria revealed by nucleotide sequence analysis of 2,4-dichlorophenoxyacetic acid degradative plasmids pDB1 and p712.

    Science.gov (United States)

    Kim, Dong-Uk; Kim, Min-Sun; Lim, Jong-Sung; Ka, Jong-Ok

    2013-05-01

    Variovorax sp. strain DB1 and Pseudomonas pickettii strain 712 are 2,4-dicholorophenoxy-acetic acid (2,4-D)-degrading bacteria, which were isolated from agricultural soils in Republic of Korea and USA, respectively. Each strain harbors a 2,4-D degradative plasmid and is able to utilize 2,4-D as the sole source of carbon for its growth. The 2,4-D degradative plasmid pDB1 of strain DB1 consisted of a 65,269-bp circular molecule with a G+C content of 66.23% and had 68 ORFs. The 2,4-D degradative plasmid p712 of strain 712 was composed of a 62,798-bp circular molecule with a 62.11% G+C content and had 62 ORFs. The plasmids pDB1 and p712 share significantly homologous 2,4-D degradative genes with high similarity to the tfdR, tfdB-II, tfdC-II, tfdD-II, tfdE-II, tfdF-II, tfdK and tfdA genes of plasmid pJP4 of Alcaligenes eutrophus isolated from Australia. In a phylogenetic analysis with trfA, traL, and trbA genes, pDB1 belonged to IncP-1β with pJP4, while p712 belonged to IncP-1ε with pKJK5 and pEMT3. The results indicated that, in spite of the differences in their backbone regions, the 2,4-D catabolic genes of the two plasmids were closely related and also related to the well-known 2,4-D degradative plasmid pJP4 even though all were isolated from different geographic regions. Other similarities in the genetic organization and the presence of IS1071 suggested that these catabolic genes may be on a transposable element, leading to widespread occurrence in soil bacteria. PMID:23376020

  20. Holmium(III Supermesityl-Imide Complexes Bearing Methylaluminato/Gallato Ligands

    Directory of Open Access Journals (Sweden)

    Dorothea Schädle

    2015-11-01

    Full Text Available Heterobimetallic µ2-imide complexes [Ho(µ2-Nmes*{Al(CH34}]2 (1, supermesityl = mes* = C6H2tBu3-2,4,6 and [Ho(µ2-Nmes*{Ga(CH34}]2 (2 have been synthesized from homoleptic complexes Ho[M(CH34]3 (M = Al, Ga via deprotonation of H2Nmes* or with K[NH(mes*] according to a salt metathesis-protonolysis tandem reaction. Single-crystal X-ray diffraction of isostructural complexes [Ho(µ2-Nmes*{M(CH34}]2 (M = Al, Ga revealed asymmetric Ho2N2 metallacycles with very short Ho–N bond lengths and secondary Ho arene interactions.

  1. Improved Degradation of Monochlorophenols by a Constructed Strain

    OpenAIRE

    Schwien, Uwe; Schmidt, Eberhard

    1982-01-01

    Pseudomonas sp. strain B13, a strain able to degrade 3-chlorobenzoate and, after prolonged adaptation (40 days), 4-chlorophenol, could transfer the ability to degrade chlorocatechols to a recipient, Alcaligenes sp. strain A7, which is able to grow with benzoate and phenol. Representative transconjugants, such as Alcaligenes sp. strain A7-2, were able to utilize all three isomeric chlorophenols; this property was not possessed by the donor or the recipient. The ability to grow readily with 4-c...

  2. Characterization of the Metabolically Modified Heavy Metal-Resistant Cupriavidus metallidurans Strain MSR33 Generated for Mercury Bioremediation

    OpenAIRE

    Rojas, Luis A.; Carolina Yáñez; Myriam González; Soledad Lobos; Kornelia Smalla; Michael Seeger

    2011-01-01

    BACKGROUND: Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. METHODOLOGY/PRINCIPAL FINDINGS: To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other me...

  3. Dicty_cDB: Contig-U16229-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Vibrio harveyi ATCC BAA-1116 ch... 125 2e-27 CP000083_127( CP000083 |pid:none) Colwellia psychr...:none) Colwellia psychrerythraea 34H, ... 103 6e-21 CP000377_2471( CP000377 |pid:none) Silicib...:none) Ralstonia metallidurans CH34, c... 127 5e-28 EF017216_7( EF017216 |pid:none) Tetrathiobac...GG, ... 96 1e-18 CP000353_1264( CP000353 |pid:none) Ralstonia metallidurans CH34 ...knqkklkkkvslksfvlppmthll*vlgvk tlmqvlqllyfqmvtlnslkrldlkwmvrlsylvktdlkdml*sltlvlsnilqlkkvvn lmyhll

  4. Dicty_cDB: Contig-U15400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 34 2.3 2 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34... 2.5 16 ( AZ524051 ) 226PbF06 Pb MBN #21 Plasmodium berghei genomic 3'... 36 2.5 2 ( AC129992 ) Rattus norve

  5. Dicty_cDB: Contig-U02594-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DL172026 ) Methods for Identifying the Target of a Compound ... 42 0.049 2 ( DJ377761 ) Identification of E...e cDNA clone:VS... 670 0.0 2 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34 0.015 11 (

  6. Dicty_cDB: Contig-U12038-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34 0.005 19 ( DW248180 ) pOP-EON00464_EST_C_1_pSK_SK EON (Oil... Palm Embryoi... 54 0.013 1 ( EY410093 ) pOP-EO07491_EST_C_1_pSK_SK EO (Oil

  7. Antibacterial activity of Pterocarpus santalinus

    Directory of Open Access Journals (Sweden)

    Manjunatha B

    2006-01-01

    Full Text Available Antibacterial activity of leaf and stem bark of Pterocarpus santalinus (Fabaceae was investigated. The antibacterial activity was tested against both Gram-positive and Gram-negative organisms. Among the two extracts tested, stem bark extract exhibited broad-spectrum antibacterial activity against the tested organisms. The stem bark extract showed maximum activity against Enterobacter aerogenes, Alcaligenes faecalis, Escherichia coli, Pseudomonas aeruginosa, Proteus vulgaris, Bacillus cereus, Bacillus subtilis, Staphylococcus aureus . The leaf extract showed maximum activity against Escherichia coli, Alcaligenes faecalis, Enterobacter aerogenes and Pseudomonas aeruginosa . Both extracts exhibited concentration dependent activity.

  8. Dicty_cDB: Contig-U16243-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Xenopus laevis acetyl-Coenzyme A a... 332 e-104 BC124019_1( BC124019 |pid:none) Xenopus tropicali...:none) Alcaligenes sp. SH-69 beta-ketothi... 252 2e-65 CU...itrobacter hamburgensis X14, co... 229 4e-65 AF078795_2( AF078795 |pid:none) Alcaligenes latus polyhydroxyal...............done Score E Sequences producing significant alignments: (bits) Value N ( AC116986 ) Dictyostelium discoid...I-1, ... 287 3e-84 CP000930_72( CP000930 |pid:none) Heliobacterium modesticaldum Ice1... 291 5e-84 AP008955_4898( AP008955 |pid

  9. Reconstitution of the type-1 active site of the H145G/A variants of nitrite reductase by ligand insertion

    NARCIS (Netherlands)

    Wijma, HJ; Boulanger, MJ; Molon, A; Fittipaldi, M; Huber, M; Murphy, MEP; Verbeet, MP; Canters, GW

    2003-01-01

    Variants of the copper-containing nitrite reductase (NiR) of Alcaligenes faecalis S6 were constructed by site-directed mutagenesis, by which the C-terminal histidine ligand (His145) of the Cu in the type-1 site was replaced by an alanine or a glycine. The type-1 sites in the NiR variants as isolated

  10. Enzymatic process for acylation of resveratrol at position 3

    OpenAIRE

    Torres, Pamela; Plou Gasca, Francisco José; Ballesteros Olmo, Antonio

    2008-01-01

    [EN] Enzymatic procedure for the regioselective acylation at position 3 of resveratrol utilising a vinyl ester and specific fungal and bacterial lipases, immobilised, as biocatalyst. The lipases utilised in said procedure come from bacteria or fungi selected from among Alcaligenes, Pseudomonas or Thermomyces.

  11. In Vitro Pharmacodynamics of Levofloxacin and Other Aerosolized Antibiotics under Multiple Conditions Relevant to Chronic Pulmonary Infection in Cystic Fibrosis ▿

    OpenAIRE

    King, Paula; Lomovskaya, Olga; Griffith, David C.; Burns, Jane L.; Dudley, Michael N.

    2009-01-01

    The inhalational administration of antibiotics can provide high concentrations locally in the lungs of cystic fibrosis patients and, thus, can be useful for the treatment of chronic bacterial infections. The present study evaluated the in vitro activities of levofloxacin, ciprofloxacin, tobramycin, amikacin, and aztreonam against clinical isolates of Pseudomonas aeruginosa, Burkholderia cepacia complex, Stenotrophomonas maltophilia, Alcaligenes xylosoxidans, and Staphylococcus aureus from cys...

  12. Bidirectional catalysis by copper-containing nitrite reductase

    NARCIS (Netherlands)

    Wijma, HJ; Canters, GW; de Vries, S; Verbeet, MP

    2004-01-01

    The copper-containing nitrite reductase from Alcaligenes faecalis S-6 was found to catalyze the oxidation of nitric oxide to nitrite, the reverse of its physiological reaction. Thermodynamic and kinetic constants with the physiological electron donor pseudoazurin were determined for both directions

  13. Sensing nitrite through a pseudoazurin-nitrite reductase electron transfer relay

    NARCIS (Netherlands)

    Astier, Y; Canters, GW; Davis, JJ; Hill, HAO; Verbeet, MP; Wijma, HJ

    2005-01-01

    Nitrite is converted to nitric oxide by haem or copper-containing enzymes in denitrifying bacteria during the process of denitrification. In designing an efficient biosensor, this enzymic turnover must be quantitatively assessed. The enzyme nitrite reductase from Alcaligenes faecalis contains a redo

  14. Isolation and characterization of bacteria from Waste Sugar Mill Arasoe-Kab.Bone As Raw Material Producing Bioplastics Degraded (Poly-??-hydroxybutyrate)

    OpenAIRE

    Haedar, Nur; Gobel, Risco B.; Umar, Muhammad Ruslan; Ambeng, Ambeng

    2014-01-01

    Beberapa genera bakteri seperti Alcaligenes, Pseudomonas, Azotobacter, Rhizobium, Azospirilum, dan Micrococcus dari beberapa spesies algae mampu mengakumulasi granula PHB yang diakumulasi oleh sel bakteri yang ditumbuhkan dalam medium yang mengandung konsentrasi karbon tinggi tetapi nitrogen dan fosfatnya terbatas, Salah satu upaya untuk menekan biaya produksi perlu dilakukan penelitian dari sudut pandang mikrobiologi, diantaranya ialah menemukan mikroba unggul baru penghasil PHB atau menemuk...

  15. Method for preventing and/or treating insulin resistance

    NARCIS (Netherlands)

    Nieuwdorp, M.; Vos, de W.M.

    2013-01-01

    The present invention describes use of Eubacterium hallii et rel. and/or Alcaligenes faecalis et rel., as well as pharmaceutical, food, or feed compositions comprising these bacteria, as a medicament, in particular for preventing and/or treating insulin resistance and/or insulin resistance-related c

  16. Calorimetric and spectroscopic investigations of the thermal denaturation of wild type nitrite reductase

    NARCIS (Netherlands)

    Stirpe, A; Guzzi, R; Wijma, H; Verbeet, MP; Canters, GW; Sportelli, L

    2005-01-01

    Nitrite reductase (NiR) is a multicopper protein, with a trimeric structure containing two types of copper site: type I is present in each subunit whereas type 2 is localized at the subunits interface. The paper reports on the thermal behaviour of wild type NiR from Alcaligenes faecalis S-6. The tem

  17. Dicty_cDB: Contig-U11308-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available romos... 36 5.1 CP000083_1562( CP000083 |pid:none) Colwellia psychrerythraea 34H,...ngi nqfqlvlvsmvwinlkrplnlkfnkekknswvfinklplnllifmilqve*kqrvllnkw yhgnrlvpssmiv*redylkrin*n*sinli...qv*ivnqn*iywklglnkslvtinqliti ktin*flqqsnqili*lmirllifqnnmlsikf*ilfnqiqnqslmvskifyllfqlnkk nfyl...nlekrfk*ikkk***in*k Frame B: rys*cyhfnlsrinltressylfipinikgly*rvvnctyssyniyllww**r*tieifh f*rtsy...:none) Ralstonia metallidurans CH34, co... 38 1.7 CP001157_4781( CP001157 |pid:none) A

  18. Bacterial genomic adaptation and response to metals

    International Nuclear Information System (INIS)

    The beta-proteobacterium Cupriavidus metallidurans CH34 (formerly Ralstonia metallidurans) has been intensively studied since 1976 in SCK-CEN and VITO, for its adaptation capacity to survive in harsh (mostly industrial) environments, to overcome acute environmental stresses, for its resistance to a variety of heavy metals and for applications in environmental biotechnology. Recently, CH34 has become a model bacterium to study the effect of spaceflight conditions in several space flight experiments conducted by SCK-CEN (e.g. MESSAGE, BASE). Furthermore, Cupriavidus and Ralstonia species are isolated from the floor, air and surfaces of spacecraft assembly rooms; were found prior-to-flight on surfaces of space robots such as the Mars Odyssey Orbiter and even in-flight in ISS cooling water and Shuttle drinking water, vindicating its role as model bacterium in space research. In addition, Ralstonia species are also the causative agent of nosocomial infections and are among the unusual species recovered from cystic fibrosis (CF) patients. The genomic organization of Cuprivavidus metallidurans CH34 was studied in-depth to identify the genetic and regulatory structures involved in the resistance to heavy metals

  19. Characterization of the metabolically modified heavy metal-resistant Cupriavidus metallidurans strain MSR33 generated for mercury bioremediation.

    Directory of Open Access Journals (Sweden)

    Luis A Rojas

    Full Text Available BACKGROUND: Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. METHODOLOGY/PRINCIPAL FINDINGS: To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg(2+. The minimum inhibitory concentrations (mM for strain MSR33 were: Hg(2+, 0.12 and CH(3Hg(+, 0.08. The addition of Hg(2+ (0.04 mM at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg(2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg(2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg(2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg(2+ (0.10 and 0.15 mM was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM after 2 h. CONCLUSIONS/SIGNIFICANCE: A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel

  20. PCR cloning of Polyhydroxybutyrate Synthase Gene (phbC) from Aeromonashydrophila

    International Nuclear Information System (INIS)

    Plastic wastes are considered to be severe environmental contaminantscausing waste disposal problems. Widespread use of biodegradable plastics isone of the solutions, but it is limited by high production cost. A polymerasechain reaction (PCR) protocol was developed for the specific for the specificdetection and isolation of full-length gene coding for polyhydroxybutyrate(PBH). (PCR) strategy using (PHB) primers resulted in the amplification of(DNA) fragments with the expected size from all isolated bacteria (PBH)synthase gene was cloned directly from Aeromonas hydrophila genome for thefirst time. The clonec fragment was named (phbCAh) gene exhibits similarly to(PHB) synthase genes of Alcaligenes latus and Pseudomonas oleovorans (97%),Alcaligenes sp. (81%) and Comamonas acidovorans (84%). (author)

  1. Corrosion inhibition of mild steel by aerobic biofilm

    International Nuclear Information System (INIS)

    Mild steel electrodes were incubated in phosphate-buffered basal salt solution (BSS) having two different aerobic bacteria, viz. Pseudomonas alcaligenes and Pseudomonas cichorii. In the medium containing P. cichorii, significant reduction in the corrosion rate was observed due to the surface reaction leading to the formation of corrosion inhibiting bacterial biofilm. With a view to understand the mechanism of microbially influenced corrosion/corrosion inhibition, electrochemical and biological experiments such as electrochemical impedance spectroscopy (EIS) measurements and biochemical analysis were made. The exposed surfaces were examined using scanning electron micrographs (SEM), energy dispersive spectroscopy (EDS) and electron spectroscopy for chemical analysis (ESCA). The scraped surface film was also examined using FT-IR spectroscopy. The results suggested that mild steel surface contained iron oxide-phosphate layer covered with bacteria and exo polymeric substance (EPS)/iron-EPS complex for P. cichorii and iron oxides and iron phosphate for P. alcaligenes

  2. Microbiological activities in a shallow-ground repository with cementitious wasteform

    International Nuclear Information System (INIS)

    Cementitious wasteform with immobilised nuclear power plant operational radioactive waste disposed in a near surface testing repository for about 20 years have been analysed for microbiological activities. Clean cultures were selected from the main metabolic groups expected within repository environment e.g. anaerobic de-nitrifying, fermenting, sulphur-reducing, iron-reducing, and oxidizing, thio-bacterium and mushrooms. Microbiological species were identified within cementitious wasteform, in the clayey soil near the wasteform and in the contacting water. The most populated medium was the soil with microbial populations Bacillus, Pseudomonas and Micrococcus, and densities of populations up to 3.6*105 colony/g. Microbial populations of generic type Bacillus, Pseudomonas, Rhodococcus, Alcaligenes, Micrococcus, Mycobacterium, and Arthrobacter were identified within cementitious wasteform. Populations of Arthrobacter, Pseudomonas, Alcaligenes, Rhodococcus, Bacillus and Flavobacterium were identified in the water samples contacting the cementitious wasteform. Microbiological species identified are potential destructors of cementitious wasteform and containers. (authors)

  3. HYDROCARBON-DEGRADING BACTERIA AND SURFACTANT ACTIVITY

    Energy Technology Data Exchange (ETDEWEB)

    Brigmon, R; Topher Berry, T; Grazyna A. Plaza, G; jacek Wypych, j

    2006-08-15

    Fate of benzene ethylbenzene toluene xylenes (BTEX) compounds through biodegradation was investigated using two different bacteria, Ralstonia picketti (BP-20) and Alcaligenes piechaudii (CZOR L-1B). These bacteria were isolated from extremely polluted petroleum hydrocarbon contaminated soils. PCR and Fatty Acid Methyl Ester (FAME) were used to identify the isolates. Biodegradation was measured using each organism individually and in combination. Both bacteria were shown to degrade each of the BTEX compounds. Alcaligenes piechaudii biodegraded BTEXs more efficiently while mixed with BP-20 and individually. Biosurfactant production was observed by culture techniques. In addition 3-hydroxy fatty acids, important in biosurfactant production, was observed by FAME analysis. In the all experiments toluene and m+p- xylenes were better growth substrates for both bacteria than the other BTEX compounds. In addition, the test results indicate that the bacteria could contribute to bioremediation of aromatic hydrocarbons (BTEX) pollution increase biodegradation through the action by biosurfactants.

  4. Determinants Encoding Resistance to Several Heavy Metals in Newly Isolated Copper-Resistant Bacteria

    OpenAIRE

    Dressler, Cathrin; Kües, Ursula; Nies, Dietrich H.; Friedrich, Bärbel

    1991-01-01

    Three copper-resistant, gram-negative bacteria were isolated and characterized. Of the three strains, Alcaligenes denitrificans AH tolerated the highest copper concentration (MIC = 4 mM CuSO4). All three strains showed various levels of resistance to other metal ions. A. denitrificans AH contains sequences which cross-hybridized with the mer (mercury resistance) determinant of Tn21 and the czc (cobalt, zinc, and cadmium resistance), cnr (cobalt and nickel resistance), and chr (chromate resist...

  5. Antibacterial activity of Pterocarpus santalinus

    OpenAIRE

    Manjunatha B

    2006-01-01

    Antibacterial activity of leaf and stem bark of Pterocarpus santalinus (Fabaceae) was investigated. The antibacterial activity was tested against both Gram-positive and Gram-negative organisms. Among the two extracts tested, stem bark extract exhibited broad-spectrum antibacterial activity against the tested organisms. The stem bark extract showed maximum activity against Enterobacter aerogenes, Alcaligenes faecalis, Escherichia coli, Pseudomonas aeruginosa, Proteus vulgaris, Bacillus cere...

  6. Isolation and Genetic Analysis of Multidrug Resistant Bacteria from Diabetic Foot Ulcers

    OpenAIRE

    Shahi, Shailesh K.; Kumar, Ashok

    2016-01-01

    Severe diabetic foot ulcers (DFUs) patients visiting Sir Sunderlal Hospital, Banaras Hindu University, Varanasi, were selected for this study. Bacteria were isolated from swab and deep tissue of 42 patients, for examining their prevalence and antibiotic sensitivity. DFUs of majority of the patients were found infected with Enterococcus spp. (47.61%), Escherichia coli (35.71%), Staphylococcus spp. (33.33%), Alcaligenes spp. (30.95%), Pseudomonas spp. (30.95%), and Stenotrophomonas spp. (30.95%...

  7. Characterization of Pseudomonas Species Isolated from the Rhizosphere of Plants Grown in Serozem Soil, Semi-Arid Region of Uzbekistan

    OpenAIRE

    Dilfuza Egamberdiyeva

    2005-01-01

    Collections of native Pseudomonas spp. are kept at the NCAM of Uzbekistan. Some of those organisms were isolated from the rhizosphere of cotton, wheat, corn, melon, alfalfa, and tomato grown in field locations within a semi-arid region of Uzbekistan. Strains used for this study were Pseudomonas alcaligenes, P. aurantiaca, P. aureofaciens, P. denitrificans, P. mendocina, P. rathonis, and P. stutzeri. Some of the pseudomonads have been characterized in this report. These strains produced enzyme...

  8. 脱窒菌のコロイド化学的性質

    OpenAIRE

    鷲谷, 亜希子; 平井, 俊朗; 林, 剛; Akiko , Washiya; Toshiaki , Hirai; Tsuyoshi, Hayashi; 帝京科学大学大学院理工学研究科; 帝京科学大学生命環境学部生命科学科; 帝京科学大学生命環境学部環境科学科

    2009-01-01

    In order to elucidate the effects of the solutes contained in waste waters; inorganic electrolytes and organic compounds, on the flocculation behavior and the denitrifying function of the denitrifiers that are employed in the biological denitrifying processes at the water purification plants. In the study, three kinds of denitrifiers which were gathered and cultured in Uenohara City, Yamanashi Prefecture; Pseudomonas aeruginosa(a bacillus with flugela), Alcaligenes sp(a bacillus with flugela)...

  9. Biodegradation of Asphalt Cement-20 by Aerobic Bacteria

    OpenAIRE

    Pendrys, John P.

    1989-01-01

    Seven gram-negative, aerobic bacteria were isolated from a mixed culture enriched for asphalt-degrading bacteria. The predominant genera of these isolates were Pseudomonas, Acinetobacter, Alcaligenes, Flavimonas, and Flavobacterium. The mixed culture preferentially degraded the saturate and naphthene aromatic fractions of asphalt cement-20. A residue remained on the surface which was resistant to biodegradation and protected the underlying asphalt from biodegradation. The most potent asphalt-...

  10. Disease: H01081 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available gative bacteria that belongs to the genus Alicaligenes. It can rarely cause keratitis in patients who had worn contact...Keratitis after Contact Lens Usage. Korean J Ophthalmol 26:49-53 (2012) PMID:21993586 Ahmed AA, Pineda R Alcaligenes xylosoxidans con...tact lens-related keratitis--a case report and literature review. Eye Contact Lens 37:386-9 (2011) ...

  11. Effect of Some Plant Growth Promoting Bacteria on Yield, Yield Components of Dry Bean (Phaseolus vulgaris L. cv. Aras 98)

    OpenAIRE

    Tozlu, Elif; Karagöz, Kenan; Babagil, G. Emel; Dizikısa, Tülay; Kotan, Recep

    2014-01-01

    ABSTRACT : The common bean (Phaseolus vulgaris L.) belongs to the family Leguminosae, and is a diverse food resource of high nutritional value. Plant growth promoting bacteria (PGPB) are a group of bacteria that actively colonize plants, increase plant growth and yield, and suppres plant disease. In this study, the effectiveness of ten PGPBs (Alcaligenes piechaudii strain RK-136, Bacillus megaterium strain M-3, Bacillus pumilus  strain M-13, Bacillus subtilis  strain BA-142, Erwinia rhapontic...

  12. Biopolymers production with carbon source from the wastes of a beer brewery industry

    Science.gov (United States)

    Wong, Phoeby Ai Ling

    The main purpose of this study was to assess the potential and feasibility of malt wastes, and other food wastes, such as soy wastes, ice-cream wastes, confectionery wastes, vinegar wastes, milk waste and sesame oil, in the induction of biosynthesis of PHA, in the cellular assembly of novel PHA with improved physical and chemical properties, and in the reduction of the cost of PHA production. In the first part of the experiments, a specific culture of Alcaligenes latus DSM 1124 was selected to ferment several types of food wastes as carbon sources into biopolymers. In addition, the biopolymer production, by way of using malt waste, of microorganisms from municipal activated sludge was also investigated. In the second part, the experiments focused on the synthesis of biopolymer with a higher molecular mass via the bacterial strain, which was selected and isolated from sesame oil, identified as Staphylococcus epidermidis . Molecular weight and molecular weight distribution of PHB were studied by GPC. Molecular weight of PHB produced from various types of food wastes by Alcaligenes latus was higher than using synthetic sucrose medium as nutrient, however, it resulted in the reverse by Staphylococcus epidermidis. Thermal properties of biopolymers were studied by DSC and TG. Using malt wastes as nutrients by Alcaligenes latus gave a higher melting temperature. Using sucrose, confectionery and sesame oil as nutrients by Staphylococcus epidermidis gave higher melting temperature. Optimization was carried out for the recovery of microbial PHB from Alcaligenes latus. Results showed that molecular weight can be controlled by changing the hypochlorite concentration, the ratio of chloroform to hypochlorite solution and the extraction time. In addition, the determination of PHB content by thermogravimetric analysis method with wet cell was the first report in our study. (Abstract shortened by UMI.)

  13. Evidence for 4-chlorobenzoic acid dehalogenation mediated by plasmids related to pSS50.

    OpenAIRE

    Layton, A C; Sanseverino, J; Wallace, W; Corcoran, C; Sayler, G. S.

    1992-01-01

    The biodegradation of 4-chlorobiphenyl usually proceeds through the intermediate 4-chlorobenzoate. Few bacterial strains can degrade 4-chlorobiphenyl to 4-chlorobenzoate and 4-chlorobenzoate to CO2. This study demonstrates that the 4-chlorobiphenyl-degrading Alcaligenes sp. strain ALP83 can degrade 4-chlorobenzoate to 4-hydroxybenzoate. The dehalogenase activity is correlated with a 10-kb fragment carried on plasmid pSS70.

  14. Effects of waste drilling fluid on bacterial isolates from a mangrove swamp oilfield location in the Niger delta of Nigeria

    International Nuclear Information System (INIS)

    Four bacteria strains isolated from a mangrove swamp oilfield location in the Niger Delta of Nigeria were cultured aerobically in the presence of 1.0% waste drilling fluid, to determine the effect of the waste on their growth. A 2-h lag phase of growth was produced by the waste in cultures of Micrococcus and Pseudomonas species, while the waste increased the lag phases of Alcaligenes and Staphylococcus species to 4 h. The exponential phase of growth of Pseudomonas sp. was depressed by the waste drilling fluid but fluid stimulated the exponential phases of Micrococcus and Alcaligenes spp. There was enhancement of the growth rate of Alcaligenes and Micrococcus spp. while those of Staphylococcus and Pseudonomas spp. were decreased. The depressed growth rates of Staphylococcus and Pseudonomas spp. in the presence of the waste drilling fluid might lead to a decrease in their contribution to the removal of the waste from the environment during spillage or disposal and, therefore, may result in an accumulation of the waste in the environment. (author)

  15. Dicty_cDB: Contig-U11780-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignavsntitqiarvdlddsdedseeeimveedievskkeyeryhrkklglplsdtedsd ndndnggddndnaimnaid...mosome 2 map complem... 38 1e-04 15 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34 2e-...1Q.Seq.d Length = 1866 Score = 1025 bits (517), Expect = 0.0 Identities = 517/517 (100%) Strand = Plus / Plu...|||||| Sbjct: 481 tgttggtcaaagagcatattcaatgttttcaactcac 517 Score = 967 bits (488), Expect = 0.0 Identities = 488/488 (100%) Strand...Sbjct: 1537 atgtaacc 1544 Score = 589 bits (297), Expect = e-168 Identities = 297/297 (100%) Strand

  16. Dicty_cDB: Contig-U11458-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Francisella philomiragia subsp. ... 64 3e-08 CP000361_689( CP000361 |pid:none) Arcobac...sma mali strain AT complete ch... 34 0.92 2 ( EY370074 ) CAXA12712.fwd CAXA Helobdella robusta Subtra... ) Staphylococcus aureus subsp. aureus N315 DNA, com... 38 1.2 20 ( EY373624 ) CAXA14648.fwd CAXA Helobdella robusta Subtra...cted ... 46 1.2 2 ( EY372136 ) CAXA13846.fwd CAXA Helobdella robusta Subtra...-Sampling_GS-31-01-01-1... 38 1.3 2 ( EY391071 ) CAXA9069.fwd CAXA Helobdella robusta Subtra

  17. Dicty_cDB: Contig-U16343-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available socitrate lyase; EC=4.1.3... 67 3e-09 CP000561_610( CP000561 |pid:none) Pyrobaculum calidifontis JCM...stonia metallidurans CH34, c... 65 6e-09 CP000926_1922( CP000926 |pid:none) Pseudomonas putida...9342 ) 1092344077476 Global-Ocean-Sampling_GS-27-01-01-1... 64 1e-09 2 ( CP000084 ) Candidatus Pelagibacter ...........done Score E Sequences producing significant alignments: (bits) Value AC117076_17( AC117076 |pid:none) Dictyostelium discoid...:none) Yersinia enterocolitica subsp. ... 494 e-138 CP001654_443( CP001654 |pid:none) Dickeya dadantii Ech70

  18. Effect of reactive and non-reactive counterion micelles upon the alkaline degradation of indomethacin

    Directory of Open Access Journals (Sweden)

    Abdullah S. Al-Ayed

    2014-01-01

    Full Text Available In the present paper, kinetics of alkaline degradation of well known drug, indomethacin (2-[1-(4-chlorobenzoyl-5-methoxy-2-methylindol-3-yl]acetic acid, was studied in presence of excess [NaOH]. The rate of hydrolysis of substrate was independent of the [indomethacin] though it increased linearly with increasing the hydroxide ion concentration with a positive slope, suggesting the following rate law: kobs = k1[OH−]. Cationic surfactants having non-reactive ions (cetyltrimethylammonium bromide, CTAB and cetyltrimethylammonium sulfate (CTA2SO4 first increased the rate constants at lower concentrations and then decreased it at higher concentrations while in case of the surfactant with reactive counterions (cetyltrimethylammonium hydroxide, CTAOH the rate increases sharply at lower concentrations of surfactant until it reaches to a plateau in contrast to the appearance of maxima in case of CTAB and (CTA2SO4. Anionic surfactant, sodium dodecyl sulfate (SDS, inhibited the reaction rate at all concentrations used in the study. Pseudophase ion-exchange model was used for analyzing the effect of cationic micelles while the inhibition by SDS micelles was fitted using the Menger–Portnoy model. The effect of salts (NaCl, NaBr and (CH34NBr was also seen on the hydrolysis of indomethacin and it was found that all salts inhibited the rate of reaction. The inhibition followed the trend NaCl < NaBr < (CH34NBr.

  19. Seleksi dan Identifikasi Bakteri Alkalifilik Penghasil Xilanase dari Tanah Bukit Krakitan, Bayat, Klaten

    Directory of Open Access Journals (Sweden)

    SURANTO

    2007-05-01

    Full Text Available Xylanase producing alkaliphilic bacteria are bacteria that can grow well in alkaline environment. They can produce xylanase that optimum at high pH to hydrolyze xylans to be xylooligosaccharides and xylose. The calcareous soil with pH more than 7,3 can be xylanase producing alkaliphilic bacteria nature habitat. The aims of this research were (1 to isolate xylanase producing alkaliphilic bacteria isolated from calcareous soil in limestone hill area Krakitan, Bayat, Klaten and (2 to determine the kind of xylanase producing alkaliphilic bacteria which has high xylanolytic activity. For isolation and selection of xylanase producing alkaliphilic bacteria, the alkaline medium pH 9-10 were used, and 0,5 % oat spelt xylan was added. The calcareous soil was taken from limestone hill area and then was filtered and inoculated on to alkaline medium. After that, they were incubated in shaker incubator for 3 days at 150 rpm in 30-37°C. Then, the enrichment sample was grown in the same medium, that 1,8% agar was added. The colonies that grew and produced clearing zone which had the highest xylanolytic activity were chosen then characterized and identified. The growth ability isolates were examined in xylan medium at pH 7, 8, 9, 10, and 11 in order to decide bacteria of fakultative or obligate alkaliphilic. Xylanase producing alkaliphilic bacteria could be isolated from calcareous soil in limestone hill area Krakitan, Bayat, Klaten. The identified 10 xylanase producing alkaliphilic bacteria that had xylanolytic activity were Pseudomonas HT-1a, Pseudomonas HT-1b, Bacillus HT-2a, Bacillus HT-2d, Flavobacterium rigense HT-3c, Micrococcus luteus HT-3d, Paracoccus alcaliphilus HT-5c, Alcaligenes HT-4c, Alcaligenes HT-5a, and Alcaligenes HT-5b.

  20. Screening and identification of polyhydroxyalkanoates producing bacteria and biochemical characterization of their possible application.

