WorldWideScience

Sample records for aka ajukaja ning

  1. Belöning och motivation

    OpenAIRE

    Blomqvist, Johnny

    2015-01-01

    Många företag använder sig av belöningssystem för att hålla kvar den nuvarande personalen och för att motivera personalen till ett bättre resultat i framtiden. För att ett belöningssystem skall fungera måste personalen vara motiverade. Syftet med detta arbete är att utreda vad personalen i några företag på Kimitoön anser om belöning och betydelsen av belöning i arbetet. I undersökningen utreder jag även motivationens betydelse i arbetet och vilken typ av belöning som motiverar på längre si...

  2. Riikide majandusvabaduse hindamise metoodikad ning majandusvabadus Eestis / Mario Lambing

    Index Scriptorium Estoniae

    Lambing, Mario

    2005-01-01

    Heritage Foundationi ja The Wall Street Journali uuringust "Majandusvabaduse indeks" ning Fraseri instituudi poolt koostatavast raportist "Majandusvabadus maailmas". Tabelid: Majandusvabaduse indeksite kajastatavad valdkonnad ning nende väärtused Eestis; Majandusvabaduse edetabelid. Graafik: Eesti hinne ja koht majandusvabaduse indeksites

  3. Achieving Better Privacy for the 3GPP AKA Protocol

    Directory of Open Access Journals (Sweden)

    Fouque Pierre-Alain

    2016-10-01

    Full Text Available Proposed by the 3rd Generation Partnership Project (3GPP as a standard for 3G and 4G mobile-network communications, the AKA protocol is meant to provide a mutually-authenticated key-exchange between clients and associated network servers. As a result AKA must guarantee the indistinguishability from random of the session keys (key-indistinguishability, as well as client- and server-impersonation resistance. A paramount requirement is also that of client privacy, which 3GPP defines in terms of: user identity confidentiality, service untraceability, and location untraceability. Moreover, since servers are sometimes untrusted (in the case of roaming, the AKA protocol must also protect clients with respect to these third parties. Following the description of client-tracking attacks e.g. by using error messages or IMSI catchers, van den Broek et al. and respectively Arapinis et al. each proposed a new variant of AKA, addressing such problems. In this paper we use the approach of provable security to show that these variants still fail to guarantee the privacy of mobile clients. We propose an improvement of AKA, which retains most of its structure and respects practical necessities such as key-management, but which provably attains security with respect to servers and Man-in-the- Middle (MiM adversaries. Moreover, it is impossible to link client sessions in the absence of client-corruptions. Finally, we prove that any variant of AKA retaining its mutual authentication specificities cannot achieve client-unlinkability in the presence of corruptions. In this sense, our proposed variant is optimal.

  4. Educators Eye Ning Transition to a Pay Model

    Science.gov (United States)

    Davis, Michelle R.

    2010-01-01

    The author reports on a move by the online social-networking site Ning to start charging for its services which has raised worries that new fees could stifle educators' technological collaboration and creativity and touch off similar moves by other companies that provide comparable services heavily used by educators. Ning, which provides a…

  5. 76 FR 29812 - In the Matter of the Designation of Army of Islam, aka Jaish al-Islam, aka Jaysh al-Islam, as a...

    Science.gov (United States)

    2011-05-23

    ... DEPARTMENT OF STATE [Public Notice 7464] In the Matter of the Designation of Army of Islam, aka Jaish al- Islam, aka Jaysh al-Islam, as a Foreign Terrorist Organization Pursuant to Section 219 of the... respect to Army of Islam, also known as Jaish al-Islam, also known as Jaysh al-Islam. Therefore, I hereby...

  6. 76 FR 29812 - In the Matter of the Designation of Army of Islam, aka Jaish al-Islam, aka Jaysh al-Islam; as a...

    Science.gov (United States)

    2011-05-23

    ... DEPARTMENT OF STATE [Public Notice 7463] In the Matter of the Designation of Army of Islam, aka Jaish al- Islam, aka Jaysh al-Islam; as a Specially Designated Global Terrorist Pursuant to Section 1(b... of Islam, also known as Jaish al-Islam, also known as Jaysh al-Islam, has committed, or poses a...

  7. The UMTS-AKA Protocols for Intelligent Transportation Systems

    Directory of Open Access Journals (Sweden)

    Hwang Min-Shiang

    2009-01-01

    Full Text Available The integration of communication protocols into transport systems is a much adored research area today. Much of seminal work has been reported on the topic of intelligent transportation systems (ITS in the recent years. Many advanced techniques have been garnered to improve online communication and to promote the security, comfort, and efficiency of ITS. Of primary importance to the effective application of ITS is the communication protocol used. A fascinating development is that the yesterday's Global System for Mobile Communication protocol is being replaced by the Universal Mobile Telecommunication System protocol, which is the third-generation mobile technology. This article attempts to identify a suitable communication system for ITS applications. It is impracticable to substantially modify the original UMTS-IMS-AKA protocol which is in practice because it can disturb the operation of the current system, and thus we explore other possibilities through this research. We investigate a novel protocol to make the original UMTS-IMS-AKA protocol compliant with ITS as well as adaptable into the current UMTS protocol.

  8. Distsiplinaarsest, aporeetilisest ning mittedistsiplinaarsest mõtlemisest / Airi Liimets

    Index Scriptorium Estoniae

    Liimets, Airi, 1959-

    2009-01-01

    Lähtudes Michel Foucault’ mõtetest diskursuse, kõnelevate häälte, filosoofia ja selle alguse kohta, küsib autor, missugusel viisil oleks võimalik mõelda muusikast ja muusikapedagoogikast, ja toob esile kolm mõtlemisviisi ning vaatleb neid teaduse vaatepunktist rõhuasetusega muusikapedagoogikal ja muusikal

  9. Leipzigi kirjandusauhind: "Sõda ja rahu" ning filosoofia ja perverssused

    Index Scriptorium Estoniae

    2011-01-01

    Leipzigi kirjandusmessi auhinna ilukirjanduse kategoorias sai austerlane Clemens J. Setz jutukogu "Die Lieber zur Zeit des Mahlstädter Kindes" ("Armastus Mahlstadti lapse ajal"). Tõlkeauhinna sai Barbara Conradi uue L. Tolstoi "Sõja ja rahu" tõlke eest ning aimekirjanduse ja esseistikaauhind läks Frankfurter Allgemeine Zeitungi vastutavale toimetajale Henning Ritterile

  10. Balti kalleim lao- ning tootmispindade rent on Riias / Kristo Kiviorg

    Index Scriptorium Estoniae

    Kiviorg, Kristo

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 21. sept. lk. 12. Tootmis- ja laopindade rent Baltimaades ja Soomes. Vt. samas: Tallinnas lao- ning tootmispinnad poolaastaga kallinenud kuni 37%; Helsingis on kõige rohkem tõusnud C-kvaliteediklassi pinnad; Tartu piirkonnas enamik saadaolevaid pindu keskmises või halvas seisukorras

  11. Gaasitoru, ujuv saun ning helisevad tuutud / Karin Paulus

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    2008-01-01

    Veneetsia XI arhitektuuribiennaalile kandideerinud tööde tutvustus. Biennaali teemaks on "Majade taga. Arhitektuur väljaspool ehitisi". Eestit esindab projekt "Gaasitoru", autorid Maarja Kask ja Ralf Lõoke arhitektuuribüroost Salto ning skulptor Neeme Külm. Teise koha said Eve Kask, Signe Kivi ja Andrus Kõresaar tööga "Peatus". Kolmas koht läks Villem Tomiste projektile "Veealune Veneetsia"

  12. En EU-strategi for integreret hjemmetræning

    DEFF Research Database (Denmark)

    Larsen, Torben

    i 3 forskellige EU-lande, 4) Pilotforsøg med TeleRehab som supplement til den direkte hjemmetræning og 5) Sammenfatning af evidensgrundlaget i en MTV efter den danske 4-grenede model.    Baseret på en SWOT-analyse satses der på implementering af forsøgsresultaterne via en meso-strategi, hvor et...

  13. Lapse koolivalmidus liit- ning ühevanuste rühmas / Lee Kerde

    Index Scriptorium Estoniae

    Kerde, Lee

    2008-01-01

    2006/2007. õppeaastal Tallinna viies lasteaias tehtud uuringust, et selgitada lapsevanemate ning lasteaiaõpetajate suhtumist koolivalmiduse saavutamise ühevanuste ja liitrühmas ning testida laste vaimset koolivalmidust

  14. SOCIAL NETWORKING IN PHYSICAL EDUCATION: Undergraduate Students’ Views on Ning

    Directory of Open Access Journals (Sweden)

    Gülfem SEZEN BALCIKANLI

    2012-04-01

    Full Text Available It was the aim of this study to investigate physical education undergraduate students’ views on the use of social networking, one of the most typical representations of Web 2.0 technologies. In order to do so, the researcher, who was the instructor of the class, entitled “Fair Play Education in Sport”, introduced Ning and its educational aspects to her students with a 50-minute presentation prior to the study. Following this, the students were encouraged to use this networking for 15 weeks in parallel with their class. During this application, the researcher helped the students to make the best use of Ning in educational settings. Upon the implementation, the researcher interviewed the students (n=19 in five groups on the basis of the questions prepared and piloted earlier. The interviews demonstrated that the students enjoyed using social networking in educational settings. The findings of the study were the following: Increasing student-student and teacher-student interaction, enhancing student motivation and classroom climate, sharing materials with the instructor and students, making use of students’ interests and needs, and making learning process more interesting and permanent. The research concluded that social networking could be used in PE classes effectively.

  15. Effekten av styrketräning kan begränsas mer av samtidig högintensiv intermittent aerob träning än av lågintensiv kontinuerlig aerob träning

    OpenAIRE

    Jutman, Magnus

    2012-01-01

    Introduktion Utifrån tidigare forskning har en modell föreslagits som beskriver att lågintensiv aerob uthållighetsträning ska ha mindre negativ påverkan på effekten av styrketräning jämfört med högintensiv aerob uthållighetsträning. Detta påstående har funnit visst stöd i litteraturen men vidare forskning krävs för att det ska kunna fastställas. Syfte Denna studie syftar till att undersöka ifall det föreligger någon skillnad mellan högintensiv aerob intermittent löpträning och lågintensiv aer...

  16. Sattumuslikkus, hegemoonia ning õiglus: John Rawls ja radikaalne demokraatia

    Directory of Open Access Journals (Sweden)

    Peeter Selg

    2010-12-01

    Full Text Available Artikkel käsitleb kriitiliselt üht viimaste kümnendite vastandust poliitilises filosoofias — ‘poliitilise liberalismi’ (Rawls ja ‘radikaalse demokraatia’ (Laclau ja Mouffe vahel. Artikkel püüab käivitada potentsiaalset dialoogi nende kahe näiliselt lahkneva lähenemise vahel. Kokkuvõttes näitab artikkel, et vastandus on möödarääkimine vähemalt ühes fundamentaalses mõttes: mõlemad lähenemised jagavad ühiskonnastmõtlemisel sama aluseetost. Artiklis nimetatakse seda ‘sattumuslikkuse eetoseks’ ning väidetakse, et see on kõige fundamentaalsem alusveendumus nii Laclau ja Mouffe’i ‘radikaalse demokraatia’ kui ka Rawlsi ‘õigluse kui ausameelsuse’ idee jaoks. Artikkel osutab ka ühele kesksele kitsaskohale Laclau ja Mouffe’i lähenemises: nende suutmatusele kontseptualiseerida institutsioonilisi korraldusi tulenevalt nende ülemäärasest rõhuasetust demokraatia dekonstruktiivsele potentsiaalile. Selles suhtes osutatakse ka Rawlsi käsitluse ilmselgetele eelistele, kuna see pakub juhiseid organiseerimaks demokraatlikke institutsioone.

  17. Adding Four- Dimensional Data Assimilation (a.k.a. grid nudging) to MPAS

    Science.gov (United States)

    Adding four-dimensional data assimilation (a.k.a. grid nudging) to MPAS.The U.S. Environmental Protection Agency is investigating the use of MPAS as the meteorological driver for its next-generation air quality model. To function as such, MPAS needs to operate in a diagnostic mod...

  18. Numerical modelling of ice floods in the Ning-Meng reach of the Yellow River basin

    NARCIS (Netherlands)

    Wang, C.

    2017-01-01

    The Ning-Meng reach of the Yellow River basin is located in the Inner Mongolia region at the Northern part of the Yellow River. Due to the special geographical conditions, the river flow direction is towards the North causing the Ning-Meng reach to freeze up every year in wintertime. Both during the

  19. Ettevõtte turgu valitsev seisund ning selle kuritarvitamine / Kristi Poogen

    Index Scriptorium Estoniae

    Poogen, Kristi

    1997-01-01

    Turgu valitseva ettevõtte mõistest, kaubaturust ja geograafilisest turust ning turgu valitseva seisundi kuritarvitamisest (ebaõiglased hinnad, diskrimineerimine, seosmüük) vastavalt uuele konkurentsiseaduse eelnõule

  20. Töö ning pidu Cannes ̀is / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak, 1955-

    1998-01-01

    Meeleoludest Cannes ̀i 51. filmifestivalil ja lühidalt Terry Gilliani filmist "Ratastel Las Vegasesse" ("Fear and Loathing in Las Vegas") ning Roberto Benigni filmist "Elu on ilus" ("La Vita é bella")

  1. Suurkiskja- ja kotkakahju ennetamise meetmed Eesti ja Soome saartel ning rannikualadel / T. Otstavel

    Index Scriptorium Estoniae

    Otstavel, Teet, 1964-

    2013-01-01

    Uuring käsitleb Eesti ja Soome rannikualade ja saarte loomakasvatajate võimalusi suurendada karjamaadel kaitset suurkiskjate ja merikotkaste vastu ning kasutada suurkiskjate rünnakute ennetamise meetmeid, eelkõige karjavalvekoeri

  2. Hirm taevas ning võit infosõjas / Taavi Minnik

    Index Scriptorium Estoniae

    Minnik, Taavi, 1986-

    2015-01-01

    Venemaa ja Egiptus soovivad Siinai poolsaare lennuõnnetuse põhjusena välistada terrorirünnaku võimaluse, samas kui välismeedias ning Venemaa opositsioonilistes kanalites selle üle aina valjemini arutletakse

  3. Vabadus, võrdsus ja vendlus ning liberaaldemokraatliku riigi üleilmastumine / Leif Kalev

    Index Scriptorium Estoniae

    Kalev, Leif, 1976-

    2011-01-01

    Vabadus, võrdsus ja vendlus liberaaldemokraatlikus riikluses, selle sisepinged ja alternatiivid üleilmastumise kontekstis ning kohasus tänase poliitika ja valitsemise analüüsimisel. Liberalismi rakendustest Eestis

  4. SEX AND SEARCHING FOR CHILDREN AMONG AKA FORAGERS AND NGANDU FARMERS OF CENTRAL AFRICA

    OpenAIRE

    HEWLETT, Barry S.; HEWLETT, Bonnie L.

    2010-01-01

    Few systematic studies exist on the sexual behavior of hunter-gatherers and rural central Africans. This study examines the reasons for having sex, the frequency of sex (coitus) per night, sexual practices during the post-partum sex taboo, and beliefs and practices regarding homosexuality, masturbation, the use of sexual stimulants and a variety of other sexual behaviors. Thirty-fi ve Aka and twenty-one Ngandu adults who were or had been married were interviewed. For adults 18–45 years of age...

  5. Digitalisering af færdighedstræning og laboratorieøvelser

    DEFF Research Database (Denmark)

    Nørgaard, Cita; Dahl, Mads R; Fridorff-Jens, Peter K.

    2014-01-01

    Dette temanummer af “Læring og Medier” sætter fokus på digitalisering af færdighedstræning og laboratorieøvelser på universiteter og UC’er. Der er mange krav og hensyn, som skal tilgodeses, når vi digitaliserer, og det har altid indflydelse på arbejdsgange, kommunikation og læringen. Helt....... Af eksempler kan nævnes simulerede rollespil, virtuel case undervisning, sproglig færdighedstræning, simulatorer og digitale laboratorier. I dette temanummer lægges der op til, at dele erfaringer og best practice man har gjort sig med digitalisering af færdighedstræning og anden inddragelse af medier...

  6. Autonomy, Equality, and Teaching among Aka Foragers and Ngandu Farmers of the Congo Basin.

    Science.gov (United States)

    Boyette, Adam H; Hewlett, Barry S

    2017-09-01

    The significance of teaching to the evolution of human culture is under debate. We contribute to the discussion by using a quantitative, cross-cultural comparative approach to investigate the role of teaching in the lives of children in two small-scale societies: Aka foragers and Ngandu farmers of the Central African Republic. Focal follows with behavior coding were used to record social learning experiences of children aged 4 to 16 during daily life. "Teaching" was coded based on a functional definition from evolutionary biology. Frequencies, contexts, and subtypes of teaching as well as the identity of teachers were analyzed. Teaching was rare compared to observational learning, although both forms of social learning were negatively correlated with age. Children received teaching from a variety of individuals, and they also engaged in teaching. Several teaching types were observed, including instruction, negative feedback, and commands. Statistical differences in the distribution of teaching types and the identity of teachers corresponded with contrasting forager vs. farmer foundational cultural schema. For example, Aka children received less instruction, which empirically limits autonomous learning, and were as likely to receive instruction and negative feedback from other children as they were from adults. Commands, however, exhibited a different pattern suggesting a more complex role for this teaching type. Although consistent with claims that teaching is relatively rare in small-scale societies, this evidence supports the conclusion that teaching is a universal, early emerging cognitive ability in humans. However, culture (e.g., values for autonomy and egalitarianism) structures the nature of teaching.

  7. 75 FR 6397 - AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

    Science.gov (United States)

    2010-02-09

    ... Service USA, Inc. a/k/a IFS USA, Inc. d/b/a Global Wine Logistics USA Inc. a/k/a GWL USA, Inc., and Global... Wine Logistics USA Inc. a/k/a GWL USA, Inc. (``GWL USA''); Anita McNeil; International First Service... FEDERAL MARITIME COMMISSION [Docket No. 10-01] AMC USA, Inc. v. International First Service S.A. a...

  8. Assessment of absorption of four lignan constituents of JingNing ...

    African Journals Online (AJOL)

    Purpose: To study small intestinal absorption of schisadrol A, schisandrol B, schizandrin A and schisandrin B in JingNing particles using in situ single-pass intestinal perfusion (SPIP). Methods: Absorption rate constant (Ka) and apparent permeability (Papp) of the drugs at different concentrations in various parts of rat small ...

  9. Valitud ja valitsenud : Eesti parlamentaarsete ja muude esinduskogude ning valitsuste isikkoosseis aastail 1917-1999 / Olev Olesk

    Index Scriptorium Estoniae

    Olesk, Olev, 1921-2017

    1999-01-01

    rets. rmt.: Valitud ja valitsenud : Eesti parlamentaarsete ja muude esinduskogude ning valitsuste isikkoosseis aastail 1917-1999 / koostaja Jaan Toomla. Tallinn : Eesti Rahvusraamatukogu, 1999. 474 lk.

  10. CITRA PEREMPUAN DALAM LIRIK LAGU KIMCIL KEPOLEN KARYA NDX AKA FAMILIA DALAM PERSPEKTIF LINGUISTIK KOGNITIF

    Directory of Open Access Journals (Sweden)

    Ferdi Arifin

    2017-11-01

    Full Text Available Kimcil Kepolen song is a dangdut hiphop and being popular song nowadays. This song is created by NDX a.k.a Familia that inspires people for his long journey as a labor towards a great Indonesian musician that has been loved by widely society. This lyric represents women image from NDX perspective before his successful being a great musician. The study employs qualitative method to look at Kimcil Kepolen lyric as a language fact which is able to be examined by semantic and cognitive linguistics perspective. The results shows us that Kimcil Kepolen lyric represents materialistic women are being hard to get engage and to make a serious relationship for poor men. The facts explain that materialistic women are easily breaking men’s heart and cheating to a man who has a stabble financial support.

  11. Examining short-term nutritional status among BaAka foragers in transitional economies.

    Science.gov (United States)

    Remis, Melissa J; Jost Robinson, Carolyn A

    2014-07-01

    Foragers in transitioning economies are at an increased risk of negative health outcomes as they undergo changes in subsistence patterns and diet. Here, we provide anthropometric data and examine the nutrition and health of adult BaAka foragers in relationship to declining wildlife and economic change in the Dzanga Sangha Protected Areas (APDS), Central African Republic. From June to August 2012, we collected biological data and dietary recall surveys from individuals in Mossapoula (MS) and Yandoumbé (YDBE) villages using standard anthropometric techniques and a single capillary blood finger prick. In our analysis, we identified variation in anthropometric measurements and hemoglobin levels by village (MS = 66, YDBE = 75) and gender (64 men, 77 women). Immigration, increased gun hunting and wildlife trades have reduced forager reliance on forest resources. These changes are evidenced in the marginal health of contemporary BaAka foragers of APDS. Although anthropometric measures of nutritional status do not significantly differ between communities, hemoglobin data highlight inequities in access to forest products between villages with different proximity to community hunting zones. Further, poor dietary diversity and low frequency of purchased foods in the diet indicate that the transition to a market economy has not been fully realized and diets are impoverished. Economic changes appear to have had the most impact at MS village, where forest use is most restricted and consumption of meat and forest products was reduced. This work highlights the nutritional and health needs of foragers in rapidly transitioning economies; especially those impacted by conservation management and zoning policies. © 2014 Wiley Periodicals, Inc.

  12. Tidlig struktureret mobilisering og træning af kritisk syge patienter på et dansk intensivafsnit

    DEFF Research Database (Denmark)

    Astrup Sørensen, Katrine; Hvid, Sidsel; Rolving, Nanna

    2015-01-01

    derimod anvendelig i forhold til at tilpasse niveauet for mobilisering og træning. Relevans for klinisk praksis: Tidlig mobilisering og træning er mulig at indføre med en simpel algoritme, dog med hensyntagen til individuelle screeningskriterier fra sted til sted, da disse åbenbart ikke er nemme...

  13. 78 FR 45011 - Designation of Bulut Yayla, AKA: Samet Ince as a Specially Designated Global Terrorist Pursuant...

    Science.gov (United States)

    2013-07-25

    ... DEPARTMENT OF STATE [Public Notice 8390] Designation of Bulut Yayla, AKA: Samet Ince as a... risk of committing, acts of terrorism that threaten the security of U.S. nationals or the national security, foreign policy, or economy of the United States. Consistent with the determination in Section 10...

  14. Inre och yttre motivation till träning : en kvalitativ studie bland regebundet aktiva kvinnor

    OpenAIRE

    Jonsson, Johanna

    2015-01-01

    Bakgrund: Regelbunden träning är viktig för både fysiskt och psykisktvälbefinnande. För att bibehålla en regelbundenhet i träningen krävs det ettengagemang och en motivation. En person kan motiveras av både inre ochyttre faktorer beroende på personens intresse. Trots att människor tenderaratt vara mer stillasittande, tycks intresset för träning och hälsa öka. Inteminst syns detta på sociala medier, där bilder och inlägg medträningsbudskap förmedlas frekvent. Syfte: Studiens syfte är att under...

  15. Athena konverentsi- ja kultuurikeskus ning restoran Volga = Athena Conference and Cultural Centre and Volga Restaurant

    Index Scriptorium Estoniae

    2008-01-01

    Athena konverentsi- ja kultuurikeskuse ning restorani Volga sisekujundusest (Tartus Küütri 1 asuva Athena kinohoone renoveerimine). Sisearhitekt: Aivar Roosaar. Restaureeriti ka muinsuskaitse alla kuuluvad Ferdi Sannamehe neoklassitsistlikud stukkreljeefid kinosaali seintel ja Peet Areni maalid restorani vitraažlaega keldrisaali nishshides. A. Roosaarest, tema tähtsamad tööd. I-III korruse, vahekorruse ja pööningu plaan, värv. välisvaade, 15 sisevaadet, foto A. Roosaarest

  16. AKA-TPG: a program for kinetic and epidemiological analysis of data from labeled glucose investigations using the two-pool model and database technology

    DEFF Research Database (Denmark)

    Boston, Raymond C; Stefanovski, Darko; Henriksen, Jan E

    2007-01-01

    of technical reasons have deterred researchers from performing TPG analysis. METHODS AND RESULTS: In this paper, we describe AKA-TPG, a new program that combines automatic kinetic analysis of the TPG model data with database technologies. AKA-TPG enables researchers who have no expertise in modeling to quickly...... fit the TPG model to individual FSHGT data sets consisting of plasma concentrations of unlabeled glucose, labeled glucose, and insulin. Most importantly, because the entire process is automated, parameters are almost always identified, and parameter estimates are accurate and reproducible. AKA...

  17. Ning Wang, Making a Market Economy; Yan Sun, Corruption and Market in Contemporary China

    OpenAIRE

    Guiheux, Gilles

    2008-01-01

    These two works shed light on the conditions under which, in the course of the last 25 years, the command economy has been dismantled and gradually replaced by a market system in China . Yan Sun, a professor of political science, is interested in corruption from a double perspective, both at the macro and the micro level. Ning Wang, a neo-institutionalist economist, asks how, thanks to the reforms, a region (Jingzhou, south of Hubei ) has been converted to pisciculture. Corruption is a crucia...

  18. Randomiseret klinisk undersøgelse af effekten af kognitiv adaptationstræning: design og metodediskussion

    DEFF Research Database (Denmark)

    Hansen, Jens Peter; Østergaard, Birte; Nordentoft, Merete

    2009-01-01

      Kognitiv adaptations træning er afprøvet gennem randomiserede studier i udlandet, men er ikke afprøvet på nydebuterede patienter, som modtager intensiv pleje og behandling. I denne artikel præsenteres et forskningsprojekt, som skal afgøre om kognitiv adaptations træning er velegnet i en dansk...... kontekst som supplement til nuværende tilbud til patienter med debuterende skizofreni. Studiet gennemføres som et randomiseret multicenter forsøg, hvor 164 konsekutivt inkluderede patienter fordeles til henholdsvis kognitiv adaptations træning og standardbehandling. Effekten af interventionen evalueres med......, fordelingsprocedure, bortfald, udvælgelse af patienter og sammenlignelighed mellem tilknyttede centre. Dette studie er det første studie, hvor kognitiv adaptations træning sammenlignes med et ambulant tilbud bestående af psykiatrisk behandling kombineret med hyppige hjemmebesøg ved distriktssygeplejersker. Studiet...

  19. Investeerija märksõnad : USA ning tervishoiu- ja IT-sektor / Uwe Zöllner

    Index Scriptorium Estoniae

    Zöllner, Uwe

    2008-01-01

    USA elanike tarbimise mõjust globaalsele majandusruumile. Aktsiainvesteeringuid plaanides tasuks silmas pidada tervishoiu- ja infotehnoloogiasektori ettevõtteid ning vaadata USA poole. Lisa: Hiina eksport võrreldes riigisisese tarbimisega

  20. High prevalence of cannabis use among Aka foragers of the Congo Basin and its possible relationship to helminthiasis.

    Science.gov (United States)

    Roulette, Casey J; Kazanji, Mirdad; Breurec, Sébastien; Hagen, Edward H

    2016-01-01

    Little is known about cannabis use in hunter-gatherers. Therefore, we investigated cannabis use in the Aka, a population of foragers of the Congo Basin. Because cannabis contains anthelminthic compounds, and the Aka have a high prevalence of helminthiasis, we also tested the hypothesis that cannabis use might be an unconscious form of self-medication against helminths. We collected self- and peer-reports of cannabis use from all adult Aka in the Lobaye district of the Central African Republic (n = 379). Because female cannabis use was low, we restricted sample collection to men. Using an immunoassay for Δ9-tetrahydrocannabinol-11-oic acid (THCA), a urinary biomarker of recent cannabis consumption, we validated cannabis use in men currently residing in camps near a logging road (n = 62). We also collected stool samples to assay worm burden. A longitudinal reinfection study was conducted among a subsample of the male participants (n = 23) who had been treated with a commercial anthelmintic 1 year ago. The prevalence of self- and peer-reported cannabis use was 70.9% among men and 6.1% among women, for a total prevalence of 38.6%. Using a 50 ng/ml threshold for THCA, 67.7% of men used cannabis. Cannabis users were significantly younger and had less material wealth than the non-cannabis users. There were significant negative associations between THCA levels and worm burden, and reinfection with helminths 1 year after treatment with a commercial anthelmintic. The prevalence of cannabis use among adult Aka men was high when compared to most global populations. THCA levels were negatively correlated with parasite infection and reinfection, supporting the self-medication hypothesis. © 2015 Wiley Periodicals, Inc.