    Science.gov (United States)

    Sangkharak, Kanokphorn; Prasertsan, Poonsuk

    2012-01-01

    Polyhydroxyalkanoates (PHAs) accumulating bacteria were isolated under various selective conditions such as pH, salt concentrations and types of heavy metal. Fifty strains of bacterial isolates were found to belong to Bacillus, Proteus, Pseudomonas, Aeromonas, Alcaligenes and Chromobacterium, based on phenotypical features and genotypic investigation. Only twenty five bacterial isolates were selected and observed for the production of PHAs. Interestingly, bacteria belonging to Firmucutes Bacillus sp. produced a high amount of PHAs. The maximum PHAs were accumulated by B. licheniformis PHA 007 at 68.80% of dry cell weight (DCW). Pseudomonas sp., Aeromonas sp., Alcaligenes sp. and Chromobacterium sp. were recorded to produce a moderate amount of PHAs, varying from 10.00-44.32% of DCW. The enzymatic activity was preliminarily analyzed by the ratio of the clear zone diameter to colony diameter. Bacillus gave the highest ratio of hydrolysis zone which corresponds to the highest hydrolytic enzyme activities. Bacillus licheniformis PHA 007 had the highest lipase and protease activity at 2.1 and 5.1, respectively. However, the highest amylase activity was observed in Bacillus sp. PHA 023 at 1.4. Determination of metabolic characteristics was also investigated to check for their ability to consume a wide range of substrates. Bacillus, Aeromonas sp. and Alcaligenes sp. had great ability to utilize a variety of substrates. To decrease high PHA cost, different sources of cheap substrates were tested for the production of PHAs. Bacillus cereus PHA 008 gave the maximal yield of PHA production (64.09% of DCW) when cultivated in anaerobically treated POME. In addition, the accumulation of PHA copolymers such as 3-hydroxyvalerate and 3-hydroxyhexanoate was also observed in Bacillus and Pseudomomas sp. strain 012 and 045, respectively. Eight of the nine isolates accumulated a significant amount of PHAs when inexpensive carbon sources were used as substrates. Here it varied from 1

  1. Three-dimensional model of stellacyanin and its implications for electron transfer reactivity

    DEFF Research Database (Denmark)

    Wherland, S; Farver, O; Pecht, I

    1988-01-01

    system. The structure also indicates that a carbonyl oxygen atom is near the copper, thus the site may have analogy to the Alcaligenes denitrificans azurin (Az) site, although the amino acid sequence is more homologous to that of Pc. The model indicates that aspartate 49, reductively labeled by Cr......(III), is near the copper center and homologous to the site labeled by Cr(III) on Pc. Also homologous to Pc is a tyrosine residue adjacent to the aspartate. This tyrosine has been implicated in Pc electron transfer and thus is probably involved in electron transfer reactivity of St as well. The higher...

  2. Phytoremediation of Pb and Hg by using Scirpus mucronatus with addition of bacterial inoculums

    International Nuclear Information System (INIS)

    Two heavy metal-resistant rhizobacteria bacteria (Brevundimonas diminuta SF-S1-5 and Alcaligenes faecalis SF-S1-60) were bioaugmented in sand and also spiked with 100 ppm Pb and 1 ppm Hg and the removal of these metals was monitored using plant, Scirpus mucronatus. The highest accumulation of Pb and Hg were obtained in the root of S. mucronatus inoculated with A. faecalis at day 42 and 28, respectively. Plant inoculated with A. faecalis also showed the highest bioaccumulation coefficient and bioconcentration factor values > 1 compared to plant inoculated with B. diminuta and control. (author)

  3. BIODEGRADATION OF PETROLEUM-WASTE BY BIOSURFACTANT-PRODUCING BACTERIA

    Energy Technology Data Exchange (ETDEWEB)

    Brigmon, R; Grazyna A. Plaza, G; Kamlesh Jangid, K; Krystyna Lukasik, K; Grzegorz Nalecz-Jawecki, G; Topher Berry, T

    2007-05-16

    The degradation of petroleum waste by mixed bacterial cultures which produce biosurfactants: Ralstonia pickettii SRS (BP-20), Alcaligenes piechaudii SRS (CZOR L-1B), Bacillus subtilis (1'- 1a), Bacillus sp. (T-1) and Bacillus sp. (T'-1) was investigated. The total petroleum hydrocarbons were degraded substantially (91 %) by the mixed bacterial culture in 30 days (reaching up to 29 % in the first 72 h). Similarly, the toxicity of the biodegraded petroleum waste decreased 3 times after 30 days as compared to raw petroleum waste. Thus, the mixed bacterial strains effectively clean-up the petroleum waste and they can be used in other bioremediation processes.

  4. Respiratory disease (rhinotracheitis) in turkeys in Brittany, France, 1981-1982. I. Field observations and serology.

    Science.gov (United States)

    Andral, B; Louzis, C; Trap, D; Newman, J A; Bennejean, G; Gaumont, R

    1985-01-01

    During the summer of 1981, a respiratory disease epidemic occurred in turkeys in Brittany, France. Since this initial epizootic, which lasted through fall, epizootic waves similar to the initial one have occurred at approximately 6-month intervals, with smaller peaks at 2-month intervals. The epidemiology, clinical signs, and postmortem findings were highly suggestive of an epizootic of chlamydiosis. Serological tests for chlamydia, paramyxoviruses, avian influenza, adenovirus 127, mycoplasma, and Alcaligenes faecalis were conducted. The chlamydia tests were the only ones consistently positive. PMID:3985881

  5. Microbiological studies on petroleum and natural gas. I. Determination of hydrocarbon-utilizing bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Iizuka, H.; Komagata, K.

    1964-01-01

    Hydrocarbon-utilizing bacteria were isolated from oil-brine, soils etc. sampled in oil fields in Japan during 1956, and the following species were identified: Corynebacterium hydrocarboclastus nov. sp., 11 strains; Pseudomonas nitroreducens nov. sp., 1 strain; Pseudomonas maltophila Hugh and Ryschenkow, 5 strains: Brevibacterium lipolyticum (Huss) Breed, 2 strains; Pseudomonas desmolytica Gray and Thornton, 5 strains; Flavobacterium ferrugineum Sickles and Shaw, 1 strain; and Alcaligenes faecalis Chastellani and Chalmers, 1 strain. One difference between Gram-negative bacteria and Gram-positive bacteria was described on the basis of the ability of assimilating hydrocarbons.

  6. The intramolecular electron transfer between copper sites of nitrite reductase

    DEFF Research Database (Denmark)

    Farver, O; Eady, R R; Abraham, Z H;

    1998-01-01

    The intramolecular electron transfer (ET) between the type 1 Cu(I) and the type 2 Cu(II) sites of Alcaligenes xylosoxidans dissimilatory nitrite reductase (AxNiR) has been studied in order to compare it with the analogous process taking place in ascorbate oxidase (AO). This internal process is......(I) and the trinuclear copper centre in ascorbate oxidase, and the characteristics of the internal ET processes of these enzymes are compared. The data are consistent with the faster ET observed in nitrite reductase arising from a more advantageous entropy of activation when compared with ascorbate...

  7. Market fish hygiene in Kenya.

    OpenAIRE

    Binta, G. M.; Tjaberg, T. B.; Nyaga, P. N.; Valland, M.

    1982-01-01

    Vibrio parahaemolyticus was isolated from 53 out of 584 samples (9.1%) of market fish. All strains were Kanagawa negative and were distributed as follows: sea fish 5 out of 370 samples (1.4%), shellfish 48 out of 214 samles (22.4%). Other fish spoilage microflora recovered were: Alcaligenes faecalis, Pseudomonas aeruginosa, Proteus vulgaris, Aeromonas spp. and Vibrio alginolyticus. Total aerobic counts and coliform counts per gram for the lake fish ranged from 2.6 X 10(2) to 6.6 X 10(7) and 1...

  8. The microbial ecology of processing equipment in different fish industries-analysis of the microflora during processing and following cleaning and disinfection.

    Science.gov (United States)

    Bagge-Ravn, Dorthe; Ng, Yin; Hjelm, Mette; Christiansen, Jesper N; Johansen, Charlotte; Gram, Lone

    2003-11-01

    The microflora adhering to the processing equipment during production and after cleaning and disinfecting procedures was identified in four different processing plants. A total of 1009 microorganisms was isolated from various-agar plates and identified. A stepwise procedure using simple phenotypic tests was used to identify the isolates and proved a fast way to group a large collection of microorganisms. Pseudomonas, Neisseriaceae, Enterobactericeae, Coryneform, Acinetobacter and lactic acid bacteria dominated the microflora of cold-smoked salmon plants, whereas the microflora in a plant processing semi-preserved herring consisted of Pseudomonas, Alcaligenes and Enterobactericeae. Psychrobacter, Staphylococcus and yeasts were found in a caviar processing plant. Overall, many microorganisms that are often isolated from fish were also isolated from the fish processing plants. However, some selection depending on processing parameters occurred, since halo- and osmo-tolerant organisms dominated in the caviar processing. After cleaning and disinfection, yeasts, Pseudomonas, Neisseriaceae and Alcaligenes remained in smokehouses, yeasts and Pseudomonas in the herring plant and Pseudomonas, Staphylococcus and yeasts in the caviar plant. The dominant adhering organisms after cleaning and disinfection were pseudomonads and yeasts independently of the microflora during processing. Knowledge of the adhering microflora is essential in the Good Hygienic Practises programme of food processing plants, as the development and design of improved cleaning and disinfecting procedures should target the microorganisms persisting and potentially contaminating the product. PMID:14527796

  9. Survival of added bacterial species and metabolism of toxic compounds in natural environments

    International Nuclear Information System (INIS)

    Bacteria able to degrade either 2,4-dichlorophenol (DCP) or phenanthrene (PHEN) were isolated from polluted freshwater environments. Two isolates able to degrade each compound were tested for mineralization with a sensitive 14C assay and for survival in lake water and sewage using a selective medium. One DCP isolate was identified as Alcaligenes paradoxus and the other as Alcaligenes sp. One PHEN isolate was identified as Pseudomonas fluorescens and the other as Pseudomonas sp. All four isolates survived and grew in sterile environments which indicated that starvation would not be a factor in survival of these strains. The number of organisms declined immediately in number in nonsterile lake water. However, they did survive or even grow in nonsterile sewage for a short period before declining in number. Biotic factors appeared to be influential for survival and mineralization of target compounds in many environments. The removal of protozoa, which prey on bacteria, improved survival of the added cells, but had no influence on the mineralization of 10 μg DCP/L. In comparison, degradation of 10 and 25 mg DCP/L stopped after a few days. Yeast nitrogen base appeared to overcome the lack of nutrient regeneration, a function attributed to protozoa. The additional nutrients increased toxicant mineralization, especially when seeded with appropriate species. Thus, protozoa may limit growth of added cells but appear to be needed for mineralization of higher concentrations of DCP

  10. Rhizosphere bacterial diversity and heavy metal accumulation in Nymphaea pubescens in aid of phytoremediation potential

    Directory of Open Access Journals (Sweden)

    RAISA KABEER

    2014-04-01

    Full Text Available The present work aims to characterize the bacterial diversity of the rhizosphere system of Nymphaea pubescens and the sediment system where it grows naturally. Heavy metal content in the sediment and Nymphea plant from the selected wetland system were also studied. Results of the current study showed that the concentration of copper, zinc and lead in the sediment ranged from 43 to 182 mg/Kg, from 331 to 1382 mg/Kg and from 121 to 1253 mg/Kg, respectively. Cadmium concentration in sediment samples was found to be zero and the order of abundance of heavy metals in the sediment samples was Zn>Pb>Cu>Cd. The abundance patterns of heavy metals in leaf, petiole and root were Cd>Cu>Pb>Zn. Microbial load in rhizosphere of Nymphea pubescens ranged from 93×102 to 69×103 and that of sediment was 62×102 to 125×103. Bacterial load in rhizosphere was higher than that of growing sediment. Four bacterial genera were identified from the rhizosphere of Nymphaea pubescens which include Acinetobacter, Alcaligens, Listeria and Staphylococcus. Acinetobacter, Alcaligens and Listeria are the three bacterial genera isolated from sediment samples. Copper resistance studies of the 14 bacterial isolates from rhizosphere and 7 strains from sediment samples revealed that most of them showed low resistance (<100 μg/ml and very few isolates showed high resistance of 400-500 μg/ml.

  11. Synthesis and Characterization of Bionic Nano-silicon-substituted Hydroxyapatite

    Directory of Open Access Journals (Sweden)

    ZHAI Qian-Qian, ZHAO Shi-Gui, WANG Xiao-Hai, LI Xiu-Zhi, LI Wen-Jie, ZHENG Ya-Sen

    2013-01-01

    Full Text Available To explore the synthesis condition of the bionic nano-silicon-substituted hydroxyapatite and the impact of the silicon content on its crystallization properties, hydroxyapatite of different silicon content were synthesized from Ca(NO32, (NH42HPO4 and Si(OCH2CH34(TEOS via an aqueous precipitation reaction. Fourier transform infrared spectroscopy (FTIR, X-ray fluorescence spectrum (XRF, X-ray diffraction (XRD and transmission electron microscopy (TEM were used for hydroxyapatite characterization. The results show that relative low temperature (40¡䧠is conducive to obtain pure bionic nano-silicon-substituted hydroxyapatite. Under this condition, SiO44- enters the lattice of hydroxyapatite and replaces part of PO43-. The more the content of silicon is, the lower the crystallinity is, the smaller the grain size is and the higher the lattice parameters a and c are.

  12. Isolation, characterization and development of bacteria in the Mine Gafsa for applications in bioremediation

    International Nuclear Information System (INIS)

    Today pollution represents an important environmental problem. Bacterial ability to bioremediate many types of pollutants in different matrixes (soil, water, and air) have been widely acknowledged. The goal of the present work is to isolate from contaminated soil of Gafsa, in Tunisia, bacterial strains to evaluate their potential for bioremediation. Soil from the mining area of Gafsa was collected. Initially, many bacterial strains were isolated in TGY agar (Tryptone/Glucose/Yeast extract agar) based on the presence of pigments. The primary bacterial selection was performed using heavy metals and the minimal inhibitory concentrations (MICs) of a metal-resistant bacterium, Cupriavidus metallidurans CH34. Isolated metal-resistant bacterium was checked for its potential to resistant to gamma radiation. Selected strain, Micrococcus luteus S7, was assessed for its bioremediation potential of matrixes artificially contaminated under laboratory conditions for its future use in developing a bio product for contaminated soil inoculation.

  13. Dicty_cDB: Contig-U09595-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-31 AL646052_2056( AL646052 |pid:none) Ralstonia solanacearum GMI1000 ... 139 3e-31 CP001114_554( CP001114 |pid:none...) Deinococcus deserti VCD115, comp... 139 4e-31 AM260479_1044( AM260479 |pid:none) Ralston...CU695239_278( CU695239 |pid:none) Ralstonia solanacearum strain Mo... 138 7e-31 CP000614_2300( CP000614 |pid:none... Frankia sp. CcI3, complete genome. 137 9e-31 CP000352_932( CP000352 |pid:none) Ralstonia metallidurans CH34... CP000570_2864( CP000570 |pid:none) Burkholderia pseudomallei 668 c... 99 5e-19 AJ223295_2( AJ223295 |pid:none) Ralston

  14. μ2-Iodido-bis{dimethyl[methylbis(quinolin-8-ylsilanyl-κ3N,Si,N′]platinum(IV} tetrakis(pentafluorophenylborate dichloromethane 0.66-solvate

    Directory of Open Access Journals (Sweden)

    Marcus I. Gibson

    2008-03-01

    Full Text Available The title complex, [Pt2(CH34(C19H15N2Si2I][B(C6F54]·0.66CH2Cl2, resulted from an attempt to synthesize a stable five-coordinate platinum species via ligand abstraction of a six-coordinate platinum precursor. However, dimerization occurred after ligand abstraction, thereby yielding the compound described in this study. The cation is a dinuclear PtIV organometallic complex, in which the metal centers are bridged by an I− anion. Both metal centers display a coordination geometry close to octahedral, including cis-arranged quinoline ligands connected by Si atoms, which form Pt—Si bonds, two cis-methyl groups, and the bridging I− anion. In the crystal structure, voids between cations and anions are partially filled with an average of 0.66 molecules of dichloromethane solvent.

  15. Dicty_cDB: Contig-U11992-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-37 AP009484_1599( AP009484 |pid:none) Macrococcus caseolyticus JCSC54... 159 2e-37 CP000083_269( CP000083 |pid:none) Colwelli...klnnlkqillr*ih*kmetlkntmkrmikyqgyh*hnyr*iks mv*kvqslrsyl*kghpilwqrk**nhyfpitgkrillnfesfyvyllfsfqn**i*vyl *ylki*li...:none) Ralstonia metallidurans CH34, co... 196 2e-48 CP000053_1057( CP000053 |pid:none) Rickettsia feli...652, comple... 214 4e-54 CP000524_458( CP000524 |pid:none) Bartonella bacilliform... c... 196 1e-48 CP000087_1092( CP000087 |pid:none) Rickettsia bellii RML369-C, com... 196 1e-48 CP000352_391( CP000352 |pid

  16. Assessment of uranium and selenium speciation in human and bacterial biological models to probe changes in their structural environment

    Energy Technology Data Exchange (ETDEWEB)

    Avoscan, L.; Milgram, S.; Untereiner, G.; Collins, R.; Khodja, H.; Carriere, M.; Gouget, B. [Lab. Pierre Sue, CEA-CNRS UMR 9956, CEA/Saclay, Gif-sur-Yvette (France); Coves, J. [Inst. de Biologie Structurale - J.-P. Ebel, Lab. des Proteines Membranaires, Grenoble (France); Hazemann, J.L. [Lab. de Geophysique Interne et Tectonopbysique, UMR CNRS/Univ. Joseph Fourier, Saint-Martin-D' Heres (France)

    2009-07-01

    This study illustrates the potential of physicochemical techniques to speciate uranium (U) and selenium (Se) in biological samples. Speciation, defined he0re as the study of structural environment, of both toxic elements, was characterized at several levels in biological media and directly in human cells or bacteria once the metal(loid)s were internalized. External speciation that is extracellular speciation in culture media was predicted by thermodynamic equilibrium computer modelling using the JChess software and validated by spectroscopic measurements (XANES and EXAFS). Internal speciation that is intracellular speciation in eukaryotic and prokaryotic cells was studied in vitro with a soil bacterium Cupriavidus metallidurans CH34 and ROS 17/2.8 osteoblasts, human cells responsible for bone formation. XANES, EXAFS, HPLC-ICP-MS and SDS-PAGE coupled to particle induced X-ray emission (PIXE) permitted the identification and quantification of complexes formed with organic or inorganic molecules and/or larger proteins. (orig.)

  17. Dicty_cDB: Contig-U06783-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available urans CH34, c... 60 7e-08 CU928162_2940( CU928162 |pid:none) Escherichia coli ED1a chromosom... 60 7e-08 EF6... eutropha H16 chromosom... 58 2e-07 AE014075_853( AE014075 |pid:none) Escherichia coli... ATP-dependent RNA helicase 16; ... 58 2e-07 CU928164_768( CU928164 |pid:none) Escherichia coli IAI39 chromo...erichia coli HS, complete ge... 58 2e-07 (A2QAX7) RecName: Full=ATP-dependent RNA helicas... complet... 57 5e-07 AF510054_1( AF510054 |pid:none) Schistocerca gregaria vasa-l

  18. Dicty_cDB: Contig-U15993-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne:ddv16b06, 3' ... 44 0.66 2 ( EY445445 ) CBAY7776.fwd CBAY Tubifex tubifex Embryos and juv... 42 0.66 2 ( ...EY438224 ) CBAY2365.rev CBAY Tubifex tubifex Embryos and juv... 42 0.68 2 ( EY452...DNA clone:ddc11g22, 3' ... 44 0.69 2 ( EY452587 ) CBAZ5999.rev CBAZ Tubifex tubifex Embryos and juv... 42 0....70 2 ( EY438225 ) CBAY2365.fwd CBAY Tubifex tubifex Embryos and juv... 42 0.70 2 ( CU469464 ) Candidatus Phy...toplasma mali strain AT complete ch... 34 0.70 16 ( EY440903 ) CBAY4437.rev CBAY Tubifex tubifex

  19. Chemical resistance of the gram-negative bacteria to different sanitizers in a water purification system

    Directory of Open Access Journals (Sweden)

    Penna Thereza CV

    2006-08-01

    Full Text Available Abstract Background Purified water for pharmaceutical purposes must be free of microbial contamination and pyrogens. Even with the additional sanitary and disinfecting treatments applied to the system (sequential operational stages, Pseudomonas aeruginosa, Pseudomonas fluorescens, Pseudomonas alcaligenes, Pseudomonas picketti, Flavobacterium aureum, Acinetobacter lowffi and Pseudomonas diminuta were isolated and identified from a thirteen-stage purification system. To evaluate the efficacy of the chemical agents used in the disinfecting process along with those used to adjust chemical characteristics of the system, over the identified bacteria, the kinetic parameter of killing time (D-value necessary to inactivate 90% of the initial bioburden (decimal reduction time was experimentally determined. Methods Pseudomonas aeruginosa, Pseudomonas fluorescens, Pseudomonas alcaligenes, Pseudomonas picketti, Flavobacterium aureum, Acinetobacter lowffi and Pseudomonas diminuta were called in house (wild bacteria. Pseudomonas diminuta ATCC 11568, Pseudomonas alcaligenes INCQS , Pseudomonas aeruginosa ATCC 15442, Pseudomonas fluorescens ATCC 3178, Pseudomonas picketti ATCC 5031, Bacillus subtilis ATCC 937 and Escherichia coli ATCC 25922 were used as 'standard' bacteria to evaluate resistance at 25°C against either 0.5% citric acid, 0.5% hydrochloric acid, 70% ethanol, 0.5% sodium bisulfite, 0.4% sodium hydroxide, 0.5% sodium hypochlorite, or a mixture of 2.2% hydrogen peroxide (H2O2 and 0.45% peracetic acid. Results The efficacy of the sanitizers varied with concentration and contact time to reduce decimal logarithmic (log10 population (n cycles. To kill 90% of the initial population (or one log10 cycle, the necessary time (D-value was for P. aeruginosa into: (i 0.5% citric acid, D = 3.8 min; (ii 0.5% hydrochloric acid, D = 6.9 min; (iii 70% ethanol, D = 9.7 min; (iv 0.5% sodium bisulfite, D = 5.3 min; (v 0.4% sodium hydroxide, D = 14.2 min; (vi 0.5% sodium

  20. High incidence of plant growth-stimulating bacteria associated with the rhizosphere of wheat grown on salinated soil in Uzbekistan.

    Science.gov (United States)

    Egamberdieva, Dilfuza; Kamilova, Faina; Validov, Shamil; Gafurova, Laziza; Kucharova, Zulfiya; Lugtenberg, Ben

    2008-01-01

    Soil salinization is increasing steadily in many parts of the world and causes major problems for plant productivity. Under these stress conditions, root-associated beneficial bacteria can help improve plant growth and nutrition. In this study, salt-tolerant bacteria from the rhizosphere of Uzbek wheat with potentially beneficial traits were isolated and characterized. Eight strains which initially positively affect the growth of wheat plants in vitro were investigated in detail. All eight strains are salt tolerant and have some of the following plant growth-beneficial properties: production of auxin, HCN, lipase or protease and wheat growth promotion. Using sequencing of part of the 16S rDNA, the eight new isolates were identified as Acinetobacter (two strains), Pseudomonas aeruginosa, Staphylococcus saprophyticus, Bacillus cereus, Enterobacter hormaechei, Pantoae agglomerans and Alcaligenes faecalis. All these strains are potential human pathogens. Possible reasons for why these bacteria present in the rhizosphere and establish there are discussed. PMID:18211262

  1. Comparison of sodium hypochlorite-based foam and peroxyacetic acid-based fog sanitizing procedures in a salmon smokehouse: Survival of the general microflora and Listeria monocytogenes

    DEFF Research Database (Denmark)

    Bagge, Dorthe; Gardshodn, K.; Gram, Lone;

    2003-01-01

    with sodium hypochlorite (routinely performed at the smokehouse). Two hundred twenty-three environmental samples were collected with sponges and swabs after each of the sanitization procedures, and 68 samples were collected during production. The total culturable aerobic plate count was determined for each...... sample, and a total of 288 bacterial strains were randomly isolated and tentatively identified to genus level by physiological and biochemical tests. The microflora was dominated by Neisseriaceae, Enterobacteriaceae, and lactic acid bacteria during production. Foam sanitization caused a change...... in the composition of the flora, with Pseudomonas spp. and Alcaligenes spp. being the dominant gram- negative bacteria and Kurthia spp. and Bacillus spp. being the surviving gram-positive bacteria. Bacteria were very sensitive to fog sanitization, and yeasts accounted for almost half of the surviving flora...

  2. Effect of various sources of organic carbon and high nitrite and nitrate concentrations on the selection of denitrifying bacteria. II. Continuous cultures in packed bed reactors.

    Science.gov (United States)

    Błaszczyk, M

    1983-01-01

    The effect of different organic compounds, nitrites and nitrates at the concentration of 1,000 mg N/l on the quantitative and strain-specific selection of denitrifying bacteria was determined in anaerobic packed bed reactors. Both the source of carbon and nitrogen form influenced strain specificity and the frequency of occurrence of denitrifying bacteria. The frequency of denitrifying bacteria within packed bed reactor ranged in different media from 11% (glucose and nitrates) to 100% (methanol and ethanol with nitrates). A single species selection was observed in the presence of nitrites within packed bed reactor: Pseudomonas aeruginosa in medium with acetate. Pseudomonas stutzeri in medium with ethanol, Pseudomonas mendocina in medium with methanol and Pseudomonas fluorescens in medium with glucose. When nitrates were present in packed bed reactor, the dominating bacteria were: P. stutzeri in medium with acetate, P. fluorescens in medium with ethanol, Paracoccus denitrificans in medium with methanol and Alcaligenes faecalis in medium with glucose. PMID:6194668

  3. Ab initio single and multideterminant methods used in the determination of reduction potentials and magnetic properties of Rieske ferredoxins

    Science.gov (United States)

    Powers, Nathan Lee

    2008-10-01

    The [Fe2S2]2+/[Fe2S 2]+ electronic structure of seven Rieske protein active sites (bovine mitochondrial cytochrome bc1 complex, spinach chloroplast cytochrome b6f complex, Rieske-type ferredoxin associated with biphenyl dioxygenase from Burkholderia cepacia, yeast cytochrome bcl complex from Saccharomyces cerevisiae, Rieske subunit of arsenite oxidase from Alcaligenes faecalis, respiratory-type Rieske protein from Thermus thermophilus, and Rieske protein II (soxF) from Sulfolobus acidocaldarius), which lie in a reduction potential range from -150 mV to 375 mV, have been studied by both single and multi-determinant quantum mechanical methods. Calculated reduction potentials and magnetic properties are found comparable to experimental values.

  4. The influence of bioaugmentation and biosurfactant addition on bioremediation efficiency of diesel-oil contaminated soil: feasibility during field studies.

    Science.gov (United States)

    Szulc, Alicja; Ambrożewicz, Damian; Sydow, Mateusz; Ławniczak, Łukasz; Piotrowska-Cyplik, Agnieszka; Marecik, Roman; Chrzanowski, Łukasz

    2014-01-01

    The study focused on assessing the influence of bioaugmentation and addition of rhamnolipids on diesel oil biodegradation efficiency during field studies. Initial laboratory studies (measurement of emitted CO2 and dehydrogenase activity) were carried out in order to select the consortium for bioaugmentation as well as to evaluate the most appropriate concentration of rhamnolipids. The selected consortium consisted of following bacterial taxa: Aeromonas hydrophila, Alcaligenes xylosoxidans, Gordonia sp., Pseudomonas fluorescens, Pseudomonas putida, Rhodococcus equi, Stenotrophomonas maltophilia, Xanthomonas sp. It was established that the application of rhamnolipids at 150 mg/kg of soil was most appropriate in terms of dehydrogenase activity. Based on the obtained results, four treatment methods were designed and tested during 365 days of field studies: I) natural attenuation; II) addition of rhamnolipids; III) bioaugmentation; IV) bioaugmentation and addition of rhamnolipids. It was observed that bioaugmentation contributed to the highest diesel oil biodegradation efficiency, whereas the addition of rhamnolipids did not notably influence the treatment process. PMID:24291585

  5. Identification and analysis of hydrogen uptake (HUP) genes of several associative nitrogen fixing bacteria with rice plant

    International Nuclear Information System (INIS)

    All of the tested species (strains) in this work can reduce TTC, suggesting that they contain hydrogen uptake hydrogenase. Hybridization with Rhizobium japonicum hup gene indicated that there was homology between restricted DNA and the probe for Alcaligenes faecalis A15, Enterobacter cloacae EnSs, Klebsiella planticola DWUL2 and Pseudomonas saccharophila. Negative results were obtained for E. cloacae E26 and K. oxytoca NG13. Hup genes of A. faecalis A15 were located on chromosomal DNA, however, it was located on the larger plasmid for E. cloacae EnSs. Nif gene and hup gene are located on the same replicon. Hup gene from different hup+ microorganisms was not homology inevitably

  6. [Computational fluid dynamics simulation of different impeller combinations in high viscosity fermentation and its application].

    Science.gov (United States)

    Dong, Shuhao; Zhu, Ping; Xu, Xiaoying; Li, Sha; Jiang, Yongxiang; Xu, Hong

    2015-07-01

    Agitator is one of the essential factors to realize high efficient fermentation for high aerobic and viscous microorganisms, and the influence of different impeller combination on the fermentation process is very important. Welan gum is a microbial exopolysaccharide produced by Alcaligenes sp. under high aerobic and high viscos conditions. Computational fluid dynamics (CFD) numerical simulation was used for analyzing the distribution of velocity, shear rate and gas holdup in the welan fermentation reactor under six different impeller combinations. The best three combinations of impellers were applied to the fermentation of welan. By analyzing the fermentation performance, the MB-4-6 combination had better effect on dissolved oxygen and velocity. The content of welan was increased by 13%. Furthermore, the viscosity of production were also increased. PMID:26647585

  7. Killer toxin from a novel killer yeast Pichia kudriavzevii RY55 with idiosyncratic antibacterial activity.

    Science.gov (United States)

    Bajaj, Bijender Kumar; Raina, Sandeepu; Singh, Satbir

    2013-08-01

    The killer phenomenon of yeast may have technological implications in many areas like beverage fermentation, food technology, biological control in agriculture, and in medicine. In the present study the killer phenomenon in Pichia kudriavzevii (P. kudriavzevii RY55) is being reported for the first time. The P. kudriavzevii RY55 toxin exhibited excellent antibacterial activity against several pathogens of human health significance such as Escherichia coli, Enterococcus faecalis, Klebsiella sp., Staphylococcus aureus, Pseudomonas aeruginosa and Pseudomonas alcaligenes. Killer toxin was purified to homogeneity by using ammonium sulphate precipitation and ion exchange chromatography and characterized for few properties. P. kudriavzevii RY55 killer toxin may be of vast significance in the development of novel antimicrobial chemotherapeutic agents, new bio-based safer candidates for food preservation and biocontrol, and starter cultures for fermentation industries. PMID:22961241

  8. Survey Microbiological Analyses of Freshly Laid and Stored Domestic Poultry Eggs in Selected Poultry Farms in Sari, Mazandaran State, Iran

    Directory of Open Access Journals (Sweden)

    Sh. Sepehr

    2012-01-01

    Full Text Available Freshly laid and stored domestic fowl eggs of 7, 14 and 21 days old, respectively were microbiologically analyzed for organisms on their shells in the chalazae, albumen and yolks. All the egg parts were analyzed by plating on nutrient, mcconkey and sabourands dextrose media, respectively. Nine bacterial isolates which include Salmonella sp., Escherichia coli, Staphylococcus aureus, Enterobacter sp., Bacillus subtilis, Alcaligene sp., Proteus vulgaris, Pseudomonas aeruginosa and Serratia marcescenes and five fungal genera namely; Aspergillus, Penicillium, Cladosporium, Monilia and Rhizopus were isolated and identified in all the samples. The bacterial load was in the range of 3.3x106-1.5x107 cfu mL-1 with the shell having the highest and the albumen the lowest load, respectively. Result showed presence of pathogenic microbes in the samples analyzed and it was concluded that domestic fowl eggs should not be consumed raw.

  9. Imipenem resistance in nonfermenters causing nosocomial urinary tract infections.

    Directory of Open Access Journals (Sweden)

    Taneja N

    2003-07-01

    Full Text Available Nonfermenting gram-negative bacilli (nonfermenters have emerged as important nosocomial pathogens causing opportunistic infections in immunocompromised hosts. These organisms show high level of resistance to b-lactam agents, fluoroquinolones and aminoglycosides. Imipenem is a carbapenem antibiotic, which can be very useful for treatment of infections caused by nonfermenters. Eighty-five nonfermenters causing nosocomial UTI were tested for MIC to imipenem by agar dilution method. Resistance to other antimicrobial agents was compared between imipenem sensitive (S and resistance (R groups. Overall 36.4% of nonfermenters were resistant to imipenem. Forty two percent of P. aeruginosa and 18.5% of Acinetobacter baumanii were imipenem resistant. Other nonfermenters showed variable resistance, resistance in Alcaligenes spp. being very high. More than 70% of the nonfermenters were resistant to ceftazidime, gentamicin and ciprofloxacin. Piperacillin and amikacin had the best in vitro susceptibility. No significant difference was found in the antibiotic susceptibility profile among imipenem sensitive (S or resistant (R strains.

  10. Microbial desulfurization of dibenzothiophene

    Energy Technology Data Exchange (ETDEWEB)

    van Afferden, M.; Schacht, S.; Beyer, M.; Klein, J.

    1988-01-01

    Concerning the sulfur removal from coal before combustion there is considerable interest in microbial methods as pyrite oxidation and elimination of organically bound sulfur from coal. Using organic sulfur compounds relevant for coal the mechanism of desulfurization was investigated. The authors isolated a defined mixed culture (FODO) able to utilize dibenzothiophene as sole sulfur source for growth, while benzoate was used as carbon source. The mixed culture FODO consists of an Alcaligenes denitrificans subspecies and a Brevibacterium species. Two metabolites of the degradation and dibenzothiophene-5-dioxide. The subsequent degradation of dibenzothiophene-5-dioxide used as sole sulfur source results in a release of sulfate ions into the medium. The results suggest a sulfur specific oxidative mechanism for removal of sulfur from dibenzothiophene.

  11. Identification and analysis of polyaromatic hydrocarbons (PAHs)--biodegrading bacterial strains from refinery soil of India.

    Science.gov (United States)

    Chaudhary, Priyanka; Sahay, Harmesh; Sharma, Richa; Pandey, Alok Kumar; Singh, Shashi Bala; Saxena, A K; Nain, Lata

    2015-06-01

    Polyaromatic hydrocarbons (PAHs) utilizing bacteria were isolated from soils of seven sites of Mathura refinery, India. Twenty-six bacterial strains with different morphotypes were isolated. These strains were acclimatized to utilize a mixture of four polycyclic aromatic hydrocarbons, i.e., anthracene, fluorene, phenanthrene, and pyrene, each at 50 mg/L concentration as sole carbon source. Out of total isolates, 15 potent isolates were subjected to 16S rDNA sequencing and identified as a member of diverse genera, i.e., Bacillus, Acinetobacter, Stenotrophomonas, Alcaligenes, Lysinibacillus, Brevibacterium, Serratia, and Streptomyces. Consortium of four promising isolates (Acinetobacter, Brevibacterium, Serratia, and Streptomyces) were also investigated for bioremediation of PAH mixture. This consortium was proved to be efficient PAH degrader resulting in 40-70 % degradation of PAH within 7 days. Results of this study indicated that these genera may play an active role in bioremediation of PAHs. PMID:26026847

  12. Effect of PGR producing bacterial strains isolated from vermisources on germination and growth of Vigna unguiculata (L. Walp.

    Directory of Open Access Journals (Sweden)

    Anandharaj Marimuthu

    2014-12-01

    Full Text Available Nineteen bacterial strains were isolated from vermisources andscreened for Indole-3-acetic acid (IAA production among themonly nine strains produce IAA and they were identified asStreptococcus spp., Micrococcus spp., Klebsiella spp., Bacillus spp., Enterobacter spp., Escherichia spp., Alcaligenes spp., Erwinia spp., and Pseudomonas spp. Among all other strains Bacillus sp. showed the higher IAA production hence selected for further molecular analysis and confirmed as Bacillus cereus. The B. cereus was grown in nutrient broth supplemented with different concentrations (1, 2, 3, 4 and 5mg/ml of tryptophan for seven days at pH 7 and at 37ºC. Crude IAA was used for in vitro phytostimulatory studies using Vigna unguiculata (L. Walp. The plant growth parameters were analyzed at different day intervals (5, 10 and 15 days. Supplementation of 5 ml crude IAA (2mg/ml of tryptophan dynamically enhances the plant growth parameters after 15 days.

  13. Antimicrobial activity of tissue and associated bacteria from benthic sea anemone Stichodactyla haddoni against microbial pathogens.

    Science.gov (United States)

    Williams, G Prakash; Babu, S; Ravikumar, S; Kathiresan, K; Prathap, S Arul; Chinnapparaj, S; Marian, M P; Alikhan, S Liakath

    2007-10-01

    Associated bacteria from Stichodactyla haddoni are found maximum in tentacle tissues than the body tissue. There are eight associated bacterial species viz., Alcaligenes sp, Corynebacterium sp, Aeromonas sp, Sporosarcina sp, Renibacterium sp, Camobacterium sp1, Camobacterium sp2 and Salinococcus sp were recorded. The culture extracts from the associated bacterial species showed sensitivity against human bacterial and fungalpathogens. However, the hexane tissue extract of sea anemone showed maximum sensitivity (24 mm dia.) against the fish bacterial pathogen Aeromonas hydrophila than the other chosen pathogens. Comparatively the tissue extracts showed promising antimicrobial sensitivity than the cell free extracts of associated bacteria, and hence, the tissue samples from the sea anemone Stichodactyla haddoni is recommended for further exploration of novel antimicrobial drugs than the associated bacteria. PMID:18405113

  14. Long-range intramolecular electron transfer in azurins

    DEFF Research Database (Denmark)

    Farver, O; Pecht, I

    1989-01-01

    The Cu(II) sites of azurins, the blue single copper proteins, isolated from Pseudomonas aeruginosa and Alcaligenes spp. (Iwasaki) are reduced by CO2- radicals, produced by pulse radiolysis, in two distinct reaction steps: (i) a fast bimolecular phase, at the rates (5.0 +/- 0.8) x 10(8) M-1.s-1 (P...... to -26 in these proteins is reduced to the RSSR- radical ion as evidenced by its characteristic absorption band centered at 410 nm. This radical ion decays in a unimolecular process with a rate identical to that of the slow Cu(II) reduction phase in the respective protein, thus clearly suggesting...... the reactive sites, their redox potential, and the nature of the separating medium. Thus, azurins with distinct structural and reactivity characteristics isolated from different bacteria or modified by site-directed mutagenesis can be used in comparing long-range electron transfer process between...

  15. Survey of Ability of Activated Sludge Isolated Bacteria in Removal of RB-B Dyestuff from Aqueous Medium

    Directory of Open Access Journals (Sweden)

    Z Javadi

    2011-01-01

    Full Text Available "n "n "nBackgrounds and Objectives: Reactive dyestuff has potential of toxicity, carcinogenesis and mutagenesis for mammals and aquatic organisms. The current physical and chemical methods such as adsorption, coagulation, precipitation, filtration and ... can been used for removing of dyestuff. Biological treatment which is effective and economic for decontamination of dyestuff wastewaters was preferred because of limitation and difficulty of physicochemical methods. In order to investigate the trend of pollution reduction of color compounds, ability of Remazol Black-B dyestuff removal from aqueous medium by bacterial consortium under anoxic conditions was studied."nMaterials and Methods: The mix culture of bacteria from textile industries activated sludge was enriched in luria broth medium containing RB-B dyestuff as a carbon source. Then biodegradation was assessed in 4 batch reactors. Microbial population of bacterial and decolorization quantities of samples were detected by MPN and UV-Vis spectrophotometer."nResults: Decolorization efficiency by the bacterial consortium was obtained more than 99% for 50 and 250 mg/L concentrations in 72 and 144 h (3 and 6 days respectively, while for the initial concentration of 500 mg/L was 98.1in 240 h (10 days of biodegradation period. Dyestuff reduction rate after completed removal was about 0.69, 1.74,2 mg/L/h for initial concentration of 50, 250, 500 mg/L respectively."nConclusion: Results showed that Alcaligenes denitrificans and Alcaligenes xylosoxidans bacteria"nwhich were isolated from activated sludge have good potential of RB-B dyestuff removal and this removal is depending on primary concentration of dye. Removal efficiency increased as primary concentration went up.

  16. Numerically dominant denitrifying bacteria from world soils.

    Science.gov (United States)

    Gamble, T N; Betlach, M R; Tiedje, J M

    1977-04-01

    Nineteen soils, three freshwater lake sediments, and oxidized poultry manure were examined to determine the dominant denitrifier populations. The samples, most shown or expected to support active denitrification, were from eight countries and included rice paddy, temperate agricultural, rain forest, organic, and waste-treated soils. Over 1,500 organisms that could grow anaerobically on nitrate agar were isolated. After purification, 146 denitrifiers were obtained, as verified by production of N(2) from NO(3) (-). These isolates were characterized by 52 properties appropriate for the Pseudomonas-Alcaligenes group. Numerical taxonomic procedures were used to group the isolates and compare them with nine known denitrifier species. The major group isolated was representative of Pseudonomas fluorescens biotype II. The second most prevalent group was representative of Alcaligenes. Other Pseudomonas species as well as members of the genus Flavobacterium, the latter previously not known to denitrify, also were identified. One-third of the isolates could not utilize glucose or other carbohydrates as sole carbon sources. Significantly, none of the numerically dominant denitrifiers we isolated resembled the most studied species: Pseudomonas denitrificans, Pseudomonas perfectomarinus, and Paracoccus denitrificans. Denitrification appears to be a property of a very diverse group of gram-negative, motile bacteria, as shown by the large number (22.6%) of ungrouped organisms. The diversity of denitrifiers from a given sample was usually high, with at least two groups present. Denitrifiers, nitrite accumulators, and organisms capable of anaerobic growth were present in the ratio of 0.20+/-0.23:0.81+/-0.23:1. There were few correlations between their numbers and the sample characteristics measured. However, the temperatures at which isolates could grow were significantly related to the temperatures of the environments from which they were isolated. Regression analysis revealed few

  17. Resistencia a metales pesados en bacterias aisladas de la bahía de Iquique Resistance to heavy metals in bacteria isolated from Iquique bay

    Directory of Open Access Journals (Sweden)

    R. Moraga

    2003-01-01

    Full Text Available Se estudió la resistencia a metales pesados en bacterias aisladas de la bahía de Iquique (20°10'S-70°08'W. Se seleccionaron 43 cepas, las cuales se cultivaron en agar PCA suplementado con CuSO4 (800 mg ml-1. Se determinaron las concentraciones mínimas inhibitorias de los siguientes metales pesados: Pb, As, Ni, Cu, Hg, Zn, Cr y Cd en las cepas que presentaron crecimiento en este medio. Además, se determinaron los patrones de resistencia a estos metales así como la susceptibilidad a diferentes antibióticos. Todas las cepas analizadas fueron bacterias Gram negativas no fermentadoras, principalmente de los géneros Pseudomonas y Alcaligenes. Se encontraron niveles variables de resistencia a los metales pesados. Se obtuvo evidencia de una relación entre la resistencia a los metales pesados y la resistencia a los antibióticos ensayadosResistance to heavy metals in bacteria isolated from Iquique bay (20°10'S-70°08'W was analyzed, selecting 43 strains for this study. Cultures were done in agar PCA enriched with CuSO4 (800 mg ml-1. The minimum inhibitory concentrations (MIC to the following heavy metals: Pb, As, Ni, Cu, Hg, Zn, Cr and Cd were determined by plate diffusion. The susceptibility to several antibiotics was also established. All the strains under study were Gram negative, non-fermentative bacteria, mainly of the genus Pseudomonas and some of the genus Alcaligenes. Levels of resistance to the heavy metals were variable in different strains. Evidence of a possible relationship between the resistance to the heavy metals and the resistance to antibiotics was obtained

  18. Crystal structures of tetramethylammonium (2,2′-bipyridinetetracyanidoferrate(III trihydrate and poly[[(2,2′-bipyridine-κ2N,N′di-μ2-cyanido-dicyanido(μ-ethylenediamine(ethylenediamine-κ2N,N′cadmium(IIiron(II] monohydrate

    Directory of Open Access Journals (Sweden)

    Songwuit Chanthee

    2016-05-01

    Full Text Available The crystal structures of the building block tetramethylammonium (2,2′-bipyridine-κ2N,N′tetracyanidoferrate(III trihydrate, [N(CH34][Fe(CN4(C10H8N2]·3H2O, (I, and a new two-dimensional cyanide-bridged bimetallic coordination polymer, poly[[(2,2′-bipyridine-κ2N,N′di-μ2-cyanido-dicyanido(μ-ethylenediamine-κ2N:N′(ethylenediamine-κ2N,N′cadmium(IIiron(II] monohydrate], [CdFe(CN4(C10H8N2(C2H8N22]·H2O, (II, are reported. In the crystal of (I, pairs of [Fe(2,2′-bipy(CN4]− units (2,2′-bipy is 2,2′-bipyridine are linked together through π–π stacking between the pyridyl rings of the 2,2′-bipy ligands to form a graphite-like structure parallel to the ab plane. The three independent water molecules are hydrogen-bonded alternately with each other, forming a ladder chain structure with R44(8 and R66(12 graph-set ring motifs, while the disordered [N(CH34]+ cations lie above and below the water chains, and the packing is stabilized by weak C—H...O hydrogen bonds. The water chains are further linked with adjacent sheets into a three-dimensional network via O—H...O hydrogen bonds involving the lattice water molecules and the N atoms of terminal cyanide groups of the [Fe(2,2′-bipy(CN4]− building blocks, forming an R44(12 ring motif. Compound (II features a two-dimensional {[Fe(2,2′-bipy(CN4Cd(en2]}n layer structure (en is ethylenediamine extending parallel to (010 and constructed from {[Fe(2,2′-bipy(CN4Cd(en]}n chains interlinked by bridging en ligands at the Cd atoms. Classical O—H...N and N—H...O hydrogen bonds involving the lattice water molecule and N atoms of terminal cyanide groups and the N—H groups of the en ligands are observed within the layers. The layers are further connected via π–π stacking interactions between adjacent pyridine rings of the 2,2′-bipy ligands, completing a three-dimensional supramolecular structure.

  19. Influence of geogenic factors on microbial communities in metallogenic Australian soils.

    Science.gov (United States)

    Reith, Frank; Brugger, Joel; Zammit, Carla M; Gregg, Adrienne L; Goldfarb, Katherine C; Andersen, Gary L; DeSantis, Todd Z; Piceno, Yvette M; Brodie, Eoin L; Lu, Zhenmei; He, Zhili; Zhou, Jizhong; Wakelin, Steven A

    2012-11-01

    Links between microbial community assemblages and geogenic factors were assessed in 187 soil samples collected from four metal-rich provinces across Australia. Field-fresh soils and soils incubated with soluble Au(III) complexes were analysed using three-domain multiplex-terminal restriction fragment length polymorphism, and phylogenetic (PhyloChip) and functional (GeoChip) microarrays. Geogenic factors of soils were determined using lithological-, geomorphological- and soil-mapping combined with analyses of 51 geochemical parameters. Microbial communities differed significantly between landforms, soil horizons, lithologies and also with the occurrence of underlying Au deposits. The strongest responses to these factors, and to amendment with soluble Au(III) complexes, was observed in bacterial communities. PhyloChip analyses revealed a greater abundance and diversity of Alphaproteobacteria (especially Sphingomonas spp.), and Firmicutes (Bacillus spp.) in Au-containing and Au(III)-amended soils. Analyses of potential function (GeoChip) revealed higher abundances of metal-resistance genes in metal-rich soils. For example, genes that hybridised with metal-resistance genes copA, chrA and czcA of a prevalent aurophillic bacterium, Cupriavidus metallidurans CH34, occurred only in auriferous soils. These data help establish key links between geogenic factors and the phylogeny and function within soil microbial communities. In particular, the landform, which is a crucial factor in determining soil geochemistry, strongly affected microbial community structures. PMID:22673626

  20. Interactions of the metal tolerant heterotrophic microorganisms and iron oxidizing autotrophic bacteria from sulphidic mine environment during bioleaching experiments.

    Science.gov (United States)

    Jeremic, Sanja; Beškoski, Vladimir P; Djokic, Lidija; Vasiljevic, Branka; Vrvić, Miroslav M; Avdalović, Jelena; Gojgić Cvijović, Gordana; Beškoski, Latinka Slavković; Nikodinovic-Runic, Jasmina

    2016-05-01

    Iron and sulfur oxidizing chemolithoautotrophic acidophilic bacteria, such as Acidithiobacillus species, hold the dominant role in mine environments characterized by low pH values and high concentrations of reduced sulfur and iron compounds, such as ores, rocks and acid drainage waters from mines. On the other hand, heterotrophic microorganisms, especially their biofilms, from these specific niches are receiving increased attention, but their potential eco-physiological roles have not been fully understood. Biofilms are considered a threat to human health, but biofilms also have beneficial properties as they are deployed in waste recycling and bioremediation systems. We have analyzed interactions of the metal tolerant heterotrophic microorganisms in biofilms with iron oxidizing autotrophic bacteria both from the sulphidic mine environment (copper mine Bor, Serbia). High tolerance to Cu(2+), Cd(2+) and Cr(6+) and the presence of genetic determinants for the respective metal tolerance and biofilm-forming ability was shown for indigenous heterotrophic bacteria that included strains of Staphylococcus and Rhodococcus. Two well characterized bacteria- Pseudomonas aeruginosa PAO1 (known biofilm former) and Cupriavidus metallidurans CH34 (known metal resistant representative) were also included in the study. The interaction and survivability of autotrophic iron oxidizing Acidithiobacillus bacteria and biofilms of heterotrophic bacteria during co-cultivation was revealed. Finally, the effect of heterotrophic biofilms on bioleaching process with indigenous iron oxidizing Acidithiobacillus species was shown not to be inhibitory under in vitro conditions. PMID:26942859

  1. Zinc-Induced Transposition of Insertion Sequence Elements Contributes to Increased Adaptability of Cupriavidus metallidurans

    Science.gov (United States)

    Vandecraen, Joachim; Monsieurs, Pieter; Mergeay, Max; Leys, Natalie; Aertsen, Abram; Van Houdt, Rob

    2016-01-01

    Bacteria can respond to adverse environments by increasing their genomic variability and subsequently facilitating adaptive evolution. To demonstrate this, the contribution of Insertion Sequence (IS) elements to the genetic adaptation of Cupriavidus metallidurans AE126 to toxic zinc concentrations was determined. This derivative of type strain CH34, devoid of its main zinc resistance determinant, is still able to increase its zinc resistance level. Specifically, upon plating on medium supplemented with a toxic zinc concentration, resistant variants arose in which a compromised cnrYX regulatory locus caused derepression of CnrH sigma factor activity and concomitant induction of the corresponding RND-driven cnrCBA efflux system. Late-occurring zinc resistant variants likely arose in response to the selective conditions, as they were enriched in cnrYX disruptions caused by specific IS elements whose transposase expression was found to be zinc-responsive. Interestingly, deletion of cnrH, and consequently the CnrH-dependent adaptation potential, still enabled adaptation by transposition of IS elements (ISRme5 and IS1086) that provided outward-directed promoters driving cnrCBAT transcription. Finally, adaptation to zinc by IS reshuffling can also enhance the adaptation to subsequent environmental challenges. Thus, transposition of IS elements can be induced by stress conditions and play a multifaceted, pivotal role in the adaptation to these and subsequent stress conditions. PMID:27047473

  2. 污水处理活性污泥微生物群落多样性研究%Microbial Population Diversity of Activated Sludge for Wastewater Treatment

    Institute of Scientific and Technical Information of China (English)

    金浩; 李柏林; 欧杰; 陈兰明

    2012-01-01

    为研究污水处理活性污泥微生物多样性,提取了活性污泥宏基因组DNA,并采用细菌通用引物27F和1492R扩增了上海污泥厂活性污泥细菌16S rDNA片段,构建了细菌16S rDNA克隆文库,并对该文库中的微生物群落进行了分析.共获得200条高质量序列并建立系统发育树,结果显示活性污泥主要的细菌类群为变形菌门(Proteobacteria)(91.9%)、厚壁菌门(Firmicures)(4.6%)、拟杆菌门(Bacteroidetes)(2%)、绿弯菌门(Chloroflexi)(0.5%)、硝化螺菌门(Nitrospirae)(1%).其中,明显的优势菌群为Alcaligenes feacalis(55%)、Pseudomonas aeruginosa(12.8%)和Stenotrophomonas(12.8%),优势菌的产酶能力在活性污泥中显示生态修复功能菌的作用.%In order to study the microbial diversity of activated sludge (AS) for wastewater treatment, the macro-ge-nomic DNA of the AS was extracted from a wastewater factory in Shanghai. The 16S rDNA of the AS bacteria was amplified using bacteria general primers 27F and 1492R to construct the bacterial 16S rDNA clone library, and analyzed the microbial population of the library. All together 200 bands of high quality sequences were obtained and established a phylogenetic tree. The results showed that the main bacterial population of the AS was the phyla of Proteobacteria (91.9% ) , Firmicutes (4.6% ) , Bacteroidetes (2% ) , Chloroflexi (0.5% ) , Nitrospirae (1% ). Among them Al-caligenes feacalis (55% ) , Pseudomonas aeruginosa ( 12. 8% ) , and Stenolrophomonas ( 12. 8% ) were noticeably dominant bacterial population, enzyme production capacity of the dominant bacteria showed the ecological restoration function in the AS.

  3. Microbiology of airway disease in a cohort of patients with Cystic Fibrosis

    Directory of Open Access Journals (Sweden)

    Carnovale Vincenzo

    2006-01-01

    Full Text Available Abstract Background Recent reports document an increasing incidence of new Gram-negative pathogens such as Stenotrophomonas maltophilia and Alcaligenes xylosoxidans isolated from patients with Cystic Fibrosis, along with an increase in common Gram-negative pathogens such as Pseudomonas aeruginosa and Burkholderia cepacia complex. Furthermore, the increase in multidrug-resistance of such organisms makes the therapeutic management of these patients more problematic. Therefore, careful isolation and identification, and accurate studies of susceptibility to antibiotics are critical for predicting the spread of strains, improving therapeutic measures and facilitating our understanding of the epidemiology of emerging pathogens. The first aim of this study was to determine the incidence and the prevalence of colonization by Gram-negative organisms isolated from respiratory samples of Cystic Fibrosis patients in the Regional Referral Cystic Fibrosis Centre of Naples; the second was to evaluate the spectrum of multidrug-resistance of these organisms. Methods Patients (n = 300 attending the Regional Cystic Fibrosis Unit were enrolled in this study over 3 years. Sputum was processed for microscopic tests and culture. An automated system, Phoenix (Becton Dickinson, Sparks, Maryland, USA, was used for phenotypic identification of all strains; the API 20 NE identification system (bioMérieux, Marcy l'Etoile, France was used when the identification with the Phoenix system was inaccurate. A PCR-RFLP method was used to characterize the organisms in the Burkholderia cepacia complex. A chemosusceptibility test on microbroth dilutions (Phoenix was used. Primary outcomes such as FEV1 were correlate with different pathogens. Results During the period of study, 40% of patients was infected by Pseudomonas aeruginosa, 7% by Burkholderia cepacia complex, 11% by Stenotrophomonas maltophilia and 7% by Alcaligenes xylosoxidans. Of the strains isolated, 460 were multidrug

  4. Far from superficial: microbial diversity associated with the skin and mucus of fish

    Science.gov (United States)

    Cipriano, Rocco C.; Dove, Alistair

    2011-01-01

    During horizontal or water-borne infection involving an obligate pathogen (e.g. – Aeromonas salmonicida, cause of furunculosis), the pathogen interacted with and influenced the microbial diversity of the dermal mucus of fish. Prior to infection, the prevalent bacterial flora cultured from juvenile Atlantic salmon (Salmo salar) included Pseudomonas fluorescens, Comomonas terrigenia, Acinetobacter sp., Moraxella sp., Pseudomonas dimunita, Alcaligenes denitrificans, Pseudomonas pseudoalcaligenes, and Pseudomonas alcaligenes, Serratia liquefaciens, Aeromonas hydrophila, other motile Aeromonas spp., and Corynebacterium aquaticum. After A. salmonicida was initially detected in this population as an external mucus infection, Acinetobacter sp., Moraxella sp., C. terrigenia, P. fluorescens, and P. dimunita, Staphylococcus sp., and A. hydrophila, were also present in appreciable numbers. Within several weeks, however, the A. salmonicida infection amplified and composed 78% of the total flora in the mucus. Only P. dimunita (4%). P. fluorescens (2%), and C. terrigenia (1%) were cultured at that time and more than a third of these fish showed evidence of a systemic A. salmonicida infection within their kidneys. Eight weeks after oral oxytetracycline treatments, A. salmonicida was no longer isolated from the mucus or kidneys of any fish and glucose inert or other oxidative microbes (e.g., P. fluorescens, C. terrigenia, Acinetobacter sp., Moraxella sp.) were beginning to repopulate the external surface of the salmon in increasing frequency. Still present and composing fairly large percentages of the total flora were A. hydrophila, as well as Enterobacter sp., and P. putrefaciens. A normal microbial diversity was re-established as the fish recovered. In another investigation, reduced biological diversity was noted in the dermal mucus among smallmouth bass that were sampled from the Jackson River (Covington, VA). In these fish, A. hydrophila and P. putrefaciens were the two

  5. Identification and characterization of a new gene from Variovorax paradoxus Iso1 encoding N-acyl-D-amino acid amidohydrolase responsible for D-amino acid production.

    Science.gov (United States)

    Lin, Pei-Hsun; Su, Shiun-Cheng; Tsai, Ying-Chieh; Lee, Chia-Yin

    2002-10-01

    An N-acyl-d-amino acid amidohydrolase (N-D-AAase) was identified in cell extracts of a strain, Iso1, isolated from an environment containing N-acetyl-d-methionine. The bacterium was classified as Variovorax paradoxus by phylogenetic analysis. The gene was cloned and sequenced. The gene consisted of a 1467-bp ORF encoding a polypeptide of 488 amino acids. The V. paradoxusN-D-AAase showed significant amino acid similarity to the N-acyl-d-amino acid amidohydrolases of the two eubacteria Alcaligenes xylosoxydans A-6 (44-56% identity), Alcaligenes facelis DA1 (54% identity) and the hyperthermophilic archaeon Pyrococcus abyssi (42% identity). After over-expression of the N-D-AAase protein in Escherichia coli, the enzyme was purified by multistep chromatography. The native molecular mass was 52.8 kDa, which agreed with the predicted molecular mass of 52 798 Da and the enzyme appeared to be a monomer protein by gel-filtration chromatography. A homogenous protein with a specific activity of 516 U.mg-1 was finally obtained. After peptide sequencing by LC/MS/MS, the results were in agreement with the deduced amino acid sequence of the N-D-AAase. The pI of the enzyme was 5.12 and it had an optimal pH and temperature of 7.5 and 50 degrees C, respectively. After 30 min heat treatment at 45 degrees C, between pH 6 and pH 8, 80% activity remained. The N-D-AAase had higher hydrolysing activity against N-acetyl-d-amino acid derivates containing d-methionine, d-leucine and d-alanine and against N-chloroacetyl-d-phenylalanine. Importantly, the enzyme does not act on the N-acetyl-l-amino acid derivatives. The enzyme was inhibited by chelating agents and certain metal ions, but was activated by 1 mm of Co2+ and Mg2+. Thus, the N-D-AAase from V. paradoxus can be considered a chiral specific and metal-dependent enzyme. PMID:12354118

  6. Isolation and characterization of bacteria from wasted ionic exchange resins kept at Area de Gestion Ezeiza belonging to RA-3 Reactor

    International Nuclear Information System (INIS)

    A spent ionic exchange resin kept at Area de Gannet's Ezeiza (Age), belonging to RA-3 Reactor, was treated with sterile water. Microorganisms suspended in the aqueous sample were isolated by several methods, broadening as much as possible cell recovery conditions. Bacteria were subject to purity controls and re-isolation when necessary. Characterization of the strains found in the sample included morphological, physiological and biochemical tests as well as stains. Being the spent resins volume reduction at Age the main purpose, a screening experiment is proposed based on bacteria capability to take carbon from the sediment present in the liquid sample. Recovered bacteria are at least the following: Method I: Bacillus cereus, Bacillus circulans, Bacillus sp., Pseudomonas pseudoalcaligenes, Pseudomonas acidovorans, Pseudomonas sp. Method II: Bacillus cereus, Pseudomonas alcaligenes, Flavimonas sp., Agrobacterium sp. Method III: Bacillus circulans, Bacillus sphaericus, Kocuria rosea, Kytococcus sedentarius, Pseudomonas acidovorans. Microorganisms present in the sample are characteristic of those having low microbiological-contamination levels. Way III is an isolation method whose design would lead to find bacteria having the desired properties in order to diminish the volume of RA-3 Reactor spent resins. (author)

  7. Bioaugmentation with a consortium of bacterial nitrophenol-degraders for remediation of soil contaminated with three nitrophenol isomers

    International Nuclear Information System (INIS)

    A consortium consisting of para-nitrophenol utilizer Pseudomonas sp. strain WBC-3, meta-nitrophenol utilizer Cupriavidus necator JMP134 and ortho-nitrophenol utilizer Alcaligenes sp. strain NyZ215 was inoculated into soil contaminated with three nitrophenol isomers for bioaugmentation. Accelerated removal of all nitrophenols was achieved in inoculated soils compared to un-inoculated soils, with complete removal of nitrophenols in inoculated soils occurring between 2 and 16 days. Real-time polymerase chain reaction (PCR) targeting nitrophenol-degradation functional genes indicated that the three strains survived and were stable over the course of the incubation period. The abundance of total indigenous bacteria (measured by 16S rRNA gene real-time PCR) was slightly negatively impacted by the nitrophenol contamination. Denaturing gradient gel electrophoresis profiles of total and group-specific indigenous community suggested a dynamic change in species richness occurred during the bioaugmentation process. Furthermore, Pareto–Lorenz curves and Community organization parameters indicated that the bioaugmentation process had little impact on species evenness within the microbial community. - Highlights: ► Nitrophenol isomers in contaminated soil were removed by a bacterial consortium. ► The inoculated three strains were stable by real-time PCR analysis. ► DGGE profiles suggested a dynamic change in indigenous species richness. ► The bioaugmentation had little impact on indigenous species evenness. - A soil contaminated with three nitrophenol isomers has been successfully bioremediated by inoculation with a bacterial consortium.

  8. Short-chain fatty acids production and microbial community in sludge alkaline fermentation: Long-term effect of temperature.

    Science.gov (United States)

    Yuan, Yue; Liu, Ye; Li, Baikun; Wang, Bo; Wang, Shuying; Peng, Yongzhen

    2016-07-01

    Sludge alkaline fermentation has been reported to achieve efficient short-chain fatty acids (SCFAs) production. Temperature played important role in further improved SCFAs production. Long-term SCFAs production from sludge alkaline fermentation was compared between mesotherm (30±2°C) and microtherm (15±2°C). The study of 90days showed that mesotherm led to 2.2-folds production of SCFAs as microtherm and enhanced the production of acetic acid as major component of SCFAs. Soluble protein and carbohydrate at mesotherm was 2.63-folds as that at microtherm due to higher activities of protease and α-glucosidase, guaranteeing efficient substrates to produce SCFAs. Illumina MiSeq sequencing revealed that microtherm increased the abundance of Corynebacterium, Alkaliflexus, Pseudomonas and Guggenheimella, capable of enhancing hydrolysis. Hydrolytic bacteria, i.e. Alcaligenes, Anaerolinea and Ottowia, were enriched at mesotherm. Meanwhile, acidogenic bacteria showed higher abundance at mesotherm than microtherm. Therefore, enrichment of functional bacteria and higher microbial activities resulted in the improved SCFAs at mesotherm. PMID:27060243

  9. Biodegradability of Chlorinated Anilines in Waters

    Institute of Scientific and Technical Information of China (English)

    CHAO WANG; GUAN-GHUA LU; YAN-JIE ZHOU

    2007-01-01

    Objective To identify the bacteria tolerating chlorinated anilines and to study the biodegradability of o-chloroaniline and its coexistent compounds. Methods Microbial community of complex bacteria was identified by plate culture observation techniques and Gram stain method. Bacterial growth inhibition test was used to determine the tolerance of complex bacteria to toxicant. Biodegradability of chlorinated anilines was determined using domesticated complex bacteria as an inoculum by shaking-flask test. Results The complex bacteria were identified, consisting of Xanthomonas, Bacillus alcaligenes,Acinetobacter, Pseudomonas, and Actinomycetaceae nocardia. The obtained complex bacteria were more tolerant to o-chloroaniline than mixture bacteria in natural river waters. The effects of exposure concentration and inoculum size on the biodegradability of o-chloroaniline were analyzed, and the biodegradation characteristics of single o-chloroaniline and 2,4-dichloroaniline were compared with the coexistent compounds. Conclusion The biodegradation rates can be improved by decreasing concentration of compounds and increasing inoculum size of complex bacteria. When o-chloroaniline coexists with aniline, the latter is biodegraded prior to the former, and as a consequence the metabolic efficiency of o-chloroaniline is improved with the increase of aniline concentration. Meanwhile, when o-chloroaniline coexists with 2,4-dichloroaniline, the metabolic efficiency of 2,4-dichloroaniline is markedly improved.

  10. Biodegradation of Complex Bacteria on Phenolic Derivatives in River Water

    Institute of Scientific and Technical Information of China (English)

    GUANG-HUA LU; CHAO WANG; ZHE SUN

    2009-01-01

    Objective To isolate, incubate, and identify 4-chlorophenol-degrading complex bacteria, determine the tolerance of these bacteria to phenolic derivatives and study their synergetic metabolism as well as the aboriginal microbes and co-metabolic degradation of mixed chlorophenols in river water. Methods Microbial community of complex bacteria was identified by plate culture observation techniques and Gram stain method. Bacterial growth inhibition test was used to determine the tolerance of complex bacteria to toxicants. Biodegradability of phenolic derivatives was determined by adding 4-chlorophenol-degrading bacteria in river water. Results The complex bacteria were identified as Mycopiana, Alcaligenes, Pseudvmonas, and Flavobacterium. The domesticated complex bacteria were more tolerant to phenolic derivatives than the aboriginal bacteria from Qinhuai River. The biodegradability of chlorophenols, dihydroxybenzenes and nitrophenols under various aquatic conditions was determined and compared. The complex bacteria exhibited a higher metabolic efficiency on chemicals than the aboriginal microbes, and the final removal rate of phenolic derivatives was increased at least by 55% when the complex bacteria were added into river water. The metabolic relationship between dominant mixed bacteria and river bacteria was studied. Conclusion The complex bacteria domesticated by 4-chlorophenol can grow and be metabolized to take other chlorophenols, dihydroxybenzenes and nitrophenols as the sole carbon and energy source. There is a synergetic metabolism of most compounds between the aboriginal microbes in river water and the domesticated complex bacteria. 4-chlorophenol-degrading bacteria can co-metabolize various chlorophenols in river water.

  11. Bacterial community in deep subseafloor sediments from the western Pacific "warm pool"

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The bacterial community in deep subseafloor sediments at a depth of 230 cm from the western Pacific "warm pool" is studied by construction of 16S rDNA clone library and PCR-RFLP (Restriction Fragment Length Polymorphism) analysis. The results indicate that the bacterial community in these sediments is mainly composed of five groups: α-Proteobacteria, β-Proteobacteria, CFB group (Cytophaga / Flexi-bacteria / Bacteroides), Acidobacteria and gram positive bacteria, with a few genera detected in each group. The most abundant bacteria group is α-Proteobacteria, and the next is β-Proteobacteria. The dominant species in α-and β-Proteobacteria are Sphingomonas paucimobilis and Pseudomonas alca-ligenes respectively. The CFB group is simply composed of members belonging to Flavobacterium. The gram positive bacteria are rich, and mainly consists of the genus Geobacillus. The analysis of bacterial community indicates that organic matter is still abundant in the subseafloor sediments at the depth of 230 cm in the western Pacific "warm pool" . These bacteria in this deep biosphere may play an impor-tant role in the nitrogen cycle of deep sea sediments at "warm pool" .

  12. Bacteriological quality of beef-contact surfaces, air microflora and wastewaters from major abattoirs located in Benin City, Southern Nigeria

    Directory of Open Access Journals (Sweden)

    Iyekhoetin Matthew Omoruyi * , Macdonald Daniel Wogu, Ehinomen Matilda Eraga

    2011-06-01

    Full Text Available The bacteriological quality of beef produced from most abattoir located in southern Nigeria has always been questionable. This work therefore investigated the bacteriological quality of abattoir facilities from both government and private owned abattoirs located in southern Nigeria. The results of our findings revealed that the total heterotrophic counts and total coliform counts exceeded the recommended standard for sanitary practices. Total heterotrophic counts from air flora ranged from 14.50 x 106to 42.50 x 106cfu. Beef-contact surface ranged from 26.50 x 106to 592.50 x 106cfu while total colony counts obtained from wastewaters from both government and private abattoirs ranged from 140.00 x 106to 1206.75 x 106cfu/ml. The total coliform counts also ranged from 14.25 x 103to 33.75 x 103for air flora and 76.00 x 103to 195.00 x 103cfu/ml for wastewaters. Eight bacterial isolates were consistently isolated during this study, and they included; Escherichia coli, Staphylococcus aureus, Staphylococcus sp., Citrobacter sp., Alcaligenes paradoxus, Klebsiella sp. and Enterococcus faecalis with varying percentage of frequency across the sampling points. The presence of indicator organisms as well as possible pathogens in this study is of special concern and stakeholders should be encouraged to review the processes involved in the establishment as well as operation of abattoir in southern Nigeria.

  13. Effects of associated bacteria on the pathogenicity and reproduction of the insect-parasitic nematode Rhabditis blumi (Nematoda: Rhabditida).