  1. Tidal triggering of earthquakes in the Ning'er area of Yunnan Province, China

    Science.gov (United States)

    Xie, Chaodi; Lei, Xinglin; Zhao, Xiaoyan; Ma, Qingbo; Yang, Simeng; Wang, Yingnan

    2017-05-01

    To investigate the potential effect of tidal modulation on the seismicity in the Ning'er area, a seismically and geothermally active zone in Yunnan Province, China, we studied the correlation between Earth tides and the occurrence of M ≥ 6.0 earthquakes dating back to 1970, as well as their aftershock sequences, using theoretically calculated tidal stresses and a statistical test. The results show a significant correlation between Earth tides and the occurrence of earthquakes. Six of seven main events occurred when the Earth tide increased the Coulomb failure stress on the source fault. Four main events occurred in a narrow range of phase angle corresponding to the maximum loading rate of tidal stress. Furthermore, the histories of the aftershock sequence as a function of the tidal phases demonstrate clear tidal modulation with a high significance. Thus, we conclude that Earth tides have a clear role in triggering (or modulating) the rupture of the fault systems in the Ning'er area.

  2. Kliniske retningslinjer for træning af aerob kapacitet og muskelstyrke til patienter med reumatoid artrit

    DEFF Research Database (Denmark)

    Larsen, Birgit Tine; Læssøe, Uffe; Kjær, Thomas

    forstærker denne risiko. Formål: Gennem effektiv og sikker træning at øge RA patienters aerob kapacitet og muskel styrke for dermed atlette patienternes daglige aktiviteter. Patienter: Voksne patienter (> 18 år) med diagnosen reumatoid artrit ifølge ARA eller ACR/EULAR kriterierne,funktionsklasserne I, II og...... III, i primær eller sekundær sektoren. Intervention/er: Kortvarig land- eller vandbaseret højintensitets træning af aerob kapacitet, kortvarig eller længerevarendeland-baseret høj-intensitets træning af aerob kapacitet i kombination med muskelstyrke træning oglængerevarende land-baseret høj......-intensitets styrke træning. Inkluderet studier: Èt systematisk review og to randomiseret klinisk kontrolleret studier (RCT). Outcomes: Aerob kapacitet, maksimal muskelstyrke, selv-rapporteret smerte, funktionsevne, sygdomsaktivitet,radiologisk ledskade og uønskede bivirkninger. Søgestrategi:Følgende databaser blev...

  3. Effects of Tang Niao Ning decoction on ET-1, GMP-140 and TXB2 in diabetic rats

    International Nuclear Information System (INIS)

    Song Jumin; Wang Lifen; Liao Han; Wang Wei; Hua Weiguo

    2003-01-01

    To investigate the effects of Tang Niao Ning decoction on fasting blood glucose (FBG), total cholesterol (TC), triglyceride (TG), endothelin (ET-1), platelet granule membrane protein (GMP-140), thromboxane B 2 (TXB 2 ), 6-keto-prostaglandin F 1α (6-keto-PGF 1α ), the selected female Wistar rats were modeled by streptozotocin (STZ) and high fat diets, and were randomly divided into two groups as Tang Niao Ning and model group, while the normal control group was set up. The Tang Niao Ning group started to supply decoctions after these rats had been fed one week with high fat diets. The rats were killed after six weeks. Above items were examed. The results showed that the model group displayed marked difference when the experiment finished compared with the normal group. The contents of fasting blood glucose and blood lipid were increased, accompanied with the phenomena of hoisting ET-1, enhancing GMP-140, increasing TXB 2 and droping 6-Keto-PGF 1α . After treatment in time with Tang Niao Ning decoction, all kinds of items were adjusted to normal level gradually. It suggested that the treatment with Tang Niao Ning decoction might decrease FBG and blood lipid. In some ways, the decoction could improve the signs of blood stasis. The regulation mechanisms of the decoction was characteristic of wholism through many channels

  4. Clinical diagnostic value of combined determination of serum RF, AKA and anti-CCP antibody levels in patients with rheumatoid arthritis

    International Nuclear Information System (INIS)

    Zhao Hongcan; Xiang Guoqian

    2005-01-01

    Objective; To investigate the clinical usefulness of combined determination of serum rheumatic factor (RF), anti-keratin antibody (AKA) and anti-cyclic citrullinated peptide antibody (anti-CCP antibody) levels for early diagnosis in patients with rheumatoid arthritis (RA). Methods: Serum RF ( with rate-nephelometry), AKA (with indirect immuno-fluorescence) and anti-CCP antibody (with ELISA) levels were determined in 40 patients with RA, 30 patients with SLE and 30 controls. Results: For diagnosis of RA; the sensitivity and specificity of RF was 70.0% and 90.0% respectively, the sensitivity and specificity of AKA was 35.0% and 96.7%, the sensitivity and specificity of anti-CCP-antibody was 85% and 93.3% respectively. With combined determination of RF, AKA and anti-CCP antibody, the sensitivity and specificity would be the highest, being 97.07 and 99.8% respectively. Conclusion: RF, AKA and anti-CCP antibody were useful diagnostic serum markers for rheumatoid arthritis and combined determination of these markers would be very useful for early diagnosis. (authors)

  5. Kultuurmaastike ja elukeskkonna kujunemine ning hoidmine, sh poollooduslike koosluste taastamine ja hooldamine, mets, keskkond, loodushoid ja sood / Kaul Nurm

    Index Scriptorium Estoniae

    Nurm, Kaul

    2004-01-01

    Autori arvates tuleb maaelu uue arengukava väljatöötamisel keskmesse tõsta talupere ja sellised struktuurid, mis suudavad ning soovivad alalhoidlikke tootmisviise rakendada, aidates nii oma tegevusega kaasa puhta ja mitmekesise looduse kujunemisele, säilimisele

  6. Noorte olukord tööturul enne kriisi, kriisi ajal ning pärast kriisi / Siim Krusell

    Index Scriptorium Estoniae

    Krusell, Siim

    2015-01-01

    Noorte hõive, töötuse ja ametialase struktuuri analüüsi fookuses on haridust kolmandal tasemel omandavate noorte töötamine ning selle lõpetanute puhul hariduse ja tööl seatavate ülesannete kooskõla puudumine

  7. 22. ja 23. II esitatakse Tallinnas Kanuti Gildi saalis ning 25. ja 26. II Tartu Sadamateatris tantsulavastust "Myrrh and Cinnamon"

    Index Scriptorium Estoniae

    2005-01-01

    Koreograafideks on G. Welzman ja R. Haver ning selles kasutatakse nelja eesti helilooja A. Pärdi, M.-M. Lille, L. Sumera ja E.-S. Tüüri muusikat. Eesti gastrollidel esitab muusikat NYYD Ensemble. Lisaks eesti muusikutele on laval ka P. Pärenson

  8. "Rohgem ei tiija mina teile kirjuda." Kirjavormelid ning peresuhete kajastused Jakob Ploomi sõjakirjades / Andreas Kalkun

    Index Scriptorium Estoniae

    Kalkun, Andreas, 1977-

    2015-01-01

    Sõjaaegse kirjakultuuri levimisest Võrumaalt pärit nekrut Jakob Ploomi 26 isikliku kirja põhjal, millest näeb, mismoodi paistis Suur sõda rohujuuretasandilt ning seda, mismoodi talupojad jõudsid sõja poolt peale sunnitud vajadusest tingituna suulisest maailmast kirjakultuuri

  9. Rahvuslus, multikultuurilisus ja liberaalne lähenemine enamuse-vähemuse suhetes ning meedias / Ragne Kõuts

    Index Scriptorium Estoniae

    Kõuts, Ragne, 1977-

    2004-01-01

    Rahvussuhteid legitimeerivate ideestike teoreetilisest käsitlusest ning nende ideestike esinemisest Eesti avalikus arvamuses. Allikana on kasutatud 1999.-2002. a. korraldatud uuringu "Integratsiooniprotsesside meediamonitooring" käigus kogutud materjali. Tabel: Riikluse tõlgendusmallide põhielemendid Eesti ajakirjanduses

  10. Uus Euroopa pärimismäärus ning selle koht Eesti rahvusvahelises eraõiguses ja rahvusvahelises tsiviil(kohtu)menetluses / Eve Põtter, Maarja Torga

    Index Scriptorium Estoniae

    Põtter, Eve

    2013-01-01

    Ülevaade Euroopa pärimismääruse (EL 650/2012) kohaldamisalast ning määruses sisalduvast regulatsioonist. Määruse vahekord Eesti riigisisese õiguse ning Eesti rahvusvaheliste lepingutega, eelkõige nn kolmandate riikidega sõlmitud õigusabilepingutega

  11. 75 FR 28849 - Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign...

    Science.gov (United States)

    2010-05-24

    ... DEPARTMENT OF STATE [Public Notice 7026] Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review of the Administrative Records assembled in these...

  12. 77 FR 6782 - In the Matter of: Kok Tong Lim, a/k/a Thomas Lim Blk 258A Compassvale Road #07-551 Singapore...

    Science.gov (United States)

    2012-02-09

    ... Thomas Lim Blk 258A Compassvale Road 07-551 Singapore 541258; Order Denying Export Privileges On October...'') of Singapore, pled guilty to one count of violating the International Emergency Economic Powers Act..., a/k/a Thomas Lim, with the last known address at: Blk 258A,Compassvale Road 07-551, Singapore 541258...

  13. Evaluation of root-knot nematode disease control and plant growth promotion potential of biofertilizer Ning shield on Trichosanthes kirilowii in the field.

    Science.gov (United States)

    Jiang, Chun-Hao; Xie, Ping; Li, Ke; Xie, Yue-Sheng; Chen, Liu-Jun; Wang, Jin-Suo; Xu, Quan; Guo, Jian-Hua

    Biofertilizer Ning shield was composed of different strains of plant growth promotion bacteria. In this study, the plant growth promotion and root-knot nematode disease control potential on Trichosanthes kirilowii in the field were evaluated. The application of Ning shield significantly reduced the diseases severity caused by Meloidogyne incognita, the biocontrol efficacy could reached up to 51.08%. Ning shield could also promote the growth of T. kirilowii in the field by increasing seedling emergence, height and the root weight. The results showed that the Ning shield could enhance the production yield up to 36.26%. Ning shield could also promote the plant growth by increasing the contents of available nitrogen, phosphorus, potassium and organic matter, and increasing the contents of leaf chlorophyll and carotenoid pigment. Moreover, Ning shield could efficiently enhance the medicinal compositions of Trichosanthes, referring to the polysaccharides and trichosanthin. Therefore, Ning shield is a promising biofertilizer, which can offer beneficial effects to T. kirilowii growers, including the plant growth promotion, the biological control of root-knot disease and enhancement of the yield and the medicinal quality. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  14. Lipid-lowering and antioxidant activities of Jiang-Zhi-Ning in Traditional Chinese Medicine.

    Science.gov (United States)

    Chen, Jianxin; Zhao, Huihui; Yang, Ying; Liu, Bing; Ni, Jian; Wang, Wei

    2011-04-12

    Jiang-Zhi-Ning (JZN) is composed of four Chinese herbs, i.e., Fleeceflower Root, Fructus Crataegi, Folium Nelumbinis and Semen Cassiae. It was used to strengthen blood circulation of coronary artery, arrhythmia and hyperlipidemia. The main objective of this paper is to evaluate lipid-lowering and antioxidant activities of extract and effective fraction of JZN by using in vitro experiments on hyperlipidemic rats. Moreover, in vivo experiments on cells were performed to investigate lipid-lowering and antioxidant activities of effective fraction and active constituents of JZN. Wistar rats with high fat diet-induced hyperlipidemia were used as in vitro models to study biological effects of lipid-lowering and antioxidant activities of extract and effective fraction of JZN. Serum total cholesterol (TC), triglyceride (TG), low-density lipoprotein cholesterol (LDL-C), high-density lipoprotein cholesterol (HDL-C), Coronary Index and Atherogenic Index were investigated to evaluate lipid-lowering effects of extract and effective fraction of JZN. Serum total nitric oxide synthase (NOS), nitric oxide (NO), endothelin-1 (ET-1), malondialdehyde (MDA), superoxide dismutase (SOD) and total antioxidant capacity (T-AOC) were detected to measure antioxidant effects of extract and effective fraction of JZN. Furthermore, oxidized low-density lipoprotein (Ox-LDL) injured human umbilical vein endothelial cell (HUVEC) model was employed as in vivo experiment to study lipid-lowering and antioxidant effects of effective fraction and active constituents of JZN. NO, ET-1, MDA SOD and T-AOC in HUVECs or culture media were investigated to evaluate antioxidant activity of effective fraction and active constituents of JZN. Using human hepatoma cell line Bel-7402, reverse transcription polymerase chain reaction (RT-PCR) technology was performed to investigate cholesterol metabolism effects of effective fraction and active constituents of JZN. Expressions of low density lipoprotein receptor (LDL

  15. Højintens intervaltræning inducerer moderat forbedring i cirkulerende diabetes-relaterede inflammatoriske cytokiner

    DEFF Research Database (Denmark)

    Bjerre, Mette; Madsen, Søren Møller; Jeppesen, Per Bendix

    2017-01-01

    Det er alment kendt, at motion forbedrer den metaboliske tilstand og mindsker risikoen for udvikling af præ-diabetes til type 2-diabetes. En væsentlig gevinst af regelmæssig motion menes at være via systemiske anti-inflammatoriske effekter, der formentlig skyldes en reduktion af fedtvævet. Hver g...... afklaret. Vi ønskede derfor at undersøge påvirkningen af højintens intervaltræning (HIIT) på cirkulerende inflammatoriske cytokiner hos patienter med type 2-diabetes.1-3...

  16. Pääsküla sõjaväeobjekti jääkreostus ning piirkonna edasise kasutamise perspektiivid / Triin Uudeväli, Anto Raukas

    Index Scriptorium Estoniae

    Uudeväli, Triin

    2004-01-01

    Pääskülas asunud NL-i raketijuhtimisekeskuse ja sideväeosa poolt tekitatud keskkonnareostuse hindamisest, likvideerimisest ning ettepanekutest territooriumi edasiseks kasutamiseks. Kaart. Skeem. Fotod

  17. Tang-Luo-Ning Improves Mitochondrial Antioxidase Activity in Dorsal Root Ganglia of Diabetic Rats: A Proteomics Study

    Directory of Open Access Journals (Sweden)

    Taojing Zhang

    2017-01-01

    Full Text Available Tang-luo-ning (TLN is a traditional Chinese herbal recipe for treating diabetic peripheral neuropathy (DPN. In this study, we investigated mitochondrial protein profiles in a diabetic rat model and explored the potential protective effect of TLN. Diabetic rats were established by injection of streptozocin (STZ and divided into model, alpha lipoic acid (ALA, and TLN groups. Mitochondrial proteins were isolated from dorsal root ganglia and proteomic analysis was used to quantify the differentially expressed proteins. Tang-luo-ning mitigated STZ-induced diabetic symptoms and blood glucose level, including response time to cold or hot stimulation and nerve conductive velocity. As compared to the normal, there were 388 differentially expressed proteins in the TLN group, 445 in ALA group, and 451 in model group. As compared to the model group, there were 275 differential proteins in TLN group and 251 in ALA group. As compared to model group, mitochondrial complex III was significantly decreased, while glutathione peroxidase and peroxidase were increased in TLN group. When compared with ALA group, the mitochondrial complex III was increased, and mitochondrial complex IV was decreased in TLN group. Together, TLN should have a strong antioxidative activity, which appears to be modulated through regulation of respiratory complexes and antioxidases.

  18. Nicholas Chielotam Akas

    African Journals Online (AJOL)

    Ariwaodongo

    Maps. Mapping activities are often used as introductory activities. They allow the community to show and talk about how they see the area where they live, the resources/ ... Brain Storming. Here the member of the community is asked to think of any idea that comes to mind and list all the ideas without evaluation or judgment.

  19. Jian Nao Ning for Treatment of Memory Impairment in Patients with Mild or Moderate Multi-infarct Dementia

    Institute of Scientific and Technical Information of China (English)

    田金洲; 尹军祥; 刘峘; 杨承芝; 王永炎

    2002-01-01

    Forty patients with multi-infarct dementia (MID) were randomly assigned to the treatment group (25 cases) treated with Jian Nao Ning (健脑宁JNN) and the duxil control group (15 cases). Memory function were assessed at baseline and endpoint using memory subscales of a battery of New Psychometric Tests (Chinese version) including mini-mental state examination (MMSE), verbal memory, and non-verbal memory, etc. After treatment, the mean scores of verbal memory in the Hopkins Verbal Learning Test (P<0.05) and total memory scores of memory items (P<0.001) in JNN group increased significantly; and improvement in episodic memory function including story recall (immediate and delayed), delayed word recall, verbal learning and verbal recognition and visual recognition in the JNN group was better than that in the duxil control group, suggesting that JNN can obviously improve memory function for the patients with mild or moderate multi-infarct dementia.

  20. Vadīšanas funkciju izpildes analīze Viļakas novada pašvaldībā.

    OpenAIRE

    Cibule, Rūta

    2016-01-01

    Bakalaura darba tēma ir “Vadīšanas funkciju izpildes analīze Viļakas novada pašvaldībā”. Darbā ir apskatītas vadīšanas funkcijas – organizēšana, plānošana, motivēšana, koordinēšana un kontrole, fokusējoties uz pirmajām trim minētajām. Bakalaura darba mērķis ir izanalizēt vadīšanas funkciju izpildi Viļakas novada domes administrācijā, pievēršot pastiprinātu uzmanību organizēšanai, motivēšanai un plānošanai. Lai šo mērķi izpildītu, pirmajā daļā autore izpētīja dažādus teorijas avotus, otrajā da...

  1. Inimväärikust alandava kohtlemise kriteeriumid ning nende rakendamine kinnipidamistingimuste hindamisel. Euroopa Inimõiguste Kohtu ja Riigikohtu halduskolleegiumi seisukohad / Carolin Toomingas

    Index Scriptorium Estoniae

    Toomingas, Carolin

    2016-01-01

    Inimväärikusest, inimväärikust alandavast kohtlemisest ja karistamise keelust ning väärikuse alandamisest kui riigi vastu suunatud nõude alusest. Euroopa Inimõiguste Kohtu praktika ja Euroopa inimõiguste ja põhivabaduste kaitse konventsiooni tähtsusest Eesti kohtute töös. Sisaldab asjakohast kohtupraktikat

  2. Isolates of Liao ning virus from wild-caught mosquitoes in the Xinjiang province of China in 2005.

    Directory of Open Access Journals (Sweden)

    Xinjun Lv

    Full Text Available Liao ning virus (LNV is related to Banna virus, a known human-pathogen present in south-east Asia. Both viruses belong to the genus Seadornavirus, family Reoviridae. LNV causes lethal haemorrhage in experimentally infected mice. Twenty seven isolates of LNV were made from mosquitoes collected in different locations within the Xinjiang province of north-western China during 2005. These mosquitoes were caught in the accommodation of human patients with febrile manifestations, or in animal barns where sheep represent the main livestock species. The regions where LNV was isolated are affected by seasonal encephalitis, but are free of Japanese encephalitis (JE. Genome segment 10 (Seg-10 (encoding cell-attachment and serotype-determining protein VP10 and Seg-12 (encoding non-structural protein VP12 were sequenced for multiple LNV isolates. Phylogenetic analyses showed a less homogenous Seg-10 gene pool, as compared to segment 12. However, all of these isolates appear to belong to LNV type-1. These data suggest a relatively recent introduction of LNV into Xinjiang province, with substitution rates for LNV Seg-10 and Seg-12, respectively, of 2.29×10(-4 and 1.57×10(-4 substitutions/nt/year. These substitution rates are similar to those estimated for other dsRNA viruses. Our data indicate that the history of LNV is characterized by a lack of demographic fluctuations. However, a decline in the LNV population in the late 1980s-early 1990s, was indicated by data for both Seg-10 and Seg-12. Data also suggest a beginning of an expansion in the late 1990s as inferred from Seg-12 skyline plot.

  3. Andmete väljastamine sideettevõtjate poolt jälitus- ja julgeolekuasutustele ning teistele selleks õigustatud isikutele : [bakalaureusetöö] / Kati Ambo-Vaher ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andres Vutt

    Index Scriptorium Estoniae

    Ambo-Vaher, Kati

    2007-01-01

    Andmete väljastamise põhiseaduslikud piirangud ja isikuandmete kaitse, sideettevõtjate poolt andmete väljastamine jälitus- ja julgeolekuasutustele ning teistele selleks õigustatud isikutele, logifailide ja päringute säilitamise kohustus ning järelevalve, andmete väljastamisega kaasnevate kulude hüvitamine

  4. Dramaturgia wiersza: „wiersz-płacz”. Płakała w nocy, ale nie jej płacz go zbudził

    Directory of Open Access Journals (Sweden)

    Anna Krajewska

    2016-12-01

    Full Text Available The article is an interpretation of the poem “Płakała w nocy, ale nie jej płacz go zbudził” (“She cried at night, but not her cries woke him” written by Stanisław Barańczak. The author focuses on description in this poem – dramatic in shape, philosophical, and according to the narrative of the anthropocentrism crisis. The author considers this poem to be a metaphysical text defining the relationship between the world of human and non-human reality. She compares the poem with those written by Jan Kochanowski (Laments, Cyprian Kamil Norwid (In Verona, Andrew Marvell (Eyes and tears, Szymborska (Apple tree.

  5. 2. XII möödus 20 aastat Adamson-Ericu muuseumi avamisest Eesti Kunstimuuseumi filiaalina ning 35 aastat Adamson-Ericu (1902-1968) surmast

    Index Scriptorium Estoniae

    2003-01-01

    Muuseumi ajaloost, põhikogust, Adamson-Ericu teoste põhiekspositsioonist, kunstinäitustest. 3. XII tutvustab Kersti Koll Adamson-Ericu ja läti kunstniku Ludolfs Libertsi näitust. 5. XII ekspositsioonis ringkäik "Meistri töövõtetest ning erinevatest materjalidest restauraatori pilgu läbi" Alar Nurkse juhtimisel, ekskursioon Ülle Kruusi juhtimisel. 10. XII algab projekti "Avatud muuseum" raames haridusprogramm "Noor kunstidetektiiv"

  6. Euroopa Inimõiguste Kohtu lahendid asjades Kolk ja Kislõi vs Eesti ning Kononov vs Läti - sarnasused, vastuolud ning Euroopa Inimõiguste Kohtu argumentide põhistatus : [bakalaureusetöö] / Martin Häidberg ; Tartu Ülikool, õigusteaduskond ; j

    Index Scriptorium Estoniae

    Häidberg, Martin

    2010-01-01

    Võrdlevast kirjeldusest Euroopa Inimõiguste Kohtu seisukohtades. Sõjakuritegudest ja inimsusevastastest kuritegudest ning konventsioonist aegumistähtaegade kohaldamatuse kohta, inimõiguste ja põhivabaduste kaitse konventsiooni artikli 7 rikkumisest ja EIÕK põhjendustest, otsuste kriitikast, põhistatusest ja vastuoludest teiste lahenditega

  7. Uimastite mõju Eesti koolinoorte isiksuse arengule ning nende kuritegelikule käitumisele : [bakalaureusetöö] / Vaike Kargu ; Tartu Ülikool, õigusteaduskond ; juhendaja: Silvia Kaugia

    Index Scriptorium Estoniae

    Kargu, Vaike

    2010-01-01

    Legaalsetest uimastitest ja nende esmatarbimise east Eestis, Eesti koolinoorte seas enamkasutatavatest illegaalsetest uimastitest ning nende mõjust koolinoorte käitumisele, sotsiaalõiguslikest tagajärgedest, alaealiste kuritegevusest, ennetustegevusest

  8. Director läks ja küsis : Milliste omadustega töötajaid te tahate tööle võtta ning millised inimesed teile ei sobi? / Janika Kuusik, Anni Pikk, Merike Jaamul... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    Elioni personalijuht Janika Kuusik, TNT Eesti personalispetsialist Anni Pikk, Eesti Posti personalijuht Merike Jaamul, advokaadibüroo Sorainen personalijuht Kristiina Härms ning Webmedia personalijuht Kairi Pauskar vastavad küsimusele, milliseid inimesi nad eelistavad palgata

  9. Joobes mootorsõiduki juhtide karistamine ning ennetusmeetmed Eestis, Rootsis, Soomes ja Venemaal : [magistritöö] / August Käära ; Tartu Ülikool, õigusteaduskond ; juhendaja: Silvia Kaugia

    Index Scriptorium Estoniae

    Käära, August

    2011-01-01

    Alkoholi- ja narkojoobe ning -sõltuvuse olemusest ja joobe õigustamise sotsiaalsetest teooriatest, karistamise alustest mootorsõiduki joobes juhtimise eest, sotsiaalprogrammidest - nende analüüsist ja ennetusmeetmetest

  10. Tallinnasse Rävala pst. 19 kavandatava Tallinna Muusikakeskkooli, Tallinna Balletikooli ning G. Otsa nimelise muusikakooli ühise õppehoone arhitektuurikonkurss = Architectural Competition for the Joint School Building of Tallinn Music-Specialised

    Index Scriptorium Estoniae

    Puusepp, Raivo

    2003-01-01

    I preemia - Andres Siim, Krister Ausing, II - Marika Lõoke, III - Maia Tüür, Andres Sevtshuk, Gabriel Evangelisti, ostupreemiad: Armin Valter, Vilen Künnapu ning Siiri Vallner, Katrin Koov, Veronika Valk

  11. Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy Conversion Devices (a.k.a. Understanding Photosystem I as a Biomolecular Reactor for Energy Conversion)

    Science.gov (United States)

    2014-04-01

    Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy Conversion Devices (a.k.a. Understanding Photosystem I as...Laboratory Adelphi, MD 20783-1197 ARL-TR-6904 April 2014 Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy...Final 3. DATES COVERED (From - To) 10/1/2010–10/1/2013 4. TITLE AND SUBTITLE Hydrogen Production from Water by Photosynthesis System I for Use as Fuel

  12. Fysisk träning som vård av muskuloskeletala störningar bland datorarbetande : - en litteraturöversikt

    OpenAIRE

    Renvall, Ralf

    2010-01-01

    Sammandrag: Ämnet för denna litteraturöversikt är fysisk träning som vård av muskuloskeletala funktionsstörningar bland datorarbetande. Dessa arbetsrelaterade muskuloskeletala funktionsstörningar är mycket vanliga. Arbetsförhållandena nuförtiden gör att tiden som används vid datorn förlängs och att minska belastningen med endast rätt arbetsergonomi kan orsaka andra problem. Förlängda arbetspass, låg variation i muskelns kontraktionsnivå och ökad monotoni kan bli följden av optimerad erg...

  13. Tang-Luo-Ning, a Traditional Chinese Medicine, Inhibits Endoplasmic Reticulum Stress-Induced Apoptosis of Schwann Cells under High Glucose Environment

    Directory of Open Access Journals (Sweden)

    Weijie Yao

    2017-01-01

    Full Text Available Tang-Luo-Ning (TLN has a definite effect in the clinical treatment of diabetic peripheral neuropathy (DPN. Schwann cells (SCs apoptosis induced by endoplasmic reticulum stress (ER stress is one of the main pathogeneses of DPN. This study investigates whether TLN can inhibit SCs apoptosis by inhibiting ER stress-induced apoptosis. Our previous researches have demonstrated that TLN could increase the expression of ER stress marker protein GRP78 and inhibited the expression of apoptosis marker protein CHOP in ER stress. In this study, the results showed that TLN attenuated apoptosis by decreasing Ca2+ level in SCs and maintaining ER morphology. TLN could decrease downstream proteins of CHOP including GADD34 and Ero1α, while it increased P-eIF2α and decreased the upstream proteins of CHOP including P-IRE1α/IRE1α and XBP-1, thereby reducing ER stress-induced apoptosis.

  14. Određivanje daljine cilja pomoću video senzora i analiza uticaja grešaka i šuma merenja / Target range evaluation using video sensor and analysis of the influence of measurement noise and errors

    Directory of Open Access Journals (Sweden)

    Dragoslav Ugarak

    2006-01-01

    Full Text Available U radu je opisan matematički model određivanja daljine cilja obradom video snimaka u toku praćenja. Analizirani su doprinosi parametara koji utiču na veličinu grešaka i određene su vrednosti standardnog odstupanja. / This paper presents mathematical model of determining target range by analyzing video frame during the tracking. The contribution of effective parameters to accuracy are analyzed and values of standard deviation are determined.