    Science.gov (United States)

    Park, Hae Woong; Kim, Yong Ook; Ha, Jae-Seok; Youn, Sung Hun; Kim, Hyeong Hwan; Bilgrami, Anwar L; Shin, Chul Soo

    2011-09-01

    Three bacteria, Alcaligenes faecalis , Flavobacterium sp., and Providencia vermicola , were isolated from dauer juveniles of Rhabditis blumi . The pathogenic effects of the bacteria against 4th instar larvae of Galleria mellonella were investigated. Providencia vermicola and Flavobacterium sp. showed 100% mortality at 48 h after haemocoelic injection, whereas A. faecalis showed less than 30% mortality. Dauer juveniles showed 100% mortality against G. mellonella larvae, whereas axenic juveniles, which do not harbor associated bacteria, exhibited little mortality. All of the associated bacteria were used as a food source for nematode growth, and nematode yield differed with bacterial species. Among the bacterial species, P. vermicola was most valued for nematode yield, showing the highest yield of 5.2 × 10(4) nematodes/mL in the plate. In bacterial cocultures using two of the three associated bacteria, one kind stimulated the other. The highest total bacterial yield of 12.6 g/L was obtained when the inoculum ratio of P. vermicola to A. faecalis was 10:1. In air-lift bioreactors, the nematode growth rate increased with an increasing level of dissolved oxygen. The maximum nematode yield of 1.75 × 10(5) nematodes/mL was obtained at 192 h with an aeration rate of 6 vvm. PMID:21867444

  14. Microbial production of poly-D-3-hydroxybutyrate from CO2.

    Science.gov (United States)

    Ishizaki, A; Tanaka, K; Taga, N

    2001-10-01

    This short review covers the biotechnological aspects of the production of poly-D-3-hydroxybutyric acid, P(3HB), from H2, O2 and CO2 by autotrophic culture of the hydrogen-oxidizing bacterium, Ralstonia eutropha. Considering the efficiency of utilization of a gas mixture as substrate, a practical fermentation process using R. eutropha for the mass production of P(3HB) from CO2 should be designed on the basis of a recycled-gas, closed-circuit culture system. Also, maintaining the O2 concentration in a gas phase lower than 6.9% (v/v) is essential to prevent the gas mixture from exploding. Our study, using an explosion-proof fermentation bench plant and a two-stage culture system with a newly designed air-lift fermenter, demonstrated that very high P(3HB) yield and productivity could be obtained while the O2 concentration was maintained below 6.9%. However, a study on the continuous production of P(3HB) from CO2 by chemostat culture of R. eutropha revealed that the productivity and content of P(3HB) in the cells was considerably lower than by fed-batch culture. It is deduced that the use of the hydrogen-oxidizing bacterium, Alcaligenes latus, which accumulates P(3HB) even in the exponential growth phase, will be useful for the effective production of P(3HB) from CO2. PMID:11693935

  15. Pyruvic Oxime Nitrification and Copper and Nickel Resistance by a Cupriavidus pauculus, an Active Heterotrophic Nitrifier-Denitrifier

    Directory of Open Access Journals (Sweden)

    Miguel Ramirez

    2014-01-01

    Full Text Available Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2 and nitrous oxide (N2O while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3–C(NOH–COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a genus (Cupriavidus known for its resistance to metals and its metabolism of xenobiotics. The microbe (a Cupriavidus pauculus designated as C. pauculus strain UM1 was examined for its ability to perform heterotrophic nitrification in the presence of Cu2+ and Ni2+ and to metabolize the xenobiotic phenol. The bacterium heterotrophically nitrified well when either 1 mM Cu2+ or 0.5 mM Ni2+ was present in either enriched or minimal medium. The organism also used phenol as a sole carbon source in either the presence or absence of 1 mM Cu2+ or 0.5 mM Ni2+. The ability of this isolate to perform a number of different metabolisms, its noteworthy resistance to copper and nickel, and its potential use as a bioremediation agent are discussed.

  16. Polymicrobial Infection of the Cornea Due to Contact Lens Wear

    Directory of Open Access Journals (Sweden)

    Selçuk Sızmaz

    2016-04-01

    Full Text Available A 38-year-old male presented with pain and redness in his left eye. He had a history of wearing contact lenses. His ophthalmic examination revealed a large corneal ulcer with surrounding infiltrate. Cultures were isolated from the contact lenses, lens solutions, storage cases, and conjunctivae of both eyes and also corneal scrapings of the left eye. Fortified vancomycin and amikacin drops were started hourly. Culture results of conjunctivae of each eye and left cornea were positive for Pseudomonas aeruginosa; cultures from the contact lenses, lens solution and storage case of both eyes revealed Pseudomonas aeruginosa and Alcaligenes xylosoxidans. Polymerase chain reaction of the corneal scraping was positive for Acanthameoba. The topical antibiotics were changed with ones that both bacteria were sensitive to and anti-amoebic therapy was added. The patient had two recurrences following initial presentation despite intensive therapy. Keratitis occurred due to multiple pathogens; the relapsing course despite adequate therapy is potentially associated with this polymicrobial etiology.

  17. Proteasas extracelulares producidas por bacterias marinas aisladas de aguas contaminadas con efluentes pesqueros

    Directory of Open Access Journals (Sweden)

    Tito Sánchez

    2013-06-01

    Full Text Available Un total de 26 cepas de bacterias marinas con actividad proteolítica fueron aisladas de agua de mar contaminadas con efluentes pesqueros; las mismas que se evaluaron en base al crecimiento y formación de halos de actividad en Agar Marino suplementados con caseína al 1%, pH 8,0 e incubados a 25 ºC por 72 h. Cinco cepas, seleccionadas por presentar los mejores halos de actividad fueron evaluadas a su vez por su crecimiento y producción de proteasas a diferentes concentraciones de NaCl, rangos de temperatura y pH; siendo consideradas finalmente como bacterias halotolerantes, psicrotróficas y alcalófilas moderadas. Estas cepas también fueron evaluadas por su actividad proteolítica específica sobre la caseína, siendo la cepa CM48 (Pseudomonas sp. la que presentó la mejor actividad específica (17,38 U/mg a las 72 horas, y seguidas por las cepas CM45 (Alcaligenes sp. (12,09 U/mg y tres cepas de Aeromonas sp. (CM43, CM44 y CM46 con valores de 12,02; 10,07 y 10,10 U/mg respectivamente.

  18. Survey of bacterial contamination of environment of swimming pools in Yazd city, in 2013

    Directory of Open Access Journals (Sweden)

    Hossein Jafari Mansoorian

    2015-09-01

    Full Text Available Background: Infections are readily transmitted as a result of bacterial contamination of swimming pools. Therefore, hygiene and preventing the contamination of swimming pools is of particular importance. The objective of this study was to determine the amount of bacterial contamination in indoor pools of Yazd in 2013. Methods: In this descriptive and analytical study, all indoor swimming pools of Yazd (12 pools were evaluated during the spring and summer of 2013, in terms of bacterial contamination. In order to determine contamination, a sterile cotton swab was used for sampling. On average, 45 samples were taken from different surfaces in each pool (shower, dressing room, sitting places in sauna, platforms and around the pool. In total, about 540 samples from all pools were tested for bacterial contamination. Results: The results show that from 540 samples, bacterial contamination was observed in about 93 samples (17.22%; and was seen more in showers, edges of the pool and jacuzzis, and the slippers used in swimming pools. The most important isolated bacteria types were E. coli, Actinobacteria, Pseudomonas alcaligenes, Pseudomonas aeruginosa and Klebsiella pneumonia. Conclusion: The results indicate the presence of bacterial contamination on the surface of these places. It is recommended that health authorities should pay more attention to cleaning and disinfecting surfaces around the pool, showers, dressing rooms etc, to prevent infectious disease transfer as a result of contact with contaminated swimming pool surfaces.

  19. Utilization of microbial community potential for removal of chlorpyrifos: a review.

    Science.gov (United States)

    Yadav, Maya; Shukla, Awadhesh Kumar; Srivastva, Navnita; Upadhyay, Siddh Nath; Dubey, Suresh Kumar

    2016-08-01

    Chlorpyrifos (CP) is the most commonly used pesticide in agricultural fields worldwide. Exposure to CP and its metabolites creates severe neuron-disorders in human beings. Improper handling and uncontrolled application of CP by farmers have lead to the contamination of surface and ground water bodies. Biodegradation offers an efficient and cost effective method for the removal of CP and other toxic organophosphorus pesticides from the contaminated environment. The degradation of CP by various microorganisms has been investigated by several researchers over the past few years. This review presents a critical summary of the recent published results on the biodegradation of CP. A diverse range of bacterial species such as Agrobacterium sp., Alcaligenes faecalis, Enterobacter sp. Arthrobacter sp. Bacillus pumilus, Pseudomonas sp. etc., fungal species like Trichoderma viridae, Aspergillus niger, Verticillium sp., Acremonium sp. Cladosporium cladosporiodes, etc. and certain algal species viz. Chlorella vulgaris, Spirulina platensis, Synechocystis sp., etc., have been shown to degrade CP. The efficacy of these communities for CP degradation in batch and continuous modes has also been discussed but more studies are required on continuous reactors. Also, the available published information on kinetics of biodegradation of CP along with the available results on molecular biological approaches are discussed in this work. PMID:25782532

  20. The missing link: Bordetella petrii is endowed with both the metabolic versatility of environmental bacteria and virulence traits of pathogenic Bordetellae

    Directory of Open Access Journals (Sweden)

    Schneiker-Bekel Susanne

    2008-09-01

    Full Text Available Abstract Background Bordetella petrii is the only environmental species hitherto found among the otherwise host-restricted and pathogenic members of the genus Bordetella. Phylogenetically, it connects the pathogenic Bordetellae and environmental bacteria of the genera Achromobacter and Alcaligenes, which are opportunistic pathogens. B. petrii strains have been isolated from very different environmental niches, including river sediment, polluted soil, marine sponges and a grass root. Recently, clinical isolates associated with bone degenerative disease or cystic fibrosis have also been described. Results In this manuscript we present the results of the analysis of the completely annotated genome sequence of the B. petrii strain DSMZ12804. B. petrii has a mosaic genome of 5,287,950 bp harboring numerous mobile genetic elements, including seven large genomic islands. Four of them are highly related to the clc element of Pseudomonas knackmussii B13, which encodes genes involved in the degradation of aromatics. Though being an environmental isolate, the sequenced B. petrii strain also encodes proteins related to virulence factors of the pathogenic Bordetellae, including the filamentous hemagglutinin, which is a major colonization factor of B. pertussis, and the master virulence regulator BvgAS. However, it lacks all known toxins of the pathogenic Bordetellae. Conclusion The genomic analysis suggests that B. petrii represents an evolutionary link between free-living environmental bacteria and the host-restricted obligate pathogenic Bordetellae. Its remarkable metabolic versatility may enable B. petrii to thrive in very different ecological niches.

  1. Hydrogen bonding of the dissociated histidine ligand is not required for formation of a proximal NO adduct in cytochrome c'.

    Science.gov (United States)

    Ghafoor, Dlzar D; Kekilli, Demet; Abdullah, Gaylany H; Dworkowski, Florian S N; Hassan, Hamid G; Wilson, Michael T; Strange, Richard W; Hough, Michael A

    2015-09-01

    Cytochromes c', that occur in methanotrophic, denitrifying and photosynthetic bacteria, form unusual proximal penta-coordinate NO complexes via a hexa-coordinate distal NO intermediate. Their NO binding properties are similar to those of the eukaryotic NO sensor, soluble guanylate cyclase, for which they provide a valuable structural model. Previous studies suggested that hydrogen bonding between the displaced proximal histidine (His120) ligand (following its dissociation from heme due to trans effects from the distally bound NO) and a conserved aspartate residue (Asp121) could play a key role in allowing proximal NO binding to occur. We have characterized three variants of Alcaligenes xylosoxidans cytochrome c' (AXCP) where Asp121 has been replaced by Ala, Ile and Gln, respectively. In all variants, hydrogen bonding between residue 121 and His120 is abolished yet 5-coordinate proximal NO species are still formed. Our data therefore demonstrate that the His120-Asp121 bond is not essential for proximal NO binding although it likely provides an energy minimum for the displaced His ligand. All variants have altered proximal pocket structure relative to native AXCP. PMID:26100643

  2. Comparison of aerobic denitrifying activity among three cultural species with various carbon sources.

    Science.gov (United States)

    Otani, Y; Hasegawa, K; Hanaki, K

    2004-01-01

    Abilities of three aerobic denitrifiers such as Alcaligenes faecalis, Microvirgula aerodenitrificans and Paracoccus pantotrophus were compared from the viewpoints of nitrate removal efficiency and organic matter utilization. First, the effect of carbon source was investigated. Although nitrate reduction was observed in all strains under aerobic conditions, a change of carbon source considerably affected the denitrification ability. In the case of P. pantotrophus, nitrate and nitrite were completely removed in three days under sodium acetate or leucine as a carbon source. In the case of A. faecalis, sufficient nitrate removal was observed only when sodium acetate or ethanol was added. P. pantotrophus and A. faecalis showed a higher ability of nitrate removal than that of M. aerodenitrificans. Therefore, P. pantotrophus was selected in order to investigate the effects of concentration and repetitive addition of carbon. Sodium acetate was used as a sole carbon source. Nitrate was not reduced when the carbon concentration was below 500 mgC/L. However, when carbon source was added repeatedly, nitrate was reduced under 100 mgC/L after the optical density of the bacterium reached above 1.0. This result indicated that a high enough level of bacterial density was necessary to express aerobic denitrification activity. PMID:15566182

  3. Adaptability of microbial inoculators and their contribution to degradation of mineral oil and PAHs

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Five dominant bacteria strains(Acetobacter sp., Alcaligenes sp., Micrococcus sp., Arthrobacter sp. and Bacillus sp.) and five fungi strains (Cephalosporium sp. I, Cephalosporium sp. Ⅱ, Aspergillus sp. Ⅰ, Aspergillus sp. Ⅱ and Fusarium sp.) isolated from petroleum-contaminated soil were used to assess the potential capability of mineral oil and PAH enhanced degradation separately and jointly using the batch liquid medium cultivation with diesel oil spiked at 1000 mg/L. The experiment was performed on a reciprocal shaker in the darkness at 25℃ to 30℃ for 100 d. The dynamic variation in the activity of microbial inoculators in each treatment and the degradation of the target pollutants during the period of experiment were monitored. Results showed a more rapid biodegradation of mineral oil and PAHs at the beginning of the experiment (about 20 d) by dominant bacteria, fungi and their mixture than that of the indigenous microorganisms, however, thereafter an opposite trend was exhibited that the removal ratio by indigenous microorganisms was superior to any other dominant treatments and the tendency lasted till the end of the experiment, indicating the limited competitive capability of dominant microorganisms to degrade the contaminants, and the natural selection of indigenous microorganisms for use in the removal of the contaminants. At the end of the experiment, the removal ratio of mineral oil ranged from 56.8 % to 79.2 % and PAHs ranged from 96.8 % to 99.1% in each treatment by microbial inoculators.

  4. Hessian fly-associated bacteria: transmission, essentiality, and composition.

    Directory of Open Access Journals (Sweden)

    Raman Bansal

    Full Text Available Plant-feeding insects have been recently found to use microbes to manipulate host plant physiology and morphology. Gall midges are one of the largest groups of insects that manipulate host plants extensively. Hessian fly (HF, Mayetiola destructor is an important pest of wheat and a model system for studying gall midges. To examine the role of bacteria in parasitism, a systematic analysis of bacteria associated with HF was performed for the first time. Diverse bacteria were found in different developmental HF stages. Fluorescent in situ hybridization detected a bacteriocyte-like structure in developing eggs. Bacterial DNA was also detected in eggs by PCR using primers targeted to different bacterial groups. These results indicated that HF hosted different types of bacteria that were maternally transmitted to the next generation. Eliminating bacteria from the insect with antibiotics resulted in high mortality of HF larvae, indicating that symbiotic bacteria are essential for the insect to survive on wheat seedlings. A preliminary survey identified various types of bacteria associated with different HF stages, including the genera Enterobacter, Pantoea, Stenotrophomonas, Pseudomonas, Bacillus, Ochrobactrum, Acinetobacter, Alcaligenes, Nitrosomonas, Arcanobacterium, Microbacterium, Paenibacillus, and Klebsiella. Similar bacteria were also found specifically in HF-infested susceptible wheat, suggesting that HF larvae had either transmitted bacteria into plant tissue or brought secondary infection of bacteria to the wheat host. The bacteria associated with wheat seedlings may play an essential role in the wheat-HF interaction.

  5. Polyphasic bacterial community analysis of an aerobic activated sludge removing phenols and thiocyanate from coke plant effluent

    Energy Technology Data Exchange (ETDEWEB)

    Felfoldi, T.; Szekely, A.J.; Goral, R.; Barkacs, K.; Scheirich, G.; Andras, J.; Racz, A.; Marialigeti, K. [Eotvos Lorand University, Budapest (Hungary). Dept. of Microbiology

    2010-05-15

    Biological purification processes are effective tools in the treatment of hazardous wastes such as toxic compounds produced in coal coking. In this study, the microbial community of a lab-scale activated sludge system treating coking effluent was assessed by cultivation-based (strain isolation and identification, biodegradation tests) and culture-independent techniques (sequence-aided T-RFLP, taxon-specific PCR). The results of the applied polyphasic approach showed a simple microbial community dominated by easily culturable heterotrophic bacteria. Comamonas badia was identified as the key microbe of the system, since it was the predominant member of the bacterial community, and its phenol degradation capacity was also proved. Metabolism of phenol, even at elevated concentrations (up to 1500 mg/L), was also presented for many other dominant (Pseudomonas, Rhodanobacter, Oligella) and minor (Alcaligenes, Castellaniella, Microbacterium) groups, while some activated sludge bacteria (Sphingomonas, Rhodopseudomonas) did not tolerate it even in lower concentrations (250 mg/L). In some cases, closely related strains showed different tolerance and degradation properties. Members of the genus Thiobacillus were detected in the activated sludge, and were supposedly responsible for the intensive thiocyanate biodegradation observed in the system. Additionally, some identified bacteria (e.g. C. badia and the Ottowia-related strains) might also have had a significant impact on the structure of the activated sludge due to their floc-forming abilities.

  6. Impact of fertilizer plant effluent on water quality

    International Nuclear Information System (INIS)

    The impact of National Fertilizer Company of Nigeria out fall effluent on the physico chemistry and bacteriology of Okrika creek was investigated during the sampling period from May to December, 1998. The National Fertilizer Company of Nigeria out fall effluent, the Okrika creek water and the lkpukulubie creek (control) water samples were collected. The physico-chemical parameters analyzed for all the samples included temperature, p H, total chloride, total dissolved solids, dissolved oxygen, conductivity, free ammonia, total phosphate, urea, zinc and iron, while the bacteriological determinations were total culturable aerobic heterotrophic bacteria count and identification of representative isolates. The Okrika creek recorded higher concentrations for all the physicochemical parameters and bacteria load than the control creek. The higher values of p H, Free NH3, urea, TDS and the conductivity of the National Fertilizer Company of Nigeria out fall effluent above the FEPA standards reflect the poor effluent quality generated by National Fertilizer Company of Nigeria. The bacteria species isolated from the samples include Aerococcus viridans, Alcaligenes faecalis, Bacillus cereus, Citrobacter freundii, Escherichia coli, Klebsiella pneumoniae, Proteus vulgaris, Pseudomonas aeruginosa, Serratia marcescens and Staphylococcus aureus. In general, the investigation revealed that there was an extremely adverse impact on the physico-chemical and bacteriological water quality characteristics of the Okrika creek as a result of the discharge of poor quality effluent from National Fertilizer Company of Nigeria operations

  7. Isolation, molecular and biochemical characterization of oil degrading bacteria from contaminated soil at an oil refinery

    International Nuclear Information System (INIS)

    Biodegradation using microorganisms is considered to be cost-effective and environmentally friendly treatment of oil-contaminated sites. Oil-biodegrading bacterial strains were isolated, identified and characterized from oil contaminated soil samples at oil refinery in Zarqa (Jordan). Thirty four bacterial isolates were grown on mineral salt media supplemented with crude oil, but 16 showed positive biodegradation of diesel. All the 34 bacterial isolates were characterized at the molecular and bio-chemical levels, and showed positive polymerase chain reaction (PCR) amplification product size of 1500 bp when 16s rDNA bacterial universal primers were used. Eighteen bacterial isolates showed positive PCR amplification product size of 150 bp specific for the genus Pseudomonas and 3 bacterial isolates showed positive amplification product size of 1500 bp specific for the genus Acinetobacter. Biochemical and physiological characterization performed on the 34 bacterial isolates revealed the presence of oil biodegrading bacterial genera and species of Pseudomonas Acidovorans, P. aeruginosa, P. vesicularis, Acinetobacter calcoaceticus, Ac. lowffii, Micro-ococcus luteus, M. varians, M. lylae, M. roseus, Alcaligenes denitrificians, Bacillus megaterium, Comamonas sp., Moralxella sp., Bordetella sp., P. putida, P. stutzeri and P. mallei. (au)

  8. ε-Caprolactam Utilization by Proteus sp. and Bordetella sp. Isolated From Solid Waste Dumpsites in Lagos State, Nigeria, First Report.

    Science.gov (United States)

    Sanuth, Hassan Adeyemi; Yadav, Amit; Fagade, Obasola Ezekiel; Shouche, Yogesh

    2013-06-01

    The ε-caprolactam is the monomer of the synthetic non-degradable nylon-6 and often found as nonreactive component of nylon-6 manufacturing waste effluent. Environmental consequences of its toxicity to natural habitats and humans pose a global public concern. Soil samples were collected from three designated solid waste dumpsites, namely, Abule-Egba, Olusosun and Isheri-Igando in Lagos State, Nigeria. Sixteen bacteria isolated from these samples were found to utilize the ε-caprolactam as a sole source of carbon and nitrogen at concentration of ≤20 g l(-1). The isolates were characterized using their 16S rRNA gene sequence and showed similarity with Pseudomonas sp., Proteus sp., Providencia sp., Corynebacterium sp., Lysinibacillus sp., Leucobacter sp., Alcaligenes sp. and Bordetella sp. Their optimal growth conditions were found to be at temperature range of 30 to 35 °C and pH range of 7.0-7.5. High Performance liquid chromatography analysis of the ε-caprolactam from supernatant of growth medium revealed that these isolates have potential to remove 31.6-95.7 % of ε-caprolactam. To the best of our knowledge, this study is first to report the ability of Proteus sp. and Bordetella sp. for ε-caprolactam utilization. PMID:24426112

  9. Sapindus saponins' impact on hydrocarbon biodegradation by bacteria strains after short- and long-term contact with pollutant.

    Science.gov (United States)

    Smułek, Wojciech; Zdarta, Agata; Łuczak, Marta; Krawczyk, Piotr; Jesionowski, Teofil; Kaczorek, Ewa

    2016-06-01

    The introduction of high toxicity petroleum contaminants to the natural environment causes damage to ecosystems and the aesthetics of the surroundings. Therefore it is critical to enhance microbial community performance to manage the degradation process. This paper analyses the effect of natural surfactants from the tree Sapindus mukorossi on biodegradation of hydrocarbons. Analysis of cell surface hydrophobicity and zeta potential confirmed effective modifications of the cell surface parameters essential for the bioavailability of contaminants to microorganisms. Interestingly, favorable differences were observed only for microorganisms from non-contaminated soil. There was also recorded an increase in diesel oil biodegradation to 41% for Sphingomonas sp. and 56% for Pseudomonas alcaligenes on addition of 100mgL(-1) of Sapindus saponins. The addition of natural surfactants has no significant impact on bacterial strains isolated from long-term contaminated soil. This research demonstrates that the addition of Sapindus extract could be a useful tool to improve the effectiveness of microbial degradation of hydrocarbon pollutants by environmental strains in recently contaminated. PMID:26954087

  10. Nitrogen fixation genetics and regulation in a Pseudomonas stutzeri strain associated with rice.

    Science.gov (United States)

    Desnoues, Nicole; Lin, Min; Guo, Xianwu; Ma, Luyan; Carreño-Lopez, Ricardo; Elmerich, Claudine

    2003-08-01

    The Pseudomonas stutzeri strain A1501 (formerly known as Alcaligenes faecalis) fixes nitrogen under microaerobic conditions in the free-living state and colonizes rice endophytically. The authors characterized a region in strain A1501, corresponding to most of the nif genes and the rnf genes, involved in electron transport to nitrogenase in Rhodobacter capsulatus. The region contained three groups of genes arranged in the same order as in Azotobacter vinelandii: (1) nifB fdx ORF3 nifQ ORF5 ORF6; (2) nifLA-rnfABCDGEF-nifY2/nafY; (3) ORF13 ORF12-nifHDK-nifTY ORF1 ORF2-nifEN. Unlike in A. vinelandii, where these genes are not contiguous on the chromosome, but broken into two regions of the genome, the genes characterized here in P. stutzeri are contiguous and present on a 30 kb region in the genome of this organism. Insertion mutagenesis confirmed that most of the nif and the rnf genes in A1501 were essential for nitrogen fixation. Using lacZ fusions it was found that nif and rnf gene expression was under the control of ntrBC, nifLA and rpoN and that the rnf gene products were involved in the regulation of the nitrogen fixation process. PMID:12904565

  11. Immobilization of cells for use as biocatalysts

    Energy Technology Data Exchange (ETDEWEB)

    Vojtisek, V.; Jirku, V.; Krumphanzl, V.; Culik, K.

    1983-07-21

    Bacterial cells and cells of higher organisms are immobilized on polymers, either as whole cells, cell fragments, or subcellular components. This immobilization is used for stabilization of their various enzymic activities, which are of commercial interest, e.g. for the enzymes themselves, for alkaloid production, for hormone transformations, or for various fermentations. Thus, Sedipur CL-930 was polymerized in the presence of glutaraldehyde and the polymer was incubated with Alcaligenes metalcaligenes cells for immobilization. The nonimmobilized cells contained an aspartate ammonia-lyase activity of 550 mumol L-aspartate converted/min/g, and the immobilized cells contained an activity of 420 or 500 mumol aspartate/min/g when the polymer used was made with 2 different ratios of Sedipur to glutaraldehyde. The immobilized cell product had the form of defined platelets (lamellae) with a diameter of 100-600 mum, depending on the Sedipur/glutaraldehyde ratio. In other procedures, cells were permeabilized with tensides and/or organic solvents after the immobilization. Other cells immobilized included yeast, fungi, and plant cells. The activities which were examined included glycolytic enzymes, penicillin acylase, L-asparagine amidohydrolase and production of alkaloids and phytosterols from Solanum aviculare.

  12. [Physicochemical and microbiological factors influencing the bioavailability of organic contaminants in subsoils]. Progress report, [July 1, 1992--June 30, 1993

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-31

    We report progress in elucidating the microbiological variables important in determining the relative success of bacteria in utilizing soil-sorbed contaminants. Two bacterial species, Pseudomonas putida (ATCC 17484) and an Alcaligenes sp. isolated from petroleum contaminated soil are known to differ markedly in their ability to utilize soil-sorbed napthalene based on a kinetic comparison of their capability of naphthalene mineralization in soil-containing and soil-free systems. The kinetic analysis led us to conclude that strain 17484 had direct access to naphthalene present in a labile sorbed state which promoted the rapid desorption of naphthalene from the non-labile phase. Conversely, both the rate and extent of naphthalene mineralization by strain NP-Alk suggested that this organism had access only to naphthalene in solution. Desorption was thus limited and the efficiency of total naphthalene removal from these soil slurries was poor. These conclusions were based on the average activities of cells in soil slurries without regard for the disposition of the organisms with respect to the sorbent. Since both organisms degrade naphthalene by apparently identical biochemical pathways, have similar enzyme kinetic properties, and are both motile, gram negative organisms, we undertook a series of investigations to gain a better understanding of what microbiological properties were important in bioavailability.

  13. [Physicochemical and microbiological factors influencing the bioavailability of organic contaminants in subsoils

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-31

    We report progress in elucidating the microbiological variables important in determining the relative success of bacteria in utilizing soil-sorbed contaminants. Two bacterial species, Pseudomonas putida (ATCC 17484) and an Alcaligenes sp. isolated from petroleum contaminated soil are known to differ markedly in their ability to utilize soil-sorbed napthalene based on a kinetic comparison of their capability of naphthalene mineralization in soil-containing and soil-free systems. The kinetic analysis led us to conclude that strain 17484 had direct access to naphthalene present in a labile sorbed state which promoted the rapid desorption of naphthalene from the non-labile phase. Conversely, both the rate and extent of naphthalene mineralization by strain NP-Alk suggested that this organism had access only to naphthalene in solution. Desorption was thus limited and the efficiency of total naphthalene removal from these soil slurries was poor. These conclusions were based on the average activities of cells in soil slurries without regard for the disposition of the organisms with respect to the sorbent. Since both organisms degrade naphthalene by apparently identical biochemical pathways, have similar enzyme kinetic properties, and are both motile, gram negative organisms, we undertook a series of investigations to gain a better understanding of what microbiological properties were important in bioavailability.

  14. Characterization and biodegradation of polycyclic aromatic hydrocarbons in radioactive wastewater

    International Nuclear Information System (INIS)

    Highlights: → Biodegradation of recalcitrant toxic organics under radioactive conditions. → Biodegradation of PAHs of varying size and complexity in mixed waste streams. → Validation of radiation-tolerance and performance of the isolated organisms. - Abstract: PAH degrading Pseudomonad and Alcaligenes species were isolated from landfill soil and mine drainage in South Africa. The isolated organisms were mildly radiation tolerant and were able to degrade PAHs in simulated nuclear wastewater. The radiation in the simulated wastewater, at 0.677 Bq/μL, was compatible to measured values in wastewater from a local radioisotope manufacturing facility, and was enough to inhibit metabolic activity of known PAH degraders from soil such as Pseudomonas putida GMP-1. The organic constituents in the original radioactive waste stream consisted of the full range of PAHs except fluoranthene. Among the observed PAHs in the nuclear wastewater from the radioisotope manufacturing facility, acenaphthene and chrysene predominated-measured at 25.1 and 14.2 mg/L, respectively. Up to sixteen U.S.EPA priority PAHs were detected at levels higher than allowable limits in drinking water. The biodegradation of the PAHs was limited by the solubility of the compounds. This contributed to the observed faster degradation rates in low molecular weight (LMW) compounds than in high molecular weight compounds.

  15. A reactor system combining reductive dechloirnation with cometabolic oxidation for complete degradation of tetrachloroentylene

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A laboratory sequential anaerobic-aerobic bioreactor system,which consisted of an anaerobic fixed film reactor and twoaerobic chemostats, was set up to degrade tetrachloroethylene (PCE)without accumulating highly toxic degradation intermediates. A soil(ca. 150 mg/liter) of PCE stoichiometrically intocis-1,2-dichloroethylene (cis-DCE), was attached to ceramic mediain the anaerobic fixed film reactor. A phenol degrading strain,Alcaligenes sp. R5, which can efficiently degrade cis-DCE byco-metabolic oxidation, was used as inoculum for the aerobicchemostats consisted of a transformation reactor and a growthreactor. The anaerobic fixed film bioreactor showed more than 99 %of PCE transformation into cis-DCE in the range of influent PCE48h. On the other hand, efficient degradation of the resultantcis-DCE by strain R5 in the following aerobic system could not beachieved due to oxygen limitation. However, 54% of the maximum(H2O2) was supplemented to the transformation reactor as anadditional oxygen source. Further studies are needed to achievemore efficient co-metabolic degradation of cis-DCE in the aerobic reactor.

  16. Multi-antibiotic resistant bacteria in frozen food (ready to cook food) of animal origin sold in Dhaka, Bangladesh

    Institute of Scientific and Technical Information of China (English)

    Fouzia Sultana; Kamrunnahar; Hafsa Afroz; Afroz Jahan; Md Fakruddin; Suvamoy Datta

    2014-01-01

    Objective: To investigate the bacterial load and antibiotic resistance pattern of bacterial isolates obtained from (ready to cook) frozen food samples of animal origin in Dhaka, Bangladesh. Methods: A total of 20 samples of frozen ready to cook food of animal origin were purchased from different separate grocery stores in Dhaka, Bangladesh. Bacteria were isolated and identified based on the basis of biochemical properties. Results: A total of 57 isolates has been isolated from 20 samples, of them 35.08% were Gram positive and 64.92% were Gram negative organisms. Highest percentages of isolated organisms were Staphylococcocus spp. (24.56%), Alcaligene spp. (17.54%), Klebshiella spp. (12.28%) and the lowest percentages of organisms were Enterococcus spp., Actinobacillus spp. and Proteus spp. Antibiogram results clearly showed that levofloxacin and imipenem were the most effective drug against the isolates. The less effective antibiotics were chloramphenicol and nalidixic acid and resistance was highest against ciprofloxacin. The most contaminated food was chicken nuggets. Conclusions: This type of frozen food contaminated with multi-antibiotic resistant microorganisms can be potential vehicles for transmitting food-borne diseases.

  17. Abilities and genes for PAH biodegradation of bacteria isolated from mangrove sediments from the central of Thailand.

    Science.gov (United States)

    Wongwongsee, Wanwasan; Chareanpat, Promchat; Pinyakong, Onruthai

    2013-09-15

    PAH-degrading bacteria, including Novosphingobium sp. PCY, Microbacterium sp. BPW, Ralstonia sp. BPH, Alcaligenes sp. SSK1B, and Achromobacter sp. SSK4, were isolated from mangrove sediments. These isolates degraded 50-76% of 100 mg/l phenanthrene within 2 weeks. Strains PCY and BPW also degraded pyrene at 98% and 71%, respectively. Furthermore, all of them probably produced biosurfactants in the presence of hydrocarbons. Interestingly, PCY has a versatility to degrade various PAHs. Molecular techniques and plasmid curing remarkably revealed the presence of the alpha subunit of pyrene dioxygenase gene (nidA), involving in its pyrene/phenanthrene degrading ability, located on megaplasmid of PCY which has never before been reported in sphingomonads. Moreover, genes encoding ferredoxin, reductase, extradiol dioxygenase (bphA3A4C) and exopolysaccharide biosynthetase, which may be involved in PAH degradation and biosurfactant production, were also found in PCY. Therefore, we conclude that these isolates, especially PCY, can be the candidates for use as inoculums in the bioremediation. PMID:23928000

  18. IDENTIFICATION AND BIOLOGICAL ACTIVITY OF POTENTIAL PROBIOTIC BACTERIA ISOLATED FROM POECILIA RETICULATA (GUPPY

    Directory of Open Access Journals (Sweden)

    Aparna Balakrishna

    2014-08-01

    Full Text Available Antagonistic activities against candidate indicator strains, adhesion to mucus and biofilm formation of potential probiotic strains isolated from Poecilia reticulata were evaluated. Four isolated strains (MBTU_PB1, MBTU_PB2, MBTU_PB3 and MBTU_PB4 showed moderate to strong antagonistic activities against the tested five indicator strains (Aeromonas hydrophila1739, Vibrio cholera 3906, Flavobacterium 2495, Acinetobacter 1271 and Alcaligenes 1424 and these isolates were further identified using biochemical tests and 16S rDNA gene sequence analysis. Except the whole cell product, the other three cellular components, namely, heat-killed whole cell product, intracellular product and extracellular product of all the four selected isolates were equally effective, as revealed by the zone of inhibitions to the tested indicator strains. The in vitro adhesion property or the ability of colonization is often considered as a selection criteria for probiotics. All the selected four strains had higher adhesion abilities than the indicator strains. Further, these four strains had the ability to form biofilms on polystyrene surfaces. The in vitro characterization of these four strains suggests possibility of using the isolates, as individual strain or in combination, for probiotic therapy in aquaculture.

  19. 中华鳖几种常见疾病病原的分离鉴定及药敏试验%Isolation,Identification and Drug Sensitivity of the Pathogens of Common Bac teritic Disease in Soft-shelled Turtle(Trionyx sinensis)

    Institute of Scientific and Technical Information of China (English)

    孙红祥; 舒妙安

    2002-01-01

    从患"穿孔病"、"腐皮病"、"溶血性腹水病"等濒死鳖的肝、心血和腹水中分离到20株细菌,其中温和气单胞菌(Aeromonas sobria)5株、豚鼠气单胞菌(A.caviae)3株、凡隆气单胞菌(A.veronii)2株、奇异变形杆菌(Proteus mirabilis)2株、产碱假单胞菌(Pseudomonas alcaligene)2株、无色杆菌(Achro sp.)3株、不动杆菌(Acinetobactersp.)2株、黄杆菌(Flavobacterium sp.)1株.人工感染试验证实,运动型气单胞菌的温和气单胞菌和豚鼠气单胞菌是其主要病原菌.药敏试验结果表明,分离菌株对新霉素、菌必治、丁胺卡那、庆大霉素、环丙沙星高度敏感.

  20. Assessment of Sanitation and Food Bacterial Identification in the Governor Official Canteen of Makassar City

    Directory of Open Access Journals (Sweden)

    Anwar Mallongi

    2016-08-01

    Full Text Available Food is one of the important parts to human health considering that diseases could be caused by food. Cases of foodborne illness (foodborne disease can be affected by processing, storage, and food serving that are not meet sanitary requirements. This research aimed to obtain an overview of the quality of food is based on the presence of bacteria and sanitary conditions in Canteen Office of the Governor of South Sulawesi Province. This type of research is descriptive observational. The population in this research is all the food that is in Canteen Office of the Governor of South Sulawesi province and obtained ten samples by using purposive sampling method. Data obtained from direct observation using observation sheet and results of laboratory tests on food samples taken from the Canteen Office of the Governor of South Sulawesi province. The data analysis was using descriptive analysis. The results showed that from ten food samples in Governor's Office Canteen, two samples are containing Escherichia coli bacteria, three food samples are containing Klebsiella sp bacteria, two samples are containing Proteus mirabilis bacteria, one sample is containing Proteus vulgaris bacteria, one sample is containing Enterobacter agglomerans, and one sample is containing Alcaligenes faecalis bacteria. Based on observational assessment for the sanitary conditions in the canteen Office of the Governor of South Sulawesi province in ten canteen, there are no qualified canteen which reach 70% of the total assessment.

  1. Bacterial Associations Across House Fly Life History: Evidence for Transstadial Carriage From Managed Manure.

    Science.gov (United States)

    Zurek, Klara; Nayduch, Dana

    2016-01-01

    House flies (Diptera: Muscidae; Musca domestica L.) associate with microbe-rich substrates throughout life history. Because larvae utilize bacteria as a food source, most taxa present in the larval substrate, e.g., manure, are digested or degraded. However, some species survive and are present as third-instar larvae begin pupation. During metamorphosis, many bacteria are again lost during histolysis of the larval gut and subsequent remodeling to produce the gut of the imago. It has been previously demonstrated that some bacterial species survive metamorphosis, being left behind in the puparium, present on the body surface, or in the gut of the emerged adult. We used a combined culture-molecular approach to identify viable microbes from managed manure residue and a wild population of house fly larvae, pupae, puparia, and adults to assess transstadial carriage. All larval (10/10), pupal (10/10), and puparial (10/10) cultures were positive for bacteria. Several bacterial species that were present in larvae also were present either in pupae or puparia. Four viable bacterial species were detectable in 6 of 10 imagoes reared from manure. Of note is the apparent transstadial carriage of Bacillus sonorensis, which has been associated with milk spoilage at dairies, and Alcaligenes faecalis, which can harbor numerous antibiotic resistance genes on farms. The potential of newly emerged flies to harbor and disseminate bacteria from managed manure on farms is an understudied risk that deserves further evaluation. PMID:26798138

  2. The cis-state of an azobenzene photoswitch is stabilized through specific interactions with a protein surface.

    Science.gov (United States)

    Korbus, Michael; Backé, Sarah; Meyer-Almes, Franz-Josef

    2015-03-01

    The photocontrol of protein function like enzyme activity has been the subject of many investigations to enable reversible and spatiotemporally defined cascading biochemical reactions without the need for separation in miniaturized and parallelized assay setups for academic and industrial applications. A photoswitchable amidohydrolase variant from Bordetella/Alcaligenes with the longest reported half-life (approximately 30 h) for the cis-state of the attached azobenzene group was chosen as a model system to dissect the underlying mechanism and molecular interactions that caused the enormous deceleration of the thermal cis-to-trans relaxation of the azobenzene photoswitch. A systematic site-directed mutagenesis study on the basis of molecular dynamics simulation data was employed to investigate enzyme and thermal cis-to-trans relaxation kinetics in dependence on selected amino acid substitution, which revealed a prominent histidine and a hydrophobic cluster as molecular determinants for the stabilization of the cis-isomer of the attached azobenzene moiety on the protein surface. The nature of the involved interactions consists of polar, hydrophobic, and possibly aromatic Π-Π contributions. The elucidated principles behind the stabilization of the cis-state of azobenzene derivatives on a protein surface can be exploited to design improved biologically inspired photoswitches. Moreover, the findings open the door to highly long-lived cis-states of azobenzene groups yielding improved bistable photoswitches that can be controlled by single light-pulses rather than continuous irradiation with UV light that causes potential photodamage to the employed biomolecules. PMID:25664524

  3. Kinetic modeling and half life study on bioremediation of crude oil dispersed by Corexit 9500

    International Nuclear Information System (INIS)

    Hydrocarbon pollution in marine ecosystems occurs mainly by accidental oil spills, deliberate discharge of ballast waters from oil tankers and bilge waste discharges; causing site pollution and serious adverse effects on aquatic environments as well as human health. A large number of petroleum hydrocarbons are biodegradable, thus bioremediation has become an important method for the restoration of oil polluted areas. In this research, a series of natural attenuation, crude oil (CO) and dispersed crude oil (DCO) bioremediation experiments of artificially crude oil contaminated seawater was carried out. Bacterial consortiums were identified as Acinetobacter, Alcaligenes, Bacillus, Pseudomonas and Vibrio. First order kinetics described the biodegradation of crude oil. Under abiotic conditions, oil removal was 19.9% while a maximum of 31.8% total petroleum hydrocarbons (TPH) removal was obtained in natural attenuation experiment. All DCO bioreactors demonstrated higher and faster removal than CO bioreactors. Half life times were 28, 32, 38 and 58 days for DCO and 31, 40, 50 and 75 days for CO with oil concentrations of 100, 500, 1000 and 2000 mg/L, respectively. The effectiveness of Corexit 9500 dispersant was monitored in the 45 day study; the results indicated that it improved the crude oil biodegradation rate.

  4. Modulation of the immune response of porcine neutrophils by different β-glucan preparations

    DEFF Research Database (Denmark)

    Juul-Madsen, Helle Risdahl; Norup, Liselotte Rothmann; Lærke, Helle Nygaard

    -vivo whole blood stimulation assay. Whole blood samples were either treated with curdlan, a linear β-(1 → 3)-D-glucan from the non-pathogenic Alcaligenes faecalis, lichenan, a mixed linked β-(1 → 3),(1 → 4)-D-glucan from Islandic moss (Cetraria islandica) or zymosan, prepared from yeast cell walls and being...... rich in branched β-(1 → 3),(1 → 6)-D-glucan. The blood cell were either stimulated alone or in combination with lipopolysaccharide (LPS) and compared with LPS-treated and untreated control samples. Preliminary results show that Zymosan, had a different effect than lichenan and curdlan, on the surface...... expression of Toll-like Receptor (TLR) 2 and 4, but not significantly on the signal regulatory protein SIRPα after a stimulation either alone or in combination with LPS. Thus, branching may appear to be important for the different effect, but an effect of impurities in the Zymosan preparation cannot be ruled...

  5. Changes in the community structure of free-living heterotrophic bacteria in the open tropical Pacific Ocean in response to microalgal lysate-derived dissolved organic matter.

    Science.gov (United States)

    Tada, Yuya; Suzuki, Koji

    2016-07-01

    Dissolved organic matter derived from phytoplankton (DOMP) can affect the bacterial biomass and community structure in aquatic ecosystems. Here, we examined the community response of free-living heterotrophic bacteria, with respect to cellular nucleic acid levels, to the DOMP lysates derived from three phytoplankton strains in the open tropical Pacific. The free amino acid (FAA) composition of each DOMP lysate differed among the microalgal strains. Terminal restriction fragment-length polymorphism analyses with 16S rRNA genes revealed that the community shifts of high nucleic acid (HNA) and low nucleic acid (LNA) bacteria varied significantly with the different DOMP lysate treatments. Furthermore, the FAA composition in DOMP lysates significantly affected the bacterial community shifts in HNA and LNA. Similarity percentage analysis using 16S rRNA gene deep-sequencing revealed that the DOMP lysates from the pelagophyte Pelagomonas calceolata caused relatively large community shifts with Alcaligenes predominating in the HNA fraction. In contrast, the DOMP lysate from the diatom Thalassiosira oceanica induced a community shift in the LNA fraction with a predominance of uncultured Actinobacteria Thus, the data indicate that the DOMP lysates from different microalgae constitute a primary factor altering the dominant bacterial groups in the open ocean. PMID:27162185

  6. Kinetic modeling and half life study on bioremediation of crude oil dispersed by Corexit 9500

    Energy Technology Data Exchange (ETDEWEB)

    Zahed, Mohammad Ali [School of Civil Engineering, Universiti Sains Malaysia, Engineering Campus, 14300 Nibong Tebal, Penang (Malaysia); Aziz, Hamidi Abdul, E-mail: cehamidi@eng.usm.my [School of Civil Engineering, Universiti Sains Malaysia, Engineering Campus, 14300 Nibong Tebal, Penang (Malaysia); Isa, Mohamed Hasnain [Civil Engineering Department, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia); Mohajeri, Leila; Mohajeri, Soraya [School of Civil Engineering, Universiti Sains Malaysia, Engineering Campus, 14300 Nibong Tebal, Penang (Malaysia); Kutty, Shamsul Rahman Mohamed [Civil Engineering Department, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia)

    2011-01-30

    Hydrocarbon pollution in marine ecosystems occurs mainly by accidental oil spills, deliberate discharge of ballast waters from oil tankers and bilge waste discharges; causing site pollution and serious adverse effects on aquatic environments as well as human health. A large number of petroleum hydrocarbons are biodegradable, thus bioremediation has become an important method for the restoration of oil polluted areas. In this research, a series of natural attenuation, crude oil (CO) and dispersed crude oil (DCO) bioremediation experiments of artificially crude oil contaminated seawater was carried out. Bacterial consortiums were identified as Acinetobacter, Alcaligenes, Bacillus, Pseudomonas and Vibrio. First order kinetics described the biodegradation of crude oil. Under abiotic conditions, oil removal was 19.9% while a maximum of 31.8% total petroleum hydrocarbons (TPH) removal was obtained in natural attenuation experiment. All DCO bioreactors demonstrated higher and faster removal than CO bioreactors. Half life times were 28, 32, 38 and 58 days for DCO and 31, 40, 50 and 75 days for CO with oil concentrations of 100, 500, 1000 and 2000 mg/L, respectively. The effectiveness of Corexit 9500 dispersant was monitored in the 45 day study; the results indicated that it improved the crude oil biodegradation rate.

  7. Vended foods in Lagos, Nigeria: A potential reservoir for the spread of emerging strains of drug resistant bacteria

    Directory of Open Access Journals (Sweden)

    Kabiru Olusegun Akinyem

    2013-04-01

    Full Text Available Background and Aims: Food is of paramount importance to the sustenance of human health, on that basis this study was initiated with a view to determining bacterial agents associated with the vended foods and to investigating antibacterial resistance of the isolates. Methods: Twelve food samples from vendors were randomly collected from ten locations within Lagos environs. The food samples were analyzed bacteriologically by standard methods. The isolates were identified and subjected to antimicrobial susceptibility testing using standard procedures. Results: The total plate counts of bacteria recorded was between 2.98 × 103 cfu/g in Jollofrice and 4.09 × 104 cfu/g in Salad. Seventy-six bacterial isolates made up of six genera; Escherichia coli, Salmonella Typhimurium, Alcaligenes spp., Klebsiella pneumoniae, Enterobacter spp., Serratia marcensens and Proteus spp. were identified. Most of the bacterial isolates were moderately sensitive to cotrimoxazole, nalidixic acid, amoxicillin and nitrofurantion except in S. Typhimurium with less than 50% susceptibility. Also over 60% of the pathogens isolated were inhibited by ceftazidime, cefpodoxime, and levofloxacin antibiotics and most strains of E. coli, S. Typhimurium and K. pneumoniae were resistant to ofloxacin, ciprofloxacin and ceftriazone. Conclusion: The study revealed gross contamination of various vended foods. It also indicated that vended foods are potential reservoir for the spread of emerging multiple drug resistant bacteria strains that pose threat to public health. There is a need for intensive surveillance to avoid possible outbreak of food- borne diseases resulting from consumption of contaminated vended foods.

  8. ISOLATION AND CHARACTERIZATION OF A LIPOLYTIC AND PHYTASE PRODUCING PROBIOTIC FOR POTENTIAL APPLICATION IN POULTRY FEED

    Directory of Open Access Journals (Sweden)

    K. RAZDAN

    2012-07-01

    Full Text Available In the current study a total of 35 bacterial isolates from 17 food and fecal samples were examined. Five among those were earmarked as putative probiotic candidates. All the selected isolates survived the low pH conditions of 2.0, and resisted the presence of bile salts (0.02-0.25% and NaCl (2-14 %, indicating their ability to survive in the gastrointestinal (GI tract conditions and hence making them suitable candidates for probiotic applications. The selected probiotic isolates showed considerable levels of hydrophobicity indicating their potential adhering properties with the gut epithelium. In addition the five selected probiotic candidates depicted substantial antagonistic action against potent pathogens like Bacillus subtilis, B. cereus, Escherichia coli, Pseudomonas aeruginosa, P. alcaligenes, Staphylococcus aureus and Streptococcus sp. The isolates CM-4 and KD-7 were most remarkable as they inhibited all the pathogens tested including S. aureus and Streptococcus sp. Extracellular enzymatic studies showed that all the five strains produced phytase whereas isolate CM-4 and KD-7 were the only lipase producers found. However no amylase protease activity was detected. Isolate CM-4 was found to be the best among all five as it showed all desirable probiotic features viz. bile salt, NaCl and pH tolerance, maximum hydrophobicity, antagonistic action against pathogens, phytase and lipase activity, therefore was identified by using 16S rDNA sequencing and MEGA BLAST.

  9. Characterization of Sea Water Microbes on Ujung Lemah Abang, Muria Peninsula

    International Nuclear Information System (INIS)

    Study of microbes in sea water has been performed at sampling location of Ujung Lemah Abang beach. The seawater sample position is 2 km from beach and 4.5 m in depth. The objective of this initial study is to characterize microbes Muria Sea at Ujung Lemah Abang beach of. Implementation of the study attended by microbiologically isolation method, elements analysis, and physico-chemical measurement of water samples and environment parameter such as pH. Identification results show that sulfate reducing bacteria species, Desulfobacter curvatus, is 8.1 x 104 cfu/m and pathogen bacteria, Alcaligenes faecalis, is ≤106 cfu/ml. The elements content of seawater samples are Ca, Mg, K, Na, Ci- , SO42- , HCO32- and Br-. The elements will threat to form scaling in the inner side of pipes and outer surface of metal components. The existing of sulphate reducing bacteria and relatively high concentration of sulphate in water supply to NPP should be anticipated. (author)

  10. Isolation and characterization of siderophore producing antagonistic rhizobacteria against Rhizoctonia solani.

    Science.gov (United States)

    Solanki, Manoj Kumar; Singh, Rajesh Kumar; Srivastava, Supriya; Kumar, Sudheer; Kashyap, Prem Lal; Srivastava, Alok K; Arora, Dilip K

    2014-06-01

    Plant protection through siderophore producing rhizobacteria (SPR) has emerged as a sustainable approach for crop health management. In present study, 220 bacteria isolated from tomato rhizosphere were screened for in vitro antagonistic activity against Rhizoctonia solani AG-4. Nine potent antagonistic strains viz., Alcaligenes sp. (MUN1, MB21, and MPF37), Enterobacter sp. (MPM1), Pseudomonas sp. (M10A and MB65), P. aeruginosa (MPF14 and MB123) and P. fluorescens (MPF47) were identified on the basis of physiological characters and 16S rDNA sequencing. These strains were able to produce hydrolytic enzymes, hydrogen cyanide, indole acetic acid, although, only few strains were able to solubilize phosphate. Two strains (MB123 and MPF47) showed significant disease reduction in glasshouse conditions were further evaluated under field conditions using three different application methods. Application of P. fluorescens (MPF47) in nursery as soil mix + seedling root treatments prior to transplantation resulted in significant disease reduction compared to control. Total chlorophyll and available iron were significantly higher in the MPF47 treated plants in contrast to infected control. In conclusion, siderophore producing bacteria MPF47 have strong biocontrol abilities and its application as soil mix + seedling root treatments provided strong shield to plant roots against R. solani and could be used for effective bio-management of pathogen. PMID:23686438

  11. Characterization of bacterial communities associated with Brassica napus L. growing on a Zn-contaminated soil and their effects on root growth.

    Science.gov (United States)

    Montalbán, Blanca; Croes, Sarah; Weyens, Nele; Lobo, M Carmen; Pérez-Sanz, Araceli; Vangronsveld, Jaco

    2016-10-01

    The interaction between plant growth-promoting bacteria (PGPB) and plants can enhance biomass production and metal tolerance of the host plants. This work aimed at isolating and characterizing the cultivable bacterial community associated with Brassica napus growing on a Zn-contaminated site, for selecting cultivable PGPB that might enhance biomass production and metal tolerance of energy crops. The effects of some of these bacterial strains on root growth of B. napus exposed to increasing Zn and Cd concentrations were assessed. A total of 426 morphologically different bacterial strains were isolated from the soil, the rhizosphere, and the roots and stems of B. napus. The diversity of the isolated bacterial populations was similar in rhizosphere and roots, but lower in soil and stem compartments. Burkoholderia, Alcaligenes, Agrococcus, Polaromonas, Stenotrophomonas, Serratia, Microbacterium, and Caulobacter were found as root endophytes exclusively. The inoculation of seeds with Pseudomonas sp. strains 228 and 256, and Serratia sp. strain 246 facilitated the root development of B. napus at 1,000 µM Zn. Arthrobacter sp. strain 222, Serratia sp. strain 246, and Pseudomonas sp. 228 and 262 increased the root length at 300 µM Cd. PMID:27159736

  12. Pathogens associated with bovine mastitis in dairy herds in the south region of Brazil

    Directory of Open Access Journals (Sweden)

    Marta Bañolas Jobim

    2010-02-01

    Full Text Available In this work, through microbiological examinations, the etiology of bovine mastitis in 628 milk samples coming from dairy farms from Paraná, Santa Catarina and Rio Grande do Sul along the year of 2007 were evaluated. Out of this total 1,382 microorganisms were isolated. By taking into account the total of isolations, the following microorganisms and their percentage, respectively were found: Staphylococcus spp. (30.53%, Escherichia coli (21.64%, Streptococcus bovis (17.08%, Streptococcus agalactiae (11.07%, Enterobacter spp. (7.53%, Pseudomonas spp. (4.12% and others (8.03%. The microorganisms grouped into the others are: Streptococcus spp., Proteus spp., gram negative rods, Shigella spp., Alcaligenes spp., Klebsiella spp., Edwarsiella spp., Citrobacter spp., Serratia spp., Salmonella spp. e Corynebacterium spp. The environmental pathogens predominated among the isolated microorganisms; 33.13% of the cultures presented more than three pathogens, suggesting contamination of the samples; in the mounts of November and December, there was an increase of the samples sent.

  13. Complex structure of a bacterial class 2 histone deacetylase homologue with a trifluoromethylketone inhibitor

    International Nuclear Information System (INIS)

    The crystal structure of HDAH FB188 in complex with a trifluoromethylketone at 2.2 Å resolution is reported and compared to a previously determined inhibitor complex. Histone deacetylases (HDACs) have emerged as attractive targets in anticancer drug development. To date, a number of HDAC inhibitors have been developed and most of them are hydroxamic acid derivatives, typified by suberoylanilide hydroxamic acid (SAHA). Not surprisingly, structural information that can greatly enhance the design of novel HDAC inhibitors is so far only available for hydroxamic acids in complex with HDAC or HDAC-like enzymes. Here, the first structure of an enzyme complex with a nonhydroxamate HDAC inhibitor is presented. The structure of the trifluoromethyl ketone inhibitor 9,9,9-trifluoro-8-oxo-N-phenylnonanamide in complex with bacterial FB188 HDAH (histone deacetylase-like amidohydrolase from Bordetella/Alcaligenes strain FB188) has been determined. HDAH reveals high sequential and functional homology to human class 2 HDACs and a high structural homology to human class 1 HDACs. Comparison with the structure of HDAH in complex with SAHA reveals that the two inhibitors superimpose well. However, significant differences in binding to the active site of HDAH were observed. In the presented structure the O atom of the trifluoromethyl ketone moiety is within binding distance of the Zn atom of the enzyme and the F atoms participate in interactions with the enzyme, thereby involving more amino acids in enzyme–inhibitor binding

  14. Risk/benefit evaluation of the use of triclosan in surgical suturing materials

    Directory of Open Access Journals (Sweden)

    Lippert, Hans

    2006-08-01

    Full Text Available Based on the current literature, a risk/benefit analysis of the antimicrobial impregnation of surgical sutures with triclosan is performed, focussing on efficacy and indication, risk of resistance development, toxicological characteristics, and environmental tolerance. From a toxicological point of view, there are no restrictions for triclosan-impregnated suturing materials. Environmental tolerance is also acceptable for this application area, because the amounts of triclosan involved pose no problems in terms of degradability. The use of surgical suturing material coated with triclosan is seen especially in contaminated wounds or where the risk of infection is high. In order to meet this requirement, the antimicrobial properties of triclosan are particularly emphasized.Both in vitro and in vivo, triclosan is highly effective against Staphylococcus spp., including MRSA, the pathogens most frequently involved in postoperative wound infections. Triclosan is not effective against Pseudomonas aeruginosa, Serratia marcescens and Alcaligenes spp., due to their intrinsic resistance against this agent.As long as the inducible resistance in vitro against triclosan is not clinically relevant, it does not speak against triclosan use in suturing material, especially because pure triclosan is applied only to a specific, limited area for a short time. However, because triclosan can induce in vitro the development of cross-resistances to antibiotics, the implementation of this agent must be exclusively limited to medically founded indications.

  15. Assessment of the bacterial contamination of hand air dryer in washrooms.

    Science.gov (United States)

    Alharbi, Sulaiman Ali; Salmen, Saleh Hussein; Chinnathambi, Arunachalam; Alharbi, Naiyf S; Zayed, M E; Al-Johny, Bassam O; Wainwright, Milton

    2016-03-01

    The present study was carried out, using standard techniques, to identify and count the bacterial contamination of hand air dryers, used in washrooms. Bacteria were isolated from the air flow, outlet nozzle of warm air dryers in fifteen air dryers used in these washrooms. Bacteria were found to be relatively numerous in the air flows. Bacterially contaminated air was found to be emitted whenever a warm air dryer was running, even when not being used for hand drying. Our investigation shows that Staphylococcus haemolyticus, Micrococcus luteus, Pseudomonas alcaligenes, Bacillus cereus and Brevundimonad diminuta/vesicularis were emitted from all of the dryers sampled, with 95% showing evidence of the presence of the potential pathogen S. haemolyticus. It is concluded that hot air dryers can deposit pathogenic bacteria onto the hands and body of users. Bacteria are distributed into the general environment whenever dryers are running and could be inhaled by users and none-users alike. The results provide an evidence base for the development and enhancement of hygienic hand drying practices. PMID:26981009

  16. Screening of anaerobic activities in sediments of an acidic environment: Tinto River.

    Science.gov (United States)

    Sánchez-Andrea, Irene; Rojas-Ojeda, Patricia; Amils, Ricardo; Sanz, José Luis

    2012-11-01

    The Tinto River (Huelva, Spain) is a natural acidic rock drainage environment produced by the bio-oxidation of metallic sulfides from the Iberian Pyritic Belt. A geomicrobiological model of the different microbial cycles operating in the sediments was recently developed through molecular biological methods, suggesting the presence of iron reducers, methanogens, nitrate reducers and hydrogen producers. In this study, we used a combination of molecular biological methods and targeted enrichment incubations to validate this model and prove the existence of those potential anaerobic activities in the acidic sediments of Tinto River. Methanogenic, sulfate-reducing, denitrifying and hydrogen-producing enrichments were all positive at pH between 5 and 7. Methanogenic enrichments revealed the presence of methanogenic archaea belonging to the genera Methanosarcina and Methanobrevibacter. Enrichments for sulfate-reducing microorganisms were dominated by Desulfotomaculum spp. Denitrifying enrichments showed a broad diversity of bacteria belonging to the genera Paenibacillus, Bacillus, Sedimentibacter, Lysinibacillus, Delftia, Alcaligenes, Clostridium and Desulfitobacterium. Hydrogen-producing enrichments were dominated by Clostridium spp. These enrichments confirm the presence of anaerobic activities in the acidic sediments of the Tinto River that are normally assumed to take place exclusively at neutral pH. PMID:22956355

  17. Bacterial community in deep subseafloor sediments from the western Pacific "warm pool"

    Institute of Scientific and Technical Information of China (English)

    ZHAO Jing; ZENG RunYing

    2008-01-01

    The bacterial community in deep subseafloor sediments at a depth of 230 cm from the western Pacific "warm pool" is studied by construction of 16S rDNA clone library and PCR-RFLP (Restriction Fragment Length Polymorphism) analysis. The results indicate that the bacterial community in these sediments is mainly composed of five groups: α-Proteobacteria, β-Proteobacteria, CFB group (Cytophaga / Flexibacteria / Bacteroides), Acidobacteria and gram positive bacteria, with a few genera detected in each group. The most abundant bacteria group is α-Proteobacteria, and the next is β-Proteobacteria. The dominant species in α-and β-Proteobacteria are Sphingomonas paucimobilis and Pseudomonas alcaligenes respectively. The CFB group is simply composed of members belonging to Flavobacterium. The gram positive bacteria are rich, and mainly consists of the genus Geobacillus. The analysis of bacterial community indicates that organic matter is still abundant in the subseafloor sediments at the depth of 230 cm in the western Pacific "warm pool". These bacteria in this deep biosphere may play an important role in the nitrogen cycle of deep sea sediments at "warm pool".

  18. Complex structure of a bacterial class 2 histone deacetylase homologue with a trifluoromethylketone inhibitor

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Tine Kragh [Abteilung für Molekulare Strukturbiologie, Institut für Mikrobiologie und Genetik and GZMB, Justus-von-Liebig Weg 11, 37077 Göttingen (Germany); Hildmann, Christian; Riester, Daniel; Wegener, Dennis; Schwienhorst, Andreas [Abteilung für Molekulare Genetik und Präparative Molekularbiologie, Institut für Mikrobiologie und Genetik, Grisebachstrasse 8, 37077 Göttingen (Germany); Ficner, Ralf, E-mail: rficner@gwdg.de [Abteilung für Molekulare Strukturbiologie, Institut für Mikrobiologie und Genetik and GZMB, Justus-von-Liebig Weg 11, 37077 Göttingen (Germany)

    2007-04-01

    The crystal structure of HDAH FB188 in complex with a trifluoromethylketone at 2.2 Å resolution is reported and compared to a previously determined inhibitor complex. Histone deacetylases (HDACs) have emerged as attractive targets in anticancer drug development. To date, a number of HDAC inhibitors have been developed and most of them are hydroxamic acid derivatives, typified by suberoylanilide hydroxamic acid (SAHA). Not surprisingly, structural information that can greatly enhance the design of novel HDAC inhibitors is so far only available for hydroxamic acids in complex with HDAC or HDAC-like enzymes. Here, the first structure of an enzyme complex with a nonhydroxamate HDAC inhibitor is presented. The structure of the trifluoromethyl ketone inhibitor 9,9,9-trifluoro-8-oxo-N-phenylnonanamide in complex with bacterial FB188 HDAH (histone deacetylase-like amidohydrolase from Bordetella/Alcaligenes strain FB188) has been determined. HDAH reveals high sequential and functional homology to human class 2 HDACs and a high structural homology to human class 1 HDACs. Comparison with the structure of HDAH in complex with SAHA reveals that the two inhibitors superimpose well. However, significant differences in binding to the active site of HDAH were observed. In the presented structure the O atom of the trifluoromethyl ketone moiety is within binding distance of the Zn atom of the enzyme and the F atoms participate in interactions with the enzyme, thereby involving more amino acids in enzyme–inhibitor binding.

  19. Tyrosinase Inhibitory Effect and Antioxidative Activities of Fermented and Ethanol Extracts of Rhodiola rosea and Lonicera japonica

    Directory of Open Access Journals (Sweden)

    Yuh-Shuen Chen

    2013-01-01

    Full Text Available This is the first study to investigate the biological activities of fermented extracts of Rhodiola rosea L. (Crassulaceae and Lonicera japonica Thunb. (Caprifoliaceae. Alcaligenes piechaudii CC-ESB2 fermented and ethanol extracts of Rhodiola rosea and Lonicera japonica were prepared and the antioxidative activities of different concentrations of samples were evaluated using in vitro antioxidative assays. Tyrosinase inhibition was determined by using the dopachrome method with L-DOPA as substrate. The results demonstrated that inhibitory effects (ED50 values on mushroom tyrosinase of fermented Rhodiola rosea, fermented Lonicera japonica, ethanol extract of Lonicera japonica, and ethanol extract of Rhodiola rosea were 0.78, 4.07, 6.93, and >10 mg/ml, respectively. The DPPH scavenging effects of fermented Rhodiola rosea (ED50 = 0.073 mg/ml and fermented Lonicera japonica (ED50 = 0.207 mg/ml were stronger than effects of their respective ethanol extracts. Furthermore, the scavenging effect increases with the presence of high content of total phenol. However, the superoxide scavenging effects of fermented Rhodiola rosea was less than effects of fermented Lonicera japonica. The results indicated that fermentation of Rhodiola rosea and Lonicera japonica can be considered as an effective biochemical process for application in food, drug, and cosmetics.

  20. Long-term Hg pollution-induced structural shifts of bacterial community in the terrestrial isopod (Porcellio scaber) gut

    Energy Technology Data Exchange (ETDEWEB)

    Lapanje, Ales, E-mail: ales@ifb.s [Institute of Physical Biology, Ljubljana (Slovenia); Zrimec, Alexis [Institute of Physical Biology, Ljubljana (Slovenia); Drobne, Damjana [Department of Biology, Biotechnical Faculty, University of Ljubljana, Ljubljana (Slovenia); Rupnik, Maja [Institute of Public Health Maribor, Maribor (Slovenia)

    2010-10-15

    In previous studies we detected lower species richness and lower Hg sensitivity of the bacteria present in egested guts of Porcellio scaber (Crustacea, Isopoda) from chronically Hg polluted than from unpolluted environment. Basis for such results were further investigated by sequencing of 16S rRNA genes of mercury-resistant (Hg{sup r}) isolates and clone libraries. We observed up to 385 times higher numbers of Hg{sup r} bacteria in guts of animals from polluted than from unpolluted environment. The majority of Hg{sup r} strains contained merA genes. Sequencing of 16S rRNA clones from egested guts of animals from Hg-polluted environments showed elevated number of bacteria from Pseudomonas, Listeria and Bacteroidetes relatives groups. In animals from pristine environment number of bacteria from Achromobacter relatives, Alcaligenes, Paracoccus, Ochrobactrum relatives, Rhizobium/Agrobacterium, Bacillus and Microbacterium groups were elevated. Such bacterial community shifts in guts of animals from Hg-polluted environment could significantly contribute to P. scaber Hg tolerance. - Chronic environmental mercury pollution induces bacterial community shifts and presence of elevated number as well as increased diversity of Hg-resistant bacteria in guts of isopods.

  1. Health risks associated with the presence of antibiotic resistant bacteria in greywater

    Directory of Open Access Journals (Sweden)

    Juan Moretton

    2012-04-01

    Full Text Available The removal and disposal of waste from domestic activities is a major health problem in densely populated urban areas. In many areas of Greater Buenos Aires, greywater is disposed in open ditches and risk potential of this has not been adequately quantified. The aim of this study was to evaluate the prevalence of antibiotic-resistant bacteria and its resistance profile present in raw greywater obtained from a channel located in the area of Ingeniero Budge Buenos Aires Province. Thus, the prevalence of heterotrophic bacteria, Gram-negative bacteria resistant to beta-lactam antibiotics and vancomycin-resistant enterococci in greywater, their typing, and resistance to other antibiotics were determined. The prevalence of resistant bacteria was determined by the agar dilution method. Of all the antibiotics tested, the highest prevalence of resistant heterotrophic bacteria was detected with cephalothin (19% and ampicillin (8%. With regard to Gram-negative bacteria, the highest prevalence of resistance was given by coliforms ampicillin (34% and cephalothin (17%. A total of 38% of enterococci with low level resistance to vancomycin was detected. The multiresistant isolates were identified as Escherichia coli, Alcaligenes faecalis y Stenotrophomonas maltophilia. These results indicate that greywater can be considered as a reservoir of bacteria resistant to antibiotics, thus increasing their health risk.