  15. En sammenlignende undersøgelse af praktikforløb og færdighedstræning i tre videregående uddannelser

    Directory of Open Access Journals (Sweden)

    Anne Mette Mørcke

    2015-03-01

    Full Text Available Praktikforløb i videregående uddannelser er blevet et politisk indsatsområde, og der er i sundhedsuddannelserne også et internationalt forskningsfokus på emnet. I denne artikel vil vi beskrive og sammenligne rammerne for praktikforløb og færdighedstræning på idræts-, læge- og sygeplejerskeuddannelsen. Artiklen tager afsæt i Heggens skelnen mellem begreberne professionsidentitet og professionel identitet. Den studerendes opfattelse af sig selv som professionsudøver må ud fra dette afsæt udvikles via tilegnelse af både en særlig videnskabelig funderet teoretisk viden, særlig praktisk ekspertise, samt en særlig etisk og social forpligtelse til at arbejde for medborgernes bedste. I den konkrete sammenligning af idræts-, læge- og syge-plejerskeuddannelserne konkluderes, at både færdighedstræning og praktik vægtes højt, men at både omfang, struktur, placering og læringsmål varierer betydeligt. Det må have væsensforskellige konsekvenser for de studerendes tilegnelse af viden, færdigheder og holdninger og dermed for deres professionelle identitetsudvikling. Vi kan ikke afgøre om professionsidentitetsforståelsen er årsag eller virkning, men der ser ud til at være et samspil mellem uddannelsernes undervisningsformer og professionsidentitet.   In this paper we describe and compare workplace learning and skills training in medicine, nursing and sports science education. The paper builds on Heggen’s concepts concerning the identity of a profession versus a personal professional identity. Based on this, a student’s perception of herself as a professional develops from learning a particular scientific knowledge-base, a particular set of practical skills and a particular ethical and social obligation to work for the community. We concluded that all three educations studied attach great importance to workplace learning and skills training, but the extent, the structure, the timing and the learning outcomes differ

  16. Uue aja ning formaadi biennaalid

    Index Scriptorium Estoniae

    2001-01-01

    Phaidron Press Ltd. väljaandena ilmunud raamatus "Fresh Cream. Contemporary Art in Culture" on kümne kuraatori valitud saja 1990-ndate kunsti mõjutanud kunstniku seas Jaan Toomik (Viktor Misiano valik). Raamatu võrdlus 1998. a. ilmunud "Cream'iga". 1998. a. ja 2000. a. kuraatorid, võtmekirjutajad

  17. Collaborative Lea(r)ning

    DEFF Research Database (Denmark)

    Nielsen, Jacob S.

    The inter-organisational collaboration perspective is not new. Phoenician merchants have used this perspective while setting up joint ventures to limit their risks in overseas trading. What is new are the ways in which efficiency alliances are interacting and changing the terms of competition, th...... as more floating. Companies in network have to understand that the success of every single company depends on the performance of every single partner in the network. The actors in the network must construct a mutual win-win situation for everybody. One of the first steps to accomplish...... systems to work together closely. Although only limited research has been done in this area it is clear that creating a joint improvement and learning culture between organisations is not easy. One of the first major step to explore this field was started in 2001 when a three year EU-funded project...

  18. Impact of parameter fluctuations on the performance of ethanol precipitation in production of Re Du Ning Injections, based on HPLC fingerprints and principal component analysis.

    Science.gov (United States)

    Sun, Li-Qiong; Wang, Shu-Yao; Li, Yan-Jing; Wang, Yong-Xiang; Wang, Zhen-Zhong; Huang, Wen-Zhe; Wang, Yue-Sheng; Bi, Yu-An; Ding, Gang; Xiao, Wei

    2016-01-01

    The present study was designed to determine the relationships between the performance of ethanol precipitation and seven process parameters in the ethanol precipitation process of Re Du Ning Injections, including concentrate density, concentrate temperature, ethanol content, flow rate and stir rate in the addition of ethanol, precipitation time, and precipitation temperature. Under the experimental and simulated production conditions, a series of precipitated resultants were prepared by changing these variables one by one, and then examined by HPLC fingerprint analyses. Different from the traditional evaluation model based on single or a few constituents, the fingerprint data of every parameter fluctuation test was processed with Principal Component Analysis (PCA) to comprehensively assess the performance of ethanol precipitation. Our results showed that concentrate density, ethanol content, and precipitation time were the most important parameters that influence the recovery of active compounds in precipitation resultants. The present study would provide some reference for pharmaceutical scientists engaged in research on pharmaceutical process optimization and help pharmaceutical enterprises adapt a scientific and reasonable cost-effective approach to ensure the batch-to-batch quality consistency of the final products. Copyright © 2016 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  19. Quality evaluation of Guan-Xin-Ning injection based on fingerprint analysis and simultaneous separation and determination of seven bioactive constituents by capillary electrophoresis.

    Science.gov (United States)

    Xu, Liying; Chang, Ruimiao; Chen, Meng; Li, Lou; Huang, Yayun; Zhang, Hongfen; Chen, Anjia

    2017-12-01

    The purpose of this study was to develop a comprehensive, rapid and practical capillary electrophoresis (CE) method for quality control (QC) of Guan-Xin-Ning (GXN) injection based on fingerprint analysis and simultaneous separation and determination of seven constituents. In fingerprint analysis, a capillary zone electrophoresis (CZE) method with a running buffer of 30 mM borate solution (pH 9.3) was established. Meanwhile, ten batches of samples were used to establish the fingerprint electropherogram and 34 common peaks were obtained within 20 min. The RSD of relative migration times (RMT) and relative peak areas (RPA) were less than 5%. In order to further evaluate the quality of GXN injection, a micellar electrokinetic chromatography (MEKC) method was developed for simultaneous separation and determination of bioactive constituents. Seven components reached baseline separation with a running buffer containing 35 mM SDS and 45 mM borate solution (pH 9.3). A good linearity was obtained with correlation coefficients from 0.9906 to 0.9997. The LOD and LOQ ranged from 0.12 to 1.50 μg/mL and from 0.40 to 4.90 μg/mL, respectively. The recoveries ranged between 99.0 and 104.4%. Therefore, it was concluded that the proposed method can be used for full-scale quality analysis of GXN injection. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Eesti riigi esindamine Euroopa Liidu Kohtus - Eestit puudutavate ja võimalike ees ootavate vaidluste ning Eesti seiuskohtade juriidiline analüüs : [magistritöö] / Katri Bagirov ; Tartu Ülikool, õigusteaduskond ; juhendaja: Julia Laffranque

    Index Scriptorium Estoniae

    Bagirov, Katri

    2010-01-01

    Eesti riigi esindamisest ELi Kohtus, esindamise korrast ja eelmenetlusest. Eesti edukusest Euroopa Liidu õiguse ülevõtmisel ning mõjutamisel ja kujundamisel, analüüsist läbi kohtupraktika. Eesti riigi esindamisega seotud probleemide juriidilisest analüüsist

  1. Sõnumisaladuse kaitse tööandjale kuuluvate sidevahendite kasutamisel ning karistusõiguslik vastutus selle õiguse rikkumisel : [magistritöö] / Olev Kirst ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Kirst, Olev

    2012-01-01

    Põhimõistete määratlemisest, sõnumisaladuse kaitse piiridest, sõnumite jälgimise vajadusest ja ulatusest, tööandja sidevahendite jälgimise õiguslikest alustest ja põhimõtetest ning praktikast, karistusõiguslikust vastutusest sõnumisaladuse rikkumisel ja kohtupraktikast (Eesti, Soome, Saksamaa, Venemaa)

  2. Tõrjuv kahjuhüvitis Eesti ja Saksa võlaõiguses mittevaralise kahju hüvitamisel ning selle seos karistusliku kahjuhüvitise kontseptsiooniga / Martin Hirvoja

    Index Scriptorium Estoniae

    Hirvoja, Martin, 1977-

    2011-01-01

    Mittevaraliste õiguste kaitsest põhiseaduses ning isikuõiguse võlaõiguslikust mõistest. Karistusliku kahjuhüvitise (punitive damages) mõistest, päritolust ja rollist. Tõrjuvast kahjuhüvitisest Saksa ja Eesti õiguses. Eesti isikuõiguste kaitsest

  3. Kujunemine omatehtud alkoholi valmistajaks ja levitajaks ning õigustused nendele tegevustele = Becoming a maker and distributor of homebrew alcohol and justifications for such activities : III koht bakalaureusetööde kategoorias / Cristo Pajust

    Index Scriptorium Estoniae

    Pajust, Cristo

    2009-01-01

    Bakalaureusetöös selgitati, kuidas kujunetakse omatehtud alkoholi valmistajaks ja levitajaks ning millised on seda ühiskonnas illegaalsena määratletud tegevust neutraliseerivad argumendid tegevuse õigustamisel enesele ja teistele. Töö lähtus sotsiaalse õppimise teooriast ja neutraliseerimisteooriast

  4. Giver specifik fodtræning og indlæg en yderligere effekt sammenlignet med et standard knæfokuseret træningsforløb for patienter med patellofemoral smertesyndrom?

    DEFF Research Database (Denmark)

    Mølgaard, Carsten; Andreasen, Jane; Christensen, Marianne

    tilstrækkelig evidens for en overbevisende effekt af fod- og knæortoser i behandlingen af PFPS patienter. Formål: At undersøge om en kombination af specifik fodtræning og indlæg kan forbedre effekten af et standard træningsregime i behandlingen af patellofemorale smerte syndrom (PFPS). Materiale og metode...

  5. Patterns of HIV prevalence among injecting drug users in the cross-border area of Lang Son Province, Vietnam, and Ning Ming County, Guangxi Province, China

    Directory of Open Access Journals (Sweden)

    Hoang Tran V

    2005-08-01

    Full Text Available Abstract Background To assess patterns of injecting drug use and HIV prevalence among injecting drug users (IDUs in an international border area along a major heroin trans-shipment route. Methods Cross-sectional surveys of IDUs in 5 sites in Lang Son Province, Vietnam (n = 348 and 3 sites in Ning Ming County, Guangxi Province, China (n = 308. Respondents were recruited through peer referral ("snowball" methods in both countries, and also from officially recorded lists of IDUs in Vietnam. A risk behavior questionnaire was administered and HIV counseling and testing conducted. Results Participants in both countries were largely male, in their 20s, and unmarried. A majority of subjects in both countries were members of ethnic minority groups. There were strong geographic gradients for length of drug injecting and for HIV seroprevalence. Both mean years injecting and HIV seroprevalence declined from the Vietnamese site farthest from the border to the Chinese site farthest from the border. 10.6% of participants in China and 24.5% of participants in Vietnam reported crossing the international border in the 6 months prior to interview. Crossing the border by IDUs was associated with (1 distance from the border, (2 being a member of an ethnic minority group, and (3 being HIV seropositive among Chinese participants. Conclusion Reducing the international spread of HIV among IDUs will require programs at the global, regional, national, and "local cross border" levels. At the local cross border level, the programs should be coordinated on both sides of the border and on a sufficient scale that IDUs will be able to readily obtain clean injection equipment on the other side of the border as well as in their country of residence.

  6. IND UCTION OF SPAW NING IN THE TR OPICAL WALKING CATFISH (C la rias b atr ac hus BY CONTROLLI NG WATER L EVEL AND T EMPERAT URE

    Directory of Open Access Journals (Sweden)

    M. ZAIRIN JR.

    2001-01-01

    Full Text Available This experiment was carried out t o confirm the rol e of water level and w ater temperature i n indu cing t he s pawning o f tr opical walking catfi sh . Ma ture mal es an d females reared un de r 23 - 2 5 °C, were paired and in duced to spa wn by cont rolling w ater level and w ater temperature. Decr easi ng water level and returni ng it to its original level r esulted i n a low spawni ng r ate (l es s t han 6. 7 % at 23 °C . Decreasing water level with simultaneous increase in water temperature, followed by returning the respective levels to their originals gave high spa wning rates ( 41.7 — 50 %; whereas the s ame treatment but without a ny water temperature decrea sed when t he wate r le vel was return ed t o t he initial level, gave a lo w spawning rate (16 .7 %. In creasin g water level only, fail ed to ind uce spa wning . A high spawning rate was obtained also when changes in water level were ca rried out under high t emperature of 28 °C. No fish spawned in the ab sence of the environmental stimulation. From the results, i t is confirmed that water le vel and t emperature play important r oles i n i nducin g spaw ning of tropical walki ng catfish. Changes i n water t emperature probably increas e the sensitivity of fish to th e change in water level. Prolo nged exposure to high water tem perature c ould also improve the sensitivity of fish.

  7. Bu-Shen-Ning-Xin Decoction ameliorated the osteoporotic phenotype of ovariectomized mice without affecting the serum estrogen concentration or uterus

    Directory of Open Access Journals (Sweden)

    Wang L

    2015-08-01

    Full Text Available Ling Wang,1,2,* Xue-Min Qiu,1,2,* Yu-Yan Gui,1,2 Ying-Ping Xu,1,2 Hans-Jürgen Gober,3 Da-Jin Li1 1Laboratory for Reproductive Immunology, Hospital and Institute of Obstetrics and Gynecology, IBS, Fudan University Shanghai Medical College, 2Shanghai Key Laboratory of Female Reproductive Endocrine Related Diseases, Shanghai, People’s Republic of China; 3Department of Pharmacy, Wagner Jauregg Hospital and Children’s Hospital, Linz, Austria *These authors contributed equally to this work Introduction: Bu-Shen-Ning-Xin Decoction (BSNXD, a traditional Chinese medicinal composition, has been used as a remedy for postmenopausal osteoporosis, but its effects on bone metabolism and the uterus have not been reported.Purpose: We aimed to determine the respective effects of BSNXD on the bones and the uterus of ovariectomized (OVX mice to evaluate the efficacy and safety of this herbal formula.Materials and methods: Postmenopausal osteoporosis animal models that were generated by ovariectomy were treated with BSNXD. Dual-energy X-ray absorptiometry was performed to analyze the bone mineral density, and histomorphometric analysis was performed to measure the parameters related to bone metabolism. Calcein labeling was performed to detect bone formation. The uteruses from the mice were weighed, and the histomorphometry was analyzed. Drug-derived serum was prepared to assess the 17-β-estradiol concentration via enzyme immunoassay.Results: BSNXD administration ameliorated the osteoporotic phenotype of OVX mice, as evidenced by an increase in the bone mineral density and bone volume; these effects could not be abolished by the administration of the aromatase inhibitor letrozole. Moreover, BSNXD had no effect on the serum estrogen concentration or uterus.Conclusion: These results suggest that BSNXD has ameliorating effects on bone loss due to estrogen deprivation without affecting the peripheral blood estrogen concentration or the uterus in OVX mice. Keywords

  8. Karistusõiguslik hädakaitse ja hädaseisund põhiõiguste piiramise alusena koolides ning nende suhestumine 1. jaanuaril 2016 jõustuva lastekaitseseaduse § 24 lõikega 3 / Anneli Soo

    Index Scriptorium Estoniae

    Soo, Anneli, 1984-

    2015-01-01

    Analüüs 1. jaanuaril 2016 jõustuva LaKS § 24 lõike 3 tähendusest teo õigusvastasust välistava asjaoluna ning kas see harmoneerub karistusõiguse dogmaatikaga hädakaitse ja hädaseisundi valdkonnas. Füüsilise vägivalla kasutamisest hädakaitse ja hädaseisundi olukorras koolis, vastavast kohtupraktikast

  9. Terrorism/Criminalogy/Sociology via Magnetism-Hamiltonian ``Models''?!: Black Swans; What Secrets Lie Buried in Magnetism?; ``Magnetism Will Conquer the Universe?''(Charles Middleton, aka ``His Imperial Majesty The Emperior Ming `The Merciless!!!''

    Science.gov (United States)

    Carrott, Anthony; Siegel, Edward Carl-Ludwig; Hoover, John-Edgar; Ness, Elliott

    2013-03-01

    Terrorism/Criminalogy//Sociology : non-Linear applied-mathematician (``nose-to-the grindstone / ``gearheadism'') ''modelers'': Worden,, Short, ...criminologists/counter-terrorists/sociologists confront [SIAM Conf. on Nonlinearity, Seattle(12); Canadian Sociology Conf,. Burnaby(12)]. ``The `Sins' of the Fathers Visited Upon the Sons'': Zeno vs Ising vs Heisenberg vs Stoner vs Hubbard vs Siegel ''SODHM''(But NO Y!!!) vs ...??? Magntism and it turn are themselves confronted BY MAGNETISM,via relatively magnetism/metal-insulator conductivity / percolation-phase-transitions critical-phenomena -illiterate non-linear applied-mathematician (nose-to-the-grindstone/ ``gearheadism'')''modelers''. What Secrets Lie Buried in Magnetism?; ``Magnetism Will Conquer the Universe!!!''[Charles Middleton, aka ``His Imperial Majesty The Emperior Ming `The Merciless!!!']'' magnetism-Hamiltonian phase-transitions percolation-``models''!: Zeno(~2350 BCE) to Peter the Pilgrim(1150) to Gilbert(1600) to Faraday(1815-1820) to Tate (1870-1880) to Ewing(1882) hysteresis to Barkhausen(1885) to Curie(1895)-Weiss(1895) to Ising-Lenz(r-space/Localized-Scalar/ Discrete/1911) to Heisenberg(r-space/localized-vector/discrete/1927) to Priesich(1935) to Stoner (electron/k-space/ itinerant-vector/discrete/39) to Stoner-Wohlfarth (technical-magnetism hysteresis /r-space/ itinerant-vector/ discrete/48) to Hubbard-Longuet-Higgins (k-space versus r-space/

  10. Yan Sun, Corruption and Market in Contemporary China, Ithaca (N.Y.), Cornell University Press, 2004 et Ning Wang, Making a Market Economy. The Institutional Transformation of a Freshwater Fishery in a Chinese Community, Londres et New York, Routledge, 200

    OpenAIRE

    Guiheux, Gilles

    2008-01-01

    Ces deux ouvrages éclairent les conditions dans lesquelles, au cours des 25 dernières années, l’économie de commande a été démantelée et remplacée progressivement par un système de marché. Yan Sun, professeur de sciences politiques, s’intéresse à la corruption dans une double perspective macro et micro. Ning Wang, économiste néo-institutionnaliste, se demande comment, à la faveur des réformes, une région (Jingzhou, au sud du Hubei) s’est convertie à la pisciculture. La corruption est une ques...

  11. 2311-IJBCS-Article-Aka Marcel Kouassi

    African Journals Online (AJOL)

    hp

    Chem. Sci. 9(2): 1120-1129, April 2015. ISSN 1997-342X (Online), ISSN ... clear dominance of high molecular weight (HMW) PAHs (pyrene, Benzo (k) ... the organic matter accumulated in deep ... hydrophobic nature, PAHs are mostly.

  12. Treating acute ankle sprain by the Tongde Ning plus elastic bandage%痛得宁加减熬膏外敷结合弹力绷带外固定治疗急性踝关节扭伤

    Institute of Scientific and Technical Information of China (English)

    郑一非

    2015-01-01

    Objective:To observe effects of Tongde Ning plus elastic bandage on acute ankle sprain. Methods:Through retrospective study, 56 cases of acute ankle sprain were selected;30 cases were male, and 26 cases were female, 28 to 52 years old. The average age was (34.5±1.4) years. 56 cases of acute ankle sprain were randomly divided into treatment group and control group, each group for 28 cases. Patients in the treatment group received Tongde Ning plus elastic bandage, and patients in the control group received elastic bandage only. Results: After the treatment, the course of disease in both groups appeared obvious difference,P<0.05. In the treatment group, 20 cases (71.4%) were cured; 8 cases (28.6%) were better. In the control group, 9 cases (32.1%) were cured; 18 cases (64.3%) were better; 1 case (3.6%) were ineffective. Conclusion:Tongde Ning applied plus elastic bandage were highly effective on acute ankle sprain, and worthy of promotion.%目的:研究痛得宁加减熬膏外敷结合弹力绷带外固定治疗急性踝关节扭伤的疗效。方法:选择回顾性研究方法,选取2014年2-5月之间来沈阳市骨科医院进行急性踝关节扭伤治疗的患者56例,其中男30例,女26例,年龄28~52岁,平均年龄(34.5±1.4)岁。按1∶1的随机方式分为治疗组和对照组,每组28人。治疗组为外敷中药膏剂加弹力绷带外固定组,对照组为单纯弹力绷带外固定组。结果:治疗组与对照组经治疗后,病程时间比较有明显差异,P<0.05;治疗组治愈20人(71.4%),好转8人(28.6%),未愈0人(0.0%);对照组治愈9人(32.1%),好转18人(64.3%),未愈1人(3.6%)。结论:痛的宁加减熬膏外敷结合弹力绷带外固定治疗急性踝关节扭伤疗效确切,值得推广应用。

  13. Computerteknologi og kognitiv genoptræning

    DEFF Research Database (Denmark)

    Wilms, Inge Linda

    2009-01-01

    Danmark er et af de lande, hvor flest indbyggere har adgang til en computer. De fleste danskere anvender computeren dagligt på arbejde og hjemme til bl.a. chat, blog, videnssøgning, handel, spil og kommunikation. Hvordan kan det så være, at der er så lille udbredelse af computerbaserede rehabilit...

  14. Combination of counterpropagation artificial neural networks and antioxidant activities for comprehensive evaluation of associated-extraction efficiency of various cyclodextrins in the traditional Chinese formula Xue-Zhi-Ning.

    Science.gov (United States)

    Sun, Lili; Yang, Jianwen; Wang, Meng; Zhang, Huijie; Liu, Yanan; Ren, Xiaoliang; Qi, Aidi

    2015-11-10

    Xue-Zhi-Ning (XZN) is a widely used traditional Chinese medicine formula to treat hyperlipidemia. Recently, cyclodextrins (CDs) have been extensively used to minimize problems relative to medicine bioavailability, such as low solubility and poor stability. The objective of this study was to determine the associated-extraction efficiency of various CDs in XZN. Three various type CDs were evaluated, including native CDs (α-CD, β-CD), hydrophilic CD derivatives (HP-β-CD and Me-β-CD), and ionic CD derivatives (SBE-β-CD and CM-β-CD). An ultra high-performance liquid chromatography (UHPLC) fingerprint was applied to determine the components in CD extracts and original aqueous extract (OAE). A counterpropagation artificial neural network (CP-ANN) was used to analyze the components in different extracts and compare the selective extraction of various CDs. Extraction efficiencies of the various CDs in terms of extracted components follow the ranking, ionic CD derivatives>hydrophilic CD derivatives>native CDs>OAE. Besides, different types of CDs have their own selective extraction and ionic CD derivatives present the strongest associated-extraction efficiency. Antioxidant potentials of various extracts were evaluated by determining the inhibition of spontaneous, H2O2-induced, CCl4-induced and Fe(2+)/ascorbic acid-induced lipid peroxidation (LPO) and analyzing the scavenging capacity for DPPH and hydroxyl radicals. The order of extraction efficiencies of the various CDs relative to antioxidant activities is as follows: SBE-β-CD>CM-β-CD>HP-β-CD>Me-β-CD>β-CD>α-CD. It can be demonstrated that all of the CDs studied increase the extraction efficiency and that ionic CD derivatives (SBE-β-CD and CM-β-CD) present the highest extraction capability in terms of amount extracted and antioxidant activities of extracts. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Bu-Shen-Ning-Xin decoction: inhibition of osteoclastogenesis by abrogation of the RANKL-induced NFATc1 and NF-κB signaling pathways via selective estrogen receptor α

    Directory of Open Access Journals (Sweden)

    Wang L

    2015-07-01

    Full Text Available Ling Wang,1,2,* Xue-Min Qiu,1,2,* Yu-Yan Gui,1,2 Ying-Ping Xu,1,2 Hans-Jürgen Gober,3 Da-Jin Li11Laboratory for Reproductive Immunology, Hospital and Institute of Obstetrics and Gynecology, IBS, Fudan University Shanghai Medical College, 2Shanghai Key Laboratory of Female Reproductive Endocrine Related Diseases, Shanghai, People’s Republic of China; 3Department of Pharmacy, Wagner Jauregg Hospital and Children’s Hospital, Wagner Jauregg Weg, Linz, Austria*These authors contributed equally to this workIntroduction: Bu-Shen-Ning-Xin decoction (BSNXD is a traditional Chinese medicinal composition that has been used as a remedy for postmenopausal osteoporosis, but the mechanisms affecting bone metabolism are not fully understood.Purpose: We investigated the molecular mechanism and signaling pathway underlying the effect of BSNXD on osteoclastogenesis.Materials and methods: A postmenopausal osteoporosis animal model generated by ovariectomy was administered BSNXD and drug-derived serum was prepared. An enzyme immunoassay was conducted to measure the 17-β-estradiol (E2 concentration in the drug-derived serum. Bone marrow-derived monocyte/macrophage precursor cells were treated with drug-derived serum, and tartrate-resistance acid phosphatase staining was conducted to observe osteoclastogenesis. A bone resorption assay was performed to analyze the effect on osteoclastic resorptive function. Real-time PCR, flow cytometry, Western blotting, transfection, and luciferase assays were conducted to explore the related mechanism.Results: E2 was not elevated in BSNXD-derived serum. BSNXD-derived serum suppressed receptor activation of nuclear factor κB ligand (RANKL-activated osteoclastogenesis in a dose-dependent manner; this effect could be reversed by estrogen receptor α antagonist methyl-piperidino-pyrazole. The serum suppressed RANKL-induced NF-κB transcription and inhibited the accumulation of nuclear factor of activated T-cells, cytoplasmic 1

  16. Tüüakas briti intellektuaal / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2007-01-01

    Suurbritannia praegusest rahandusministrist Gordon Brownist võib saada Tony Blairi järel järgmine peaminister. CV: Gordon Brown. Vt. samas: Kuningas Midase maagia hajub: Browni puudutus ei muuda kullaks

  17. Diagnostic and prognostic values of antikeratin antibodies (AKA ...

    African Journals Online (AJOL)

    Egyptian Journal of Pediatric Allergy and Immunology (The). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 1, No 1 (2003) >. Log in or Register to get access to full text downloads.

  18. Dance: A Psychosocial Tool for Child's Development | Akas ...

    African Journals Online (AJOL)

    Creative Artist: A Journal of Theatre and Media Studies. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 4, No 1 (2010) >. Log in or Register to get access to full text downloads.

  19. Scieszka's Subversive Little Red Hen: AKA "One Annoying Chicken"

    Science.gov (United States)

    Pantaleo, Sylvia

    2007-01-01

    During the past three years, the author has been exploring Grade 5 students' processes of reading and understanding contemporary picturebooks with Radical Change characteristics and metafictive devices, and examining how students use their knowledge of these characteristics and devices to create their own texts. "The Stinky Cheese Man and Other…

  20. HUMAN PARAGONIMIASIS IN AFRICA | Aka | Annals of African ...

    African Journals Online (AJOL)

    Annals of African Medicine. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 7, No 4 (2008) >. Log in or Register to get access to full text downloads.

  1. HUMAN PARAGONIMIASIS IN AFRICA | Aka | Annals of African ...

    African Journals Online (AJOL)

    An up-to-date review on human paragonimiasis in Africa was carried out to determine the current geographical distribution of human cases and analyze the animal reservoir, snails and crustaceans which intervene in the local life cycle of Paragonimus species. Two countries, i.e., Cameroon and Nigeria, were mainly ...

  2. Ryder Cup ning rahvusvaheline kogemus teenindusvaldkonnast / Liis Meeras

    Index Scriptorium Estoniae

    Meeras, Liis

    2006-01-01

    Iirimaal Dublini lähedal Kildare maakonna provintsis asuvas K-Clubis 22.-24. septembrini toimunud 36. Ryder Cup turniirist, mis on üks prestiizhikaim golfiüritus maailmas. Oma muljetest räägivad üritusel teenindanud turismitudengid TÜ Pärnu kolledzhist

  3. Genoptræning efter brystkræftkirurgi

    DEFF Research Database (Denmark)

    Kronborg Poulsen, Lise; Høgdal, Nina; Sørensen, Lisbeth Villemoes

    2011-01-01

    The short- and long-term benefits of post-discharge physiotherapy regimens after breast cancer surgery are debatable. A national survey in Denmark performed at hospitals and municipal rehabilitation clinics showed considerable variability in post-breast surgery rehabilitation regimens. As hospital...

  4. Raha ja maa asemel uurimine ning pankrot / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2010-01-01

    Aserbaidžaani kinnisvaraprojekti investeerinud ärimehed kahtlustavad Tõnis Haavelit investeerimiskelmuses, ärimehed esitasid projektiks võlakirju emiteerinud Seaside Residence Baku vastu pankrotiavalduse

  5. Tu(r)ning weakness to strength: Mechanomutable bioinspired materials

    Science.gov (United States)

    2017-04-03

    building blocks," Philosophical Magazine Letters, Vol. 94, 592-600, 2014. • A.K. Nair, A. Gautieri, M.J. Buehler,"Role of intrafibrillar collagen...release. 4 • S. Cranford, N. Pugno, M.J. Buehler, "Silk and Web Synergy: The Merging of Material and Structural Performance," in: Biotechnology of

  6. Hagi ese ja alus ning hagi muutmine kohtupraktikas / Margit Vutt

    Index Scriptorium Estoniae

    Vutt, Margit, 1968-

    2011-01-01

    Hagi alust ja eset käsitlevast kohtupraktikast. Kohtu selgitamiskohustusest hagi eseme ja aluse õigel määratlemisel. Hagi muutmist reguleerivatest normidest. Artikli aluseks on Riigikohtus 2010. aasta sügisel koostatud kohtupraktika analüüs

  7. 8 . TOTAL THRUST ON EARTH-RETAlNING STRUCTURES DUE ...

    African Journals Online (AJOL)

    The various surcharges along retaining walls may include vehicle loads ... be developed from ice formation due to pore water freezing. ... Figure 1 Lateral pressure against rigid wall due to ... value for the case of a line load is due to the effect.