  2. The complete multipartite genome sequence of Cupriavidus necator JMP134, a versatile pollutant degrader.

    Directory of Open Access Journals (Sweden)

    Athanasios Lykidis

    Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.

  3. Study of the impact of environmental bacteria ob uranium speciation in order to engage bioremediation process

    International Nuclear Information System (INIS)

    Uranium is both a radiological and a chemical toxic. Its concentration in the environment is low except when human activities have caused pollution. Uranium is a heavy reactive element, and thus it is easily complexed with soil component like minerals or organic molecules. These different complexes can be more or less bioavailable for microorganisms and plants, and then get in the human food chain. The knowledge and the understanding of transfer mechanisms and also the fate of toxic elements in the biosphere are a key issue to estimate health and ecological hazards. The knowledge of the speciation is very important for bioremediation processes. Here, we focused on the microorganisms effects onto uranium speciation in environment. Bacteria can accumulate and/or transform uranium depending on the initial form of the element. Thus, its bioavailability could be changed. The species used in this work are Cupriavidus metallidurans CH34, which is an environmental bacteria with a high resistance to heavy metal, Deinococcus radiodurans R1, which is known for his radiological resistance, and Rhodopseudomonas palustris, which is a purple photo-trophic bacteria capable of degrading aromatic compounds. Two forms of uranium were used with these bacteria, a mineral one, uranyl carbonate, and an organic one, uranyl citrate. In a first step, the growth media were modified in order to stabilize uranium complexes thanks to a simulation program. Then, the capacity of the bacteria to accumulate or transform uranium was studied. We saw a difference between minimal inhibition concentrations of these two speciation which is due to a difference between phosphate bioavailability. No accumulation was observed with environmental pH but uranium precipitation was observed with acidic pH (pH 1). Uranium speciation seemed to be well controlled in the growth media and the precipitates were uranyl phosphate. (author)

  4. The biological chemistry of the transition metal "transportome" of Cupriavidus metallidurans.

    Science.gov (United States)

    Nies, Dietrich H

    2016-05-01

    This review tries to illuminate how the bacterium Cupriavidus metallidurans CH34 is able to allocate essential transition metal cations to their target proteins although these metals have similar charge-to-surface ratios and chemical features, exert toxic effects, compete with each other, and occur in the bacterial environment over a huge range of concentrations and speciations. Central to this ability is the "transportome", the totality of all interacting metal import and export systems, which, as an emergent feature, transforms the environmental metal content and speciation into the cellular metal mélange. In a kinetic flow equilibrium resulting from controlled uptake and efflux reactions, the periplasmic and cytoplasmic metal content is adjusted in a way that minimizes toxic effects. A central core function of the transportome is to shape the metal ion composition using high-rate and low-specificity reactions to avoid time and/or energy-requiring metal discrimination reactions. This core is augmented by metal-specific channels that may even deliver metals all the way from outside of the cell to the cytoplasm. This review begins with a description of the basic chemical features of transition metal cations and the biochemical consequences of these attributes, and which transition metals are available to C. metallidurans. It then illustrates how the environment influences the metal content and speciation, and how the transportome adjusts this metal content. It concludes with an outlook on the fate of metals in the cytoplasm. By generalization, insights coming from C. metallidurans shed light on multiple transition metal homoeostatic mechanisms in all kinds of bacteria including pathogenic species, where the "battle" for metals is an important part of the host-pathogen interaction. PMID:27065183

  5. Mechanisms of Nutrient Acquisition by Rock Eating Microbes Revealed by Proteomics

    Science.gov (United States)

    Bryce, C. C.; Martin, S.; LeBihan, T.; Cockell, C.

    2013-12-01

    In nutrient poor terrestrial environments such as fresh lava flows, bioessential elements contained within surrounding rocks can be an important source of nutrients for the microbial community. The role of microbes in the alteration of rock surfaces, driven by this nutrient requirement, is widely accepted and is known to play an important role in CO2 drawdown as well as influencing nutrient flux to the biosphere. There is, however, limited knowledge of the biological processes which facilitate the uptake of bioessential elements from rocks. Using a technique known as 'shotgun' proteomics we have investigated the cellular processes involved in the uptake of iron, calcium and magnesium from fresh basalt in the heavy metal resistant bacterium Cupriavidus metallidurans CH34. Quantitative proteomics allows us to obtain a detailed snapshot of the protein complement of cells. By comparing cultures grown under normal growth conditions to cultures grown with basalt as an alternative iron, calcium or magnesium source, we can highlight proteins which are differentially expressed and therefore important for life in a rocky environment. We observe that the use of rock-bound nutrients induces a complex metabolic response in C.metallidurans which is distinct from the effects observed in the presence of rocks in normal growth medium. This is evidenced, for example, by the upregulation of a number of proteins involved in alternative energy-producing processes such as chemolithotrophy, sulphur oxidation and hydrogen oxidation compared to control cultures. This work has implications for the understanding of how microbes forge a life for themselves from the Earth's crust and highlights the importance of the field of proteomics for the study of life in terrestrial environments.

  6. Planetary protection protecting earth and planets against alien microbes

    International Nuclear Information System (INIS)

    Protecting Earth and planets against the invasion of 'alien life forms' is not military science fiction, but it is the peaceful daily job of engineers and scientists of space agencies. 'Planetary Protection' is preventing microbial contamination of both the target planet and the Earth when sending robots on interplanetary space mission. It is important to preserve the 'natural' conditions of other planets and to not bring with robots 'earthly microbes' (forward contamination) when looking for 'spores of extra terrestrial life'. The Earth and its biosphere must be protected from potential extraterrestrial biological contamination when returning samples of other planets to the Earth (backward contamination). The NASA-Caltech Laboratory for Planetary Protection of Dr. Kasthuri Venkateswaran at the Jet Propulsion Laboratory (JPL) (California, USA) routinely monitors and characterizes the microbes of NASA spacecraft assembly rooms and space robots prior to flight. They have repeatedly isolated Cupriavidus and Ralstonia strains pre-flight from spacecraft assembly rooms (floor and air) and surfaces of space robots such as the Mars Odyssey Orbiter (La Duc et al., 2003). Cupriavidus and Ralstonia strains have also been found in-flight, in ISS cooling water and Shuttle drinking water (Venkateswaran et al., Pyle et al., Ott et al., all unpublished). The main objective of this study is to characterise the Cupriavidus and Ralstonia strains isolated at JPL and compare them to the Cupriavidus metallidurans CH34T model strain, isolated from a Belgian contaminated soil and studied since 25 years at SCK-CEN and to enhance our knowledge by performing additional tests at JPL and gathering information regarding the environmental conditions and the cleaning and isolation methods used in such spacecraft assembling facilities

  7. The Formation of the Solar System: Theories Old and New

    Science.gov (United States)

    Woolfson, Michael

    ch. 1. Theories come and theories go -- ch. 2. Measuring atoms and the universe -- ch. 3. Greek offerings -- ch. 4. The shoulders of giants -- ch. 5. A voyage of discovery to the solar system -- ch. 6. The problem to be solved -- ch. 7. The French connection -- ch. 8. American Catherine-Wheels -- ch. 9. British big tides -- ch. 10. Russian could capture-with British help -- ch. 11. German vortices-with a little French help -- ch. 12. McCrea's floccules -- ch. 13. What earlier theories indicate -- ch. 14. Disks around new stars -- ch. 15. Planets around other stars -- ch. 16. Disks around older stars -- ch. 17. What a theory should explain now -- ch. 18. The new Solar Nebula theory: the angular momentum problem -- ch. 19. Making planets top-down -- ch. 20. A bottom-up alternative -- ch. 21. Making planets faster -- ch. 22. Wandering planets -- ch. 23. Back to top-down -- ch. 24. This is the stuff that stars are made of -- ch. 25. Making dense cool clouds -- ch. 26. A star is born -- ch. 27. Close to the maddening crowd -- ch. 28. Close encounters of the stellar kind -- ch. 29. Ever decreasing circles -- ch. 30. How many planetary systems? -- ch. 31. Starting a family -- ch. 32. Tilting-but not as windmills -- ch. 33. The terrestrial planets raise problems! -- ch. 34. A British Bang theory: the earth and Venus -- ch. 35. Behold the wandering moon -- ch. 36. Fleet Mercury and warlike Mars -- ch. 37. Gods of the sea and the nether regions -- ch. 38. Bits and pieces -- ch. 39. Comets-the harbingers of doom! -- ch. 40. Making atoms with a biggish bang -- ch. 41. Is the capture theory valid?

  8. [Construction and properties of a microbial whole-cell sensor CB10 for the bioavailability detection of Cr6+].

    Science.gov (United States)

    Hou, Qi-Hui; Ma, An-Zhou; Zhuang, Xu-Liang; Zhuang, Guo-Qiang

    2013-03-01

    A microbial whole-cell biosensor CB10 for the bioavailability assessing of Cr6+ was constructed by molecular biotechnology. The regulatory gene and promoter of CB10 was from the chromium resistance system of plasmid pMOL28 from Cupriavidus metallidurans CH34, and the reporter gene of CB10 was luc which was derived from Photinus pyralis. Finally, its response characteristic was discussed under different incubation conditions e. g. pH and temperature. The results showed that a microbial whole-cell biosensor CB10 had been successfully constructed which could respond to Cr6+ within 30 min, with a LOD for Cr6+ of 2 micromol x L(-1). When the incubation concentration of Cr6+ was between 20 micromol x L(-1) and 200 micromol x L(-1), the luc activity of the CB10 biosensor was in linear correlation with the concentration of Cr6+. When the concentration of heavy metal was in the range of 10-50 micromol x L(-1), the response of CB10 was relatively more specific. Moreover, high concentrations of Pb2+, Mn2+ and Sb2+ could also induce CB10. By analyzing the response characteristic of CB10 biosensor, we could draw the conclusion that 15-30 degrees C and pH 4-7 were appropriate for CB10, and 30 degrees C and pH 7 were the optimal conditions for the incubation of the CB10 biosensor. The microbial whole-cell biosensor CB10 for the detection of Cr6+ was fast-responding, specific, sensitive and stable under various conditions. In prospective, it could be used in the fast detection of Cr6+ in water and assessment of the bioavailability of Cr6+ in soil. PMID:23745432

  9. Avaliação da contaminação bacteriana em desinfetantes de uso domiciliar Evaluation of bacterial contamination in disinfectants for domestic use

    Directory of Open Access Journals (Sweden)

    Fumie Miyagi

    2000-10-01

    Full Text Available OBJETIVO: Avaliar desinfetantes de uso domiciliar, identificando a presença de bactérias contaminantes, e conhecer o nível de tolerância dessas bactérias ao cloreto de benzalcônio. MÉTODOS: Foram adquiridas aleatoriamente no comércio da região metropolitana de São Paulo, SP, Brasil, 52 amostras de desinfetantes de uso domiciliar para análise quanto à presença de bactérias contaminantes. O nível de tolerância dessas bactérias ao cloreto de benzalcônio foi determinado pelo método da macrodiluição em caldo. RESULTADOS: De 52 amostras, 16 (30,77% estavam contaminadas por bactérias Gram negativas, com contagens variando entre 10(4 e 10(6 UFC/ml. Esses contaminantes foram identificados como Alcaligenes xylosoxidans, Burkholderia cepacia e Serratia marcescens. As Concentrações Inibitórias Mínimas (CIM: mg/ml do cloreto de benzalcônio para S. marcescens, A. xylosoxidans e B. cepacia foram: 2,48, 1,23 e 0,30, respectivamente. CONCLUSÕES Os desinfetantes de uso domiciliar à base de compostos de amônio quaternário são passíveis de contaminação por bactérias. As CIM do cloreto de benzalcônio para as bactérias contaminantes estavam abaixo das concentrações do princípio ativo presente nos desinfetantes, indicando que a tolerância ao biocida não é estável, podendo ser perdida com o cultivo das bactérias em meios de cultura sem o biocida.OBJECTIVE: To evaluate disinfectants for domestic use for the presence of bacteria, identify them, and determine their tolerance level to benzalkonium chloride. METHODS: Fifty-two samples of commercially available disinfectants for domestic use were acquired at random in the metropolitan area of São Paulo, Brazil, and analyzed to detect the presence of bacterial contaminants. The isolated organisms were identified and their tolerance level to benzalkonium chloride was determined by broth macrodilution method. RESULTS: Sixteen (30.77% of fifty-two disinfectants sampled were

  10. Microorganisms associated with post-harvest green olives deteriorations in Morocco

    Directory of Open Access Journals (Sweden)

    Faid, M.

    1994-10-01

    Full Text Available Altered green olive fruits harvested by the pole slender method were studied for the microorganisms involved in post-harvest alterations of the fruits before the fermentation process. The determinations included: standard plate count, Gram-negative bacteria (conforms and pseudomonads, bacillus, and yeasts. Results showed that the alterations are due first to yeasts and their interactions with pseudomonads and conforms. The most frequent yeasts were represented by the species: Debaryomyces hansenii, Rodothorula glutinis, Pichia membranefaciens, P. Anomala and Candida Bacarum. Gram-negative fermenting bacteria were represented by the species: Envinia carotovora, Hafnia alvei, Enterobacter agglomerans, E. Aerogenes and Serratia marcescens, S. liquefaciens and Shigella flexneri. The oxidase-positive bacteria were most abundant and mainly dominated by Pseudomonas species including P. aeruginosa, P. alcaligenes and P. Syringae. Most of the isolates of these microorganisms were cellulolytic and lipolytic. bacillus especies were also isolated and identified. The main species were Bacillus megaterium, B. pumilus, B. cereus and B. olei. Bacillus species seem not involved in olive deteriorations

    Se estudiaron los microorganismos envueltos en las alteraciones postcosecha de aceitunas verdes alteradas recolectadas mediante el método de vareo y antes del proceso de fermentación. Las determinaciones incluyeron: recuento estándar en placa, bacterias gram-negativa (coliformes y pseudomonas, bacillus y levaduras. Los resultados mostraron que las alteraciones son debidas en primer lugar a las levaduras y a sus interaciones con pseudomonas y coliformes. Las levaduras más frecuentes estuvieron representadas por las especies: Debaryomyces hansenii, Rodothorula glutinis, Pichia membranefaciens, P. anómala y Candida bacarum. Las bacterias gram

  11. Avaliação da microbiota ocular em pacientes com disfunção do filme lacrimal Evaluation of conjunctival flora in patients with tear film dysfunction

    Directory of Open Access Journals (Sweden)

    Melissa Megumi Tomimatsu

    2009-12-01

    Full Text Available OBJETIVO: Avaliar a microbiota conjuntival em olhos com disfunção do filme lacrimal, e a modificação desta microbiota após a colocação de plug de silicone no canalículo inferior. MÉTODOS: Série de casos intervencionais não comparativos para avaliar 68 olhos de 41 pacientes com disfunção do filme lacrimal, durante o período de 2002 a 2007, na Universidade Federal de São Paulo. Todos os pacientes foram submetidos à colheita de amostras de raspado conjuntival de fundo-de-saco inferior para cultivo em Brain heart infusion broth. Os vinte e dois pacientes submetidos à colocação de plug de silicone repetiram a colheita de raspado conjuntival um mês após o procedimento. RESULTADOS: Dos 68 olhos avaliados, 47 apresentaram crescimento bacteriano nas amostras colhidas. Nove diferentes espécies de bactérias foram identificadas: Staphylococcus coagulase negativa em 66,66%, Staphylococcus aureus em 13,72%, Corynebacterium sp em 5,86%, Enterobacter aerogenes em 3,92%, Streptococcus hemolítico do grupo viridans em 1,96%, Serratia sp em 1,96%, Alcaligenes xylosoxidans spp em 1,96%, Corynebacterium xerosis em 1,96%, e Proteus mirabilis em 1,96%. Staphylococcus coagulase negativa (SCN foi o microrganismo mais frequentemente isolado tanto antes quanto após o plug de silicone. A sensibilidade do SCN à Oxacilina antes da colocação do plug era de 87,50%, e, após, de 73,68%. CONCLUSÃO: A microbiota em olhos com disfunção do filme lacrimal é bastante semelhante à encontrada em olhos normais. A resistência de SCN à Oxacilina foi um pouco maior após o implante do plug de silicone.PURPOSE: To evaluate conjunctival microbiota in eyes with tear film dysfunction and its modification after punctal occlusion with silicone plug. METHODS: Non comparative interventional case series study to evaluate 68 eyes of 41 patients with tear film dysfunction, from 2002 to 2007, followed in Federal University of Sao Paulo. Samples for culture were all

  12. AISLAMIENTO DE BACTERIAS RESISTENTES A ARSENICO DESDE MUESTRAS DE ROCAS VOLCANICAS DE LA QUEBRADA CAMARONES, REGION PARINACOTA: CHILE ISOLATION OF ARSENIC RESISTANCE BACTERIA FROM VOLCANIC ROCKS OF QUEBRADA CAMARONES, PARINACOTA REGION: CHILE

    Directory of Open Access Journals (Sweden)

    Víctor Campos

    2007-01-01

    Full Text Available El arsénico se encuentra en estado natural en rocas, suelo, agua, aire y es liberado al ambiente mediante fenómenos naturales tales como erupciones volcánicas, erosión de las rocas e incendios forestales, donde los microorganismos son esenciales para el ecosistema por su participación en diferentes procesos naturales. El objetivo del trabajo fue aislar bacterias resistentes a arsénico, desde muestras de rocas provenientes de la Quebrada Camarones, región Parinacota, Chile. Las rocas fueron cultivadas en un medio mineral adicionado con arsenito (500 ug/ml durante 7 días a temperatura ambiente y con agitación. Las cepas fueron aisladas en diferentes medios e identificadas mediante el sistema Rapid™NF plus. La capacidad de oxidar arsénico fue realizada mediante el ensayo cualitativo con nitrato de plata y la detección de genes aox, mediante RT-PCR. La reducción de arsénico fue evaluada mediante la amplificación de los genes ars por PCR. Se aislaron bacilos Gram negativos, no fermentadores, identificados como Pseudomonas alcaligenes y Wautersia solanacearum todas ellas capaces de tolerar concentraciones igual o mayor a 8 mM de As(III. Los análisis mediante RT-PCR demuestran la presencia de genes aox, que codifica para una enzima oxidante que cataliza la oxidación de As(III a As(V. La capacidad de oxidar arsenito de las cepas aisladas, favorecería la colonización de otras especies no tolerantes a arsénico importantes en los ciclos biogeoquímicos.Arsenic is naturally present in rocks, soil, water, and air, being released to the environment by natural processes such as volcanic eruptions, and erosion rock. Microorganisms are known to play an important role in the Arsenic natural cycle. The aim of this work was isolate arsenic resistant bacteria to volcanic rocks, from Quebrada Camarones, Parinacota Region, Chile. Rocks were cultured in an arsenite conditioned mineral broth (500 ug/mL over 7 days at ambient temperature, under

  13. Contagem, isolamento e caracterização de bactérias psicrotróficas contaminantes de leite cru refrigerado Counting, isolation and characterization of psychrotrophic bacteria from refrigerated raw milk

    Directory of Open Access Journals (Sweden)

    Edna Froeder Arcuri

    2008-11-01

    Full Text Available Com os objetivos de quantificar, isolar e caracterizar bactérias psicrotróficas contaminantes de leite cru refrigerado, produzido na região da Zona da Mata de Minas Gerais e Sudeste do Rio de Janeiro, foram analisadas amostras de leite coletadas de 20 tanques coletivos e 23 tanques individuais. As contagens de bactérias psicrotróficas nas amostras de leite para os dois tipos de tanques de refrigeração variaram entre 10² e 10(7 Unidades Formadoras de Colônias (UFC ml-1, porém, um maior número de tanques coletivos apresentou contagens acima de 1 x 10(5 UFC ml-1. Foi verificada a predominância de bactérias psicrotróficas gram-negativas (81,2%, que foram identificadas pelos sistemas API 20E e API 20NE nos gêneros: Aeromonas, Alcaligenes, Acinetobacter, Burkholderia,Chryseomonas, Enterobacter, Ewingella, Klebsiella, Hafnia, Methylobacterium, Moraxella, Pantoea, Pseudomonas, Serratia, Sphingomonas e Yersinia. As bactérias gram-positivas (18,8% foram identificadas com API 50 CH, API Coryne e API Staph, nos gêneros: Bacillus, Brevibacterium, Cellum/Microbacterium, Kurthia e Staphylococcus. Os sistemas API utilizados não identificaram todos os isolados bacterianos. Pseudomonas foi o gênero mais isolado e P. fluorescens foi a espécie predominante. A maioria dos isolados bacterianos apresentou atividade proteolítica e/ou lipolítica a temperaturas de refrigeração de 4°C, 7°C e 10°C, evidenciando seu alto potencial de deterioração do leite e dos produtos lácteos. Os resultados ressaltam que maior atenção deve ser dada aos procedimentos que impeçam a contaminação do leite por esses microrganismos.This study aimed to quantify, isolate and characterize psychrotrophic bacteria from refrigerated raw milk produced at the ‘Mata’ Region of Minas Gerais State and Southeast of Rio de Janeiro State, Brazil. Raw milk samples, were collected at the farms, from 20 collective refrigerated tanks and 23 individual refrigerated tanks

  14. 15N-标记的气相色谱-同位素比质谱与气相气谱-质谱联用鉴定微生物反硝化作用%Isotopic Confirmation of Occurrence of Microbial Denitrification Based on N2 and N2O Production Monitored by Gas Chromatography/Isotope Ratio Mass Spectrometry and Gas Chromatography/Mass Spectrometry

    Institute of Scientific and Technical Information of China (English)

    艾国民; 郑海燕; 张敏; 刘志培

    2011-01-01

    A new 15N-labled procedure based on isotopic ratio monitoring of N2 by GC-isolink-IRMS (isotope artio mass spectrometer) with high precision and of N2() by GC-MS in SIM mode with high sensitivity was developed for the identification and confirmation of in vitro microbial denitrification. Gas metabolites, produced by Alcaligenes faecalis, including atmospheric gases in the confined culti-vation tube, were analyzed using GS-CarbonPlot column, and a satisfactory baseline separation of N2/ O2, CO2, N2O and water vapour was obtained in a single run, which eliminated CO2 and H2O inter-ference contributed to isotopic determination of N2 and N2O. In δ15N analysis of N2, combustion oven in GC isolink can remove all of the O2in the sample gases, and precise and accurate δ15N measurement can be conducted. The δ15 N value of N2 of 15N-labled sample, 15N-natural abundance control, and 15N-KNO3 blank control were (2. 394 ± 0. 261)%0, (0. 022 + 0. 044)%0 and (0. 315 ± 0. 045)%0, respectively. In addition, significant increase in relative isotopic abundance of 14.15N2O and 15.15N2O (RT = 2. 99 min) to 14.14N2O was observed, indicating N2and N2O production from denitrification by A. Faecalis. This proposed identification procedure, providing isotopic evidence of N2 and/or N2O production based on the marked enrichment in the N isotope ratio, is rapid, sensitive, accurate and precise to indentify and confirm the occurrence of microbial denitrificaiton, especially for new isolated and screened ones. We have confirmed the denitrifying activity by several strains of microorganism screened from the environment using this procedure. This procedure has also been applied in confir-ming the N2 production by nitrifier denitrification under defined conditions.%以好氧反硝化菌-产碱杆菌(Alcaligenes faecalis)在15N-KN03标记反硝化培养下所产气体与培养管中空气的混合气体为分析对象,在样品中N2/O2,CO2,N2O,H2O基线分离的基础上,利用气相色谱-同

  15. Avaliação da contaminação bacteriana em desinfetantes de uso domiciliar

    Directory of Open Access Journals (Sweden)

    Miyagi Fumie

    2000-01-01

    Full Text Available OBJETIVO: Avaliar desinfetantes de uso domiciliar, identificando a presença de bactérias contaminantes, e conhecer o nível de tolerância dessas bactérias ao cloreto de benzalcônio. MÉTODOS: Foram adquiridas aleatoriamente no comércio da região metropolitana de São Paulo, SP, Brasil, 52 amostras de desinfetantes de uso domiciliar para análise quanto à presença de bactérias contaminantes. O nível de tolerância dessas bactérias ao cloreto de benzalcônio foi determinado pelo método da macrodiluição em caldo. RESULTADOS: De 52 amostras, 16 (30,77% estavam contaminadas por bactérias Gram negativas, com contagens variando entre 10(4 e 10(6 UFC/ml. Esses contaminantes foram identificados como Alcaligenes xylosoxidans, Burkholderia cepacia e Serratia marcescens. As Concentrações Inibitórias Mínimas (CIM: mg/ml do cloreto de benzalcônio para S. marcescens, A. xylosoxidans e B. cepacia foram: 2,48, 1,23 e 0,30, respectivamente. CONCLUSÕES Os desinfetantes de uso domiciliar à base de compostos de amônio quaternário são passíveis de contaminação por bactérias. As CIM do cloreto de benzalcônio para as bactérias contaminantes estavam abaixo das concentrações do princípio ativo presente nos desinfetantes, indicando que a tolerância ao biocida não é estável, podendo ser perdida com o cultivo das bactérias em meios de cultura sem o biocida.

  16. Avaliação da contaminação bacteriana em desinfetantes de uso domiciliar

    Directory of Open Access Journals (Sweden)

    Fumie Miyagi

    2000-10-01

    Full Text Available OBJETIVO: Avaliar desinfetantes de uso domiciliar, identificando a presença de bactérias contaminantes, e conhecer o nível de tolerância dessas bactérias ao cloreto de benzalcônio. MÉTODOS: Foram adquiridas aleatoriamente no comércio da região metropolitana de São Paulo, SP, Brasil, 52 amostras de desinfetantes de uso domiciliar para análise quanto à presença de bactérias contaminantes. O nível de tolerância dessas bactérias ao cloreto de benzalcônio foi determinado pelo método da macrodiluição em caldo. RESULTADOS: De 52 amostras, 16 (30,77% estavam contaminadas por bactérias Gram negativas, com contagens variando entre 10(4 e 10(6 UFC/ml. Esses contaminantes foram identificados como Alcaligenes xylosoxidans, Burkholderia cepacia e Serratia marcescens. As Concentrações Inibitórias Mínimas (CIM: mg/ml do cloreto de benzalcônio para S. marcescens, A. xylosoxidans e B. cepacia foram: 2,48, 1,23 e 0,30, respectivamente. CONCLUSÕES Os desinfetantes de uso domiciliar à base de compostos de amônio quaternário são passíveis de contaminação por bactérias. As CIM do cloreto de benzalcônio para as bactérias contaminantes estavam abaixo das concentrações do princípio ativo presente nos desinfetantes, indicando que a tolerância ao biocida não é estável, podendo ser perdida com o cultivo das bactérias em meios de cultura sem o biocida.

  17. Isolation and characterization of a glyphosate-degrading rhizosphere strain, Enterobacter cloacae K7.

    Science.gov (United States)

    Kryuchkova, Yelena V; Burygin, Gennady L; Gogoleva, Natalia E; Gogolev, Yuri V; Chernyshova, Marina P; Makarov, Oleg E; Fedorov, Evgenii E; Turkovskaya, Olga V

    2014-01-20

    Plant-growth-promoting rhizobacteria exert beneficial effects on plants through their capacity for nitrogen fixation, phytohormone production, phosphate solubilization, and improvement of the water and mineral status of plants. We suggested that these bacteria may also have the potential to express degradative activity toward glyphosate, a commonly used organophosphorus herbicide. In this study, 10 strains resistant to a 10 mM concentration of glyphosate were isolated from the rhizoplane of various plants. Five of these strains--Alcaligenes sp. K1, Comamonas sp. K4, Azomonas sp. K5, Pseudomonas sp. K3, and Enterobacter cloacae K7--possessed a number of associative traits, including fixation of atmospheric nitrogen, solubilization of phosphates, and synthesis of the phytohormone indole-3-acetic acid. One strain, E. cloacae K7, could utilize glyphosate as a source of P. Gas-liquid chromatography showed that E. cloacae growth correlated with a decline in herbicide content in the culture medium (40% of the initial 5mM content), with no glyphosate accumulating inside the cells. Thin-layer chromatography analysis of the intermediate metabolites of glyphosate degradation found that E. cloacae K7 had a C-P lyase activity and degraded glyphosate to give sarcosine, which was then oxidized to glycine. In addition, strain K7 colonized the roots of common sunflower (Helianthus annuus L.) and sugar sorghum (Sorghum saccharatum Pers.), promoting the growth and development of sunflower seedlings. Our findings extend current knowledge of glyphosate-degrading rhizosphere bacteria and may be useful for developing a biotechnology for the cleanup and restoration of glyphosate-polluted soils. PMID:23545355

  18. Microbial liquefaction of peat for the production of synthetic fuels

    Energy Technology Data Exchange (ETDEWEB)

    Gunasekaran, M.

    1988-01-01

    Objectives of this study were: to evaluate the potential of using various microorganisms to hydrolyse and liquify peat; to determine the optimal conditions for peat hydrolysis and liquefaction; to study the co-metabolizable substances; to separate the compounds present in liquified peat by alumina and silica acid chromatography and capillary gas chromatography; and to identify the compounds in liquified peat by capillary GC-Mass spectrometry. Organisms used in the study include: Coprinus comatus, Coriolus hirsutus, Ganoderma lucidum, Lentinus edodes, Lenzites trabea, Phanerochaete chrysosporium, Pleurotus ostreatus, P. sapidus, Polyporus adjustus, Neurospora sitophila, Rhizophus arrhizus, Bacillus subtilis, Acinetobacter sp. and Alcaligenes sp. The fungi were maintained and cultivated in potato dextrose agar at 30 C. The bacteria were maintained in nutrient agar at 30 C. We have also initiated work on coal solubilization in addition to the studies on peat liquefaction. A relatively new substratum or semi-solid base for culture media called Pluronic F-127, or Polyol (BASF, New Jersey). Objectives of this study were: (1) to study the growth patterns of Candida ML 13 on pluronic as substratum; (2) to determine the rate of microbial coal solubilization on pluronic F-127 amended in different growth media; (3) to separate the mycelial mat of Candida ML 13 from unsolubilized coal particles and solubilized coal products from pluronic F-127; (4) to determine the effects of pH on microbial coal solubilization in pluronic F-127 media; (5) the effect of concentration of pluronic F-127 in media on coal solubilization; and, (6) to study the role of extracellular factors secreted by Candida ML 13 on coal solubilization in pluronic F-127 media. Results are discussed. 4 refs.

  19. Associations of Europium(III) with gram-negative bacteria

    International Nuclear Information System (INIS)

    Full text of publication follows: Migration of radionuclides in the environment is greatly affected by bacteria. Gram-negative bacteria are ubiquitous in the environment and can preferentially bind radionuclides because of the presence of the cell envelop consisting of two membrane bilayers with an intervening thin peptidoglycan layer, where carboxyl and phosphate functional groups are mainly involved in metal cation adsorption. In this study, we investigated the association of Eu(III) with four Gram-negative bacteria Pseudomonas fluorescens, Alcaligenes faecalis, Shewanella putrefaciens, and Paracoccus denitrificans. Europium(III) is a good analogue of Am(III) and Cm(III). The association of Eu(III) with the bacteria were determined by time-resolved laser-induced fluorescence spectroscopy (TRLFS). The kinetics study showed that the Eu(III) adsorption on the bacteria proceeded rapidly. The Eu(III) adsorption on P. fluorescens at pH 3, A. faecalis and P. denitrificans at pHs 3, 4, and 5, and S. putrefaciens at pHs 4 and 5 reached a maximum within 5 minutes after contact. For P. denitrificans, the percent adsorption of Eu(III) decreased after the maximum percent adsorption was attained, which suggests the existence of exudates with an affinity with Eu(III). TRLFS showed that the coordination of Eu(III) on these bacteria is multi-dentate through an inner-spherical process. The ligand field of Eu(III) on P. denitrificans was as strong as the ones observed for halo-philic microorganisms, while that of P. fluorescens, A. faecalis, and S. putrefaciens was the typical one observed for non-halo-philic microorganisms. The coordination environment of Eu(III) on the bacteria differed from each other, though they are categorized as Gram-negative bacteria with the similar cell wall components. (authors)

  20. Bacteria in crude oil survived autoclaving and stimulated differentially by exogenous bacteria.

    Science.gov (United States)

    Gong, Xiao-Cui; Liu, Ze-Shen; Guo, Peng; Chi, Chang-Qiao; Chen, Jian; Wang, Xing-Biao; Tang, Yue-Qin; Wu, Xiao-Lei; Liu, Chun-Zhong

    2012-01-01

    Autoclaving of crude oil is often used to evaluate the hydrocarbon-degrading abilities of bacteria. This may be potentially useful for bioaugmentation and microbial enhanced oil recovery (MEOR). However, it is not entirely clear if "endogenous" bacteria (e.g., spores) in/on crude oil survive the autoclaving process, or influence subsequent evaluation of the hydrocarbon-degradation abilities of the "exogenous" bacterial strains. To test this, we inoculated autoclaved crude oil medium with six exogenous bacterial strains (three Dietzia strains, two Acinetobacter strains, and one Pseudomonas strain). The survival of the spore-forming Bacillus and Paenibacillus and the non-spore-forming mesophilic Pseudomonas, Dietzia, Alcaligenes, and Microbacterium was detected using a 16S rRNA gene clone library and terminal restriction fragment length polymorphism (T-RFLP) analysis. However, neither bacteria nor bacterial activity was detected in three controls consisting of non-inoculated autoclaved crude oil medium. These results suggest that detection of endogenous bacteria was stimulated by the six inoculated strains. In addition, inoculation with Acinetobacter spp. stimulated detection of Bacillus, while inoculation with Dietzia spp. and Pseudomonas sp. stimulated the detection of more Pseudomonas. In contrast, similar exogenous bacteria stimulated similar endogenous bacteria at the genus level. Based on these results, special emphasis should be applied to evaluate the influence of bacteria capable of surviving autoclaving on the hydrocarbon-degrading abilities of exogenous bacteria, in particular, with regard to bioaugmentation and MEOR. Bioaugmentation and MEOR technologies could then be developed to more accurately direct the growth of specific endogenous bacteria that may then improve the efficiency of treatment or recovery of crude oil. PMID:23028421

  1. Bacteria in crude oil survived autoclaving and stimulated differentially by exogenous bacteria.

    Directory of Open Access Journals (Sweden)

    Xiao-Cui Gong

    Full Text Available Autoclaving of crude oil is often used to evaluate the hydrocarbon-degrading abilities of bacteria. This may be potentially useful for bioaugmentation and microbial enhanced oil recovery (MEOR. However, it is not entirely clear if "endogenous" bacteria (e.g., spores in/on crude oil survive the autoclaving process, or influence subsequent evaluation of the hydrocarbon-degradation abilities of the "exogenous" bacterial strains. To test this, we inoculated autoclaved crude oil medium with six exogenous bacterial strains (three Dietzia strains, two Acinetobacter strains, and one Pseudomonas strain. The survival of the spore-forming Bacillus and Paenibacillus and the non-spore-forming mesophilic Pseudomonas, Dietzia, Alcaligenes, and Microbacterium was detected using a 16S rRNA gene clone library and terminal restriction fragment length polymorphism (T-RFLP analysis. However, neither bacteria nor bacterial activity was detected in three controls consisting of non-inoculated autoclaved crude oil medium. These results suggest that detection of endogenous bacteria was stimulated by the six inoculated strains. In addition, inoculation with Acinetobacter spp. stimulated detection of Bacillus, while inoculation with Dietzia spp. and Pseudomonas sp. stimulated the detection of more Pseudomonas. In contrast, similar exogenous bacteria stimulated similar endogenous bacteria at the genus level. Based on these results, special emphasis should be applied to evaluate the influence of bacteria capable of surviving autoclaving on the hydrocarbon-degrading abilities of exogenous bacteria, in particular, with regard to bioaugmentation and MEOR. Bioaugmentation and MEOR technologies could then be developed to more accurately direct the growth of specific endogenous bacteria that may then improve the efficiency of treatment or recovery of crude oil.