  8. Viktor Misiano kureerib Mark Raidperet ning Jaan Toomikut

    Index Scriptorium Estoniae

    2007-01-01

    27.05-26.08.2007 esitatakse Itaalia kunstikeskuses Pratos näitusel "Progressive Nostalgia" Jaan Toomiku videot "Merikajakas" (2004) ja Mark Raidpere videot "Andrei/Andris" (2006). Loetletud osalejad teistest maadest

  9. Banaanikasvatuse alused ning tootmispõhine teadus / Andres Taklaja

    Index Scriptorium Estoniae

    Taklaja, Andres, 1947-

    2011-01-01

    Kõrgtehnoloogilise tootmise ja tugevate ülikoolide seosest Silicon Valley näite põhjal ehk teaduspõhisest tootmisest ja tootmispõhisest teadusest, kus suured ettevõtted on tähtsad teaduse tellijad

  10. Puhtus ja kord majas ning mõtetes / Ene Vool

    Index Scriptorium Estoniae

    Vool, Ene, 1948-

    2007-01-01

    Kalle Rõõmuse projekteeritud inimese bioenergiast lähtuvast eramust, kus raudse järjekindlusega kasutati energeetilisest seisukohast ülimalt inimsõbralikke loodusmaterjale - mida vähem materjale, seda vähem väljamõjusid. Sisearhitekt oli Terje Kivist. Kalle Rõõmuse kommentaar

  11. 75 FR 337 - Action Affecting Export Privileges: Ning Wen

    Science.gov (United States)

    2010-01-05

    ... electronic components from the United States to the People's Republic of China (PRC) in violation of U.S... security reasons and their export to the PRC requires a license from the U.S. Department of Commerce... Shipper's Export Declarations, which are filed with the U.S. Government and which must contain information...

  12. Loe raha, ole paindlik ning kuula klienti / Peep Ehasalu

    Index Scriptorium Estoniae

    Ehasalu, Peep, 1966-

    2004-01-01

    Eesti ettevõtete TOP 100 1. koht. Kolmandat aastat järjest edetabeli tippu jõudnud Tele2 edu rajaneb kolmel sambal. Lisad: Tele2 Eesti AS; Tele2 pürgib maruliselt kõrgustesse. Kommenteerivad Andrus Hiiepuu, Inna Kramer ja Agne Kivisaar.

  13. Euroopa Majandus- ja Rahaliit ning rahapoliitika maailma kolmes peamises valuutaregioonis

    Index Scriptorium Estoniae

    2002-01-01

    Ilmunud ka: Alternative exchange rate regimes in the globalised world : conference dedicated to the 10th anniversary of the re-introduction of the Estonian kroon. - Tallinn. Vestlusringis esinesid Euroopa Keskpanga esindaja Pierre Vander Haegen, Saksa Liidupanga asepresident Jürgen Stark, Keio ülikooli professor Eisuke Sakakibara, USA rahandusministeeriumi atashee Euroopas James G. Wallar

  14. 76 FR 60452 - In the Matter of: Bahram Maghazehe, a.k.a. Benjamin Maghazehe, a.k.a. Ben Maghazehe, 154 Sequoia...

    Science.gov (United States)

    2011-09-29

    ...-installation and removal of the equipment from the U.S. hospital and the export of the equipment from the...). Maghazehe had knowledge that a U.S. hospital was discarding the oncology system and that a company in Iran... States. For purposes of this paragraph, servicing means installation, maintenance, repair, modification...

  15. 75 FR 73156 - The Amended Designation of Lashkar-e-Tayyiba (LT, LeT), aka Lashkar-e-Toiba, aka Lashkar-i-Taiba...

    Science.gov (United States)

    2010-11-29

    ..., Falah Insania, Welfare of Humanity, Humaniatarian Welfare Foundation, Human Welfare Foundation...-i-Insaniyat, Falah Insania, Welfare of Humanity, Humaniatarian Welfare Foundation, Human Welfare...

  16. Peer To Peer-utlåning i Sverige : En komparativ studie mellan bankutlåning och Peer To Peer-utlåning på den svenska konsumentkreditmarknaden

    OpenAIRE

    Edman, Lars; Kaltea, Kristofer

    2015-01-01

    Background: Peer to peer lending has in recent years emerged and become a popular way to borrow money, mostly in the US and the UK. Since the first company was established in 2005, several competitors have emerged, and P2P lending has grown on average by 84 % quarterly between the second quarter year 2007 and the second quarter year 2014 in the US. Lending Club, which is the largest player within P2P-lending, has since its start in 2008 carried loans of a total value of six billions USD. Aim:...

  17. Gut Microbiome of Coexisting BaAka Pygmies and Bantu Reflects Gradients of Traditional Subsistence Patterns

    Czech Academy of Sciences Publication Activity Database

    Gomez, A.; Petrželková, Klára Judita; Burns, M. B.; Yeoman, C. J.; Amato, K. R.; Vlčková, K.; Modrý, David; Todd, A.; Robinson, C. A. J.; Remis, M. J.; Torralba, M.; Morton, E.; Umana, J. D.; Carbonero, F.; Gaskins, H. R.; Nelson, K. E.; Wilson, B. A.; Stumpf, R. M.; White, B. A.; Leigh, S. R.; Blekhman, R.

    2016-01-01

    Roč. 14, č. 9 (2016), s. 2142-2153 ISSN 2211-1247 Institutional support: RVO:60077344 Keywords : western lowland gorillas * microbiome * metabolomics * foraging ecology * anthropogenic interactions Subject RIV: EE - Microbiology, Virology Impact factor: 8.282, year: 2016

  18. Gut microbiome of coexisting BaAka pygmies and Bantu reflects gradients of traditional subsistence patterns

    Czech Academy of Sciences Publication Activity Database

    Gomez, A.; Petrželková, Klára Judita; Burns, M. B.; Yeoman, C. J.; Amato, K. R.; Vlčková, K.; Modrý, D.; Todd, A.; Robinson, C. A. J.; Remis, M. J.; Torralba, M.; Morton, E.; Umana, J. D.; Carbonero, F.; Gaskins, H. R.; Nelson, K.; Wilson, B. A.; Stumpf, R. M.; White, B. A.; Leigh, S. R.; Blekhman, R.

    2016-01-01

    Roč. 14, č. 9 (2016), s. 2142-2153 ISSN 2211-1247 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : western lowland gorillas * microbiome * metabolomics * foraging ecology * anthropogenic interactions Subject RIV: EG - Zoology Impact factor: 8.282, year: 2016

  19. Virumaal elab hiphopkultuur rampidel ja tänavatel / Britta aka BB

    Index Scriptorium Estoniae

    Britta aka BB

    2008-01-01

    Rakvere JJ-Street on esimene ametlik tänavatantsukool Eestis. 26.-28. septembril toimub Tallinnas Salme kultuurikeskuses tänavatantsufestival JJ-Street Baltic Session, festivali korraldaja on Joel Juht

  20. High efficiency environmental sampling with UV-cured peelable coatings (aka NuGoo project)

    Energy Technology Data Exchange (ETDEWEB)

    Henzl, Vladimir [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Junghans, Sylvia Ann [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lakis, Rollin Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-11-21

    This report presents slides on CA Related Project (FY13-17); Environmental sampling by IAEA (not only) during CA; Decontamination gels; Cotton swipes vs. decon gel (FY15); Contamination removal study; The origins of the NuGoo; NuGoo – proof of concept; NuGoo – FY17 project ($250K); LED lamp – which one works and why; Selecting photoinitiator; Monomers and oligomers; Results.

  1. Alois Philipp Maria. Maksuparadiisi söakas troonipärija / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    Liechtensteini prints Alois Philipp Maria andis vastulöögi Saksamaa süüdistusele. Väideti, et Liechtensteinis ei peeta läbipaistvusest ja seadusega kooskõlas olemisest lugu. Prints Alois Philipp Maria. Kaart: Maksuparadiisid

  2. Adventures in Music Translation: Italian Songs and Arias (aka “The Yellow Book” and Me

    Directory of Open Access Journals (Sweden)

    Lynn Penrod

    2017-06-01

    Full Text Available This article is a general exploration of translation issues involved in the translation and performance of the art song, arguing that although critical interest in recent years has been growing, the problems involved in these hybrid translation projects involving both text and music present a number of conundrums: primacy of text or music, focus on performability, and age-old arguments about fidelity and/or foreignization vs domestication. Using information from theatre translation and input from singers themselves, the author argues that this particular area of translation studies will work best in the future with a collaborative approach that includes translators, musicologists, and performers working together in order to produce the most “singable” text as possible for the art song in performance.

  3. Switch-attention (aka switch-reference in South-American temporal clauses: facilitating oral transmission

    Directory of Open Access Journals (Sweden)

    Rik van Gijn

    2012-01-01

    Full Text Available Cultures without a written tradition depend entirely on the oral channel to transmit sometimes highly complex information. It is therefore not surprising that in the languages of such cultures linguistic devices evolve that enhance textual coherence, and thus comprehension. These devices should ideally also be economical in terms of morphosyntactic complexity in order to facilitate both production and comprehension. In this paper, I will argue that switch-attention (a term preferred over the traditional switch-reference systems in temporal clauses fulfill these requirements of cohesion and complexity reduction, making them particularly apt for orally transmitting texts. Moreover, switch-reference systems seem to diffuse relatively easily. These features taken together are suggested to be (partly responsible for the widely attested phenomenon in areas without a lengthy written tradition.

  4. Science in a Team Environment (AKA, How to Play Nicely with Others)

    Science.gov (United States)

    Platts, S. H.; Primeaux, L.; Swarmer, T.; Yarbough, P. O

    2017-01-01

    So you want to do NASA funded research in a spaceflight analog? There are several things about participating in an HRP managed analog that may be different from the way you normally do work in your laboratory. The purpose of this presentation is to highlight those differences and explain some of the unique aspects of doing this research. Participation in an HRP funded analog study complement, even if initially selected for funding, is not automatic and involves numerous actions from ISSMP, HRP, and the PI. There are steps that have to be taken and processes to follow before approval and ISSMP-FA integration. After the proposal and acceptance process the Investigator works closely with the Flight Analog team to ensure full integration of their study requirements into a compliment. A complement is comprised of a group of studies requiring a common platform and/or scenario that are able to be integrated on a non-interference basis for implementation. Full integration into the analog platform can be broken down into three phases: integration, preparation, and implementation. These phases occur in order with some overlap in the integration and preparation phase. The ISSMP-FA team integrates, plans and implements analog study complements. Properly defining your research requirements and getting them documented is one of the most critical components to ensure successful integration and implementation of your study, but is also one of the most likely to be neglected by PIs. Requirements that are not documented, or that are documented poorly are unlikely to get done, no matter how much you push. The process to document requirements is two-fold, consisting of an initial individual requirements integration and then a compliment requirements integration. Understanding the requirements in detail and early ensures that the science is not compromised by outside influences. This step is vital to the integration, preparation, and implementation phases. The individual requirements integration is the first step in ensuring that the research fits into an available analog platform or allows for the Flight Analog team to provide information on structural study changes for participation in the analog. At this early point investigators need to understand exactly what their requirements are to produce relevant data and convey their must have needs to the Flight Analog team. The fluid nature of analog platforms allow for minor alterations to the operational structure. Participation in analog research requires flexibility from the investigator to ensure implementation of their research into a flight like analog platform. The compliment integration requires plasticity; investigators are asked to work closely with one another and the Flight Analog team to combine research studies into a single study plan. This study plan's ultimate goal is to facilitate multiple study participation with minimal scientific impact to each individual study. The Flight Analogs team works to find the best compromise for all parties while protecting the flight like atmosphere of a particular analog. Additional restrictions, limitations and constraints may be required by the analog in order to make all of the science work. Many studies need to be combined into each complement and there are a limited number of hours available for data collection. Through data/sample sharing, we can reduce the burden on the test subject, while usually avoiding significant science impacts. Restrictions on food, exercise, medications and sleep cycle are important to consider for your research.

  5. A Peculiar Subclass of Type Ia Supernovae a.k.a. Type Iax

    Science.gov (United States)

    Singh, Mridweeka; Misra, Kuntal; Sahu, Devendra Kumar; Dastidar, Raya; Gangopadhyay, Anjasha; Bose, Subhash; Srivastav, Shubham; Anapuma, Gadiyara Chakrapani; Chakradhari, Nand Kumar; Kumar, Brajesh; Kumar, Brijesh; Pandey, Shashi Bhushan

    2018-04-01

    We present optical photometric (upto ˜ 410 days since Bmax) and spectroscopic (upto ˜ 235 days since Bmax) observations of a type Iax supernova SN 2014dt located in M61. The broad band light curves follow a linear decline up to ˜ 100 days after which a significant flattening is seen in the late-time (beyond 150 days) light curves of SN 2014dt. SN 2014dt best matches the light curve evolution of SN 2005hk and reaches a peak magnitude of MB˜ -18.12±0.04 with ?m15˜ 1.35±0.06 mag. The earliest spectrum at ˜ 23 days is dominated by FeII and CoII lines with the absence of the Si II 6150 Å line. Using the peak bolometric luminosity we estimate a 56Ni mass of 0.14 M⊙ in the case of SN 2005hk and the striking similarity between SN 2014dt and SN 2005hk implies that a comparable amount of 56Ni would have been synthesized in the explosion of SN 2014dt. There are several explosion scenarios proposed for these peculiar events. Being one of the brightest and closest SN! , SN 2014dt is an ideal candidate for long term monitoring. Late phase observations are very essential to understand the progenitor system and the actual explosion scenario for these events.

  6. Propellant Handler’s Ensemble, aka Self-Contained Atmospheric Protective Ensemble (SCAPE), Ventilator Improvement Study

    Data.gov (United States)

    National Aeronautics and Space Administration — Life Support Services provides personal protective equipment services to the Space Shuttle, Delta and Atlas launch vehicles and their payloads, and other tenant...

  7. Ballywood ehk Balti Küpsis = Ballywood aka Baltic Cookie / Kalle Komissarov

    Index Scriptorium Estoniae

    Komissarov, Kalle, 1976-

    2010-01-01

    Žürii liige Tallinna Ülikooli Loomemaja ja ülikoolilinnaku sisehoovi kavandamiseks korraldatud avalikust arhitektuurivõistlusest, võidutööst. 1. auhinna sai võistlustöö "Küpsis", mille autoriteks on Maarja Kask, Karli Luik ja Ralf Lõoke (Salto). 2. auhind läks võistlustööle "Camera Obscura" (Luhse ja Tuhal), 3. auhind võistlustööle "2. oktoober" (Arhitektuuriagentuur)

  8. Forskningstræning i speciallægeuddannelsen i anæstesiologi

    DEFF Research Database (Denmark)

    Afzali, Monika; Jansen, Tejs; Skjelsager, Karen

    2014-01-01

    This article describes the structure of the research training module, as a part of the education programme for anaesthesiologists in the eastern region of Denmark. The module consists of courses, independent work on a project, guidance and evaluation. In a period of about four years a total of 56...... anaesthesiologists have completed the programme. A questionnaire revealed that 59% felt their abilities to read and interpret research had been improved and 30% reported an increasing interest in research. 40% had presented their project at scientific meetings and 25% had published their project....

  9. Väärt vara linnas ning maal / Ain Alvela ; kommenteerinud Mart Saa

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Uus Maa Kinnisvarabüroo tegevjuhi Mika Sucksdorffi hinnangul on Tallinnas kinnisvara üks arengusuundi Kalamaja-Kopli-Paljassaare piirkond. A&A Kinnisvara tegevjuhi Aivar Villemsoni hinnangul hakkavad kinnisvarahinnad tõusma esmalt pealinna keskmes, Rocca al Mare ja Pirita kandis

  10. Forskningstræning er utilstrækkeligblandt kommende læger

    DEFF Research Database (Denmark)

    Binderup, Marie Louise Mølgaard; Ete, Neval Ete; Ovesen, Christian

    2012-01-01

    This questionnaire survey investigated interest and activity in pregraduate research among 643 medical students at the Faculty of Health and Medical Sciences at the University of Copenhagen. We find, that although the students show great interest and motivation for research, very few have actual ...... research experience. The students described suboptimal research training, lack of tutoring and facilitation as well as of career counselling. Also, conditions for pregraduate research activities are unequal among the faculties of health sciences in Denmark....

  11. Film, ruum ja narratiiv : "Mis juhtus Andres Lapeteusega?" ning "Viini postmark" / Eva Näripea

    Index Scriptorium Estoniae

    Näripea, Eva, 1980-

    2011-01-01

    Analüüsitakse narratiivi aegruumi loomise viise juhtumi analüüsi vormis, vaadeldes kaht eesti mängufilmi : G. Kromanovi "Mis juhtus Andres Lapeteusega?" (Tallinnfilm, 1966) ja Veljo Käsperi "Viini postmark" (Tallinnfilm, 1967)

  12. Film, ruum ja narratiiv : "Mis juhtus Andres Lapeteusega?" ning "Viini postmark" / Eva Näripea

    Index Scriptorium Estoniae

    Näripea, Eva

    2006-01-01

    Analüüsitakse narratiivi aegruumi loomise viise juhtumi analüüsi vormis, vaadeldes kaht eesti mängufilmi : G. Kromanovi "Mis juhtus Andres Lapeteusega?" (Tallinnfilm, 1966) ja Veljo Käsperi "Viini postmark" (Tallinnfilm, 1967)

  13. Process Writing and the Internet: Blogs and Ning Networks in the Classroom

    Science.gov (United States)

    Boas, Isabela Villas

    2011-01-01

    In contrast to the product approach to writing, which is based on studying and replicating textual models, the process approach involves multiple and repeated steps that compel the writer to closely consider the topic, language, purpose for writing, and social reality of an audience. In addition to discussing the benefits of the process approach…

  14. Punase koolimaja saamisloost ning ajast enne ja pärast seda / Aavo Soopa

    Index Scriptorium Estoniae

    Soopa, Aavo

    1998-01-01

    Viljandi Maagümnaasiumi 120. aastapäeval meenutatakse G.M. Schmidti eraõppeasutust ja selle järglase Liivimaa Maagümnaasiumi sündi ja tegevust : ka Riia arhitekti R. Häuseri projekteeritud kahekorruselisest punasest tellismajast, mis valmis 1877.a.

  15. Filosofisk terapi som træning til døden

    DEFF Research Database (Denmark)

    Dræby, Anders

    Den eksistentielfænomenologiske terapi deler den opfattelse med stoicismen, at filosofiens hovedopgave er at hjælpe mennesket med at finde vej i en problematisk verden. Oplægget udforsker desuden et overlap, som består i den indsigt, at terapeutisk udfrielse fra menneskelig lidelse til livsduelig......Den eksistentielfænomenologiske terapi deler den opfattelse med stoicismen, at filosofiens hovedopgave er at hjælpe mennesket med at finde vej i en problematisk verden. Oplægget udforsker desuden et overlap, som består i den indsigt, at terapeutisk udfrielse fra menneskelig lidelse til...

  16. Ülevaade peamistest majandusindikaatoritest 1993-2000. a. ning prognoos 2001. a.

    Index Scriptorium Estoniae

    2001-01-01

    Sisemajanduse koguprodukt, tarbijahinna indeks, väliskaubandus, tööhõive, tööstustoodang, elanike sissetulekud, jae-ettevõtete kaubakäive. Diagrammid ja tabel: tähtsamad majandusindikaatorid ja nende prognoos 2001.a. Järgneb: Konjunktuur, juuni, nr. 2, 2001, lk. 36-38. Ilmunud ka: Konjunktuur : Quarterly Review of the Estonian Economy, mai, nr. 1, 2001, lk. 43-45; juuli, nr. 2, 2001, lk. 34-36

  17. Kollektiivse esindamise organisatsioonide litsentsitasud: suurusele seatud nõuded ning nende rakendamine / Mari Haamer

    Index Scriptorium Estoniae

    Haamer, Mari, 1993-

    2016-01-01

    Kollektiivse esindamise organisatsioonidest ja nende funktsioonist. Kollektiivse esindamise organisatsioonide litsentsitasude suurusest Eesti õiguses, nende nõuete täitmise kontrollimisest. Kasutajate ja kollektiivse esindamise organisatsioonide huvide tasakaalu säilitamisest. Sisaldab asjakohast kohtupraktikat

  18. Kulikov : Vene kinnisvaraäris toob edu enesekindlus ning lai silmaring / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2004-01-01

    Vene kinnisvaraärimehest Jevgeni Kulikovist, kes on Eestis toimuval rahvusvahelisel konverentsil "Kinnisvara 2004" peaesineja. Lisad: Kompanii MIEL; Vene kinnisvaraturg; Grigori Kulikov - Vene hinnatuim

  19. 1,65 miljardi dollari eest edevust ning näpatud saateid / Kalle Kose

    Index Scriptorium Estoniae

    Kose, Kalle

    2006-01-01

    Interneti sotsiaalvõrgustikust YouTube ja selle liitumisest Google'iga. Vt. ka: Intervjuu kasutajaga : "YouTube'i pärast on jäänud nii mõndagi tegemata." Aktsiakaupleja Oliver Peek räägib YouTube'i kasutamisest teleri asendajana. Diagramm: Videovahetuse keskkondade turuosad. Graafik: Videovahetuskeskkondade turuosa kasv USA-s

  20. Hjemmetræning på tværs af sektorer betaler sig

    DEFF Research Database (Denmark)

    Larsen, Torben

    2009-01-01

    plejeforanstaltninger og en afkortet liggetid på sygehuset. Udover sundhedsmæssige gevinster er der et samfundsøkonomisk besparelsespotentiale, som er betinget af en overvindelse af organisatoriske, finansielle og faglige barrierer jf. SWOT-analysen.    Da problemerne med at implementere denne viden i sundhedsvæsenet...

  1. Juhtimissüsteemide selgroog. Lean ning ISO - terviklahendused tootmise haldamiseks / Anton Ovsjankin

    Index Scriptorium Estoniae

    Ovsjankin, Anton

    2011-01-01

    Kasvanud on juurutatavate Lean ja ISO süsteemide arv, kuid on kasvanud ka nende juurutamise ja arendamisega seotud ebaõnnestumiste arv. Põhjustest, miks jäävad paljud Leani ja ISO juurutanud ettevõtted ilma lubatud tulemusteta. Leani ja ISO haldamiseks vajalikest teguritest

  2. Molecular Scree ning of Blast Resistance Genes in Rice Germplasms Resistant to Magnaporthe oryzae

    Directory of Open Access Journals (Sweden)

    Liang Yan

    2017-01-01

    Full Text Available Molecular screening of major rice blast resistance genes was determined with molecular markers, which showed close-set linkage to 11 major rice blast resistance genes (Pi-d2, Pi-z, Piz-t, Pi-9, Pi-36, Pi-37, Pi5, Pi-b, Pik-p, Pik-h and Pi-ta2, in a collection of 32 accessions resistant to Magnaporthe oryzae. Out of the 32 accessions, the Pi-d2 and Pi-z appeared to be omnipresent and gave positive express. As the second dominant, Pi-b and Piz-t gene frequencies were 96.9% and 87.5%. And Pik-h and Pik-p gene frequencies were 43.8% and 28.1%, respectively. The molecular marker linkage to Pi-ta2 produced positive bands in eleven accessions, while the molecular marker linkage to Pi-36 and Pi-37 in only three and four accessions, respectively. The natural field evaluation analysis showed that 30 of the 32 accessions were resistant, one was moderately resistant and one was susceptible. Infection types were negatively correlated with the genotype scores of Pi-9, Pi5, Pi-b, Pi-ta2 and Pik-p, although the correlation coefficients were very little. These results are useful in identification and incorporation of functional resistance genes from these germplasms into elite cultivars through marker-assisted selection for improved blast resistance in China and worldwide.

  3. Balansseerimine abstraktse liikumise ning tähendusliku loo vahel / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin

    2008-01-01

    "Augusti tantsufestival" Tallinnas Kanuti gildi saalis 21.-31. VIII 2008. Tantsulavastustest "Gallina Aquatica", "Creating Sense", "Mi madre y yo", "Ball", "Radiodance", "And I just stood there watching the sky and the people below"

  4. Effekten av fysisk träning på e-sportprestation

    OpenAIRE

    Johnsson, Oliver

    2017-01-01

    Purpose The purpose of this study was to investigate the effects of physical exercise on different skills that affect e-sports performance for e-sportsmen at amateur level in the game Overwatch. This is to gain knowledge about how e-sports training could be developed and streamlined. Methods The study is of the explorative research type since it deals with a topic that haven’t previously been broadly investigated. The method used was a quantitative exploratory method. The design was an inte...

  5. Kardial adaptation til fysisk træning--fysiologiske og kliniske aspekter

    DEFF Research Database (Denmark)

    Gustafsson, F; Mehlsen, J

    1999-01-01

    Vigorous physical training induces left ventricular hypertrophy (LVH), a so-called "athlete's heart". The hypertrophic response represents an adaptation to the increased haemodynamic load on the heart associated with physical exercise. Wall thickness and/or left ventricular internal diameters...... these athletes are male oarsmen. Occasionally, it may be difficult to distinguish physiological LVH from primary heart disease and therefore it is of importance also for physicians to be familiar with the "athlete's heart". Also, the sensitivity of the non-invasive methods for detecting coronary heart disease...

  6. Võimalusi ning viiteid teatrikunsti ja muinasjutu sobitamisele teatriõhtuks / Rait Avestik

    Index Scriptorium Estoniae

    Avestik, Rait

    2006-01-01

    Muinasjuttudest (nende teatralisatsioonidest) täiskasvanutele Eesti teatris - "Jänese aasta" (Von Krahli Teater, lav. Kristian Smeds), "Suur kuri hunt" (Vanemuine, lav. Taago Tubin), "Kaks päikest" (NO99, lav. Andres Noormets), "Troll-Poiss" (Eesti Riiklik Nukuteater, lav. Finn Poulsen)

  7. Velfungerende forskningstræning i gynækologi og obstetrik

    DEFF Research Database (Denmark)

    Settnes, Annette; Lykkebo, Annemette Windfang; Eriksen, Gitte

    2011-01-01

    In 2003 The National Board of Health, Denmark, enforced a compulsory training course in academic research as part of the specialist training for doctors. The trainees must learn to search and evaluate relevant literature and be able to implement the results in clinical practice. The structure of ...

  8. Development and Evaluation of Ning Social Network for Teaching Training Online Surveillance

    Science.gov (United States)

    Mohd Nawi, Mohd Aliff; Jamsari, Ezad Azraai; Sulaiman, Adibah; Hamzah, Mohd Isa

    2013-01-01

    Supervision of teaching practice is an important aspect of training teachers in improving their teaching skills. Barriers such as distance and time factor are the constraints faced by the lecturers at the National University of Malaysia to communicate with the teacher trainees under their supervision. Therefore, this study aims to develop and…

  9. Haldusleping : mõiste, kasutusala ning mõned olulised õiguslikud jooned / Martin Hirvoja

    Index Scriptorium Estoniae

    Hirvoja, Martin, 1977-

    1999-01-01

    Halduslepingu mõistest ja piiritlemisest teistest avalik-õiguslikest ja eraõiguslikest lepingutest, halduslepingu kasutusalast, kirjalikust vormist, motiveerimisest, tühisusest ja tühistatavusest

  10. Tartu ja Tallinna boheemkond ning lotovõitjad : Valitud palu dokumentaalfilmide sarjast "Eesti lood" / Olev Remsu

    Index Scriptorium Estoniae

    Remsu, Olev, 1947-

    2009-01-01

    ETVs näidatud dokumentaalfilmidest sarjas "Eesti lood" - Indrek Kangro film Jaan-Jürgen Klausist "Professionaalne amatöör" (eetris 3. XII 2008), Margit Lillaku film kunstnik Sandra Jõgevast "Ars longa" (eetris 29. X 2008), Eva-Katariina Taimre "Jackpot" lotovõitjatest (eetris 19. XI 2008)

  11. "Popi ja Huhuu" ning tema eelkäija eesti kirjanduses / Pille-Riin Larm

    Index Scriptorium Estoniae

    Larm, Pille-Riin, 1981-

    2012-01-01

    Friedebert Tuglase novelli "Popi ja Huhuu" kõrvutatakse 1881. aasta Meelejahutajas ilmunud anonüümse ajaviitejutuga "Ahvi armastus ja kättemaksmine". - Jutuke "Ahwi armastus ja kättemaksmine" sisaldub artikli lisas lk. 750-754

  12. Kehakunsti valu ning võlu : kolm Manifesta performance'it / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    1998-01-01

    Performance'id : New Yorgis elava poola kunstniku Piotr Uklanski 'Üleni põlemine', belgia kunstniku Honoré d'O 'Käsikiri varahoidjale', serblase Tanja Ostojici performance. Luksemburgi kunstniku Bert Theisi reis 'Dialektiline hüpe'

  13. Millestki ürgsest ja kargest ning autoriteediröövist / Madis Ernits

    Index Scriptorium Estoniae

    Ernits, Madis, 1971-

    2015-01-01

    Riigikorraldust reguleerivatest põhiseadusnormidest. Riigikohtu lahendist 3-4-1-6-12: õiguskantsleri taotlus nr 8 „Euroopa stabiilsusmehhanismi asutamislepingu artikkel 4 lõike 4 põhiseadusele vastavuse kohta.” Kriitika ja arvamused ESM-kaasuse kohta

  14. Järgsilpide "o" ja "u" varieerumine ning traditsioonid vanas kirjakeeles / Külli Prillop

    Index Scriptorium Estoniae

    Prillop, Külli

    2009-01-01

    Kirjeldatakse, mida võib vanade tekstide põhjal oletada "o" ja "u" vaheldumisest ja selle põhjustest, kasutades eelkõige Georg Mülleri jutluste tekste. Selgitatakse ka probleeme vana kirjakeele tekstide põhjal keelemuutuste kohta järelduste tegemisel

  15. Eile sai Eesti Kunstimuuseumi asutamisest 86 aastat ning Tartu Kunstimuuseumi asutamisest 65 aastat

    Index Scriptorium Estoniae

    2005-01-01

    Kumu ettekannetepäev "Roheline, toores ja lõikamata. Noor eesti kunst uue sajandi alguses" sarjast "Lisandusi eesti kunstiloole". Esinesid Karin Laansoo, Irit Rogoff, Kaido Ole, Kristjan Mändmaa, Rael Artel. Esitleti raamatut "22 + Noored eesti kunstnikud. Young Estonian Artists". 18. XI kirjutatakse alla Jaapani valitsuse kultuuritoetusleping, mis on suunatud Kumu varustamiseks kaasaegse audiogiidi süsteemiga, esitlustehnika ja maalikonserveerimislabori tehnikaga

  16. Assessment of absorption of four lignan constituents of JingNing ...

    African Journals Online (AJOL)

    Pharmacotherapy Group, Faculty of Pharmacy, University of Benin, Benin City, 300001 Nigeria. All rights ... There are some methods used to evaluate intestinal absorption kinetics .... gravimetric correction method proposed by. Sutton et al was ...

  17. Træning af kontrolleret empati i accelererede kræftbehandlingsforløb

    DEFF Research Database (Denmark)

    Roelsgaard Obling, Anne

    2012-01-01

    This paper takes departure from sociology of emotions to explore the training of empathy and empathic response in accelerated cancer care. The paper focuses on a training workshop in empathic communication during which doctors from a cancer clinic learn to recognise and control the emotional frame...... of doctor-patient interactions. Through a descriptive analysis, it addresses how communication techniques are rehearsed and it discusses the effects of this training. It is shown that the performance of communicating empathically relies on standardised scripts, which direct and cultivate the conduct...... of techniques of micro-management such as qualitative measurement and performance audit. In other words, attempts to improve softer dimensions of medical services entail a further standardisation of these dimensions....

  18. Expectancies for cigarettes, e-cigarettes, and nicotine replacement therapies among e-cigarette users (aka vapers).

    Science.gov (United States)

    Harrell, Paul T; Marquinez, Nicole S; Correa, John B; Meltzer, Lauren R; Unrod, Marina; Sutton, Steven K; Simmons, Vani N; Brandon, Thomas H

    2015-02-01

    Use of e-cigarettes has been increasing exponentially, with the primary motivation reported as smoking cessation. To understand why smokers choose e-cigarettes as an alternative to cigarettes, as well as to US Food and Drug Administration (FDA)--approved nicotine replacement therapies (NRT), we compared outcome expectancies (beliefs about the results of drug use) for the three nicotine delivery systems among vapers, i.e., e-cigarette users, who were former smokers. Vapers (N = 1,434) completed an online survey assessing 14 expectancy domains as well as perceived cost and convenience. We focused on comparisons between e-cigarettes and cigarettes to determine the attraction of e-cigarettes as a smoking alternative and between e-cigarettes and NRT to determine perceived advantages of e-cigarettes over FDA-approved pharmacotherapy. Participants believed that e-cigarettes, in comparison to conventional cigarettes, had fewer health risks; caused less craving, withdrawal, addiction, and negative physical feelings; tasted better; and were more satisfying. In contrast, conventional cigarettes were perceived as better than e-cigarettes for reducing negative affect, controlling weight, providing stimulation, and reducing stress. E-cigarettes, compared to NRT, were perceived to be less risky, cost less, cause fewer negative physical feelings, taste better, provide more satisfaction, and be better at reducing craving, negative affect, and stress. Moderator analyses indicated history with ad libitum forms of NRT was associated with less positive NRT expectancies. The degree to which expectancies for e-cigarettes differed from expectancies for either tobacco cigarettes or NRT offers insight into the motivation of e-cigarette users and provides guidance for public health and clinical interventions to encourage smoking-related behavior change. © The Author 2014. Published by Oxford University Press on behalf of the Society for Research on Nicotine and Tobacco. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  19. Ainult hulludele : [ultra-võistluste sarjast Haanja100 Neliküritus] / Ivar Tupp aka Dr Holden

    Index Scriptorium Estoniae

    Tupp, Ivar

    2011-01-01

    Tartu üliõpilaste looduskaitseringi Lumeilvese matkadest ehk Eesti 20 kõrgeima mäetipu vallutamisest, millest kasvas välja haanjamatkad.ee, mis korraldab ka ülipika distantsiga spordivõistluste sarja Haanja neliküritus. Lisa: Matk üle mägede

  20. Biological soil crusts: An organizing principle in dryland ecosystems (aka: the role of biocrusts in arid land hydrology)

    Science.gov (United States)

    Chamizo, Sonia; Belnap, Jayne; Elridge, David J; Issa, Oumarou M

    2016-01-01

    Biocrusts exert a strong influence on hydrological processes in drylands by modifying numerous soil properties that affect water retention and movement in soils. Yet, their role in these processes is not clearly understood due to the large number of factors that act simultaneously and can mask the biocrust effect. The influence of biocrusts on soil hydrology depends on biocrust intrinsic characteristics such as cover, composition, and external morphology, which differ greatly among climate regimes, but also on external factors as soil type, topography and vegetation distribution patterns, as well as interactions among these factors. This chapter reviews the most recent literature published on the role of biocrusts in infiltration and runoff, soil moisture, evaporation and non-rainfall water inputs (fog, dew, water absorption), in an attempt to elucidate the key factors that explain how biocrusts affect land hydrology. In addition to the crust type and site characteristics, recent studies point to the crucial importance of the type of rainfall and the spatial scale at which biocrust effects are analyzed to understand their role in hydrological processes. Future studies need to consider the temporal and spatial scale investigated to obtain more accurate generalizations on the role of biocrusts in land hydrology.

  1. 78 FR 76103 - Donald V. Bernardo, a/k/a Don Bernarndo, 701 Fredericksburg Road, Mathews, NC 28105; Order...

    Science.gov (United States)

    2013-12-16

    ..., sales, and transfers of defense articles, that is, C-130 Hercules military transport aircraft, in return... owned, possessed or controlled by the Denied Person, or service any item, of whatever origin, that is...

  2. Y(BH4)3--an old-new ternary hydrogen store aka learning from a multitude of failures.

    Science.gov (United States)

    Jaroń, Tomasz; Grochala, Wojciech

    2010-01-07

    Fourteen different synthetic approaches towards pure solvent-free Y(BH(4))(3) have been tested, thirteen of which have failed. Attempted reactions of YCl(3) or Y(OC(4)H(9))(3) with LiBH(4) in THF, those of YCl(3) with (C(4)H(9))(4)N(+) BH(4)(-), as well as between YH(x approximately 3) and R(4)NBH(3) (R = CH(3), C(2)H(5)) in the presence or absence of a solvent (n-hexane or CH(2)Cl(2)) did not lead to the expected product. The mechanochemical solid/solid reactions (MBH(4) + 3 YX(3)--> Y(BH(4))(3) + 3 LiCl, where M = Li, Na; X = F, Cl) have succeeded only for the LiBH(4) and YCl(3) reagents, but the separation of the crystalline reaction products (Y(BH(4))(3) in its Pa3 phase and LiCl) by dissolution or flotation in various solvents has not been successful. The thermal decomposition process of Y(BH(4))(3) in a mixture with LiCl has been investigated with thermogravimetric (TGA) and calorimetric analysis (DSC) combined with spectroscopic evolved gas analysis (EGA). Three major endothermic steps could be distinguished in the DSC profile at ca. 232, 282, 475 degrees C (heating rate 10 K min(-1)) corresponding to a phase transition and two steps of thermal decomposition. Solid decomposition products are amorphous except for the new cubic polymorph of Y(BH(4))(3) overlooked in previous work. The high-temperature phase forms at the onset of thermal decomposition and it may be prepared by heating of the low-temperature phase up to a narrow temperature range (194-210 degrees C) followed by rapid quenching. Y(BH(4))(3) constitutes a novel highly efficient hydrogen storage material (theor. 9.0 wt% H) but, unfortunately, the evolved H(2) is contaminated by toxic boron hydrides and products of their pyrolysis.

  3. Digital coach supporting the creation of a project plan (A.K.A. pid or plan of approach)

    NARCIS (Netherlands)

    Steven Nijhuis

    2012-01-01

    full text via link. A lot of curricula in higher education depend on Project Based Learning. This provides students with a setting which (slightly) resembles their future way of working: in teams, in projects. The rojects have increasingly a real problem-owner, so students are highly motivated to

  4. 77 FR 66462 - Proposed CERCLA Settlement Relating to the Digital Equipment Corp. Site a/k/a the PCB Horizon...

    Science.gov (United States)

    2012-11-05

    ..., Puerto Rico. Under this Agreement, the Settling Party agrees to pay a total of $50,000 to EPA in two equal payments for past response costs in accordance with the following schedule. Within five business days after the Settling Party receives notice from EPA that this Agreement has been signed by EPA, the...

  5. Stanford-Binet & WAIS IQ Differences and Their Implications for Adults with Intellectual Disability (aka Mental Retardation)

    OpenAIRE

    Silverman, Wayne; Miezejeski, Charles; Ryan, Robert; Zigman, Warren; Krinsky-McHale, Sharon; Urv, Tiina

    2010-01-01

    Stanford-Binet and Wechsler Adult Intelligence Scale (WAIS) IQs were compared for a group of 74 adults with intellectual disability (ID). In every case, WAIS Full Scale IQ was higher than the Stanford-Binet Composite IQ, with a mean difference of 16.7 points. These differences did not appear to be due to the lower minimum possible score for the Stanford-Binet. Additional comparisons with other measures suggested that the WAIS might systematically underestimate severity of intellectual impairm...

  6. Stanford-Binet and WAIS IQ Differences and Their Implications for Adults with Intellectual Disability (aka Mental Retardation)

    Science.gov (United States)

    Silverman, Wayne; Miezejeski, Charles; Ryan, Robert; Zigman, Warren; Krinsky-McHale, Sharon; Urv, Tiina

    2010-01-01

    Stanford-Binet and Wechsler Adult Intelligence Scale (WAIS) IQs were compared for a group of 74 adults with intellectual disability (ID). In every case, WAIS Full Scale IQ was higher than the Stanford-Binet Composite IQ, with a mean difference of 16.7 points. These differences did not appear to be due to the lower minimum possible score for the…

  7. Stanford-Binet & WAIS IQ Differences and Their Implications for Adults with Intellectual Disability (aka Mental Retardation).

    Science.gov (United States)

    Silverman, Wayne; Miezejeski, Charles; Ryan, Robert; Zigman, Warren; Krinsky-McHale, Sharon; Urv, Tiina

    2010-03-01

    Stanford-Binet and Wechsler Adult Intelligence Scale (WAIS) IQs were compared for a group of 74 adults with intellectual disability (ID). In every case, WAIS Full Scale IQ was higher than the Stanford-Binet Composite IQ, with a mean difference of 16.7 points. These differences did not appear to be due to the lower minimum possible score for the Stanford-Binet. Additional comparisons with other measures suggested that the WAIS might systematically underestimate severity of intellectual impairment. Implications of these findings are discussed regarding determination of disability status, estimating prevalence of ID, assessing dementia and aging-related cognitive declines, and diagnosis of ID in forensic cases involving a possible death penalty.

  8. 75 FR 71075 - Action Affecting Export Privileges; Anvik Technologies Sdn. Bhd., a/k/a Anvik Technologies; Babak...

    Science.gov (United States)

    2010-11-22

    ..., Malaysia, and certifying that the items ``will not be diverted to any country, company or individual that.... companies about end- users in an effort to prevent U.S. law enforcement officials from discovering and... Lumpur 50250, Malaysia Level 36, Menara Citibank, 165 Jalan Ampang, Kuala Lumpur 50450, Malaysia Level 19...

  9. MINERALIZING, STEAM REFORMING TREATMENT OF HANFORD LOW-ACTIVITY WASTE (a.k.a. INEEL/EXT-05-02526)

    International Nuclear Information System (INIS)

    A. L. Olson; N. R. Soelberg; D. W. Marshall; G. L. Anderson

    2005-01-01

    The U.S. Department of Energy (DOE) documented, in 2002, a plan for accelerating cleanup of the Hanford Site, located in southeastern Washington State, by at least 35 years. A key element of the plan was acceleration of the tank waste program and completion of ''tank waste treatment by 2028 by increasing the capacity of the planned Waste Treatment Plant (WTP) and using supplemental technologies for waste treatment and immobilization''. The plan identified steam reforming technology as a candidate for supplemental treatment of as much as 70% of the low-activity waste (LAW). Mineralizing steam reforming technology, offered by THOR Treatment Technologies, LLC would produce a denitrated, granular mineral waste form using a high-temperature fluidized bed process. A pilot scale demonstration of the technology was completed in a 15-cm-diameter reactor vessel. The pilot scale facility was equipped with a cyclone separator and heated sintered metal filters for particulate removal, a thermal oxidizer for reduced gas species and NOx destruction, and a packed activated carbon bed for residual volatile species capture. The pilot scale equipment is owned by the DOE, but located at the Science and Technology Applications Research (STAR) Center in Idaho Falls, ID. Pilot scale testing was performed August 2-5, 2004. Flowsheet chemistry and operational parameters were defined through a collaborative effort involving Idaho National Engineering and Environmental Laboratory (INEEL), Savannah River National Laboratory (SRNL), and THOR Treatment Technologies personnel. Science Application International Corporation, owners of the STAR Center, personnel performed actual pilot scale operation. The pilot scale test achieved a total of 68.4 hours of cumulative/continuous processing operation before termination in response to a bed de-fluidization condition. 178 kg of LAW surrogate were processed that resulted in 148 kg of solid product, a mass reduction of about 17%. The process achieved essentially complete bed turnover within approximately 40 hours. Samples of mineralized solid product materials were analyzed for chemical/physical properties. SRNL will report separately the results of product performance testing that were accomplished

  10. Võrdseid võimalusi ja õppimist soodustav koolijuhtimine ning koolide autonoomia / Pavlos Hatzopoulos, Andreas Kollias, Kathy Kikis-Papadakis

    Index Scriptorium Estoniae

    Hatzopoulos, Pavlos

    2015-01-01

    Artikkel käsitleb European Policy Network on School Leadershipi (EPNoSL) raames tehtud analüüse, keskendudes kooli autonoomia küsimustele Euroopas, osutades vajadusele hoida kooli autonoomia ja keskvõimu otsustusõigus mõistlikus tasakaalus

  11. En tránsito a ningún lugar. Sobre Diario de una pasajera de Ágata Gligo

    Directory of Open Access Journals (Sweden)

    Alberto Giordano

    2014-06-01

    This essay presents a reading of Ágata Gligo’s Diario de una pasajera heedful to the ways in which her writing responds to the experiences of unhappiness and frustration related to the autobiographical circumstances that are in their origin: the disease (cancer and the literary block. The present workdiscusses how the act of understanding the disease and its social consequences reduce the diary’s writing performative power great thanksand how the distrust of the language dynamics and the novelist idealization obstruct the diary’s possibility of becoming a literary and existential immanent search.

  12. Astmelise tulumaksu mõju Eesti maksusüsteemile, kohalike omavalitsuste eelarvetele ning pensionireformile / Kairi Lainjärv

    Index Scriptorium Estoniae

    Lainjärv, Kairi

    2003-01-01

    Autor järeldab, et astmelise tulumaksu rakendamine vähendab kohalike omavalitsuste tulubaasi, lükkab edasi pensionireformi eesmärki suurendada kodumaist säästmist, rikub Eesti lubadust Euroopa Liidule säilitada proportsionaalne tulumaks, tekitab vajaduse suurendada tulubaasi säilitamiseks kaudsete maksude osakaalu, võib kaasa tuua majanduskasvu pidurdamise, suurendab jõukamate ja vaesemate ühiskonnakihtide võõrandumist üksteisest. Tabelid

  13. Peterburis pakutakse valgeid öid täis muusikat ning Neeme Järvit / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2005-01-01

    Peterburis toimuvast 7 nädalat kestvast süvamuusikafestivalist "Valgete ööde tähed/Stars of the White Nights", kontsertidel esinejatest. 25. juunil toimuvast Neeme, Paavo ja Kristjan Järvi ühiskontserdist

  14. Suur põgenemine 1944 : eestlaste lahkumine läände ning selle mõjud / Peep Pillak

    Index Scriptorium Estoniae

    Pillak, Peep, 1957-

    2005-01-01

    Välis-Eesti uuringute keskuse ja Rootsi Eesti saatkonna korraldatud teaduskonverensist (Tartu, 22. okt. 2004), kus arutluse all oli 1944. a. suur põgenemine läände ja selle mõjud tänasesse päeva

  15. "Vältimatud nuhtlused" : August Komendant, Louis I. Kahn ja arhitektuuri ning insenerikunsti keerulised suhted / Thomas Leslie

    Index Scriptorium Estoniae

    Leslie, Thomas

    2006-01-01

    Artikkel põhineb Thomas Leslie Kuressaares Louis Kahni päevadel peetud ettekandel. Louis Kahni koostöös August Komendandiga projekteeritud hoonetest pikemalt Richardsi Meditsiiniliste Uuringute laboratooriumist, Salki bioloogianistituudist (1959-1965, La Jolla, Kalifornia) ja Kimbelli kunstimuuseumist (1966-1972, Texas, Fort Worth). Bibl. lk. 75

  16. Fysisk træning hjælper også normalvægtige kvinder med polycystisk ovariesyndrom

    DEFF Research Database (Denmark)

    Bisgaard, Helene; Dela, Flemming

    2017-01-01

    Polycystic ovary syndrome (PCOS) affects 12-21% of women in the childbearing age and is the most common cause of hyperandrogenaemia and anovulatory infertility. There is an increase in insulin resistance in both overweight and lean women with PCOS. Exercise treatment is mandatory among...... the overweight women due to sufficient evidence that it can improve the signs and symptoms of PCOS. This has not been fully investigated among the lean. However, new randomized controlled trials show that structured physical exercise can also improve insulin sensitivity, hyperandrogenaemia and menstrual...... frequency in lean women with PCOS....

  17. Uudised : Ernesaksa auhind ning stipendiumid. Arvo Pärdi uus teos Roomas. Paavo Järvi Euroopas / Ilmar Moss

    Index Scriptorium Estoniae

    Moss, Ilmar

    2000-01-01

    4. dets. toimus Kuusalus G.Ernesaksa mälestuskontsert, kus anti üle stipendiumid ja Ernesaksa nim. auhind. 19. nov. toimus Roomas A.Pärdi teose "Cecilia, vergine romana" esiettekanne. P.Järvi kontsertidest detsembris Euroopas

  18. Direktiivsed kõneaktid ning nende kasutamise dünaamika isa ja ema kõnes: juhtumiuuring

    Directory of Open Access Journals (Sweden)

    Helen Kõrgesaar

    2015-04-01

    Full Text Available The aim of the article is to give an overview of directive speech acts in Estonian child-directed speech. Two school-age children from the same family and their dialogues with both parents individually are under observation. A longitudinal study has been used as the method (one child has been regularly recorded from ages 7 to 10, the other from ages 10 to 14, including 16 hours of audio material. All directive speech acts have been singled out from the parents’ speech and classified into imperatives, hints, prohibitions, statements of an addressee’s desired actions, permissions, speaker’s wishes, suggestions, hortatives, warnings and statements of social rules. Based on the analysis, comparisons are made between the mother’s and father’s speech with regard to the usage of different types of directives, and the dynamics of using directives when the child is growing as well as in situations of communication have been examined.

  19. Kunstinäituselt Jumala ja kanade juurde ning sealt põrgusse / Riin Kübarsepp

    Index Scriptorium Estoniae

    Kübarsepp, Riin, 1978-

    2005-01-01

    Mirja-Mari Smidti ja Allan Tõnissoo näitus "Kunstinäitus" Hobusepea galeriis 31. III-18. IV. Tanel Saare "Gott und Huhn episode IV: seed shower" kuni 23. IV Draakoni galeriis. Kuni 24. IV Tallinna Linnagaleriis Pirjetta Branderi näitus "Põrgu ja teised jutud", millega oli kaasas Mikko Tuhkaneni kunstniku loomingu analüüsi sisaldav kirjutis "A Woman's work is never done"

  20. Ældre patienter bør tilbydes fysisk træning tidligt efter kirurgi

    DEFF Research Database (Denmark)

    Beyer, Nina; Suetta, Charlotte Arneboe

    2013-01-01

    The use of fast-track regimes has led to a marked decline in complication rates post surgery. Nevertheless, older people have an increased risk of loss of muscle mass and strength and disability post surgery compared to younger adults. Consequently, attempts to counteract these problems seem highly...

  1. Euroopa ja Hiina pehme tasakaalustumine Ida-Aasia ning Ameerika Ühendriikide suhtes : arvustus / Jaanika Erne

    Index Scriptorium Estoniae

    Erne, Jaanika 1967-

    2013-01-01

    Arvustus: Nicola Casarini. Remaking Global Order: The Evolution of Europe-China Realtions and its Implications for East Asia and the United States. Oxford: Oxford University Press, 2010. (Oxford Scholarship Online.) 344 pp

  2. Detsibill : Meie aja kangelane Maryn E. Coote ning ajakirjandus. White label : Soda Effect - Uus kraam. Kuula / DJ Pickney Tiger

    Index Scriptorium Estoniae

    DJ Pickney Tiger, pseud., 1970-

    2007-01-01

    Poplauljast Marju Kuudist. Ansambli Soda Effect heliplaadist. Heliplaatidest: Sentenced "Buried Alive", Depeche Mode"Best of. Volume 1", Moby "Go: The Very Best", Bill Frisell, Ron CArter, Paul Motian "Nonesuch", My Chemical Romance "The Black Parade", Arabanda "Shams", Barbariz "Auh", Demogustico "Demogustico", Tutty Moreno ft. Jouce "Magica", Akon "Konvicted", Union Of Knives "Violence and Birdsong", Snoop Dogg "The Blue Carpet Treatment"

  3. Kommunikationsträning för personal kan öka patienters utbyte av vården

    DEFF Research Database (Denmark)

    Ehrstedt, Frida; Ammentorp, Jette; Kofoed, Poul-Erik

    2014-01-01

    This literature review presents results of research on communication skills training (CST) of medical staff and its effect on patients. The 27 studies identified by a search in PubMed and Cochrane databases showed considerable heterogeneity in interventions, methods and study length. Most studies...

  4. Bækkenbundstræning til gravide og barslende kvinder--en gennemgang af et Cochrane-review

    DEFF Research Database (Denmark)

    Brostrøm, Søren; Due, Ulla; Lose, Gunnar

    2010-01-01

    Urinary and anal incontinence are prevalent in pregnant and parturient women. Pelvic floor muscle training is frequently employed for prevention and treatment. A recent Cochrane review is discussed. Fifteen studies with a total of 6,181 women were included. Pregnant women without urinary...... incontinence experienced a reduction of the risk of developing urinary incontinence in later pregnancy or post partum. Peripartum patients with urinary and anal incontinence experienced a reduction of their symptoms following training....

  5. Bækkenbundstræning til gravide og barslende kvinder--en gennemgang af et Cochrane-review

    DEFF Research Database (Denmark)

    Brostrøm, Søren; Due, Ulla; Lose, G.

    2010-01-01

    Urinary and anal incontinence are prevalent in pregnant and parturient women. Pelvic floor muscle training is frequently employed for prevention and treatment. A recent Cochrane review is discussed. Fifteen studies with a total of 6,181 women were included. Pregnant women without urinary...... incontinence experienced a reduction of the risk of developing urinary incontinence in later pregnancy or post partum. Peripartum patients with urinary and anal incontinence experienced a reduction of their symptoms following training...

  6. Ældre patienter bør tilbydes fysisk træning tidligt efter kirurgi

    DEFF Research Database (Denmark)

    Beyer, Nina; Suetta, Charlotte Arneboe

    2013-01-01

    The use of fast-track regimes has led to a marked decline in complication rates post surgery. Nevertheless, older people have an increased risk of loss of muscle mass and strength and disability post surgery compared to younger adults. Consequently, attempts to counteract these problems seem highly...... relevant. The number of studies on the effect of perioperative training is still limited. However, there is increasing evidence that strength training commenced early post surgery is safe and effective in regard to restore muscle function in older patients going through acute or elective surgery....

  7. Visionäärid ning disaini hälli kiigutajad Charles ja Ray Eames / Katrin Kask

    Index Scriptorium Estoniae

    Kask, Katrin

    2007-01-01

    Ameerika disainiklassikute Charles (1907-1978) ja Ray Eamesi (1912-1988) disainitud toolidest. Nende oma majast Californias, mis koosneb tehases valmistatud teras-, vineer- ja klaasdetailidest. Filmidest "Ülevaade Metropolitanist" ja "Powers of Ten"

  8. 18. sajandi teise poole Šoti valgustusliku arhitektuuri ideedest, nende retseptsioonist Vene keisrikojas ning baltisaksa kultuuriruumis / Epi Tohvri

    Index Scriptorium Estoniae

    Tohvri, Epi, 1970-

    2006-01-01

    Arhitektide Robert Adami (1728-1792), Charles Cameroni (1745-1812) ja William Hastie (Vassili Geste 1755-1832) loomingust. Šoti valgustusajastu olulisemad arhitektuuriideed. Robert Adami mõju Eestis mõisaarhitektuuris

  9. Fysisk træning som behandling af nedsat funktionsevne hos svage, hjemmeboende 75+-årige

    DEFF Research Database (Denmark)

    Vad, Esther; Worm, Charlotte; Lauritsen, Jens

    2002-01-01

    The aim of this study was to establish the value of physical training as a treatment of reduced physical ability in frail, elderly patients living at home.......The aim of this study was to establish the value of physical training as a treatment of reduced physical ability in frail, elderly patients living at home....

  10. Videolectures og peer feedback i færdighedestræning på biomekanikstudiet på SDU

    DEFF Research Database (Denmark)

    Lauridsen, Henrik Hein; Nørgaard, Cita

    studerende - hvordan kan vi fremme feedback i vores undervisningsmodeller? oÅbne muligheden for at give både synkron og asynkron Feedback på studerendes træningssituationer i færdighedslaboratoriet. oOptimere muligheden for at studerende kan give peer Feedback på hinandens optagelser vedr. indøvelse af...

  11. S. DR. O. NoREL, /iei Ge&ening NV ...

    African Journals Online (AJOL)

    Test

    maal beskaamd, dikwels opgehef en getroos. Ek wys uit baie bladsye bv. op die ontleding van Jakob se gebed, Gen. 32 :9 vv. soos op bl. 92 vv. gegee, van Jesaja 63:14 — 64:12 op bl. 123 vv.; op die uit nemende verklaring van die Bybelse voorstelling van die ken van God, bl. 176 v.; op die treffende karakterisering van ...

  12. Annemarie Bauer, Katharina Gröning (Hg.: Gerechtigkeit, Geschlecht und demografischer Wandel. Frankfurt am Main: Mabuse-Verlag 2008

    Directory of Open Access Journals (Sweden)

    Margret Karsch

    2009-07-01

    Full Text Available Der Sammelband belegt einmal mehr, dass Fürsorgeleistungen für Kinder und Ältere überwiegend von Frauen übernommen werden. Diese können und wollen die unbezahlte und oft unsichtbare Arbeit aber nicht mehr leisten – auch eine Frage der Gerechtigkeit. Die Autor/-innen plädieren für eine politische Debatte, um diesen Missstand aufzuheben. Wie wollen wir im Alter leben, was sind uns Unterstützung und Pflege wert? Die Fragen gehen uns alle an und verlangen eine gesamtgesellschaftliche Lösung. Da in Zukunft mehr alte Menschen auf Unterstützung angewiesen sein werden, muss die Fürsorge dringend neu organisiert werden.The collected volume proves once more that it is primarily women who care for children and the elderly. These women no longer can nor want to do the unpaid and often invisible work. This is also a question of equality. The authors plead for political debate that would correct these grievances. How do we want to live as we grow older, what is support and care worth to us? The questions apply to us all and require a cross-societal solution. Because in the future more elderly people will be dependant on support, care has desperately to be reorganized.