  2. Community of thermoacidophilic and arsenic resistant microorganisms isolated from a deep profile of mine heaps.

    Science.gov (United States)

    Casas-Flores, S; Gómez-Rodríguez, E Y; García-Meza, J V

    2015-12-01

    Soluble arsenic (As) in acidic feed solution may inhibit the copper (Cu) bioleaching process within mine heaps. To clarify the effect of soluble arsenic on the live biomass and bioxidative activity in heaps, toxicological assays were performed using a synthetic feed solution given by a mine company. The microorganisms had previously been isolated from two heap samples at up to 66 m depth, and cultured using specific media for chemolithotrophic acidophiles (pH 1-2) and moderate thermophiles (48°C), for arsenic tolerance assay. The four media with the highest biomass were selected to assay As-resistance; one culture (Q63h) was chosen to assay biooxidative activity, using a heap sample that contained chalcopyrite and covellite. We found that 0.5 g/L of As does not affect living biomass or biooxidative activity on Cu sulfides, but it dissolves Cu, while As precipitates as arsenic acid (H3AsO4·½H2O). The arsenic tolerant community, as identified by 16S rDNA gene sequence analysis, was composed of three main metabolic groups: chemolithotrophs (Leptospirillum, Sulfobacillus); chemolithoheterotrophs and organoheterotrophs as Acidovorax temperans, Pseudomonas alcaligenes, P. mendocina and Sphingomonas spp. Leptospirillum spp. and S. thermosulfidooxidans were the dominant taxa in the Q63-66 cultures from the deepest sample of the oldest, highest-temperature heap. The results indicated arsenic resistance in the microbial community, therefore specific primers were used to amplify ars (arsenic resistance system), aio (arsenite oxidase), or arr (arsenate respiratory reduction) genes from total sample DNA. Presence of arsB genes in S. thermosulfidooxidans in the Q63-66 cultures permits H3AsO4-As(V) detoxification and strengthens the community's response to As. PMID:26283066

  3. Linear alkylbenzene sulfonate tolerance in bacteria isolated from sediment of tropical water bodies polluted with detergents.

    Science.gov (United States)

    Eniola, Kehinde I T; Olayemi, Albert B

    2008-12-01

    The discharge of untreated detergent-bearing waste introduces linear alklcylbenzene sulfonates (LAS) to the aquatic environment. The surfactant persists in some streams and rivers in Nigeria, some is adsorbed to suspended materials and end in the sediment of the receiving water bodies. In this study, bacteria isolated from sediments of some tropical detergent-effluent-polluted streams were tested for tolerance to LAS using the media dilution technique. LAS-tolerance was indicated by growth of the bacteria in the presence of the surfactant. The pH, concentrations of surfactant, population of heterotrophic bacteria and population of LAS-tolerant bacteria in the sediments were determined. A direct relationship (r = 0.9124) was found between the alkaline conditions (pH= 8.2-12.0) and high surfactant concentrations (45-132 mg/g) in the sediment. The sediments harboured a high population and a wide variety of bacteria; the populations of viable heterotrophic bacteria (VHB: 2.9 x 10(5) to 1.2 x 10(7) cfu/g) and LAS tolerant bacteria (LTB: 1.5 x 10(4) to 1.2 x 10(6) cfu/g) had a direct relationship (r = 0.9500). An inverse relationship resulted between each of them and the concentration of surfactant in the sediment, r(VHB/LAS) = -0.9303 and r(LTB/LAS) = -0.9143, respectively. Twelve bacteria species were isolated from the sediment: Alcaligenes odorans, Bacillus subtilis, Burkholderia cepacia, Citrobacter freundii, Citrobacter diversus, Escherichia coli, Micrococcus luteus, Micrococcus albus, Pseudomonas putida, Pseudomonas stutzeri, Staphylococcus aureus and Streptococcusfaecalis. Most of them were adapted to the surfactant with their maximum acceptable concentrations ranging between 0.03 and >1.0% (w/v). The sediments could serve as source of adapted organisms which can be used in bio-treatment of LAS-bearing waste. PMID:19419067

  4. Precipitation of Phosphate Minerals by Microorganisms Isolated from a Fixed-Biofilm Reactor Used for the Treatment of Domestic Wastewater

    Directory of Open Access Journals (Sweden)

    Almudena Rivadeneyra

    2014-04-01

    Full Text Available The ability of bacteria isolated from a fixed-film bioreactor to precipitate phosphate crystals for the treatment of domestic wastewater in both artificial and natural media was studied. When this was demonstrated in artificial solid media for crystal formation, precipitation took place rapidly, and crystal formation began 3 days after inoculation. The percentage of phosphate-forming bacteria was slightly higher than 75%. Twelve major colonies with phosphate precipitation capacity were the dominant heterotrophic platable bacteria growing aerobically in artificial media. According to their taxonomic affiliations (based on partial sequencing of the 16S rRNA, the 12 strains belonged to the following genera of Gram-negative bacteria: Rhodobacter, Pseudoxanthobacter, Escherichia, Alcaligenes, Roseobacter, Ochrobactrum, Agromyce, Sphingomonas and Paracoccus. The phylogenetic tree shows that most of the identified populations were evolutionarily related to the Alphaproteobacteria (91.66% of sequences. The minerals formed were studied by X-ray diffraction, scanning electron microscopy (SEM, and energy dispersive X-ray microanalysis (EDX. All of these strains formed phosphate crystals and precipitated struvite (MgNH4PO4·6H2O, bobierrite [Mg3(PO42·8H2O] and baricite [(MgFe3(PO42·8H2O]. The results obtained in this study show that struvite and spherulite crystals did not show any cell marks. Moreover, phosphate precipitation was observed in the bacterial mass but also near the colonies. Our results suggest that the microbial population contributed to phosphate precipitation by changing the media as a consequence of their metabolic activity. Moreover, the results of this research suggest that bacteria play an active role in the mineral precipitation of soluble phosphate from urban wastewater in submerged fixed-film bioreactors.

  5. Stable Copper-Nitrosyl Formation By Nitrite Reductase in Either Oxidation State

    Energy Technology Data Exchange (ETDEWEB)

    Tocheva, E.I.; Rosell, F.I.; Mauk, A.G.; Murphy, M.E.P.

    2009-06-04

    Nitrite reductase (NiR) is an enzyme that uses type 1 and type 2 copper sites to reduce nitrite to nitric oxide during bacterial denitrification. A copper-nitrosyl intermediate is a proposed, yet poorly characterized feature of the NiR catalytic cycle. This intermediate is formally described as Cu(I)-NO{sup +} and is proposed to be formed at the type 2 copper site after nitrite binding and electron transfer from the type 1 copper site. In this study, copper-nitrosyl complexes were formed by prolonged exposure of exogenous NO to crystals of wild-type and two variant forms of NiR from Alcaligenes faecalis (AfNiR), and the structures were determined to 1.8 {angstrom} or better resolution. Exposing oxidized wild-type crystals to NO results in the reverse reaction and formation of nitrite that remains bound at the active site. In a type 1 copper site mutant (H145A) that is incapable of electron transfer to the type 2 site, the reverse reaction is not observed. Instead, in both oxidized and reduced H145A crystals, NO is observed bound in a side-on manner to the type 2 copper. In AfNiR, Asp98 forms hydrogen bonds to both substrate and product bound to the type 2 Cu. In the D98N variant, NO is bound side-on but is more disordered when observed for the wild-type enzyme. The solution EPR spectra of the crystallographically characterized NiR-NO complexes indicate the presence of an oxidized type 2 copper site and thus are interpreted as resulting from stable copper-nitrosyls and formally assigned as Cu(II)-NO{sup -}. A reaction scheme in which a second NO molecule is oxidized to nitrite can account for the formation of a CuD-NO{sup -} species after exposure of the oxidized H145A variant to NO gas.

  6. Resonance Raman Spectra of Five-Coordinate Heme-Nitrosyl Cytochromes c': Effect of the Proximal Heme-NO Environment.

    Science.gov (United States)

    Servid, Amy E; McKay, Alison L; Davis, Cherry A; Garton, Elizabeth M; Manole, Andreea; Dobbin, Paul S; Hough, Michael A; Andrew, Colin R

    2015-06-01

    Five-coordinate heme nitrosyl complexes (5cNO) underpin biological heme-NO signal transduction. Bacterial cytochromes c' are some of the few structurally characterized 5cNO proteins, exhibiting a distal to proximal 5cNO transition of relevance to NO sensing. Establishing how 5cNO coordination (distal vs proximal) depends on the heme environment is important for understanding this process. Recent 5cNO crystal structures of Alcaligenes xylosoxidans cytochrome c' (AXCP) and Shewanella frigidimarina cytochrome c' (SFCP) show a basic residue (Arg124 and Lys126, respectively) near the proximal NO binding sites. Using resonance Raman (RR) spectroscopy, we show that structurally characterized 5cNO complexes of AXCP variants and SFCP exhibit a range of ν(NO) (1651-1671 cm(-1)) and ν(FeNO) (519-536 cm(-1)) vibrational frequencies, depending on the nature of the proximal heme pocket and the sample temperature. While the AXCP Arg124 residue appears to have little impact on 5cNO vibrations, the ν(NO) and ν(FeNO) frequencies of the R124K variant are consistent with (electrostatically) enhanced Fe(II) → (NO)π* backbonding. Notably, RR frequencies for SFCP and R124A AXCP are significantly displaced from the backbonding trendline, which in light of recent crystallographic data and density functional theory modeling may reflect changes in the Fe-N-O angle and/or extent of σ-donation from the NO(π*) to the Fe(II) (dz(2)) orbital. For R124A AXCP, correlation of vibrational and crystallographic data is complicated by distal and proximal 5cNO populations. Overall, this study highlights the complex structure-vibrational relationships of 5cNO proteins that allow RR spectra to distinguish 5cNO coordination in certain electrostatic and steric environments. PMID:25961377

  7. PCR typing of genetic determinants for metallo-beta-lactamases and integrases carried by gram-negative bacteria isolated in Japan, with focus on the class 3 integron.

    Science.gov (United States)

    Shibata, Naohiro; Doi, Yohei; Yamane, Kunikazu; Yagi, Tetsuya; Kurokawa, Hiroshi; Shibayama, Keigo; Kato, Haru; Kai, Kumiko; Arakawa, Yoshichika

    2003-12-01

    From January 2001 to December 2002, 587 strains of gram-negative bacterial isolates demonstrating resistance to ceftazidime and a combination of sulbactam and cefoperazone were subjected to a disk diffusion screening test using sodium mercaptoacetic acid; 431 strains (73.4%) appeared to produce metallo-beta-lactamase (MBL). Of these 431 strains, 357 were found by PCR to carry genes for IMP-1 type MBL (bla(IMP-1)), while only 7 and 67 strains carried the IMP-2 gene (bla(IMP-2)) and the VIM-2 gene (bla(VIM-2)), respectively. Neither VIM-1 nor SPM-1 type MBL genes were found among the strains tested. Of 431 strains, 427 carried the intI1 gene, and 4 strains carrying both the intI1 and intI3 genes were reidentified as Pseudomonas putida harboring bla(IMP-1). Of these four P. putida strains, three strains and one strain, respectively, were separately isolated from two hospitals located in the same prefecture, and the three strains showed very similar pulsed-field gel electrophoresis patterns. Of 357 bla(IMP-1) carriers, 116, 53, 51, 47, and 30 strains were identified as Pseudomonas aeruginosa, Alcaligenes xylosoxidans, P. putida/fluorescens, Serratia marcescens, and Acinetobacter baumannii, respectively. Four strains carrying bla(IMP-2) were reidentified as P. putida. Sixty-three P. aeruginosa strains and four P. putida strains carried bla(VIM-2). Of 427 intI1-positive strains, 180, 53, 51, 47, and 35 were identified as P. aeruginosa, A. xylosoxidans, P. putida/fluorescens, S. marcescens, and A. baumannii, respectively. In the present study, it was confirmed that strains carrying bla(IMP-1) with a class 1 integron are the most prevalent type in Japan, although several intI3 carriers have also been identified sporadically in this country. PMID:14662918

  8. Bacterial Colonization of Cod (Gadus morhua L.) and Halibut (Hippoglossus hippoglossus) Eggs in Marine Aquaculture

    Science.gov (United States)

    Hansen, Geir Høvik; Olafsen, Jan A.

    1989-01-01

    Aquaculture has brought about increased interest in mass production of marine fish larvae. Problems such as poor egg quality and mass mortality of fish larvae have been prevalent. The intensive incubation techniques that often result in bacterial overgrowth on fish eggs could affect the commensal relationship between the indigenous microflora and opportunistic pathogens and subsequently hamper egg development, hatching, larval health, and ongrowth. Little information about the adherent microflora on fish eggs is available, and the present study was undertaken to describe the microbial ecology during egg development and hatching of two fish species of potential commercial importance in marine aquaculture. Attachment and development of the bacterial flora on cod (Gadus morhua L.) eggs from fertilization until hatching was studied by scanning electron microscopy. The adherent microflora on cod (G. morhua L.) and halibut (Hippoglossus hippoglossus) eggs during incubation was characterized and grouped by cluster analysis. Marked bacterial growth could be demonstrated 2 h after fertilization, and at hatching eggs were heavily overgrown. Members of the genera Pseudomonas, Alteromonas, Aeromonas, and Flavobacterium were found to dominate on the surface of both cod and halibut eggs. The filamentous bacterium Leucothrix mucor was found on eggs from both species. While growth of L. mucor on halibut eggs was sparse, cod eggs with a hairy appearance due to overgrowth by this bacterium close to hatching were frequently observed. Vibrio fischeri could be detected on cod eggs only, and pathogenic vibrios were not detected. Members of the genera Moraxella and Alcaligenes were found only on halibut eggs. Caulobacter and Seliberia spp. were observed attached to eggs dissected from cod ovaries under sterile conditions, indicating the presence of these bacteria in ovaries before spawning. Adherent strains did not demonstrate antibiotic resistance above a normal level. Attempts to

  9. ОСОБЕННОСТИ РАСПРОСТРАНЕНИЯ БАКТЕРИЙ РОДА PSEUDOMONAS В ВОДНОЙ ЭКОСИСТЕМЕ РЕКИ КУБАНИ

    OpenAIRE

    Бороздина, Ирина

    2011-01-01

    Проведено экспериментальное исследование по идентификации, изучению морфофизиологических, культуральных, тинкториальных и биохимических свойств бактерий рода Pseudomonas в пробах воды реки Кубани на глубине 10 и 50 см. Из микрофлоры кубанской воды выделено 15 видов грамотрицательных бактерий: Ps. acidovorans, Ps. alcaligenes, Ps. fluorescens, Ps. putida, Ps. aeruginosa, Ps. cepacia, Ps. diminuta, Ps. maltophilia, Ps.pseudoalcaligenes, Ps. putida, Ps. putrefaciens, Ps. stutzeri, Ps. testostero...

  10. [Staghorn renal lithiasis treated with shock waves. Bacteriologic aspects].

    Science.gov (United States)

    Durlach, R A; Toblli, J E; Gigler, C; Domecq, P; Vázquez, R; Cucci, V; Ramas, H; Ghirlanda, J M

    1994-01-01

    Struvite renal stones are caused by infection of the urine with bacteria that synthesize the enzyme urease. Ammonium is released by the breakdown of urea by urease, the urine becomes highly alkaline, and magnesium ammonium phosphate (struvite) and carbonate apatite crystallize. Incorporation of the infecting bacteria within the developing stone, results in a focus of infection that is resistant to conventional antimicrobial therapy, and which is manifested clinically by repeated urinary tract infection caused by persistent bacteriuria. Extracorporeal shock wave lithotripsy (ESWL) currently is accepted as the election treatment for most renal calculi. This trial examines the bacteriologic aspects pre and post-ESWL. Eighty adult patients, 47 females and 33 males, without clinical signs of urinary tract infections (UTI) were submitted to urine cultures pre and post-ESWL. The first 50 patients underwent during and post-ESWL, 150 blood cultures, which all proved to be negative, confirming very low risk of generalized sepsis. No patient presented fever, chills or rigors pre or postprocedures. With respect to urine cultures 43 patients (52.5%) had a pre-ESWL UTI, in comparison to 49 (60%) who had a UTI post-ESWL. The distribution of organisms pre and post-ESWL was as follows: Proteus mirabilis (22/22), Escherichia coli (11/11), Pseudomonas aeruginosa (4/5), Klebsiella pneumoniae (2/2), Enterobacter cloacae (0/1), Alcaligenes odorans (1/2) Enterococcus faecalis (1/3), Staphylococcus saprophyticus (1/2) and Candida albicans (1/1). In this study 6 patients presented bacteriuria post-ESWL probably due to bacteria from inside the calculi. According to these results, the risk of bacteremia seems to be very low. In 60% of staghorn renal stones we could demonstrate a bacterial infection. PMID:7658975

  11. Anoxic Biodegradation of Isosaccharinic Acids at Alkaline pH by Natural Microbial Communities.

    Directory of Open Access Journals (Sweden)

    Simon P Rout

    Full Text Available One design concept for the long-term management of the UK's intermediate level radioactive wastes (ILW is disposal to a cementitious geological disposal facility (GDF. Under the alkaline (10.013.0 anoxic conditions expected within a GDF, cellulosic wastes will undergo chemical hydrolysis. The resulting cellulose degradation products (CDP are dominated by α- and β-isosaccharinic acids (ISA, which present an organic carbon source that may enable subsequent microbial colonisation of a GDF. Microcosms established from neutral, near-surface sediments demonstrated complete ISA degradation under methanogenic conditions up to pH 10.0. Degradation decreased as pH increased, with β-ISA fermentation more heavily influenced than α-ISA. This reduction in degradation rate was accompanied by a shift in microbial population away from organisms related to Clostridium sporosphaeroides to a more diverse Clostridial community. The increase in pH to 10.0 saw an increase in detection of Alcaligenes aquatilis and a dominance of hydrogenotrophic methanogens within the Archaeal population. Methane was generated up to pH 10.0 with acetate accumulation at higher pH values reflecting a reduced detection of acetoclastic methanogens. An increase in pH to 11.0 resulted in the accumulation of ISA, the absence of methanogenesis and the loss of biomass from the system. This study is the first to demonstrate methanogenesis from ISA by near surface microbial communities not previously exposed to these compounds up to and including pH 10.0.

  12. Metagenomic analyses of alcohol induced pathogenic alterations in the intestinal microbiome and the effect of Lactobacillus rhamnosus GG treatment.

    Directory of Open Access Journals (Sweden)

    Lara Bull-Otterson

    Full Text Available Enteric dysbiosis plays an essential role in the pathogenesis of alcoholic liver disease (ALD. Detailed characterization of the alterations in the gut microbiome is needed for understanding their pathogenic role in ALD and developing effective therapeutic approaches using probiotic supplementation. Mice were fed liquid Lieber-DeCarli diet without or with alcohol (5% v/v for 6 weeks. A subset of mice were administered the probiotic Lactobacillus rhamnosus GG (LGG from 6 to 8 weeks. Indicators of intestinal permeability, hepatic steatosis, inflammation and injury were evaluated. Metagenomic analysis of the gut microbiome was performed by analyzing the fecal DNA by amplification of the V3-V5 regions of the 16S rRNA gene and large-scale parallel pyrosequencing on the 454 FLX Titanium platform. Chronic ethanol feeding caused a decline in the abundance of both Bacteriodetes and Firmicutes phyla, with a proportional increase in the gram negative Proteobacteria and gram positive Actinobacteria phyla; the bacterial genera that showed the biggest expansion were the gram negative alkaline tolerant Alcaligenes and gram positive Corynebacterium. Commensurate with the qualitative and quantitative alterations in the microbiome, ethanol caused an increase in plasma endotoxin, fecal pH, hepatic inflammation and injury. Notably, the ethanol-induced pathogenic changes in the microbiome and the liver were prevented by LGG supplementation. Overall, significant alterations in the gut microbiome over time occur in response to chronic alcohol exposure and correspond to increases in intestinal barrier dysfunction and development of ALD. Moreover, the altered bacterial communities of the gut may serve as significant therapeutic target for the prevention/treatment of chronic alcohol intake induced intestinal barrier dysfunction and liver disease.

  13. Effects on Salmonella shell contamination and trans-shell penetration of coating hens' eggs with chitosan.

    Science.gov (United States)

    Leleu, S; Herman, L; Heyndrickx, M; De Reu, K; Michiels, C W; De Baerdemaeker, J; Messens, W

    2011-01-31

    Chitosan is a biopolymer with antimicrobial activity and film-forming properties. In this study, the effects on Salmonella shell contamination and trans-shell penetration of coating hens' eggs with chitosan was evaluated. A chitosan was selected from eight types (four non-commercial and four commercial) based on its antimicrobial activity against Salmonella enterica serovar Enteritidis (S. Enteritidis). For this purpose, a contact plate method was developed and chitosans were applied at a concentration of 0.25% (w/v). A commercial type with a molecular weight of 310-375 kDa and a deacetylation degree of 75% that reduced S. Enteritidis by 0.71 log(10) colony forming units compared to the control (without chitosan) was selected for further studies. The chitosan was shown to have antimicrobial activity against other egg borne bacteria, i.e., Acinetobacter baumannii, Alcaligenes sp., Carnobacterium sp., Pseudomonas sp., Serratia marcescens and Staphylococcus warneri, and against S. enterica serovar Typhimurium, Escherichia coli and Listeria monocytogenes. The effects of various concentrations of the selected chitosan (0.25%, 1% and 2%) on Salmonella shell contamination and trans-shell penetration were assessed using the agar molding technique. Effective reduction of eggshell contamination could not be demonstrated, but trans-shell penetration was significantly reduced in the presence of a 2% chitosan eggshell coating, with only 6.1% of the eggs being penetrated compared to 24.5% of the uncoated eggs. It was concluded that the 2% chitosan coating has the potential to reduce contamination of egg contents resulting from trans-shell penetration by S. Enteritidis. PMID:21146239

  14. Degradation of 2,6-di-tert-butylphenol by an isolated high-efficiency bacterium strain

    Institute of Scientific and Technical Information of China (English)

    ZHANG Ya-lei; FANG Zhen-wei; XU De-qiang; XIAO Yi-ping; ZHAO Jian-fu; QIANG Zhi-min

    2005-01-01

    An aerobic bacterium strain, F-3-4, capable of effectively degrading 2,6-di-tert-butylphenol (2, 6-DTBP), was isolated and screened out from an acrylic fiber wastewater and the biofilm in the wastewater treatment facilities. This strain was identified as Alcaligenes sp. through morphological, physiological and biochemical examinations. After cultivation, the strain was enhanced by 26.3% in its degradation capacity for 2,6-DTBP. Results indicated that the strain was able to utilize 2,6-DTBP, lysine, lactamine, citrate, n-utenedioic acid and maiic acid as the sole carbon and energy source, alkalinize acetamide, asparagine, L-histidine, acetate, citrate and propionate,but failed to utilize glucose, D-fructose, D-seminose, D-xylose, serine and phenylalanine as the sole carbon and energy source. The optimal growth conditions were determined to be: temperature 37 ℃, pH 7.0, inoculum size 0.1% and shaker rotary speed 250 r/min.Under the optimal conditions, the degradation kinetics of 2,6-DTBP with an initial concentration of 100 mg/L was studied. Results indicated that 62.4% of 2,6-DTBP was removed after 11 d. The degradation kinetics could be expressed by Eckenfelder equation with a half life of 9.38 d. In addition, the initial concentration of 2,6-DTBP played an important role on the degradation ability of the strain. The maximum initial concentration of 2,6-DTBP was determined to be 200 mg/L. Above this level, the strain was overloaded and exhibited significant inhibition.

  15. Rhizoma Coptidis alkaloids alleviate hyperlipidemia in B6 mice by modulating gut microbiota and bile acid pathways.

    Science.gov (United States)

    He, Kai; Hu, Yinran; Ma, Hang; Zou, Zongyao; Xiao, Yubo; Yang, Yong; Feng, Min; Li, Xuegang; Ye, Xiaoli

    2016-09-01

    It is hypothesized that Rhizoma Coptidis (RC) alkaloids exert their hypolipidemic effects primarily by targeting the gastrointestinal tract and liver. Thus, this study was conducted to evaluate the antihyperlipidemic mechanisms of RC alkaloids (at a daily dose of 140mg/kg for 35days) in high-fat and high-cholesterol induced hyperlipidemic B6 mice. After treatment, serum lipid parameters were determined, the expression of lipid metabolism related genes and pathways such as the sterol regulatory element binding proteins (SREBPs) and bile acid signaling in mice were also investigated. Meanwhile, Illumina sequencing was used to investigate the differences in gut microbiota of B6 mice. The results indicated that RC alkaloids reduced the body weight gain and serum total cholesterol (TC), triglyceride (TG), low-density lipoprotein cholesterol (LDL-C), total bile acids (TBA) and lipopolysaccharide of B6 mice. Liver fat deposition and epididymal adipose cell size were also deceased in therapy group. RC alkaloids feeding significantly promoted the abundance of Sporobacter termitidis, Alcaligenes faecalis, Akkermansia muciniphila in the gut of mice, whereas, the abundance of Escherichia coli, Desulfovibrio C21_c20, Parabacteroides distasonis was suppressed. The observed antihyperlipidemic effects of RC alkaloids can also be attributed to their action as agonists of FXR and TGR5, activators for SREBP2, LDLR, UCP2 and CYP7A1, inhibitors of HMGCR, TXNIP, TLR4 and JNK. Therefore, this study expands current knowledge on hypolipidemic mechanisms of RC alkaloids and presents new evidence supporting a key role for RC alkaloids as regulators of lipid homeostasis by modulation gut microbiota and hepatic lipid metabolism. PMID:27287254

  16. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22

    Directory of Open Access Journals (Sweden)

    Bhave Mrinal

    2009-03-01

    Full Text Available Abstract Background Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22, a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Findings Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. Conclusion TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  17. Radiation application for upgrading of bioresources - Development of antifungal and/or nitrogen fixative microbes

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ki Sung; Ko, Dong Kyu; Han, Gab Jin [Paichai University, Taejon (Korea)

    2000-04-01

    (1) In this study, the antifungal bacteria six strains were isolated from various environment located in Chung-cheong area, Korea. These isolates were identified the genera Bacillus sp, Pseudomonas sp. through morphological, physiological and biochemical analysis. Strains KL3362 and KL3397 were identified as Pseudomonas aurantiaca and Alcaligenes faecalis, respectively. Considering antifungal(AF) spectrum, strain KL3303, 3334, and 3341 show the broad range, KL3362 and KL3397 the narrow range of AF activity on a number of pathogenic fungi. Therefore, strains KL3341 and KL3362 were selected as the strong candidate of antifungal bacteria on every purpose and usage related with our research goal. (2) KL3341 producing-antifungal substances were consisted of five different kinds of low molecular weight polypeptides (3) Optimal conditions for the production of antifungal substances were analyzed under various environmental conditions. Growth rates were different according to carbon and nitrogen source, antifungal substance production yields were not different, however. Product of antifungal substances according t phosphate is proportional to the concentration. And productivity of antifungal substances was generally high in the range 30 {approx} 37 deg. C at pH 7. In case of adding vitamin B1 or lysine to medium, the antifungal activity was enhanced. (4) Mutants with enhanced antifungal activities were constructed by radiation of {gamma}-ray. (5) AF strains were screened and selected from this research can be used in the microbial biocides as well as multifunctional bio-controllers in order to remove plant pathogenic fungi and to clarify the polluted environment. Due to their excellent degradation capability for agricultural and/or organic substances, they also can be used to improve soil quality, to ferment compost and to clean up the environment. 35 refs., 17 figs., 15 tabs. (Author)

  18. Solvent-Free Lipase-Catalyzed Synthesis of Diacylgycerols as Low-Calorie Food Ingredients

    Science.gov (United States)

    Vázquez, Luis; González, Noemí; Reglero, Guillermo; Torres, Carlos

    2016-01-01

    Problems derived from obesity and overweight have recently promoted the development of fat substitutes and other low-calorie foods. On the one hand, fats with short- and medium-chain fatty acids are a source of quick energy, easily hydrolyzable and hardly stored as fat. Furthermore, 1,3-diacylglycerols are not hydrolyzed to 2-monoacylglycerols in the gastrointestinal tract, reducing the formation of chylomicron and lowers the serum level of triacylglycerols by decreasing its resynthesis in the enterocyte. In this work, these two effects were combined to synthesize short- and medium-chain 1,3-diacylglycerols, leading to a product with great potential as for their low-calorie properties. Lipase-catalyzed transesterification reactions were performed between short- and medium-chain fatty acid ethyl esters and glycerol. Different variables were investigated, such as the type of biocatalyst, the molar ratio FAEE:glycerol, the adsorption of glycerol on silica gel, or the addition of lecithin. Best reaction conditions were evaluated considering the percentage of 1,3-DAG produced and the reaction rate. Except Novozym 435 (Candida antarctica), other lipases required the adsorption of glycerol on silica gel to form acylglycerols. Lipases that gave the best results with adsorption were Novozym 435 and Lipozyme RM IM (Rhizomucor miehei) with 52 and 60.7% DAG at 32 h, respectively. Because of its specificity for sn-1 and sn-3 positions, lipases leading to a higher proportion of 1,3-DAG vs. 1,2-DAG were Lipozyme RM IM (39.8 and 20.9%, respectively) and Lipase PLG (Alcaligenes sp.) (35.9 and 19.3%, respectively). By adding 1% (w/w) of lecithin to the reaction with Novozym 435 and raw glycerol, the reaction rate was considerably increased from 41.7 to 52.8% DAG at 24 h. PMID:26904539

  19. Efficacy of intraoperative vancomycin in irrigating solutions on aqueous contamination during phacoemulsification

    Directory of Open Access Journals (Sweden)

    Srinivasan Renuka

    2008-01-01

    Full Text Available Purpose: To study the efficacy of adding vancomycin in irrigating solutions, in comparison to topical antibiotic given preoperatively for a day, during phacoemulsification, in reducing the anterior chamber (AC contamination. Settings and Design: This was a prospective, interventional, hospital-based study. Materials and Methods: This was a study involving 400 eyes of 400 paitens, undergoing routine phacoemulsification between January 2004 and June 2006. The patients were non-randomly assigned to two groups: Group 1 included 180 patients, who received topical ciprofloxacin eye-drops (four-hourly for a day preoperatively and Group 2 included 220 patients, who underwent phacoemulsification with vancomycin (20 µg/ml in the irrigating solution. Anterior chamber aspirate obtained at the end of the surgery was sent for microbial workup. The number of positive cultures in both the groups was determined. Statistical analysis: This was performed using Chi-square test. Results: Aqueous samples showed microbial growth in 38 (21.1% out of 180 eyes in Group 1 and in 17 (7.7% out of 220 eyes in Group 2 ( P = 0.001. Coagulase-negative staphylococcus was the most common organism in both the groups. Aqueous samples from four eyes in group 1 showed multiple organisms, while none of the sample from group 2 showed more than one organism. None of the eyes in either group showed fungal contamination. One patient in Group 1 developed endophthalmitis, and the causative organism was Alcaligenes faecalis. All patients were followed up for a minimum of six months (range: 6 to 14 months and mean: 9.3 months. Conclusion: Addition of vancomycin in irrigating solutions is more efficacious in reducing AC contamination in comparison to topical antibiotic administered a day preoperatively.

  20. Novel aromatic ring-hydroxylating dioxygenase genes from coastal marine sediments of Patagonia

    Directory of Open Access Journals (Sweden)

    Ferrero Marcela A

    2008-03-01

    Full Text Available Abstract Background Polycyclic aromatic hydrocarbons (PAHs, widespread pollutants in the marine environment, can produce adverse effects in marine organisms and can be transferred to humans through seafood. Our knowledge of PAH-degrading bacterial populations in the marine environment is still very limited, and mainly originates from studies of cultured bacteria. In this work, genes coding catabolic enzymes from PAH-biodegradation pathways were characterized in coastal sediments of Patagonia with different levels of PAH contamination. Results Genes encoding for the catalytic alpha subunit of aromatic ring-hydroxylating dioxygenases (ARHDs were amplified from intertidal sediment samples using two different primer sets. Products were cloned and screened by restriction fragment length polymorphism analysis. Clones representing each restriction pattern were selected in each library for sequencing. A total of 500 clones were screened in 9 gene libraries, and 193 clones were sequenced. Libraries contained one to five different ARHD gene types, and this number was correlated with the number of PAHs found in the samples above the quantification limit (r = 0.834, p nahAc-like genes, phnAc-like genes as identified in Alcaligenes faecalis AFK2, and phnA1-like genes from marine PAH-degraders from the genus Cycloclasticus. Conclusion These results show the presence of hitherto unidentified ARHD genes in this sub-Antarctic marine environment exposed to anthropogenic contamination. This information can be used to study the geographical distribution and ecological significance of bacterial populations carrying these genes, and to design molecular assays to monitor the progress and effectiveness of remediation technologies.