  13. Alexander Theodor von Middendorffi tegevus Liivimaa põllumajanduse edendajana ning tema seosed eesti rahvusliku liikumisega / Erki Tammiksaar

    Index Scriptorium Estoniae

    Tammiksaar, Erki, 1969-

    2006-01-01

    Middendorffi tegevusest Peterburis Peterburi Vabamajanduse Seltsi presidendina ja II ülevenemaalise põllumajandusnäituse organiseerijana. Middendorffi agraarpoliitilistest veendumustest, tegevusest Liivimaa Üldkasulikus ja ja Ökonoomilises Sotsieteedis, Middendorffi osast Aleksandrikooli probleemi segapuntras. Kuukirjast Eesti Põllomees ja Middendorffi suhetest J. V. Jannseniga

  14. Kaks kanget: Forgotten Sunrise ning Tharaphitha enne ja nüüd / Anders Melts, Ants Lill ; intervjueerinud Mart Kalvet

    Index Scriptorium Estoniae

    Melts, Anders

    2009-01-01

    Küsimustele vastavad dark-elektro-bändi Forgotten Sunrise laulja Anders Melts ja pagan-metal-bändi Tharaphita laulja-kitarrist Ants Lill. Ansamblitest ja nende esimestest heliplaatidest, mis üllitati hiljuti uuesti plaadifirma Nailboard Records poolt: Tharaphita albumi "Raev" digipack-CD, millele on lisatud 1996. aastal ilmunud neljalooline demosalvestis "Kui varjud põlevad" ja Forgotten Sunrise demo "Behind The Abysmal Sky" (1993) ja minialbumi "Forever Sleeping Greystones" (1994) lood

  15. 76 FR 40772 - Additional Designation of Entities Pursuant to Executive Order 13382

    Science.gov (United States)

    2011-07-11

    ... designees is as follows: Entities: 1. IRAN AIR (a.k.a. AIRLINE OF THE ISLAMIC REPUBLIC OF IRAN (HOMA); a.k.a. HAVAPEYMA MELI IRAN HOMA; a.k.a. HOMA; a.k.a. IRAN AIR CARGO; a.k.a. IRAN AIR P J S C; a.k.a. IRANAIR; a.k.a. IRANAIR CARGO; a.k.a. NATIONAL IRANIAN AIRLINES (HOMA); f.k.a. SHERKAT SAHAMI AAM HAVOPAYMAIE JOMHOURI...

  16. 76 FR 20450 - Designation of Nine Individuals Pursuant to Executive Order 13566

    Science.gov (United States)

    2011-04-12

    ..., Safia); DOB 1952; POB Al Bayda, Libya (individual) [LIBYA2] 4. GADDAFI, Hannibal (a.k.a. AL-GADDAFI, Hannibal; a.k.a. AL-QADHAFI, Hannibal; a.k.a. ELKADDAFI, Hannibal; a.k.a. EL-QADDAFI, Hannibal; a.k.a. GADDAFI, Hannibal Muammar; a.k.a. GHADAFFI, Hannibal; a.k.a. GHATHAFI, Hannibal; a.k.a. QADDAFI, Hannibal...

  17. 76 FR 34805 - Designation of Three Entities and One Individual Pursuant to Executive Order 13553

    Science.gov (United States)

    2011-06-14

    ... OF THE GUARDIANS OF THE ISLAMIC REVOLUTION; a.k.a. THE IRANIAN REVOLUTIONARY GUARDS), Tehran, Iran... (individual) [IRAN-HR] Entities ISLAMIC REVOLUTIONARY GUARD CORPS (a.k.a. AGIR; a.k.a. IRANIAN REVOLUTIONARY GUARD CORPS; a.k.a. IRG; a.k.a. IRGC; a.k.a. ISLAMIC REVOLUTIONARY CORPS; a.k.a. PASDARAN; a.k.a...

  18. 76 FR 25783 - Identification of Thirty Entities as Governemnt of Libya Entities Pursuant to Executive Order 13566

    Science.gov (United States)

    2011-05-05

    ... SOCIAL DEVELOPMENT FUND COMPANY (a.k.a. ECONOMIC SOCIAL AND DEVELOPMENT FUND; a.k.a. SOCIAL AND ECONOMIC...://www.lap.ly [LIBYA2] 7. LIBYAN AFRICAN INVESTMENT COMPANY (a.k.a. LAAICO; a.k.a. LAICO; a.k.a. LIBYAN ARAB AFRICAN INVESTMENT COMPANY; a.k.a. THE LAICO GROUP), Janzoor (neighborhood), Tripoli, Libya; P.O...

  19. 76 FR 54468 - Petra Pet, Inc. (a/k/a Petrapport) v. Panda Logistics Limited; Panda Logistics Co., Ltd. (f/k/a...

    Science.gov (United States)

    2011-09-01

    ... Logistics Limited; Panda Logistics Co., Ltd. (f/k/a panda Int'l Transportation Co., Ltd.); and RDM Solutions... ``Complainant,'' against Respondents Panda Logistics Limited, Panda Logistics Co., Ltd. (f/k/a Panda Int'l... alleges that Respondents Panda Logistics Limited and Panda Logistics Co., Ltd., are each a non-vessel...

  20. Hypermobile Ehlers-Danlos syndrome (a.k.a. Ehlers-Danlos syndrome Type III and Ehlers-Danlos syndrome hypermobility type): Clinical description and natural history.

    Science.gov (United States)

    Tinkle, Brad; Castori, Marco; Berglund, Britta; Cohen, Helen; Grahame, Rodney; Kazkaz, Hanadi; Levy, Howard

    2017-03-01

    The hypermobile type of Ehlers-Danlos syndrome (hEDS) is likely the most common hereditary disorder of connective tissue. It has been described largely in those with musculoskeletal complaints including joint hypermobility, joint subluxations/dislocations, as well as skin and soft tissue manifestations. Many patients report activity-related pain and some go on to have daily pain. Two undifferentiated syndromes have been used to describe these manifestations-joint hypermobility syndrome and hEDS. Both are clinical diagnoses in the absence of other causation. Current medical literature further complicates differentiation and describes multiple associated symptoms and disorders. The current EDS nosology combines these two entities into the hypermobile type of EDS. Herein, we review and summarize the literature as a better clinical description of this type of connective tissue disorder. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  1. TREN DAN DISPARITAS ANGKA KEMATIAN BAYI (AKB, ANGKA KEMATIAN ANAK BALITA (AKA, ANGKA KEMATIAN BALITA (AKBA MENURUT SOSIAL EKONOMI DI INDONESIA, SUSENAS 1998, 2001 dan 2003

    Directory of Open Access Journals (Sweden)

    Tin Afifah

    2012-11-01

    Full Text Available Trend and Disparity of Infant Mortality Rate (IMR, Child Mortality Rate (CMR and Under Five Mortality Rate (USMR and Social Economic Statusin Indonesia in 1998, 2001 and 2003.Infant Mortality Rate (IMR, Child Mortality Rate (CMR and Under Five Mortality rate(U5MR, especially IMR, are important as welfare indicators. IMR and U5MR are The Healthy Indonesia 2010 Indicators (IS 2010. The IMR and CMR are the MDG indicators. Due to inadequate registration system in Indonesia, estimation of various parameters of population, still rely upon survey data. Frequently,IMR and U5MR are estimated indirectly from population Census (SP, the Intercensal Population Survey (Supas, The National Socio-Economic Survey (Susenas, and the Indonesia Demographic and Health Survey (SDKI. The analysis objectives are to find the trend of IMR. CMR and U5MR, and its pattern by the social economic background and as well as the disparities. The Source data are the 1998, 2001 and2003 Susenas. The data cover all provinces except Nanggroe Aceh Darussalam, Maluku and Papua. The variables are children survival (mean of children ever born and mean of children survival, urban rural, regional, education background and quintile of strata economics. Analyses were done with indirect technique analysis with Brass-Trussel Method West Model. The analysis shows that trends of all indicators are fluctuative. The estimates of IMR and U5MR for the five-year period prior to the survey indicated aslightly increase from the I998 Susenas (49 and 65 to the 2001 Susenas (51 and 65, then decreased in the 2003 Susenas (42 and 52. All indicators show that the mortality by social economics background are highest in the poorest family, less educated mothers, live in the rural area and in the East of Indonesia Region. The results also show that the 2003 Susenas U5MR is exceeding the IS 2010 target (58/1000 and almost reach the IMR IS 2010 target (40/1000.Keywords: trend, disparity, infant mortality rate, child mortality rate, under five mortality rate

  2. Assessing mobile food vendors (a.k.a. street food vendors)--methods, challenges, and lessons learned for future food-environment research.

    Science.gov (United States)

    Lucan, S C; Varona, M; Maroko, A R; Bumol, J; Torrens, L; Wylie-Rosett, J

    2013-08-01

    Mobile food vendors (also known as street food vendors) may be important sources of food, particularly in minority and low-income communities. Unfortunately, there are no good data sources on where, when, or what vendors sell. The lack of a published assessment method may contribute to the relative exclusion of mobile food vendors from existing food-environment research. A goal of this study was to develop, pilot, and refine a method to assess mobile food vendors. Cross-sectional assessment of mobile food vendors through direct observations and brief interviews. Using printed maps, investigators canvassed all streets in Bronx County, NY (excluding highways but including entrance and exit ramps) in 2010, looking for mobile food vendors. For each vendor identified, researchers recorded a unique identifier, the vendor's location, and direct observations. Investigators also recorded vendors answers to where, when, and what they sold. Of 372 identified vendors, 38% did not answer brief-interview questions (19% were 'in transit', 15% refused; others were absent from their carts/trucks/stands or with customers). About 7% of vendors who ultimately answered questions were reluctant to engage with researchers. Some vendors expressed concerns about regulatory authority; only 34% of vendors had visible permits or licenses and many vendors had improvised illegitimate-appearing set-ups. The majority of vendors (75% of those responding) felt most comfortable speaking Spanish; 5% preferred other non-English languages. Nearly a third of vendors changed selling locations (streets, neighbourhoods, boroughs) day-to-day or even within a given day. There was considerable variability in times (hours, days, months) in which vendors reported doing business; for 86% of vendors, weather was a deciding factor. Mobile food vendors have a variable and fluid presence in an urban environment. Variability in hours and locations, having most comfort with languages other than English, and reluctance to interact with individuals gathering data are principal challenges to assessment. Strategies to address assessment challenges that emerged form this project may help make mobile-vendor assessments more routine in food-environment research. Copyright © 2013 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  3. Otantik Bir Vehbi-İbâzî Akaîd Metni: Akidetü't-Tevhid Li-Amr İbn Cümey

    OpenAIRE

    DÜNDAR, M. Mücahid

    2013-01-01

     Ib?diyya is the only branch of Kh?rijiyya which rejects “isti?r?d” and have a more moderate disposition by not qualifying their opponents as disbelievers (mushrik). As one of the most ancient creed text that had been originally authored in Tamazight, ?Aq?da al-Tawh?d, is a work that shows us the fundamental beliefs of Maghreb Ib?d?s and their distinctive features in concise style. The text that its Tamazight origin could be dated back to third century of hijra wa...

  4. Assessing mobile food vendors (a.k.a. street food vendors)—methods, challenges, and lessons learned for future food-environment research

    Science.gov (United States)

    Lucan, Sean C.; Varona, Monica; Maroko, Andrew R.; Bumol, Joel; Torrens, Luis; Wylie-Rosett, Judith

    2013-01-01

    OBJECTIVES Mobile food vendors (also known as street food vendors) may be important sources of food, particularly in minority and low-income communities. Unfortunately, there are no good data sources on where, when, or what vendors sell. The lack of a published assessment method may contribute to the relative exclusion of mobile food vendors from existing food-environment research. A goal of this study was to develop, pilot, and troubleshoot a method to assess mobile food vendors. STUDY DESIGN Cross-sectional assessment of mobile food vendors through direct observations and brief interviews. METHODS Using printed maps, investigators canvassed all streets in Bronx County, NY (excluding highways but including entrance and exit ramps) in 2010, looking for mobile food vendors. For each vendor identified, researchers recorded a unique identifier, the vendor’s location, and direct observations. Investigators also recorded vendors answers to where, when, and what they sold. RESULTS Of 372 identified vendors, 38% did not answer brief-interview questions (19% were “in transit”, 15% refused; others were absent from their carts/trucks/stands or with customers). About 7% of vendors who ultimately answered questions were reluctant to engage with researchers. Some vendors expressed concerns about regulatory authority; only 34% of vendors had visible permits or licenses and many vendors had improvised illegitimate-appearing set-ups. The majority of vendors (75% of those responding) felt most comfortable speaking Spanish; 5% preferred other non-English languages. Nearly a third of vendors changed selling locations (streets, neighborhoods, boroughs) day-to-day or even within a given day. There was considerable variability in times (hours, days, months) in which vendors reported doing business; for 86% of vendors, weather was a deciding factor. CONCLUSIONS Mobile food vendors have a variable and fluid presence in an urban environment. Variability in hours and locations, having most comfort with languages other than English, and reluctance to interact with individuals gathering data are principal challenges to assessment. Strategies to address assessment challenges that emerged form this project may help make mobile-vendor assessments more routine in food-environment research. PMID:23891280

  5. Superposition model analysis of nickel(II) ions in trigonal bipyramidal complexes exhibiting huge zero field splitting (aka ‘giant magnetic anisotropy’)

    Energy Technology Data Exchange (ETDEWEB)

    Rudowicz, Czesław, E-mail: crudowicz@zut.edu.pl [Faculty of Chemistry, A. Mickiewicz University, 61-614 Poznań (Poland); Institute of Physics, West Pomeranian University of Technology, Szczecin (Poland); Açıkgöz, Muhammed [Department of Chemistry, Rutgers University, Newark, New Jersey 07102 (United States); Gnutek, Paweł [Institute of Physics, West Pomeranian University of Technology, Szczecin (Poland)

    2017-07-15

    Graphical abstract: Using crystal structure data for [Ni(Me{sub 6}tren)Cl](ClO{sub 4}) and [Ni(Me{sub 6}tren)Br](Br) as well as taking into account the Jahn-Teller distortions of five-fold coordinated Ni-complexes revealed by DFT geometry optimization, the ZFSPs are predicted for several structural models and wide ranges of model parameters. - Highlights: • Semiempirical study of potential SMM [Ni(Me{sub 6}tren)Cl](ClO{sub 4}) and [Ni(Me{sub 6}tren)Br](Br). • Superposition model analysis of zero field splitting (ZFS) parameters carried out. • Jahn-Teller distortions revealed by DFT geometry optimization considered. • SPM predicts D(ZFS) of observed magnitudes with positive or negative signs. • Results corroborate giant ZFS, which shall not be equated with magnetic anisotropy. - Abstract: Potential single-ion magnet Ni{sup 2+} systems: [Ni(Me{sub 6}tren)Cl](ClO{sub 4}) and [Ni(Me{sub 6}tren)Br](Br) reveal unusually high zero field splitting (ZFS). The ZFS parameter (ZFSP) D{sub expt} = −120 to −180 cm{sup −1} was determined indirectly by high-magnetic field, high-frequency electron magnetic resonance (HMF-EMR). Modeling ZFSPs using the density functional theory (DFT) codes predicts D values: −100 to −200 cm{sup −1}. Such ZFSP values may seem controversial in view of the D values usually not exceeding several tens of cm{sup −1} for Ni{sup 2+} ions. To corroborate or otherwise these results and elucidate the origin of the huge ZFS (named inappropriately as ‘giant uniaxial magnetic anisotropy’) and respective wavefunctions, we have undertaken semiempirical modeling based on the crystal field (CF) and spin Hamiltonians (SH) theory. In this paper, a feasibility study is carried out to ascertain if superposition model (SPM) calculations may yield such huge D values for these Ni{sup 2+} systems. Using crystal structure data for [Ni(Me{sub 6}tren)Cl](ClO{sub 4}) and [Ni(Me{sub 6}tren)Br](Br) as well as taking into account the Jahn-Teller distortions of five-fold coordinated Ni-complexes revealed by DFT geometry optimization, the ZFSPs are predicted for several structural models and wide ranges of model parameters. The results indicate that in the presence of the Jahn-Teller distortions, the SPM-predicted ZFSP D may achieve the observed magnitudes, whereas the positive as well as negative D-signs are obtainable. Further studies based on SPM calculations of CF parameters and diagonalization of the Hamiltonian (H{sub free} {sub ion} + H{sub CF}) will allow considering the wavefunctions compositions and thus actual origin of the splitting between the ground and first excited state.

  6. Transport Studies Enabling Efficiency Optimization of Cost-Competitive Fuel Cell Stacks (aka AURORA: Areal Use and Reactant Optimization at Rated Amperage)

    Energy Technology Data Exchange (ETDEWEB)

    Conti, Amedeo [Nuvera Fuel Cells, Inc., Billerica, MA (United States); Dross, Robert [Nuvera Fuel Cells, Inc., Billerica, MA (United States)

    2013-12-06

    Hydrogen fuel cells are recognized as one of the most viable solutions for mobility in the 21st century; however, there are technical challenges that must be addressed before the technology can become available for mass production. One of the most demanding aspects is the costs of present-day fuel cells which are prohibitively high for the majority of envisioned markets. The fuel cell community recognizes two major drivers to an effective cost reduction: (1) decreasing the noble metals content, and (2) increasing the power density in order to reduce the number of cells needed to achieve a specified power level. To date, the majority of development work aimed at increasing the value metric (i.e. W/mg-Pt) has focused on the reduction of precious metal loadings, and this important work continues. Efforts to increase power density have been limited by two main factors: (1) performance limitations associated with mass transport barriers, and (2) the historical prioritization of efficiency over cost. This program is driven by commercialization imperatives, and challenges both of these factors. The premise of this Program, supported by proprietary cost modeling by Nuvera, is that DOE 2015 cost targets can be met by simultaneously exceeding DOE 2015 targets for Platinum loadings (using materials with less than 0.2 mg-Pt/cm2) and MEA power density (operating at higher than 1.0 Watt/cm2). The approach of this program is to combine Nuvera’s stack technology, which has demonstrated the ability to operate stably at high current densities (> 1.5 A/cm2), with low Platinum loading MEAs developed by Johnson Matthey in order to maximize Pt specific power density and reduce stack cost. A predictive performance model developed by PSU/UTK is central to the program allowing the team to study the physics and optimize materials/conditions specific to low Pt loading electrodes and ultra-high current density and operation.

  7. 77 FR 34339 - Yufeng Wei, a/k/a Annie Wei, 165 Beech Street, Belmont, MA 02378; Order Denying Export Privileges

    Science.gov (United States)

    2012-06-11

    ... Street, Belmont, MA 02378; Order Denying Export Privileges On January 28, 2011, in the U.S. District... of the Arms Export Control Act (22 U.S.C. 2778 (2000)) (``AECA''). Specifically, Wei was convicted of... electronic components designated on the U.S. Munitions List to China through Hong Kong between 2004 and 2007...

  8. Georgia uued sõbrad vs. Georgia (vanad) sõbrad ehk väikeriikide söakas vastandumine suurriikidele / Toomas Alatalu

    Index Scriptorium Estoniae

    Alatalu, Toomas, 1942-

    2012-01-01

    Gruusia Sõprade (FOG) - Prantsusmaa, Saksamaa, Ühendkuningriigi, Venemaa ja USA diplomaatilisest foorumist. Selle alternatiivne grupp e. nn. Uued Sõbrad (NFOG): Eesti, Läti, Poola, Rumeenia, Bulgaaria

  9. Tactical Considerations for Army Aviation In Interventionary Operations, a.k.a - LIC, MOOTW, OOTW, and SASO: Are We Ready Yet?

    National Research Council Canada - National Science Library

    Bird, Craig

    1997-01-01

    .... Army brigade is likely to occur by 2005. It describes the nature of the military organization necessary to succeed in lesser regional conflict by introducing a realistic, hypothetical scenario...

  10. Women, worms and work: Implications of conservation management and declining biodiversity on subsistence practices and health of Aka populations in the Congo Basin

    Czech Academy of Sciences Publication Activity Database

    Robinson, C. A. J.; Remis, M. J.; Petrželková, Klára Judita; Hůzová, Z.

    2014-01-01

    Roč. 153, S58 (2014), s. 154 ISSN 0002-9483. [Annual Meeting of the American Association of Physical Anthropologists /83./. 08.04.2014-12.04.2014, Calgary] Institutional support: RVO:68081766 Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology

  11. Results of the independent verification of radiological remedial action at 600 South Clayhill Drive (AKA 600 South Cemetery Road), Monticello, Utah (MS00145)

    International Nuclear Information System (INIS)

    Wilson, M.J.; Crutcher, J.W.

    1991-07-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1986 and 1987, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 600 South Cemetery Road (updated by San Juan County and the state of Utah to 600 South Clayhill Drive), Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  12. 78 FR 76814 - In the Matter of: Mohammed Soroush Mahalaty, a/k/a Mohammad Soroush,a/k/a Mike Soroush, 18...

    Science.gov (United States)

    2013-12-19

    ... specifically using the hawala system to transfer money into Iran which money Mahalaty believed was intended for... assessment, $5,000 fine and restitution of $739,377.31. Section 766.25 of the Export Administration... the export privileges of any person who has been convicted of a violation of the Export Administration...

  13. MRP, Generalplan Ost ning baltisakslaste Eestist ja Lätist väljarändamine (Poola arhiivide valguses) / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2009-01-01

    Üürnike Liit korraldas 22. sept. 2009 Rahvusraamatukogus omandireformialase konverentsi. Õigusajaloolase ettekanne varade tagastamisest, kahjude kompenseerimisest, baltisakslaste väljarändamisest, II maailmasõjast

  14. Eesti luule ja poeetika tagasivaates : vestlus Vincent B. Leitchiga / Vincent B Leitch ; küsitles [ja tõlkis ning eessõna:] Anne Lange

    Index Scriptorium Estoniae

    Leitch, Vincent B

    2002-01-01

    V. B. Leitch oli ilmumata jäänud koguteose "The poetry of Estonia: essays in comparative analysis" toimetaja. Kogumikus oleks ilmunud Yale'i ülikoolis peamiselt 1960. a-tel peetud ettekanded eesti luulest. Loengud korraldas Aleksis Rannit. V. B. Leitch meenutab ka Ants Orast, kes oli tema doktoritöö juhendaja Florida ülikoolis

  15. Partiklid jah, jaa ning jajaa naaberpaari järelliikmena müügiläbirääkimistes / Riina Kasterpalu

    Index Scriptorium Estoniae

    Kasterpalu, Riina

    2005-01-01

    Vastavate partiklite funktsionaalsetest ülesannetest, kasutamisest ja tähendustest müügivestlustes telefoni teel peetud müügiläbirääkimisi analüüsides. Järgneb: Keel ja Kirjandus, 2005, nr. 12

  16. Aktiivse eutanaasia moraalsusest ning legaliseerimise võimalikkusest : [bakalaureusetöö] / Andres Simson ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Sootak

    Index Scriptorium Estoniae

    Simson, Andres

    1999-01-01

    Ajalooline ülevaade, aktiivse eutanaasia mõiste, liigid, erinevate koolkondade suhtumine, moraalsuse poolt- ja vastuargumendid, Austraalia eutanaasiaseadused, USA seadusandlus.Vt. ka: Juridica (1999) nr. 7, lk. 342-347

  17. Süvendatud majandus- ja rahandusliidu rajamine: mõju põhiõiguste kaitsele ning põhiseaduse aluspõhimõtetele / Alexander Lott

    Index Scriptorium Estoniae

    Lott, Alexander, 1987-

    2013-01-01

    Euroopa Parlamendi ja nõukogu määruse ettepanekust ühtse solveerimismehhanismi ja pankade ühtse solveerimisfondi loomiseks. Kriisilahendusmehhanismi loomise ettepanekust süvendatud majandus- ja rahaliidu rajamise kontekstis, mõjust omandipõhiõiguse kaitsele ja määruse kooskõlast põhiseaduse aluspõhimõtetega

  18. The Optical Resolution of Chiral Tetrahedrone-type Clusters Contai- ning SCoFeM (M=Mo or W) Using High Performance Liquid Chromatography Chiral Stationary Phase

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Amylose tris (phenylcarbamate) chiral stationary phase (ATPC-CSP) was prepared and used for optical resolution of clusters 1 and 2. n-Hexane/2-propanol ( 99/1; v/v) were found to be the most suitable mobile phase on ATPC-CSP.

  19. Tööotsija töötuks tunnistamise ning töötu abiraha määramise ja maksmise ajutise juhendi kinnitamise kohta

    Index Scriptorium Estoniae

    1991-01-01

    Kehtib 1. aprillist 1991. Lisatud ajutine juhend: töö vahendamine tööotsijale, töötule, töötu abiraha määramine ja maksmine Lisatud: töötu abiraha arvutamine. Muudatus: RT I 1992 nr. 27 art. 362

  20. Dareios I kuninglikust titulatuurist Behistuni raidkirja näitel ning võimalikud Mesopotaamia mõjutused selles / Andreas Johandi, Vladimir Sazonov

    Index Scriptorium Estoniae

    Johandi, Andreas, 1983-

    2016-01-01

    Dareios I tiitlitest "kuningas", "suurkuningas", "Pärsia kuningas", "kuningate kuningas", "Babüloni kuningas", "kõikide maade kuningas". Dareios I tiitlid erinesid Kyros II ja Kambyses II tiitlitest, samas pärines nende kõigi ametlik titulatuur enamasti Mesopotaamiast

  1. Ralf Köning, el comic queer y otros ejemplos: de la identidad gay en la cultura de la diversidad sexual

    OpenAIRE

    Saxe, Facundo Nazareno

    2009-01-01

    A partir de los años ochenta se produce en las narrativas alemanas y españolas una tematización creciente de la identidad gay surgida durante los años setenta, en lo que se denomina el período post-Stonewall. Esta tematización confronta y, al mismo tiempo, explora las raíces de los grandes escritores homoeróticos de la primera mitad del siglo XX. A su vez, este tema gay que se consolida durante los ochenta y noventa, paulatinamente, se va proyectando a otros géneros diferentes ...

  2. Styrket færdighedstræning eller afsporende forstyrrelse? Digitalisering af undervisning i øvelseslaboratorier på professionsuddannelserne

    DEFF Research Database (Denmark)

    Eriksen, Kathrine; Nielsen, Marianne

    2014-01-01

    I arbejdet med tilegnelse af praktiske færdigheder i professionsuddannelser, er værdien af digitalisering omdiskuteret. Der hersker således uenighed om digitalisering blot medfører passiv iagttagelse af udførelsen af færdigheder, eller om digitalisering kan medvirke til at styrke de studerendes...

  3. Keiserlikud portreegaleriid : kujunemislugu ning osa poliitilises ja kunstielus = Russian Imperial Portrait Galleries - Their History and Role in Art and Politics / Jelizaveta Renne

    Index Scriptorium Estoniae

    Renne, Jelizaveta, 1951-

    2008-01-01

    Portreemaalide kollektsioneerimisest Venemaal 18. sajandil - era- ja keiserlike portreegaleriide loomisest, kogude komplekteerimisest, ajaloolisest tähtsusest ja saatusest. Çeşme paleest ja kogust, Marmorpalee pildigaleriist, Romanovite portreegaleriist

  4. Keisrikultus Rooma riigis Juliuste-Claudiuste ja 1. Flaviuste dünastia valitsusajal ning selle võimalikud kajastused algkristlikus kirjanduses / Jaan Lahe, Ergo Naab

    Index Scriptorium Estoniae

    Lahe, Jaan, 1971-

    2014-01-01

    Keisrikultuse tekkimisest. Keisrikultusest üksikute keisrite valitsusajal. Keisrikultuse pühadest, templitest, ohvritest ja preestritest. Keisrikultusest kui religioossest ja sotsiaalsest fenomenist. Keisrikultuse võimalikest kajastustest algkristlikus kirjanduses. Jeesuse ülendamismotiivist Pauluse autentsetes kirjades. Jeesuse ülendamisest ja viimsest vaenlasest. Jeesuse ülendamismotiivist Pauluse koolkonna kirjutistes. Ülendamismotiivist kirjas koloslastele. Jeesusele omistatud Kyrios-tiitli arengujoontest ja võimalikest kontrastidest keisrikultusega

  5. Euroopa Sotsiaalfondi vahendid Eesti noortekeskustes - kasutus, tulemused ja mõju noortekeskustele ning ühiskonnale / Heidi Paabort ; kommenteerinud Kerli Kõiv, Tiina Sinijärv, Aire Pruus

    Index Scriptorium Estoniae

    Paabort, Heidi

    2013-01-01

    ESFi programmide tulemusel toimunud muutusi noorsootöös kommenteerivad Rõuge vallavalitsuse noorsootöö spetsialist Kerli Kõiv, Keila ANK ja Keila Noortekeskuse juhataja Tiina Sinijärv ja Nursi noorsootöös osaleja Aire Pruus

  6. Väike- ja keskettevõtete osakaalust majanduses ning ettevõtluspoliitika rollist ettevõtlusalase aktiivsuse toetamisel / Juhan Teder

    Index Scriptorium Estoniae

    Teder, Juhan, 1960-

    2004-01-01

    Ettevõtete struktuurist suurusgrupiti eri riikides; teguritest, mis nimetatud struktuuri mõjutavad; riikliku ettevõtluspoliitika rollist; soovitusi ettevõtlusalase aktiivsuse stimuleerimiseks. Tabelid

  7. Privaatsuse kaitse tagamine Eestis, Euroopa Liidus ning Ameerika Ühendriikides : [bakalaureusetöö] / Bert Blös ; Akadeemia Nord, õigusteaduskond ; juhendaja: Mailis Rand

    Index Scriptorium Estoniae

    Blös, Bert

    2002-01-01

    Privaatsuse kaitse avalikus sektoris, põhiseaduslikud alused, põhiõigused ja -vabadused, seadusandlus, riigiasutuste andmekogude regulatsioon Eestis, privaatsuse kaitse erasektoris, EL andmekaitse direktiiv, privaatsuse kaitse, probleemistik andmete edastamisel teistesse riikidesse

  8. Lotte ning ta sõbrad ja sugulased ehk Kas vägivallatus võib olla põnev / Leelo Tungal

    Index Scriptorium Estoniae

    Tungal, Leelo, 1947-

    2001-01-01

    Joonisfilmid "Lotte" ja "Lotte reis lõunamaale" : stsenaristid Andrus Kivirähk, Janno Põldma, Heiki Ernits : kunstnik Heiki Ernits : lavastajad Leo Lätti, Ebe Tramberg : helilooja Olav Ehala : Eesti Joonisfilm 2000. Lisa : S. Teinemaa koostatud J. Põldma ja H. Ernitsa filmograafia

  9. Teadus- ja arendustegevus ning kaalutlusõiguse roll selle rahastamisel : [teadusmagistritöö] / Sille Uusna ; Tartu Ülikool, õigusteaduskond ; juhendaja: Raul Narits

    Index Scriptorium Estoniae

    Uusna, Sille

    2007-01-01

    Teadus- ja arendustegevuse olemusest, teaduskorraldus objektiivse õiguse reguleerimise objektina, teaduspoliitika kujundamise meetoditest, haldusorgani kaalutlusõigus teaduskorralduses, teadus- ja arendustegevuse finantseerimine, kaalutlusõiguse osakaal teaduse finantseerimismeetmetes

  10. Eesti Panga staatus ning selle muutumine seoses euro kasutuselevõtuga : [bakalaureusetöö] / Ursula Laido ; Tartu Ülikooli Õigusinstituut ; juhendaja: Madis Kallion

    Index Scriptorium Estoniae

    Laido, Ursula

    2005-01-01

    Eesti Panga ajalugu, õiguslik staatus, juhtimine, ülesanded, pädevus, Euroopa Liit kui Euroopa Majandus- ja Rahaliit, keskpankade süsteem, euro, eurole üleminek ja sellest tulenevad muudatused Eesti Panga jaoks

  11. Lapsendamise sotsiaalsed ning psühholoogilised aspektid Eesti ja Soome võrdluses : [magistritöö] / Kalmer Puusepp ; Tartu Ülikool, õigusteaduskond ; juhendaja: Silvia Kaugia

    Index Scriptorium Estoniae

    Puusepp, Kalmer, 1972-

    2013-01-01

    Lapsendamise mõiste ajaloolisest arengust Eesti ja Soome õiguskorras, abikaasade õiguslikust regulatsioonist lapsendamisel Eestis ja Soomes, lapsendamise peamistest sotsiaalsetest aspektidest Eestis ja Soomes, lapsendamise psühholoogilistest aspektidest, Tartu Maavalitsuse ja Helsingi linna sotsiaal - ja tervise ameti arvamustested

  12. Bu-Shen-Ning-Xin Decoction ameliorated the osteoporotic phenotype of ovariectomized mice without affecting the serum estrogen concentration or uterus

    OpenAIRE

    Wang, Ling; Qiu,Xue-Min; Gui,Yu-Yan; Xu,Yingping; Gober,Hans-Jürgen; Li,Da-Jin

    2015-01-01

    Ling Wang,1,2,* Xue-Min Qiu,1,2,* Yu-Yan Gui,1,2 Ying-Ping Xu,1,2 Hans-Jürgen Gober,3 Da-Jin Li1 1Laboratory for Reproductive Immunology, Hospital and Institute of Obstetrics and Gynecology, IBS, Fudan University Shanghai Medical College, 2Shanghai Key Laboratory of Female Reproductive Endocrine Related Diseases, Shanghai, People’s Republic of China; 3Department of Pharmacy, Wagner Jauregg Hospital and Children’s Hospital, Linz, Austria *These authors contribute...

  13. Rezension zu: Hildegard Maria Nickel, Andreas Heilmann, Hasko Hüning, Max Lill: Geschlechterpolitik in Krisenzeiten. Eine Fallstudie im Bankensektor. Berlin: edition sigma 2015.

    Directory of Open Access Journals (Sweden)

    Annett Schulze

    2015-12-01

    Full Text Available Am Beispiel der LandesBank Berlin zeigen die Autor/-innen konkrete Auswirkungen der Bankenkrise auf in Unternehmen agierende betriebliche Akteur/-innen. Inwiefern diese eigene Handlungsspielräume entwickeln (können und welche Kontinuitäten betriebliche Vergeschlechtlichungsprozesse aufweisen, belegt die Studie eindrücklich. Der mit dem Wandel von Erwerbsarbeit verknüpfte Eigensinn zeigt sich in den Vorstellungen von Zuständigkeiten der weiblichen Angestellten und in den veränderten Antworten auf Work-Life-Balance-Fragen ─ bei jungen männlichen Angestellten und bei älteren Führungskräften, die jungen Vätern einen Mentalitätswandel unterstellen. So könnten sich neue Kollektivierungen jenseits von Geschlecht bilden, insofern an geteilte Interessen in Krisensituationen angeknüpft werden würde.

  14. Træning har positiv effekt på helbredsrelateret livskvalitet hos kræftpatienter i behandling--en gennemgang af et Cochranereview

    DEFF Research Database (Denmark)

    Lønkvist, Camilla Kjær; Højman, Pernille; Gehl, Julie

    2013-01-01

    Cancer and treatment of cancer affects the health-related quality of life (HRQoL) in patients. A recent Cochrane review concludes that exercise may have positive effects on HRQoL and several other domains. Other reviews have shown that physical activity may protect against development of cancer...

  15. Kinnipeetud välismaa laevade ja laevaperede viivitamatu vabastamine - rannikuriigi kohustus ning lipuriigi võimalus diplomaatilise kaitse osutamiseks / Heiki Lindpere

    Index Scriptorium Estoniae

    Lindpere, Heiki, 1949-

    2007-01-01

    Ülevaade Ühinenud Rahvaste Organisatsiooni (ÜRO) 1982. aasta mereõiguse konventsioonis olevast reederite ja meremeeste huvide kaitseks kokkulepitud iseseisvast menetlusest Rahvusvahelises Mereõiguse Kohtus ja mujal

  16. [Valitsusliidus olevad Reformierakond ning Isamaa ja Res Publica Liit on kavandatava koolireformi suhtes eri meelt] / Mailis Reps, Tiiu Kuurme, Karin Kütt

    Index Scriptorium Estoniae

    Reps, Mailis, 1975-

    2010-01-01

    Reformierakonna ettepaneku kohta jätta omavalitsustele õiguse otsustada, kas gümnaasium ja põhikool lahutatakse või jätkatakse ühendkooliga avaldavad arvamust riigikogu liige Mailis Reps, Tallinna Ülikooli dotsent Tiiu Kuurme ja Rannu keskkooli direktor Karin Kütt

  17. Tahtluse vormid ning nende eristamine teoorias ja praktikas : [bakalaureusetöö] / Mattias Jõgi ; Tartu Ülikool, õigusteaduskond ; juhendaja: Anneli Soo

    Index Scriptorium Estoniae

    Jõgi, Mattias

    2010-01-01

    Tahtlusest Ameerika Ühendriikides ja mandri-Euroopas, tahtluse vormidest Eestis 1935. a. kriminaalseadustiku ja 1961. a. kriminaalkoodeksi järgi, tahtluse vormide eristamisest ja esinemisest kehtivas karistusseadustikus, kelmusest ja selle erikoosseisudest, kohtuotsustes tahtluse vormide eristamisest

  18. Athena konverentsi- ja kultuurikeskuse ning restorani Volga sisekujundus (Athena kinohoone renoveerimine). Tartu. Küütri 1 / Aivar Roosaar, Ferdi Sannamees, Peet Aren

    Index Scriptorium Estoniae

    Roosaar, Aivar

    2008-01-01

    I-III korruse, vahekorruse ja pööningu plaan, värv. välisvaade, 15 sisevaadet; fotod: Velvet Stuudiod; restaureeriti ka muinsuskaitse alla kuuluvad Ferdi Sannamehe neoklassitsistlikud stukkreljeefid kinosaalis ja Peet Areni maalid restorani keldrisaalis

  19. Brugbar peer feedback: Instruktion og træning før vi slipper de studerende løs

    DEFF Research Database (Denmark)

    Hvass, Helle; Heger, Stine

    2018-01-01

    Om den rammesætning og instruktion som studerende har behov for, hvis peer feedback skal fungere som læringsaktivitet i praksis.......Om den rammesætning og instruktion som studerende har behov for, hvis peer feedback skal fungere som læringsaktivitet i praksis....

  20. Ettekujutusi islami paradiisist ja paradiisineitsitest ning nende seos džihaadi ja märterlusega / Elo Süld

    Index Scriptorium Estoniae

    Süld, Elo, 1979-

    2012-01-01

    Ajaloolis-kriitiline pilt usklike ja märtrite tasuna oodatavast paradiisist, paradiisineitsite tõlgendamisest. Paradiisimotiivide aluseks olevatest religioossetest ettekujutustest (Koraan, judaistlik, kristlik ja zoroastrismi kontekst, sufismi allegooria, araabia luule, kreeka antiikmütoloogia)

  1. Rezension zu: Annemarie Bauer, Katharina Gröning (Hg.: Gerechtigkeit, Geschlecht und demografischer Wandel. Frankfurt am Main: Mabuse-Verlag 2008

    Directory of Open Access Journals (Sweden)

    Margret Karsch

    2009-07-01

    Full Text Available Der Sammelband belegt einmal mehr, dass Fürsorgeleistungen für Kinder und Ältere überwiegend von Frauen übernommen werden. Diese können und wollen die unbezahlte und oft unsichtbare Arbeit aber nicht mehr leisten – auch eine Frage der Gerechtigkeit. Die Autor/-innen plädieren für eine politische Debatte, um diesen Missstand aufzuheben. Wie wollen wir im Alter leben, was sind uns Unterstützung und Pflege wert? Die Fragen gehen uns alle an und verlangen eine gesamtgesellschaftliche Lösung. Da in Zukunft mehr alte Menschen auf Unterstützung angewiesen sein werden, muss die Fürsorge dringend neu organisiert werden.

  2. Milline on puuetega inimeste olukord hariduses ja tööturul ning mida arvate Anni Akadeemia laadsest eraalgatusest? / Vello Saliste, Kaja Plado, Kristin Veltri...[jt.

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastasid: Kosejõe kooli direktor Vello Saliste, Tartu ülikooli eripedagoogika programmijuht Kaja Plado, Haapsalu sanatoorse internaatkooli eripedagoog Kristin Veltri, Kiigemetsa kooli sotsiaalpedagoog Elo Palmiste, Tallinna ülikooli eripedagoogika osakonna juhataja Kadi Lukanenok

  3. Kuninganna Kristiina ning kunungas Karl XI : rootsiaegsed portreed raekojas = Queen Christina and King Karl XI : portraits of the Swedish period in the Town Hall / Pia Ehasalu

    Index Scriptorium Estoniae

    Ehasalu, Pia, 1964-

    2004-01-01

    Kuninganna Kristiina portreest lapsena (1638). Arvatav autor: Rootsi tolleaegne õuekunstnik Jacob Heinrich Elbfas või tema töökoda. Rootsi kuninga Karl XI noorpõlveportreest (1670). Autor: Karl XI õuekunstnik David Klöcker Ehrenstrahl (1628-1698)

  4. 78 FR 52823 - Designation of 1 Individual and 1 Entity Pursuant to Executive Order 13224 of September 23, 2001...

    Science.gov (United States)

    2013-08-26

    ... (Pakistan); alt. National ID No. 42201-015024707-7 (individual) [SDGT]. Entity 1. JAMIA TALEEM-UL-QURAN-WAL...; a.k.a. MADRASA TALEEMUL QURAN WAL HADITH; a.k.a. MADRASA TALEEMUL QURAN WAL SUNNAH; a.k.a. MAWIYA MADRASSA; a.k.a. MOW-YA MADRASSA; a.k.a. TALALIM QURAN MADRASSA; a.k.a. TALEEM UL-QURAN MADRASSA; a.k.a...

  5. 78 FR 31630 - Designation of One (1) Entity Pursuant to Executive Order 13582 of August 17, 2011, “Blocking...

    Science.gov (United States)

    2013-05-24

    ... TELEVISION (a.k.a. ADDOUNIA TV; a.k.a. AL DOUNIA; a.k.a. AL-DONYA TELEVISION CHANNEL; a.k.a. DUNIA LIMITED LIABILITY COMPANY FOR INFORMATION; a.k.a. DUNIA TELEVISION), Information Free Zone, Damascus, Syria [SYRIA...

  6. 77 FR 27280 - Actions Taken Pursuant to Executive Order 13382

    Science.gov (United States)

    2012-05-09

    ..., Shahrake-E-Quds, Tehran, Iran [IRGC] [NPWMD]. 4. IRAN MARINE INDUSTRIAL COMPANY, SADRA (a.k.a. IRAN MARINE INDUSTRIAL COMPANY SSA; a.k.a. IRAN SADRA; a.k.a. IRAN SHIP BUILDING CO.; a.k.a. SADRA; a.k.a. SHERKATE...

  7. Factors Influencing the Formation of Corrosive Conditions in Puget Sound and the Extreme Conditions Observed During Summer 2015 Associated with the NE Pacific Warm Anomaly (a.k.a. The Blob)

    Science.gov (United States)

    Alin, S. R.; Curry, B.; Newton, J.; Feely, R. A.; Sutton, A.

    2016-02-01

    Puget Sound is a complex glacial estuarine system that receives input from many rivers and streams, in addition to runoff from the urban and agricultural environments surrounding the southern part of the Salish Sea ecosystem. A series of glacial sills restrict estuarine circulation such that intrusions of seawater only occur episodically, resulting in long residence times in some parts of the basin. Through survey cruises and stationary time-series, we have observed the dynamic biogeochemical cycles in various sub-basins of Puget Sound since 2008. Areas of Puget Sound with restricted circulation may experience conditions of high pCO2, low pH, and low aragonite saturation state throughout the year. Historically, the highest pCO2 and lowest pH and aragonite saturation states have been observed in early fall in Hood Canal. Upwelling of dense, nutrient- and CO2-rich but oxygen-poor water along the coast provides the marine source water for Puget Sound's deep waters. We estimate that marine waters entering Puget Sound via the Strait of Juan de Fuca are now corrosive 95% of the time, representing a 26% increase in frequency since the preindustrial era. Both river inputs and intense primary production in surface waters drive remineralization in deep waters of Puget Sound basins, contributing to the formation of corrosive conditions in waters below the productive surface. In addition, we estimate that regionally enhanced atmospheric CO2 content may result in an increase in CO2 uptake in the region. In 2015 many features of the seasonal carbon cycle were accelerated relative to earlier years, as a result of the influence of the NE Pacific warm anomaly. In southern Hood Canal, the surface spring bloom began weeks earlier than usual, and in July, we saw the lowest estimated pH and aragonite saturation values in deep waters observed to date in Washington marine environments, which was about two months earlier than historical seasonal minima in pH and aragonite saturation.

  8. Inherited Anti-Thrombin Deficiency in A Malay-Malaysian Family: A Missense Mutation at Nucleotide g.13267C>A aka anti-thrombin Budapest 5 (p.Pro439Thr) of the SERPINC 1 gene.

    Science.gov (United States)

    Norlelawati, A T; Rusmawati, I; Naznin, M; Nur Nadia, O; Rizqan Aizzani, R; Noraziana, A W

    2014-02-01

    Inherited anti-thrombin deficiency is an autosomal dominant disorder which is associated with increased risk for venous thromboembolism (VTE). This condition is very rare in Malaysia and there has been no documented report. Thus, the aim of the present study is to investigate the type of an inherited anti-thrombin deficiency mutation in a 25-year-old Malay woman who presented with deep vein thrombosis in her first pregnancy. DNA was extracted from the patient's blood sample and buccal mucosal swabs from family members. Polymerase chain reaction(PCR) assays were designed to cover all seven exons of the serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1) gene; and the products were subjected to DNA sequencing. Sequences were referred to NCBI Reference Sequence: NG_012462.1. A heterozygous substitution mutation at nucleotide position 13267 (CCT->ACT) was identified in the patient and two other family members, giving a possible change of codon 439 (Pro→Thr) also known as anti-thrombin Budapest 5. The genotype was absent in 90 healthy controls. The study revealed a heterozygous antithrombin Budapest 5 mutation in SERPINC 1 giving rise to a possible anti-thrombin deficiency in a Malay-Malaysian family.

  9. U.S. Workshop on the Physics and Chemistry of II-VI Materials (a.k.a. II-VI Workshop) - ARO Research Area 9: Materials Science - Physical Properties of Materials

    Science.gov (United States)

    2015-12-21

    integrated into arrays and can be fabricated on various substrates including glass . This makes it well suited for constructing photodetector-arrays for...energy forming a stable TeO2 , but the Cd 3d doublet remained the same. We also analyzed the diffusion profile of the contact metals that were...The devices in this study were made on Corning® Willow® Glass , which is a highly transparent, flexible, hermetic, and dimensionally stable

  10. Electrical, Electronic, and Electromechanical (EEE) Parts Management and Control Requirements for Space Flight Hardware and Critical Ground Support Equipment...aka... The NASA EEE Parts Standard, NASA-STD 8739.10

    Science.gov (United States)

    Majewicz, Peter; Sampson, Michael

    2016-01-01

    Describes development and content of a new NASA Standard for Electrical Electronic and Electromechanical (EEE) parts. This Standard reflects current practices, instead of changing them. Most NASA Centers utilize local documents, but there is minimal consistency across the Agency. A gap analysis clearly shows the differences that exist among the different centers and with respect to the NASA Parts Policy. Once approved, the new standard can be referenced in contracts and agreements with organizations outside of NASA.

  11. 77 FR 70548 - Designation of one (1) individual Pursuant to Executive Order 13224 of September 23, 2001...

    Science.gov (United States)

    2012-11-26

    ... follows: Individual 1. AL-MUSAWI, Ali Mussa Daqduq (a.k.a. 'ABD AL-YUNIS, Hamid Majid; a.k.a. AL-LAMI.... AL-MUSAWI, Hamid Muhammad Jabur; a.k.a. AL-MUSUI, Hamid Muhammad Jabur; a.k.a. DAQDUQ, Ali Mussa; a.k...

  12. Investeeringute ja erinevate toetuste ning käibemaksuskeemide kohaldamise mõju taimekasvatusettevõtte rahavoole = Effect of investments and various subsidies and application of value added tax schemes on crop cultivation enterprise's cash flow / J

    Index Scriptorium Estoniae

    Lehtsaar, Jüri, 1961-

    2005-01-01

    Kolme Eesti põllumajandusettevõtte 2003. aasta majandusnäitajate alusel loodud mudelettevõtte baasil tehtud analüüs investeeringute, toetuste ja alternatiivse käibemaksusüsteemi kohaldamise mõjude kohta. Selgitavad diagrammid. Tabel: Eesti põllumajandustootjate tulu kujunemine aastatel 2000-2003 mln kr; Skeem: Põllukultuuride ja teravilja kasvupind Eestis 2000-2004 tuh ha

  13. Eduard Tubina "Kogutud teoste" köidetest I/I (sümfooniad nr. 1 ja 2) ning I/VII (orkestrisüidid) / Timo Virtanen ; (tõlkinud Merike Vaitmaa)

    Index Scriptorium Estoniae

    Virtanen, Timo, 1956-

    2013-01-01

    Arvustus: Lauri Sirp, Toomas Trass (toim.). Kogutud teosed. I seeria, I köide : Sümfoonia nr. 1 ; Sümfoonia nr. 2 : Legendaarne / Eduard Tubin. Stockholm : Rahvusvaheline Eduard Tubina Ühing ; Gehrmans Musikförlag, 2012

  14. 辽宁省大豆优异种质资源的利用%Study on utilization of high quality soybean seed source of LiaoNing province

    Institute of Scientific and Technical Information of China (English)

    梁成第; 郭迎伟; 王立敏

    2003-01-01

    辽宁省铁岭大豆研究所在1986-1996年间,先后对全省保存的916份大豆品种资源进行系统鉴定与评价.从中鉴定出优异抗旱资源39份,优异抗病资源77份,优异抗虫资源175份,耐瘠资源40份.

  15. Noor, ambitsioonikas, haritud... ning pokaaliga pildid Facebookis?! : töö otsimisel muutub Facebook üha tähtsamaks. Mõned nipid noorele tööotsijale / Kadri Eisenschmidt

    Index Scriptorium Estoniae

    Eisenschmidt, Kadri

    2013-01-01

    Tallinna Ülikooli sotsioloogia eriala lõpetanud Kadri Eisenschmidti artikkel annab ülevaate tema bakalaureusetööst, mille eesmärk oli selgitada, kas ja kuidas mõjutavad sotsiaalvõrgustikud noorte võimalusi töökoha leidmisel

  16. Elektroonilise rämpspostituse olemus. Rämps e-posti saatmisega kahju õigusvastane tekitamine e-kirja teenuse kasutajatele ning Interneti teenuse pakkujatele. Probleemi seadusandlik lahendus : [bakalaureusetöö] / Veiko Vahimets ; Tartu Ülikool,

    Index Scriptorium Estoniae

    Vahimets, Veiko

    2003-01-01

    Elektroonilise rämpsposti olemus - õigusliku regulatsiooni vajalikkus, elektrooniline rämpspostitus ja deliktiõigus, elektroonilise rämpspostituse vastase seadusandluse arengusuunad (Ameerika Ühendriikides, Kanadas, Austraalias, Taiwanil, Euroopa Liidus, Eestis)

  17. Kohtueelses menetluses antud ütluste kasutamine kohtumenetluses EV Riigikohtu ja Euroopa Inimõiguste Kohtu seisukohad ning SE 599 rakendunud muutused : [bakalaureusetöö] / Agu Aver ; Tartu Ülikool, õigusteaduskond ; juhendaja: Eerik Kergandberg

    Index Scriptorium Estoniae

    Aver, Agu

    2012-01-01

    Eesti kriminaalmenetluse arengust, võistlevusest, Euroopa Inimõiguste ja Põhivabaduste kaitse konventsiooni artiklist 6 lõige 3 p (d), kohtueelses menetluses antud ütluste avaldamisest KrMS kohaselt, kuulduste keelust

  18. [Mis teemal peaks kirjutama tänapäeval sellise "40 kirja", millele te allkirja andmist võiksite kaaluda ning mis mõjuks ühiskonnas värske õhu puhanguna?

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad 1980. aastal koostatud "40 kirjale" allakirjutanud kultuuri- ja ühiskonnategelased P. Lorents, P. Kask, H. Kiik, T. Kall, T. Kaljuste, M. Kalda, A. Langemets, K. Alttoa, M. Hint, F. Jüssi, P. Aimla, L. Hainsalu, M. Lauristin, J. Klõšeiko, A. Laats, K. Kreismann, A. Laht, R. Ruutsoo, L. Tavel, A. Valton, P. Tulviste, P.-E. Rummo, T. Rätsep, R. Tamsalu, A. Tarand, E. Nirk, M. Sirkel ja J. Tamm

  19. Kohtupsühhiaatrilist ekspertiisi ja sundravi reguleerivate õigusaktide rakendamine ning võimalikud muudatused : [magistritöö] / Kaupo Piirsalu ; Tartu Ülikool, õigusteaduskond ; juhendajad: Jaan Ginter, Kadri Andresen

    Index Scriptorium Estoniae

    Piirsalu, Kaupo

    2012-01-01

    Õigusharude-vahelistest ekspertiisi- ja sundravialastest regulatsioonidest, kohtupsühhiaatsiaekspertiisist, õigusharude-ülesest regulatsiooni võimalikkusest ja põhiõiguste tagamisest, võrdlusest teiste riikidega, muudatustest ja ettepanekutest

  20. Uniprindi büroo- ja trükikojahoone : edu peatänavatest, Uniprindi trükikojast ning geneerilisest arhitektuurist = Success from Main Streets, Uniprint Printing Plant, and Generic Architecture / Veljo Kaasik

    Index Scriptorium Estoniae

    Kaasik, Veljo

    2000-01-01

    Pärnu mnt. ristmiku juurde Tallinnas R. Puusepa arhitektibüroo poolt trükikojale Uniprint projekteeritud büroo-tootmishoonest. Arhitektid Raivo Puusepp, Krista Väärtnõu. Konstruktsioonid: Projektbüroo Teinos, Civen OÜ. Projekt 1999-2000, hoone valmis 2000. Peatänavaid ääristava hoonestuse kiirest muundumisest. 9 ill.: korruste plaanid, lõiked, vaated (joon.); välisvaated (foto)

  1. Väljendusvabaduse liberaalsed kontseptsioonid ja nende kajastumine rahvusvahelises ning siseriiklikus õiguses : [bakalaureusetöö] / Ksenia Žurakovskaja ; Tartu Ülikool, õigusteaduskond ; juhendaja: Lauri Mälksoo

    Index Scriptorium Estoniae

    Žurakovskaja, Ksenia, 1984-

    2006-01-01

    "Sõna" definitsioon ja väljenduse vorm, liberaalsete väljendusvabaduse kontseptsioonide juriidiline teostamine (John Stuart Mill), väljendusvabadus kui eneseteostuse ja demokratiseerumise tähtsaim element

  2. Lepingulise esindaja õigus ütluste andmisest keelduda tsiviilkohtumenetluses ning selle õiguse seos konfidentsiaalsuskohustusega : [magistritöö] / Jako Laanemägi ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andreas Kangur

    Index Scriptorium Estoniae

    Laanemägi, Jako

    2010-01-01

    Ütluste andmisest tsiviilprotsessis, advokaadi osast, õigusnõustaja rollist, prokuristist e. menetlusosalise lepingulisest esindajast kohtumenetluses, notari osast, muu isiku rollist (nt. patendivolinik)

  3. Reservatsioonide lubatavus ning reservatsioonide vastuväidete õiguslik mõju ILC uurimistöö valguses : [bakalaureusetöö] / Marja-Liisa Laatsit ; Tartu Ülikool, õigusteaduskond ; juhendaja: Lauri Mälksoo

    Index Scriptorium Estoniae

    Laatsit, Marja-Liisa

    2009-01-01

    ILC = International Law Commission. - Reservatsioonidest tänases teoorias ja praktikas, vastuväidetest reservatsioonide tegemisele, reservatsioonide lubatavusest ja nende õiguslikust mõjust (ILC eriraportöör Pellet̀ettepanekutest, NATO SOFA lepingust)

  4. Vaidluste lahendamine ning lahendite läbivaatuse eesmärk ICSID süsteemis : [bakalaureusetöö] / Tanel Ader ; Tartu Ülikool, õigusteaduskond ; juhendaja: Aleksandr Popov

    Index Scriptorium Estoniae

    Ader, Tanel

    2012-01-01

    ICSID (Rahvusvaheline Investeerimisvaidluste Lahendamise Keskus = International Centre for Settlement of Investment Disputes) eelsest õiguslikust olukorrast, konventsiooni eesmärkidest, Maailmapanga põhimõtete täitmisest, kahjutasu tunnustamisest ja väljanõudmisest, riikide suveräänsest puutumatusest

  5. Ühiskondlik süüdistus : EV Ülemkohtu esimehe, nõukogude teenelise juristi J. Kirikali, Ülemkohtu liikmete U. Penderi ja A. Viljardi ning EV prokuröri L. Urge vastu / Enn Sarv

    Index Scriptorium Estoniae

    Sarv, Enn, 1921-2008

    1992-01-01

    1991. a. 27. veebruari Ülemkohtu pleenumi määrusest, mis puudutas 1946. a. süüdi mõistetud koolinoori (Ageeda-Andrea Paavel, Aili Jürgenson, Eino Valdmaa, Lia Frei, Juhan Kuusk). Lisatud määruse täistekst

  6. Õiguspärane sundvõõrandamine rahvusvahelises õiguses ning maagaasiseaduse ja majandustegevuse seadustiku üldosa seaduse muutmise seaduse eelnõus : [magistritöö] / Kristjan Kotkas ; Tartu Ülikool, õigusteaduskond ; juhendaja: Maarja Torga