  1. DNA-fingerprinting di stipiti di Chryseobacterium spp isolati da pazienti con Fibrosi Cistica

    Directory of Open Access Journals (Sweden)

    Antonietta Lambiase

    2007-03-01

    Full Text Available Objectives: Pulmonary infections by Gram-negative bacteria, as Pseudomonas aeruginosa, Burkholderia cepacia, Stenotrophomonas maltophilia, are the major cause of morbidity in Cystic Fibrosis patients. In the past decade, several pathogens as Alcaligenes spp and no tuberculosis mycobacteria have been recovered in these patients. Bacteria of genus Chryseobacterium are widespread Gram-negative microrganisms and involved in human infections. Aims of this study were to value the isolation frequency of Chryseobacterium strains in a cohort of Cystic Fibrosis patients, to investigate their antimicrobial sensibility and to establish possible clonal likeness between strains. Methods:A retrospective study was undertaken between January 2003 and December 2005 on 300 patients receiving care at the Regional Cystic Fibrosis Centre of Naples University “Federico II”. Sputum samples were checked: for bacterial identification, selective media and commercial identification systems were used.The activity of antimicrobial agents was determined using diffusion and microdiluthion methods. For DNA-fingerprinting, a genomic DNA macrorestriction followed by pulsed-field electrophoresis was carried out. Results:A total of 26 strains from 17 patients were isolated (7 C. meningosepticum, 14 C. indologenes, 5 C. gleum. Strains were resistant to cephalosporins and carbapenems; some were sensitive to ciprofloxacin, levofloxacin and trimethoprim-sulphamethoxazole. Macrorestriction analysis showed substantial heterogeneity among strains. Conclusions: Actually, the prognostic role of Chryseobacterium in Cystic Fibrosis is unclear and although the small number of isolations, it is need to be on the look out regard such microorganisms. The considerable resistance implies difficulties on therapeutic approach. Results of DNA-fingerprinting indicate no evidence of clonal likeness and then of patient-to-patient spread.

  2. Construction and Properties of a Microbial Whole-cell Sensor CB10 for the Bioavailability Detection of Cr6+%Cr6+生物可利用度检测的微生物全细胞传感器CB10的构建及其响应特征

    Institute of Scientific and Technical Information of China (English)

    侯启会; 马安周; 庄绪亮; 庄国强

    2013-01-01

    为实现重金属污染环境中 Cr6-的生物可利用度评价,进而为Cr6的污染治理提供可靠依据,本研究采用分子生物技术,以重金属广谱抗性菌株Cupriavidus metallidurans CH34的pMOL28质粒上铬抗性调控系统的启动子和调控蛋白基因为传感器调控元件,以北美萤火虫Photinus pyralis的萤火虫荧光素酶基因luc为报告基因构建了一种可对Cr6+生物可利用度进行检测的微生物全细胞传感器CB10,并探究了其在不同检测条下的响应特征.结果表明,微生物全细胞传感器CB10在30 min内即可响应一定浓度的Cr6+;其对Cr6的检测最低限LOD为2μmol· L-1;当Cr6的浓度为20 ~ 200 μmol·L-1时,CB10的响应能力与Cr6+浓度线性相关,进而传感器CB10可对该范围内的Cr6+生物可利用度进行定量分析(R2=0.980 55);当重金属诱导浓度为10~ 50 μmol·L-1时,CB10对Cr6+具有较强的响应特异性;本研究也发现,较高浓度的pb2+、Mn2+和Sb2+也可以产生对CB10的诱导能力;诱导温度为30℃,pH为7时,CB10的响应效率最高;诱导温度为15 ~ 30℃,pH为4~7时,CB10响应能力表现稳定.CB10具备较强的响应速率、灵敏度、特异性和稳定性,具备对水体重金属进行快速检测和土壤重金属的生物可利用进行评价的潜力.%A microbial whole-cell biosensor CB10 for the bioavailability assessing of Cr6+ was constructed by molecular biotechnology. The regulatory gene and promoter of CB10 was from the chromium resistance system of plasmid pMOL28 from Cupriavidus metallidurans CH34, and the reporter gene of CB10 was luc which was derived from Photinus pyralis. Finally, its response characteristic was discussed under different incubation conditions e. g. pH and temperature. The results showed that a microbial whole-cell biosensor CB10 had been successfully constructed which could respond to Cr6+ within 30 min , with a LOD for Cr6+ of 2 μmol·L-1. When the incubation concentration of

  3. Rapid identification of LT+ E. coli by means of PCR and its test comparisons

    Institute of Scientific and Technical Information of China (English)

    Ying Xia Cui; Hai Feng Shao; Yu Hua Yang

    2000-01-01

    AIM To select a test method for specifical, sensitive and rapid identification of LT+ E. coli.METHODS Stool samples inoculated into LB solution were cultured for 4 hours at 35℃. 10 μ boiled culturesolution was taken to template. Two oligonucleotide primers were used in a polymerase chain reaction (PCR)procedure to amplify a highly conserved DNA sequence of the A subunit of the heat-labile enterotoxin.Detection of the 110 bp amplified product can be done by agarose gel electrophoresis. Thirty strains ofknown bacteria (LT+ E. coli (EC-129), ST+ E. coli (EC-130)and LT+ ST+ E. coli (EC-142), Salmonellatyphimurium , Salmonella typhi , Salmonella paratyphi A, Salmonella group C, Shigella sonnei , Enterobacteraerogenes, Alcaligenes sp, Providencia rettgeri, Proteus mirabilis, Morganella morganii, Pseudomouasaeruginosa, Aeromonas hydrophila, Klebsiella pneumoniae, Citrobacter diversus, Enterobacter cloacae, 12strains of E. coli isolated from bile samples ) and 108 diarrhea samples were detected. A total of 108 diarrheasamples were compared with LT probe hybridization, modified Eleck (M-Eleck) and ELISA simultaneously.RESULTS By PCR, of the 30 strains of bacteria, only LT+ E. coli and LT+ ST+ E. coli were positive; in40 of the 108 diarrhea samples, 20 were positive and in the other 68 samples from infants, only five werefound to be positive. Of the 25 positive samples by PCR, 23 were also found to be positive in the other 3tests; 1 was found to be positive by M-Eleck and ELISA. Of the 83 negative samples by PCR, the samenegative results were found by M-EIeck and ELISA, but 2 were found to be positive by LT probehybridization. The overall coincidence rate was about 95%. Analysis of correlation showed a significantdifference between PCR and other three tests (P0.05) between them. In the detection of LT+ E. coli by means of PCR, the minimumnumber of target bacteria required was 50 CFU. The whole test was finished in 7 hours.CONCLUSION Detection of LT+ E. coli by PCR showed

  4. Isolation and Genetic Analysis of Multidrug Resistant Bacteria from Diabetic Foot Ulcers.

    Science.gov (United States)

    Shahi, Shailesh K; Kumar, Ashok

    2015-01-01

    Severe diabetic foot ulcers (DFUs) patients visiting Sir Sunderlal Hospital, Banaras Hindu University, Varanasi, were selected for this study. Bacteria were isolated from swab and deep tissue of 42 patients, for examining their prevalence and antibiotic sensitivity. DFUs of majority of the patients were found infected with Enterococcus spp. (47.61%), Escherichia coli (35.71%), Staphylococcus spp. (33.33%), Alcaligenes spp. (30.95%), Pseudomonas spp. (30.95%), and Stenotrophomonas spp. (30.95%). Antibiotic susceptibility assay of 142 bacteria with 16 antibiotics belonging to eight classes showed the presence of 38 (26.76%) isolates with multidrug resistance (MDR) phenotypes. MDR character appeared to be governed by integrons as class 1 integrons were detected in 26 (68.42%) isolates. Altogether six different arrays of genes (aadA1, aadB, aadAV, dhfrV, dhfrXII, and dhfrXVII) were found within class 1 integron. Gene cassette dhfrAXVII-aadAV (1.6 kb) was present in 12 (3 Gram positive and 9 Gram negative) isolates and was conserved across all the isolates as evident from RFLP analysis. In addition to the presence of class 1 integron, six β-lactamase resistance encoding genes namely bla TEM, bla SHV, bla OXA, bla CTX-M-gp1, bla CTX-M-gp2, and bla CTX-M-gp9 and two methicillin resistance genes namely mecA and femA and vancomycin resistance encoding genes (vanA and vanB) were identified in different isolates. Majority of the MDR isolates were positive for bla TEM (89.47%), bla OXA (52.63%), and bla CTX-M-gp1 (34.21%). To our knowledge, this is the first report of molecular characterization of antibiotic resistance in bacteria isolated from DFUs from North India. In conclusion, findings of this study suggest that class-1 integrons and β-lactamase genes contributed to the MDR in above bacteria. PMID:26779134

  5. Gene regulation of plasmid- and chromosome-determined inorganic ion transport in bacteria.

    Science.gov (United States)

    Silver, S; Walderhaug, M

    1992-03-01

    Regulation of chromosomally determined nutrient cation and anion uptake systems shows important similarities to regulation of plasmid-determined toxic ion resistance systems that mediate the outward transport of deleterious ions. Chromosomally determined transport systems result in accumulation of K+, Mg2+, Fe3+, Mn2+, PO4(3-), SO4(2-), and additional trace nutrients, while bacterial plasmids harbor highly specific resistance systems for AsO2-, AsO4(3-), CrO4(2-), Cd2+, Co2+, Cu2+, Hg2+, Ni2+, SbO2-, TeO3(2-), Zn2+, and other toxic ions. To study the regulation of these systems, we need to define both the trans-acting regulatory proteins and the cis-acting target operator DNA regions for the proteins. The regulation of gene expression for K+ and PO4(3-) transport systems involves two-component sensor-effector pairs of proteins. The first protein responds to an extracellular ionic (or related) signal and then transmits the signal to an intracellular DNA-binding protein. Regulation of Fe3+ transport utilizes the single iron-binding and DNA-binding protein Fur. The MerR regulatory protein for mercury resistance both represses and activates transcription. The ArsR regulatory protein functions as a repressor for the arsenic and antimony(III) efflux system. Although the predicted cadR regulatory gene has not been identified, cadmium, lead, bismuth, zinc, and cobalt induce this system in a carefully regulated manner from a single mRNA start site. The cadA Cd2+ resistance determinant encodes an E1(1)-1E2-class efflux ATPase (consisting of two polypeptides, rather than the one earlier identified). Cadmium resistance is also conferred by the czc system (which confers resistances to zinc and cobalt in Alcaligenes species) via a complex efflux pump consisting of four polypeptides. These two cadmium efflux systems are not otherwise related. For chromate resistance, reduced cellular accumulation is again the resistance mechanism, but the regulatory components are not identified

  6. ISOLATION AND CHARACTERIZATION OF RHIZOBIA AND PLANT GROWTH-PROMOTING RHIZOBACTERIA AND THEIR EFFECTS ON GROWTH OF RICE SEEDLINGS

    Directory of Open Access Journals (Sweden)

    K. Z. Tan

    2014-01-01

    Full Text Available Biofertilizer is a relatively safer, environmentally friendly and cost-effective approach as an alternative to reduce chemical fertilizer usage. The selection of bacterial strains with multiple beneficial characteristics are important to maximize the effectiveness on the host plant. Due to aforementioned interest, several Plant Growth-Promoting Rhizobacterial (PGPR and rhizobial strains were isolated from rice and legume roots, respectively, at four locations in Malaysia namely Universiti Putra Malaysia (UPM, Serdang, Selangor; Besut, Terengganu; Tunjung, Kelantan and Sik, Kedah. Bacterial isolations were undertaken to select the best isolates which exhibit multiple beneficial effects to the rice plant and a total of 205 bacterial strains were isolated and categorized as follows; 94 rhizospheric and 107 endophytic bacteria from rice roots, one rhizobial strain from soybean and three from Mimosa pudica. These isolates were screened for their abilities to fix N2 and solubilize phosphate; 52 were positive for both tests. The selected isolates were then tested for IAA production and other biochemical tests such as potassium solubilization, hydrolyzing enzymes (cellulase and pectinase and iron siderophore productions. Four isolates, namely UPMB19 (rhizospheric PGPR from Tunjung, Kelantan, UPMB20 (endophytic PGPR from Besut, Terengganu, UPMR30 (rhizobia from soybean and UPMR31 (rhizobia from Mimosa were selected for subsequent plant inoculation tests with UPMB10, a PGPR isolated from oil palm root, as the reference strain. Based on 16S rDNA gene sequencing, these bacterial strains were identified under several genera: Lysinibacillus, Alcaligenes, Bradyrhizobium, Rhizobium and Bacillus, respectively. Results of plant inoculation test indicated that UPMB19 significantly enhanced the seedling height at the early growth stage (7 days after transplanting, DAT which could be attributed to the higher N2

  7. Differential sensitivity of aerobic gram-positive and gram-negative microorganisms to 2,4,6-trinitrotoluene (TNT) leads to dissimilar growth and TNT transformation: Results of soil and pure culture studies

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, M.E.; Manning, J.F. Jr.

    1996-07-30

    The effects of 2,4,6-trinitrotoluene (TNT) on indigenous soil populations and pure bacterial cultures were examined. The number of colony-forming units (CFU) appearing when TNT-contaminated soil was spread on 0.3% molasses plates decreased by 50% when the agar was amended with 67 {mu}g TNT mL{sup -1}, whereas a 99% reduction was observed when uncontaminated soil was plated. Furthermore, TNT-contaminated soil harbored a greater number of organisms able to grow on plates amended with greater than 10 {mu}g TNT mL{sup -1}. The percentage of gram-positive isolates was markedly less in TNT-contaminated soil (7%; 2 of 30) than in uncontaminated soil (61%; 20 of 33). Pseudomonas aeruginosa, Pseudomonas corrugate, Pseudomonasfluorescens and Alcaligenes xylosoxidans made up the majority of the gram-negative isolates from TNT-contaminated soil. Gram-positive isolates from both soils demonstrated marked growth inhibition when greater than 8-16 {mu}g TNT mL{sup -1} was present in the culture media. Most pure cultures of known aerobic gram-negative organisms readily degraded TNT and evidenced net consumption of reduced metabolites. However, pure cultures of aerobic gram-positive bacteria were sensitive to relatively low concentrations of TNT as indicated by the 50% reduction in growth and TNT transformation which was observed at approximately 10 {mu}g TNT mL{sup -1}. Most non-sporeforming gram-positive organisms incubated in molasses media amended with 80 {mu}g TNT mL{sup -1} or greater became unculturable, whereas all strains tested remained culturable when incubated in mineral media amended with 98 {mu}g TNT mL{sup -1}, indicating that TNT sensitivity is likely linked to cell growth. These results indicate that gram-negative organisms are most likely responsible for any TNT transformation in contaminated soil, due to their relative insensitivity to high TNT concentrations and their ability to transform TNT.

  8. Relative rates of nitric oxide and nitrous oxide production by nitrifiers, denitrifiers, and nitrate respirers.

    Science.gov (United States)

    Anderson, I C; Levine, J S

    1986-05-01

    Biogenic emissions of nitric and nitrous oxides have important impacts on the photochemistry and chemistry of the atmosphere. Although biogenic production appears to be the overwhelming source of N(2)O, the magnitude of the biogenic emission of NO is very uncertain. In soils, possible sources of NO and N(2)O include nitrification by autotrophic and heterotrophic nitrifiers, denitrification by nitrifiers and denitrifiers, nitrate respiration by fermenters, and chemodenitrification. The availability of oxygen determines to a large extent the relative activities of these various groups of organisms. To better understand this influence, we investigated the effect of the partial pressure of oxygen (pO(2)) on the production of NO and N(2)O by a wide variety of common soil nitrifying, denitrifying, and nitrate-respiring bacteria under laboratory conditions. The production of NO per cell was highest by autotrophic nitrifiers and was independent of pO(2) in the range tested (0.5 to 10%), whereas N(2)O production was inversely proportional to pO(2). Nitrous oxide production was highest in the denitrifier Pseudomonas fluorescens, but only under anaerobic conditions. The molar ratio of NO/N(2)O produced was usually greater than unity for nitrifiers and much less than unity for denitrifiers. Chemodenitrification was the major source of both the NO and N(2)O produced by the nitrate respirer Serratia marcescens. Chemodenitrification was also a possible source of NO and N(2)O in nitrifier cultures but only when high concentrations of nitrite had accumulated or were added to the medium. Although most of the denitrifiers produced NO and N(2)O only under anaerobic conditions, chemostat cultures of Alcaligenes faecalis continued to emit these gases even when the cultures were sparged with air. Based upon these results, we predict that aerobic soils are primary sources of NO and that N(2)O is produced only when there is sufficient soil moisture to provide the anaerobic microsites

  9. A Novel Triculture System (CC3) for Simultaneous Enzyme Production and Hydrolysis of Common Grasses through Submerged Fermentation

    Science.gov (United States)

    Leo, Vincent V.; Passari, Ajit K.; Joshi, J. Beslin; Mishra, Vineet K.; Uthandi, Sivakumar; Ramesh, N.; Gupta, Vijai K.; Saikia, Ratul; Sonawane, Vijay C.; Singh, Bhim P.

    2016-01-01

    The perennial grasses are considered as a rich source of lignocellulosic biomass, making it a second generation alternative energy source and can diminish the use of fossil fuels. In this work, four perennial grasses Saccharum arundinaceum, Panicum antidotale, Thysanolaena latifolia, and Neyraudia reynaudiana were selected to verify their potential as a substrate to produce hydrolytic enzymes and to evaluate them as second generation energy biomass. Here, cellulase and hemi-cellulase producing three endophytic bacteria (Burkholderia cepacia BPS-GB3, Alcaligenes faecalis BPS-GB5 and Enterobacter hormaechei BPS-GB8) recovered from N. reynaudiana and S. arundinaceum were selected to develop a triculture (CC3) consortium. During 12 days of submerged cultivation, a 55–70% loss in dry weight was observed and the maximum activity of β-glucosidase (5.36–12.34 IU) and Xylanase (4.33 to 10.91 IU) were observed on 2nd and 6th day respectively, whereas FPase (0.26 to 0.53 IU) and CMCase (2.31 to 4.65 IU) showed maximum activity on 4th day. Around 15–30% more enzyme activity was produced in CC3 as compared to monoculture (CC1) and coculture (CC2) treatments, suggested synergetic interaction among the selected three bacterial strains. Further, the biomass was assessed using Fourier-transform infrared spectroscopy (FTIR) and Scanning electron microscopy (SEM). The FTIR analysis provides important insights into the reduction of cellulose and hemicellulose moieties in CC3 treated biomass and SEM studies shed light into the disruption of surface structure leading to access of cellulose or hemicelluloses microtubules. The hydrolytic potential of the CC3 system was further enhanced due to reduction in lignin as evidenced by 1–4% lignin reduction in biomass compositional analysis. Additionally, laccase gene was detected from A. faecalis and E. hormaechei which further shows the laccase production potential of the isolates. To our knowledge, first time we develop an effective

  10. The respiratory arsenite oxidase: structure and the role of residues surrounding the rieske cluster.

    Directory of Open Access Journals (Sweden)

    Thomas P Warelow

    Full Text Available The arsenite oxidase (Aio from the facultative autotrophic Alphaproteobacterium Rhizobium sp. NT-26 is a bioenergetic enzyme involved in the oxidation of arsenite to arsenate. The enzyme from the distantly related heterotroph, Alcaligenes faecalis, which is thought to oxidise arsenite for detoxification, consists of a large α subunit (AioA with bis-molybdopterin guanine dinucleotide at its active site and a 3Fe-4S cluster, and a small β subunit (AioB which contains a Rieske 2Fe-2S cluster. The successful heterologous expression of the NT-26 Aio in Escherichia coli has resulted in the solution of its crystal structure. The NT-26 Aio, a heterotetramer, shares high overall similarity to the heterodimeric arsenite oxidase from A. faecalis but there are striking differences in the structure surrounding the Rieske 2Fe-2S cluster which we demonstrate explains the difference in the observed redox potentials (+225 mV vs. +130/160 mV, respectively. A combination of site-directed mutagenesis and electron paramagnetic resonance was used to explore the differences observed in the structure and redox properties of the Rieske cluster. In the NT-26 AioB the substitution of a serine (S126 in NT-26 for a threonine as in the A. faecalis AioB explains a -20 mV decrease in redox potential. The disulphide bridge in the A. faecalis AioB which is conserved in other betaproteobacterial AioB subunits and the Rieske subunit of the cytochrome bc 1 complex is absent in the NT-26 AioB subunit. The introduction of a disulphide bridge had no effect on Aio activity or protein stability but resulted in a decrease in the redox potential of the cluster. These results are in conflict with previous data on the betaproteobacterial AioB subunit and the Rieske of the bc 1 complex where removal of the disulphide bridge had no effect on the redox potential of the former but a decrease in cluster stability was observed in the latter.

  11. Study on Antimicrobial Activity of Alkaloids in Sophora flavescens and S.tonkinensis%苦参、山豆根生物碱及其总碱的抑菌活性研究

    Institute of Scientific and Technical Information of China (English)

    戴五好; 钱利武; 杨士友; 周国勤; 王丽丽

    2012-01-01

    目的:通过研究苦参、山豆根中生物碱及其总碱的体外抑菌活性,探讨苦参碱类化合物抑菌活性与结构之间的相关性.方法:采用牛津杯法,菌株37℃恒温培养24 h,检测苦参、山豆根中生物碱对7种菌株(金黄色葡萄球菌、铜绿假单胞菌、产碱假单胞菌、恶臭假单胞菌、肺炎链球菌、甲型溶血性链球菌、乙型溶血性链球菌)的抑制作用.结果:苦参、山豆根中生物碱对7种菌株均有抑制作用,其中氧化苦参碱、氧化槐果碱的抗菌作用较弱,槐定碱对甲型溶血性链球菌、乙型溶血性链球菌抗菌作用显著,抑菌圈分别达到(2.60 ±0.10),(2.53 ±0.15)cm.苦参总碱、山豆根总碱对乙型溶血性链球菌的抑菌圈分别为(2.43 ±0.21),(1.77±0.05)cm.结论:苦参、山豆根中生物碱的结构与抑菌活性有一定的联系,苦参、山豆根中生物碱可作为天然抗菌成分加以开发和利用.%Objective: By studying the alkaloids of Sophora flavescens and Sophora tonkinensis in vitro antibacterial activity, the relationship between the antibacterial activity and structure was examined. Method: Using Oxford cup method, strains had been cultured for 24 hours at a constant temperature of 37 ℃,the antimicrobial effect of alkaloids in S. Flavescens and S. Tonkinensis was studied in vitro against seven strains (Staphylococcus aureus, Pseudomonas aeruginosa, P. Alcaligenes, P. Putida, Streptococcus pneumoniae, a-hemolytic streptococcus, β-hemolytic streptococcus). Result; The experimental results indicated the alkaloids in 5. Flavescens and S. Tonkinensis showed the good inhibiting effect for seven strains, antibacterial activities of oxymatrine and oxysophocarpine were weak in vitro antibacterial activities of sophoridine showed remarkable effect for ctihemolytic streptococcus and β-hemolytic streptococcus, the inhibition zones by sophoridine were (2. 60 ±0. 10) , (2. 53 ±0. 15) cm to a-hemolytic streptococcus and

  12. Bioavailability enhanced rhizosphere remediation of petroleum hydrocarbon contaminated soil

    International Nuclear Information System (INIS)

    contain were analyzed by gas chromatography method. Four bioassays were used to measure toxicity during bio-remediation of soil contaminated by petroleum hydrocarbons: Microtox(R) test, SOSchromotest, lettuce seed germination and sheep red blood cell (RBS) hemolysis assay. Rhizosphere remediation was found to be effective for removal of polycyclic aromatic hydrocarbons (PAHs), total petroleum hydrocarbons (TPHs) from soil with the use of alfalfa inoculated by the Pseudomonas stutzeri MEV-S1 strain (RU 2228952 patent) and oats inoculated by the Pseudomonas alcaligenes MEV strain (RU 2228953 patent) in vegetation and field experiments. The reduction of the TPH and PAH concentrations in soil was accompanied by the reduction of integral toxicity and genotoxicity, evaluated by bio-testing. It is conceivable, therefore, that a possible way to optimize petroleum hydrocarbons phyto-remediation is the use of selected plants and microbial inoculants with specific chemotactic affinities and bio-surfactant production. The proposed technology for soil bio-remediation with the use of integrated plant-microbial system is ecologically and toxicologically safe and economically attractive

  13. Bioavailability enhanced rhizosphere remediation of petroleum hydrocarbon contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Marchenko, A.; Vorobyov, A.; Zharikov, G.; Ermolenko, Z.; Dyadishchev, N.; Borovick, R.; Sokolov, M. [Research Centre for Toxicology and Hygienic Regulation of Biopreparations, Moscow region (Russian Federation); Ortega-Calvo, J.J. [Instituto de Recursos Naturales y Agrobiologia, CSIC, Sevilla (Spain)

    2005-07-01

    contain were analyzed by gas chromatography method. Four bioassays were used to measure toxicity during bio-remediation of soil contaminated by petroleum hydrocarbons: Microtox(R) test, SOSchromotest, lettuce seed germination and sheep red blood cell (RBS) hemolysis assay. Rhizosphere remediation was found to be effective for removal of polycyclic aromatic hydrocarbons (PAHs), total petroleum hydrocarbons (TPHs) from soil with the use of alfalfa inoculated by the Pseudomonas stutzeri MEV-S1 strain (RU 2228952 patent) and oats inoculated by the Pseudomonas alcaligenes MEV strain (RU 2228953 patent) in vegetation and field experiments. The reduction of the TPH and PAH concentrations in soil was accompanied by the reduction of integral toxicity and genotoxicity, evaluated by bio-testing. It is conceivable, therefore, that a possible way to optimize petroleum hydrocarbons phyto-remediation is the use of selected plants and microbial inoculants with specific chemotactic affinities and bio-surfactant production. The proposed technology for soil bio-remediation with the use of integrated plant-microbial system is ecologically and toxicologically safe and economically attractive.

  14. Bioreactor-based bioremediation of hydrocarbon-polluted Niger Delta marine sediment, Nigeria.

    Science.gov (United States)

    Chikere, Chioma Blaise; Chikere, Blaise Ositadinma; Okpokwasili, Gideon Chijioke

    2012-03-01

    Crude oil-polluted marine sediment from Bonny River loading jetty Port Harcourt, Nigeria was treated in seven 2.5 l stirred-tank bioreactors designated BNPK, BNK5, BPD, BNO(3), BUNa, BAUT, and BUK over a 56-day period. Five bioreactors were biostimulated with either K(2)HPO(4), NH(4)NO(3), (NH(4))(2)SO(4), NPK, urea or poultry droppings while unamended (BUNa) and heat-killed (BAUT) treatments were controls. For each bioreactor, 1 kg (wet weight) sediment amended with 1 l seawater were spiked with 20 ml and 20 mg of crude oil and anthracene which gave a total petroleum hydrocarbons (TPH) range of 106.4-116 ppm on day 0. Polycyclic aromatic hydrocarbons (PAH) in all spiked sediment slurry ranged from 96.6 to 104.4 ppm. TPH in each treatment was ≤14.9 ppm while PAH was ≤6.8 ppm by day 56. Treatment BNO(3) recorded highest heterotrophic bacterial count (9.8 × 10(8) cfu/g) and hydrocarbon utilizers (1.15 × 10(8) cfu/g). By day 56, the percentages of biodegradation of PAHs, as measured with GC-FID were BNK5 (97.93%), BNPK (98.38%), BUK (98.82%), BUNa (98.13%), BAUT (93.08%), BPD (98.92%), and BNO(3) (98.02%). BPD gave the highest degradation rate for PAH. TPH degradation rates were as follows: BNK5 (94.50%), BNPK (94.77%), BUK (94.10%), BUNa (94.77%), BAUT (75.04%), BPD (95.35%), BNO(3) (95.54%). Fifty-six hydrocarbon utilizing bacterial isolates obtained were Micrococcus spp. 5 (9.62%), Staphylococcus spp. 3 (5.78%), Pseudomonas spp. 7 (13.46%), Citrobacter sp. 1 (1.92%), Klebsiella sp. 1 (1.92%), Corynebacterium spp. 5 (9.62%), Bacillus spp. 5 (9.62%), Rhodococcus spp. 7 (13.46%), Alcanivorax spp. 7 (13.46%), Alcaligenes sp. 1 (1.92%), Serratia spp. 2 (3.85%), Arthrobacter spp. 7 (13.46%), Nocardia spp. 2 (3.85%), Flavobacterium sp. 1 (1.92%), Escherichia sp. 1 (1.92%), Acinetobacter sp. 1 (1.92%), Proteus sp. 1 (1.92%) and unidentified bacteria 10 (17%). These results indicate that the marine sediment investigated is amenable to bioreactor

  15. Duševní stav málo a pravidelně tělesně aktivních žen ve druhém trimestru těhotenství The state of mind of less physically active and regularly physically active women in the second trimester of their pregnancies

    Directory of Open Access Journals (Sweden)

    Damir Karpljuk

    2008-04-01

    ětluje 23,51 % variance z celkových 34,91 % vysvětlené variance. Těhotné ženy skupiny PTA tedy svůj stav defi novaly většinou jako pozitivní, s následujícími emocemi: uvolněný, spokojený, příjemný, nepesimistický, přitažlivý, hrdý a šťastný. U skupiny NTA byl prvním eliminovaným faktorem faktor spojený s negativními emocemi, což vysvětluje 19,45 % variance z celkových 34,68 % vysvětlené variance. Tato skupina těhotných žen defi novala svůj stav většinou jako negativní, s následujícími opakujícími se emocemi: melancholický, napjatý, vznětlivý, depresivní a nervózní. Zjištěná fakta ukazují, že pravidelná sportovní aktivita prospívá duševnímu stavu a duševnímu zdraví těhotných žen. The moment a woman fi nds out that she is pregnant, her life changes in many aspects as she starts to adjust to the baby growing in her body. Her wish is to feel well, to safely reach the due date and give birth to a healthy child. We conducted a survey among 163 pregnant women at the end of the second trimester of their pregnancies and this article presents the relationship between their sport activity and their state of mind during pregnancy. Two groups of pregnant women, namely those who were regularly physically active (RPA and those with a low level of being physically active (LPA were compared and the relationship between their level of sport activity and their state of mind was established. The first part of the inventory focused on sport activity, namely – the frequency, forms and types of their sport activities. The RPA group consisted of 69 pregnant women who regularly engage in organised sport activities at sport centres or are physically active 3 to 4 times a week in an unorganised way. Activities which lasted for 30 minutes or more were considered. The LPA group consisted of 94 pregnant women who were physically active only occasionally or were physically inactive. The second part of the inventory investigating

  16. 济南市1300例儿童呼吸道疾病流行病学分析%Epidemiological investigation on respiratory diseases in 1 300 children, in Jinan, Shandong

    Institute of Scientific and Technical Information of China (English)

    张昕婷; 张俊英; 曹爱华

    2014-01-01

    Objective To analyze the characteristics of respiratory diseases and to provide scientific basis for developing relevant control measures.Methods 1 300 children with respiratory diseases were treated in hospitals,from Jan.2013 to May 2014,in the city of Jinan.Characteristics of respiratory diseases were analyzed.Results The distribution of respiratory diseases in children appeared as:373 cases of pneumonia (28.7%),3 cases of pulmonary tuberculosis (0.2%),467 cases of acute bronchitis (35.9%),102 cases of asthma (7.8%),and 355 cases of upper respiratory tract infection (27.3%).The upper respiratory tract infection contained 168 cases of tonsillitis (12.9%),91 cases of pharyngitis (7.0%),52 cases of laryngitis (4.0%) and 44 cases of iaryngopharyngitis (3.4%).The age distribution of cases with children respiratory diseases appeared as:71 cases < 1 years old (5.5%),385 cases as 1-2 years old (29.6%),534 cases as 3-6 years old (41.1%),258 cases as 7-12 years old (19.8%) and 52 cases as >13 years old (4.0%).The seasonal distribution of children respiratory diseases appeared as:364 cases in Spring (28.0%),163 cases in summer (12.5%),315 cases in autumn (24.2%) and 458 cases in winter (35.2%).Regional distribution of children respiratory diseases appeared as:516 cases in urban area (39.7%),225 cases in suburb (17.3%),376 cases in townships (28.9%) and 183 in villages (14.1%).725 strains were isolated and identified that containing 349 strains (48.1%) of Mycoplasma pneumoniae,136 strains (18.8%) of Haemophilus influenza,103 strains (14.2%) of Streptococcus pneumoniae,82 strains (11.3%) of Klebsiella pneumoniae,38 strains (5.2%) of Acinetobacter baumannii,35 strains(4.8%) of Enterobacter cloacae,22 strains (3.0%) of Streptococcus pyogenes,17 strains (2.3%) of Alcaligenes,16 strains (2.2% of Candida albicans) and 9 strains (1.2%) of Flavobacterium indologenes.1 288 cases (99.1%) were cured.Conclusion The

  17. Toward Open Science at the European Scale: Geospatial Semantic Array Programming for Integrated Environmental Modelling

    Science.gov (United States)

    de Rigo, Daniele; Corti, Paolo; Caudullo, Giovanni; McInerney, Daniel; Di Leo, Margherita; San-Miguel-Ayanz, Jesús

    2013-04-01

    -European Framework for Integrated Soil Water Erosion Assessment. Vol. 359 of IFIP Advances in Information and Communication Technology. Springer Boston, Berlin, Heidelberg, Ch. 34, pp. 310-318. http://dx.doi.org/10.1007/978-3-642-22285-6_34 San-Miguel-Ayanz, J., Schulte, E., Schmuck, G., Camia, A., Strobl, P., Liberta, G., Giovando, C., Boca, R., Sedano, F., Kempeneers, P., McInerney, D., Withmore, C., de Oliveira, S. S., Rodrigues, M., Durrant, T., Corti, P., Oehler, F., Vilar, L., Amatulli, G., Mar. 2012. Comprehensive monitoring of wildfires in Europe: The European Forest Fire Information System (EFFIS). In: Tiefenbacher, J. (Ed.), Approaches to Managing Disaster - Assessing Hazards, Emergencies and Disaster Impacts. InTech, Ch. 5. http://dx.doi.org/10.5772/28441 de Rigo, D., Caudullo, G., San-Miguel-Ayanz, J., Stancanelli, G., 2012. Mapping European forest tree species distribution to support pest risk assessment. In: Baker, R., Koch, F., Kriticos, D., Rafoss, T., Venette, R., van der Werf, W. (Eds.), Advancing risk assessment models for invasive alien species in the food chain: contending with climate change, economics and uncertainty. Bioforsk FOKUS 7. OECD Co-operative Research Programme on Biological Resource Management for Sustainable Agricultural Systems; Bioforsk - Norwegian Institute for Agricultural and Environmental Research. http://www.pestrisk.org/2012/BioforskFOKUS7-10_IPRMW-VI.pdf Estreguil, C., Caudullo, G., de Rigo, D., Whitmore, C., San-Miguel-Ayanz, J., 2012. Reporting on European forest fragmentation: Standardized indices and web map services. IEEE Earthzine. http://www.earthzine.org/2012/07/05/reporting-on-european-forest-fragmentation-standardized-indices-and-web-map-services/ Estreguil, C., de Rigo, D. and Caudullo, G. (exp. 2013). Towards an integrated and reproducible characterisation of habitat pattern. Submitted to Environmental Modelling & Software Amatulli, G., Camia, A., San-Miguel-Ayanz, J., 2009. Projecting future burnt area in the EU