    Index Scriptorium Estoniae

    Kotkas, Kristjan

    2012-01-01

    Sundvõõrandamisest ja selle lubatavusest rahvusvahelises õiguses, eelnõus toodud meetmete analüüsist rahvusvahelise õiguse taustal, õiguspärase sundvõõrandamise tingimuste olemasolust eelnõus

  7. Chemical Profiling of Re-Du-Ning Injection by Ultra-Performance Liquid Chromatography Coupled with Electrospray Ionization Tandem Quadrupole Time-of-Flight Mass Spectrometry through the Screening of Diagnostic Ions in MSE Mode

    Science.gov (United States)

    Wang, Zhenzhong; Geng, Jianliang; Dai, Yi; Xiao, Wei; Yao, Xinsheng

    2015-01-01

    The broad applications and mechanism explorations of traditional Chinese medicine prescriptions (TCMPs) require a clear understanding of TCMP chemical constituents. In the present study, we describe an efficient and universally applicable analytical approach based on ultra-performance liquid chromatography coupled to electrospray ionization tandem quadrupole time-of-flight mass spectrometry (UPLC-ESI-Q/TOF-MS) with the MSE (E denotes collision energy) data acquisition mode, which allowed the rapid separation and reliable determination of TCMP chemical constituents. By monitoring diagnostic ions in the high energy function of MSE, target peaks of analogous compounds in TCMPs could be rapidly screened and identified. “Re-Du-Ning” injection (RDN), a eutherapeutic traditional Chinese medicine injection (TCMI) that has been widely used to reduce fever caused by viral infections in clinical practice, was studied as an example. In total, 90 compounds, including five new iridoids and one new sesquiterpene, were identified or tentatively characterized by accurate mass measurements within 5 ppm error. This analysis was accompanied by MS fragmentation and reference standard comparison analyses. Furthermore, the herbal sources of these compounds were unambiguously confirmed by comparing the extracted ion chromatograms (EICs) of RDN and ingredient herbal extracts. Our work provides a certain foundation for further studies of RDN. Moreover, the analytical approach developed herein has proven to be generally applicable for profiling the chemical constituents in TCMPs and other complicated mixtures. PMID:25875968

  8. Õigusvastaselt võõrandatud vara tagastamine ja kompenseerimine ning sellega seotud kohtulikud vaidlused : [bakalaureusetöö] / Eve Lill ; Tartu Ülikool, õigusteaduskond ; juhendaja: Kalle Merusk

    Index Scriptorium Estoniae

    Lill, Eve

    1996-01-01

    Õigusvastaselt võõrandatud vara tagastamise ja kompenseerimise menetlus ja vaidlused, halduskohtu pädevus ja vaidluste liigid seoses õigusvastaselt võõrandatud vara tagastamise ja kompenseerimisega

  9. Piinamise ja ebainimliku või alandava kohtlemise või karistamise tõkestamise Euroopa konventsioon ja Komitee ning Eesti kohta koostatud raportite vanglaid puudutav osa : [bakalaureusetöö] / Mariko Jõeorg ; Tartu Ülikool, õigusteaduskond ; juh

    Index Scriptorium Estoniae

    Jõeorg, Mariko

    2003-01-01

    Euroopa Nõukogust, piinamise ja ebainimliku või alandava kohtlemise või karistamise tõkestamise Euroopa konventsiooni loomine, mõisted, Komitee visiidid Eestisse ja raportid vanglate kohta (1997, 1999), Eesti vastulaused

  10. Motoorika areng eelkoolieas ning selle mõju õpiedukusele esimeses klassis = The development of motor at preschool age and its influence on academic achievement in their first form : I koht magistritööde kategoorias / Kristi Heilman

    Index Scriptorium Estoniae

    Heilman, Kristi

    2009-01-01

    Uuringu ülesandeks oli välja selgitada koolieelikute liigutusoskuste tase sõltuvalt liikumistundide arvust lasteaia õppenädalas ja püüda välja selgitada liikumisoskuste mõju lapse õpiedukusele esimeses klassis

  11. Süüteovahendi konfiskeerimise eesmärk ja õiguslik olemus ning selle põhiseaduslik õigustus. Riigikohtu üldkogu otsus asjas 3-1-1-37-07 / Andres Parmas

    Index Scriptorium Estoniae

    Parmas, Andres, 1977-

    2008-01-01

    Riigikohtu lahendist 3-1-1-37-07 (Toomas Tiiki kaitsja vandeadvokaadi abi Anti Aasmaa kassatsioon Viru Ringkonnakohtu 22. märtsi 2007. a kohtuotsuse peale kriminaalasjas Toomas Tiiki süüdistuses KarS § 424 järgi)

  12. 76 FR 35062 - Apparel America, Inc. (n/k/a HSK Industries, Inc.), Decora Industries, Inc., Diversicon Holdings...

    Science.gov (United States)

    2011-06-15

    ... Transportation Network Group, Inc., and Premier Wealth Management, Inc. (a/k/a Premiere Wealth Management, Inc... concerning the securities of Premier Wealth Management, Inc. (a/k/a Premiere Wealth Management, Inc.) because...

  13. Yeast Interacting Proteins Database: YGL061C, YER016W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aidin

  14. Yeast Interacting Proteins Database: YGL061C, YDR016C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...6C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...it description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force p... Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT

  15. Yeast Interacting Proteins Database: YKR037C, YGL061C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ion Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by

  16. Yeast Interacting Proteins Database: YGR113W, YDR016C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...DR016C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced

  17. Yeast Interacting Proteins Database: YGR113W, YKR037C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...KR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...escription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produ

  18. Yeast Interacting Proteins Database: YKR037C, YDR016C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...016C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ion Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by

  19. Yeast Interacting Proteins Database: YGR113W, YGL061C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...GL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...scription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produc

  20. Yeast Interacting Proteins Database: YKR083C, YKL052C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...2C ASK1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...e name DAD2 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ey description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force p

  1. Yeast Interacting Proteins Database: YKR083C, YDR201W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...1W SPC19 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force ...on Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by M

  2. 78 FR 2721 - Designation of Entities Pursuant to Executive Order 13413

    Science.gov (United States)

    2013-01-14

    ... Economic Powers Act (50 U.S.C. 1701 et seq.) (IEEPA) and section 5 of the United Nations Participation Act... listing of the blocked entities appears as follows: 1. FORCES DEMOCRATIQUES DE LIBERATION DU RWANDA (a.k.a. COMBATANT FORCE FOR THE LIBERATION OF RWANDA; a.k.a. DEMOCRATIC FORCES FOR THE LIBERATION OF RWANDA; a.k.a...

  3. 75 FR 47899 - Designation of Two Entities and Seven Individuals Pursuant to Executive Order 13224

    Science.gov (United States)

    2010-08-09

    ..., or economy of the United States; (3) persons determined by the Director of OFAC, in consultation with... RECONSTRUCTION IN LEBANON; a.k.a. IRAN'S HEADQUARTERS FOR THE RECONSTRUCTION OF LEBANON), Near Iranian Embassy....k.a. KHOSHNEVIS, Hussam; a.k.a. KHOSHNVIS, Hassan; a.k.a. KHOUCHNOYESS, Hussam); nationality Iran...

  4. 78 FR 59097 - Designation of Two Individuals Pursuant to Executive Order 13224 of September 23, 2001, “Blocking...

    Science.gov (United States)

    2013-09-25

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... MADJID, Afif; a.k.a. BIN ABDUL MAJID, Afif); DOB 01 Jan 1955; POB Pacitan, East Java, Indonesia; nationality Indonesia (individual) [SDGT]. 2. SUNGKAR, Said Ahmad (a.k.a. SUNGKAR, Sahid Ahmad; a.k.a. SUNGKAR...

  5. 78 FR 41995 - Actions Taken Pursuant to Executive Order 13382

    Science.gov (United States)

    2013-07-12

    ...-hour fax-on-demand service, Tel.: 202/622-0077. Background On June 28, 2005, the President, invoking... Executive Order 13382. The list of additional designees is as follows: 1. DAEDONG CREDIT BANK (a.k.a. DAE-DONG CREDIT BANK; a.k.a. DCB; a.k.a. TAEDONG CREDIT BANK), Suite 401, Potonggang Hotel, Ansan-Dong...

  6. 77 FR 10807 - Designation of One Entity Pursuant to Executive Order 13553

    Science.gov (United States)

    2012-02-23

    ... International Emergency Economic Powers Act (50 U.S.C. 1701-06) (``IEEPA'') and the Comprehensive Iran Sanctions... INTELLIGENCE AND SECURITY (a.k.a. VEZARAT-E ETTELA'AT VA AMNIAT-E KESHVAR; a.k.a. ``MOIS''; a.k.a. ``VEVAK..., Tehran, Iran; Ministry of Intelligence, Second Negarestan Street, Pasdaran Avenue, Tehran, Iran [SDGT...

  7. Itaallane Giulietto Chiesa - 9/11 tabulõhkuja / Ivari Vee

    Index Scriptorium Estoniae

    Vee, Ivari

    2008-01-01

    Itaalia publitsist ja politoloog ning Europarlamendi saadik Giulietto Chiesa kohtus Tallinnas ajakirjanike ja teiste huvilistega ning tutvustas oma raamatut "Zero" ning selle ainetel valminud filmi "9/11. Uurimine nullist"

  8. Kaadris: "Naerata ometi" / Ulve Määrits

    Index Scriptorium Estoniae

    Määrits, Ulve

    2012-01-01

    Restaureeriti mängufilm "Naerata ometi". Sel puhul toimus ringreis Tilsis ning taastatud filmi esitlus Põlva kultuurikeskuses, kus osalesid ning meenutasid filmi valmimist ka lavastaja Arvo Iho ning osatäitjad Katrin Tamleht ja Kerttu Aaving

  9. Two steps forward, one step back? : the field of womeǹs human rights / Hilary Charlesworth

    Index Scriptorium Estoniae

    Charlesworth, Hilary

    2014-01-01

    Sümpoosion naiste inimõigustest ning vastava seadusandluse problemaatilisusest. Lisaks naiskohtunike mõjust kohtusüsteemile Euroopa Inimõiguste Kohtus, abordist ning vastavast seadusandlusest Suurbritannias, naistevastasest vägivallast ning lesbiliste suhete õiguslikust regulatsioonist

  10. "Retsh Pospolita energetitshna" / Vladimir Skripov

    Index Scriptorium Estoniae

    Skripov, Vladimir

    2007-01-01

    Euroopa Komisjoni energiapoliitika-alased dokumendid ning Venemaa energiatarnete katkestused on sundinud Baltimaid ja Poolat tegema koostööd uute elektrikaablite ehitamise ning tuumaenergia kasutuse laiendamiseks ning otsima alternatiivseid sihtkohti naftaimpordiks

  11. Informatsioon, juhtimine, infotehnoloogia ja infotehnoloogia juhtimine / Vambola Leping

    Index Scriptorium Estoniae

    Leping, Vambola

    2004-01-01

    Infotehnoloogia juhtimise vajadusest, võimalustest ettevõtetes ning organisatsioonides, informatsiooni ja andmete vahekorrast ning seosest juhtimisega, infotehnoloogia juhtimise kooslusmudelist. Skeem. Diagramm

  12. Kust leida naissoost meest? / Ramo Pener

    Index Scriptorium Estoniae

    Pener, Ramo

    2016-01-01

    Mõistest Gender Mainstreaming ning selle hukutava maailmavaate tagamaadest. Adekvaatse identiteedi kujunemise kaasaaitamisel on oluline aidata kaasa soorollide kujunemisele, selgitamisele ning toetamisele

  13. Privatisation of enterprises of infrastructure : why did it misfire? / Heido Vitsur

    Index Scriptorium Estoniae

    Vitsur, Heido, 1944-

    2002-01-01

    Edelaraudtee ning Narva elektrijaamade erastamisest, sellega seonduvatest probleemidest ning viimastest arengutest. Lisad: Muutused maksunduses; Balti riikide kõige kallim ja odavam pealinn; Aastatehingud Eestis

  14. Vello Viirsalu - Orienteeruja Kuldsulg 9. VII 1938 - 23. III 2011 / Heino Mardiste

    Index Scriptorium Estoniae

    Mardiste, Heino, 1936-

    2011-01-01

    Pikaaegsest Tartu Onkoloogiahaigla radioloogist ja statistikakabineti juhatajast, kes oli ka orienteerumisspordi harrastaja ning eestvedaja - orjenteerumiskaartide koostaja, OK Kape asutaja ning orienteerumisspordi ajaloouurija jne

  15. Õpilane / Kristina Lindemann

    Index Scriptorium Estoniae

    Lindemann, Kristina, 1984-

    2016-01-01

    Rahvusvahelise õpilaste hindamisprogrammi PISA 2015. aasta uuringu tulemuste analüüs, mis näitab, kuidas õpilaste sotsiaalmajanduslik taust ning tegevused seostuvad sooritustulemustega ning tulevikuootustega

  16. The Many Sides of Happy Lim: aka Hom Ah Wing, Lin Jian Fu, Happy Lum, Lin Chien Fu, Hom Yen Chuck, Lam Kin Foo, Lum Kin Foo, Hom, Lim Goon Wing, Lim Gin Foo, Gin Foo Lin, Koon Wing Lim, Henry Chin, Lim Ying Chuck, Lim Ah Wing, et. al.

    Directory of Open Access Journals (Sweden)

    Gordon H. Chang

    2010-03-01

    Full Text Available

    Known to the FBI, INS, and IRS as Mr. Ah Wing Hom, he was also Lin Jian Fu, Jian Fu (Tough Guy, or just Fu to the readers of the many poems and short stories he published in Chinese over four decades in the twentieth century. And to still others, primarily English-readers of his writing, he was Happy Lim, an ironic, even tragically bizarre name, as his life was far from pleasant. On New Year's Day 1986, he died alone in a dingy San Francisco Chinatown bachelor hotel suffering from a bacterial infection and a chronic blood disorder that had required the amputation of all his toes the year before. He was seventy-eight years of age and had spent most of his life within blocks of where he died.

  17. Strategies to improve road safety : how to learn from Dutch experiences? Lecture held at the Seminar on Road Safety "Stategies to improve road safety: How to learn from Dutch experiences?", Ankara/Istanbul, Turkey, 6-7 November 2012. [a.k.a. as: Improving road safety : experiences from The Netherlands.

    NARCIS (Netherlands)

    Hagenzieker, M.P.

    2016-01-01

    On the occasion of the visit of the Dutch Prime Minister Mark Rutte to Turkey, The Netherlands embassy in Ankara and the consulate-general in Istanbul are organising a half-day seminar on the successful road safety strategy of the Netherlands on 6 and 7 November 2012. During these events road safety

  18. Mäletamine ja nostalgia Karl Ristikivi romaanis „Kõik, mis kunagi oli” ning Bernard Kangro Joonatani -romaanides. Remembering and Nostalgia in Karl Ristikivi`s novel „All that Once Was” and Bernard Kangro’s Joonatan-novels

    Directory of Open Access Journals (Sweden)

    Maarja Hollo

    2012-04-01

    Full Text Available Research on the phenomenon of nostalgia has been notably shaped by the interest taken by sociologists, historians, and ethnologists in the ways of remembering past events and the impact of these ways of reminiscence on different communities of memory. This article considers remembering in a narrower sense, focusing on the modes of expression of individual memory, that is, on nostalgia. More specifically, nostalgia is defined as a conglomeration of feelings, images and interpretations that accompany individual remembering; the contradictions between these elements reflect the tensions inherent in remembering. The purpose of the article is first to emphasize ways in which remembering is represented in the works of two Estonian writers who went into exile during World War II; second, differences among their novels which thematize remembering, and third, how these works communicate today, in the context of recent polemics around memory. Karl Ristikivi’s novel „All that Once Was” (Kõik, mis kunagi oli”, 1946, was his first work to be published in exile, and the first volume of a dilogy set in Estonia, which the writer had already planned before fleeing Estonia. The first volume of Bernard Kangro’s Joonatan trilogy was published in 1971, and the last in 1973 – a period of creative crisis for Kangro, in which his prose writing undergoes significant change. In the works of both Ristkivi and Kangro, remembering and nostalgia are inextricably bound together. In Ristikivi’s novel, the connections emerge through the parallel representation of remembering, events in historical time, and the writing of history; in Kangro’s novels, in the force field of remembering and events in historical time. Ristikivi’s novel is set a few months before the conclusion of the Molotov- Ribbentrop pact in August, 1939. The novel’s focus, however, is not on the historical events themselves, but rather on how characters experience and interpret their own personal past and present. The novel shows how personal remembering differs from the logic of cultural memory, and seems to confirm that remembering maintains a certain autonomy from historical time. Such an understanding of memory can be taken as an effort to critique attempts to politicize memory. Ristikivi stresses qualities of individual remembering such as self-enclosure and refusal to submit to efforts at collectivization and assimilation. This kind of memory is only for the characters themselves to know; never once do they express their memories in language. As concerns nostalgia, Ristikivi’s novel emphasizes its connection with forgetting: in their retrospection and recollection, characters remember only extraordinary events in their lives, but not the texture of their everyday lives. Like Ristikivi, Kangro also speaks of the connections between nostalgia and remembering. In his Joonatan-novels, however, nostalgia has a more ambivalent meaning. The protagonist of the Joonatan novels, who has just returned to the homeland from exile, feels the tension between his wish to reconcile himself with the past and the nostalgic memories that flood him in the homeland. On the one hand, indulging in nostalgia tears him away from the wish to remember painful past events, and with this from present reality; on the other hand, his nostalgia helps him overcome a traumatic past. In both Ristikivi’s and Kangro’s novels nostalgic memories are connected with personally meaningful places, to which they return again and again.

  19. Ravi rahastamise lepingu sõlmimise menetluse regulatsiooni ja selle alusel Eesti Haigekassa poolt välja kujundatud halduspraktika kitsaskohad ning nende ületamise võimalused : [magistritöö] / Alle-Riin Nõgols ; Tartu Ülikool, õigusteaduskond

    Index Scriptorium Estoniae

    Nõgols, Alle-Riin

    2012-01-01

    Ravi rahastamise lepingu olemusest ja sõlmimiseks läbiviidavast haldusmenetlusest, Eesti Haigekassa õiguslikust seisundist EL konkurentsiõiguse tähenduses, tervishoiuteenuse osutajate võrdse kohtlemise võimalustest ravi rahastamise lepingute sõlmimise protsessis

  20. Assessment of Secondary School Students' Awareness, Knowledge and Attitudes to Environmental Pollution Issues in the Mining Regions of South Africa: Implications for Instruction and Learning

    Science.gov (United States)

    Olufemi, Adejoke Christianah; Mji, Andile; Mukhola, Murembiwa S.

    2016-01-01

    In this paper, we compared the levels of awareness, knowledge and attitudes (AKA) about environmental pollution of secondary school students from two South African provinces. The purpose was to determine the levels of AKA between students living under different environmental conditions. These two groups were students from a coal-mining province…

  1. 76 FR 72502 - Removal From the List of Specially Designated Nationals and Blocked Persons of Certain Entities...

    Science.gov (United States)

    2011-11-23

    .... Box 15715, Az Zawiyah, Libya [LIBYA2] 7. BREGA PETROLEUM MARKETING COMPANY (a.k.a. BPMC; a.k.a. BREGA... Montplaisir (Bourjel), 1002, Tunis, Tunisia; Avenue Kheireddine Pacha, Cite Ennasim Montplaisir, 1002, Tunis, Tunisia; P.O. Box 485, 1080, Tunis Cedex, Tunisia; Bizerte Centre, 7000, Bizerte, Tunisia; Ennasim Mont...

  2. Architectural, Mechanical, Electrical, Plumbing, and Site Documents Associated with Sustainability Base, N232

    Science.gov (United States)

    Grymes, Rosalind A.; Martin, Rodney Alexander; Dianati, Soheila

    2016-01-01

    These files contain more precise and accurate representations of the architectural, mechanical, electrical, plumbing, and site information pertaining to Sustainability Base, aka Collaborative Support Facility, aka N232. These supersede the 'bid' drawings released in STI 8112 previously. They are useful for NASA researchers and collaborators in modeling the performance characteristics of the facility. Otherwise, they do not contain new data.

  3. Haplotype frequencies in a sub-region of chromosome 19q13.3, related to risk and prognosis of cancer, differ dramatically between ethnic groups

    DEFF Research Database (Denmark)

    Schierup, M.H.; Mailund, T.; Li, H.

    2009-01-01

    Background: A small region of about 70 kb on human chromosome 19q13.3 encompasses 4 genes of which 3, ERCC1, ERCC2, and PPP1R13L (aka RAI) are related to DNA repair and cell survival, and one, CD3EAP, aka ASE1, may be related to cell proliferation. The whole region seems related to the cellular...

  4. 76 FR 40773 - Additional Designation of Entities Pursuant to Executive Order 13382 and Information Regarding...

    Science.gov (United States)

    2011-07-11

    ... INVESTMENT COMPANY; a.k.a. MEHR IRANIAN ECONOMY COMPANY; a.k.a. MEHR IRANIAN ECONOMY INVESTMENTS; f.k.a... Square, Tehran, Iran; No. 48, 14th Alley, Ahmad Qassir Street, Argentina Square, Tehran, Iran; Business Registration Document 103222 (Iran); Web site http://www.mebank.ir ; Telephone: 982188526300; Alt. Telephone...

  5. 76 FR 38279 - Designation of One Individual and One Entity Pursuant to Executive Order 13224

    Science.gov (United States)

    2011-06-29

    ... policy, or economy of the United States; (3) persons determined by the Director of OFAC, in consultation.... SHAHRIYARI, Behnam (a.k.a. SHAHRIARI, Behnam; a.k.a. SHAHRYARI, Behnam); DOB 1968; nationality Iran..., Tehran, Iran [SDGT]. Dated: June 23, 2011. Adam J. Szubin, Director, Office of Foreign Assets Control...

  6. 78 FR 60844 - Wooden Bedroom Furniture From the People's Republic of China: Partial Rescission of Antidumping...

    Science.gov (United States)

    2013-10-02

    ... Furniture Co., Ltd. Dorbest Ltd., Rui Feng Woodwork Co., Ltd. Aka Rui Feng Woodwork (Dongguan) Co., Ltd., Rui Feng Lumber Development Co., Ltd. Aka Rui Feng Lumber Development (Shenzhen) Co., Ltd., Fine... Fung Wooden Factory, Sun Fung Co., Shin Feng Furniture Co., Ltd., Stupendous International Co., Ltd...

  7. 77 FR 22756 - Modification of Temporary Denial Order Making Temporary Denial of Export Privileges Applicable to...

    Science.gov (United States)

    2012-04-17

    ... Gatewick Freight & Cargo Services, a/k/a/ Gatewick Aviation Services, G 22 Dubai Airport Free Zone, P.O... Airport Free Zone, P.O. Box 393754, Dubai, United Arab Emirates; and P.O. Box 52404, Dubai, United Arab.... Kerman Aviation, a/k/a GIE Kerman Aviation, 42 Avenue Montaigne 75008, Paris, France. Sirjanco Trading, P...

  8. 76 FR 70544 - OFAC Implementation of Certain Sanctions Imposed on Seven Persons by the Secretary of State...

    Science.gov (United States)

    2011-11-14

    ... LTD; a.k.a. PETROCHEMICAL TRADING COMPANY LIMITED; a.k.a. ``PCCI''), P.O. Box 261539, Jebel Ali, Dubai... Group, ROG Corporate Office, Royal Oyster General Trading LLC, P.O. Box 34299, Dubai, United Arab..., Building W5B, Dubai Airport Free Zone, P.O. Box 54916, Dubai, United Arab Emirates: The Director of OFAC...

  9. 76 FR 71867 - Addition of Certain Persons to the Entity List; and Implementation of Entity List Annual Review...

    Science.gov (United States)

    2011-11-21

    ... Kabul, Afghanistan, and A2 Ground Floor, City Computer Plaza, Shar-e-Naw, Kabul, Afghanistan; (3) Fazal..., Peshawar, Pakistan; (3) Fazal Rahim Farid, a.k.a., the following three aliases: --Fazel Rahim Farid... Afghanistan EAR). Fazal Rahim Farid, a.k.a., the For all items Presumption of denial........ 76 FR [INSERT FR...

  10. 75 FR 9645 - Additional Designations of Individuals and Entities Pursuant to Section 804(b) of the Foreign...

    Science.gov (United States)

    2010-03-03

    ... worldwide basis. It provides a statutory framework for the President to impose sanctions against significant... identified by the President. In addition, the Secretary of the Treasury consults with the Attorney General...; a.k.a. MENDEZ VARGAS, Jesus; a.k.a. MENDEZ, Jesus), Tazumbos, Jalisco, Mexico; Calle Dr. Lose Luis...

  11. 75 FR 36516 - Addition and Removal of Certain Persons on the Entity List: Addition of Persons Acting Contrary...

    Science.gov (United States)

    2010-06-28

    ... reasons. OnTime Electronics Technology Company and Tam Wai Tak, a.k.a., Thomsom Tam, are being added due... June 5, 2008, OnTime Electronics Technology Company and Tam Wai Tak were indicted in the Southern... Commercial Center, 28 Ferry Street, Jordon, Kowloon, Hong Kong; and (2) Tam Wai Tak, a.k.a., Thomsom Tam...

  12. 31 CFR Appendix A to Part 560 - Persons Determined to be the Government of Iran, as defined in § 560.304 of This Part

    Science.gov (United States)

    2010-07-01

    ...; all offices worldwide [IRAN] BANK REFAH KARGARAN (a.k.a. BANK REFAH; a.k.a. WORKERS' WELFARE BANK (OF...., Vanak Sq., Tehran, Iran; 99-A, Maker Tower F, 9th Floor, Cuffe Parade, Colabe, Mumbai 400 005, India; No... Arab Emirates; Office No. 99-A, Maker Tower “F” 9th Floor Cutte Pavade, Colabe, Bumbai 700005, India...

  13. 77 FR 44715 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2012-07-30

    ..., S.A. DE C.V. (a.k.a. LA TIJERA PARQUE INDUSTRIAL; a.k.a. PROVENZA CENTER), Av. Adolfo Lopez Mateos... (Mexico) [SDNTK]. 8. PETROBARRANCOS, S.A. DE C.V., Av. Benjamin Hill No. 5602, Col. Industrial el Palmito...

  14. 77 FR 2609 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to the Foreign...

    Science.gov (United States)

    2012-01-18

    ..., S.A. DE C.V. (a.k.a. MEDIC EXPRESS, S.A. DE C.V.; a.k.a. GRUPO LOMEDIC), Av. del Parque 489, Col. San Andres, Guadalajara, Jalisco 44810, Mexico; Calle Chicle 234, Colonia El Colli Industrial, Zapopan...

  15. Chapter Twelve

    African Journals Online (AJOL)

    User

    okada na obere jenareto ai passi mai nebo·. 17 ... Oluchukwu Micro-Finance Bank gbasara aka inyere ndi 10. Mmadu aka n'uzo di .... Nigeria· This in no small measure has been helping unemployed people, graduates ... Even in the transport sector people have been empowered to be self reliant· This could be seen in the ...

  16. Yeast Interacting Proteins Database: YGR113W, YGL079W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ntial subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depol

  17. Yeast Interacting Proteins Database: YGR113W, YLR424W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...13W Bait gene name DAM1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force

  18. Yeast Interacting Proteins Database: YKR037C, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymeri

  19. Yeast Interacting Proteins Database: YDR034C, YGR113W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aidin...Rows with this bait as prey (0) YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), coupl...es kinetochores to the force produced by MT depolymerization thereby aiding in ch

  20. 76 FR 50407 - Addition of Persons Acting Contrary to the National Security or Foreign Policy Interests of the...

    Science.gov (United States)

    2011-08-15

    ... Physics and Chemistry (a.k.a., China Academy of Engineering Physics (CAEP)'s 902 Institute); --Southwest... as one of nineteen individual aliases for the listed person the ``Chinese Academy of Engineering... described above, to read as follows: China (1) Chinese Academy of Engineering Physics, a.k.a., the following...

  1. Self-employment and quasi self-employment: a challenge for labour law

    NARCIS (Netherlands)

    Westerveld, M.; Zaal, I.

    2015-01-01

    Over the years the (Dutch) labour market has witnessed a growing number of workers outside the realm of the employment contract. At the end of the past century the number of (in Dutch) ‘self-employed without personnel’ (a.k.a. independent contractor, a.k.a. sole trader) was around one in seventeen

  2. Putini sõprade käes on Riia ja peagi võibolla ka Seim / Otto Ozols ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Ozols, Otto

    2016-01-01

    Intervjuu Läti kirjaniku ja publitsisti Otto Ozolsiga lõunanaabrite juures toimuvast ning sellest, kuidas on viimaste aastate arengud Euroopas ja Venemaal puudutanud Läti poliitikat ning ühiskonda

  3. Moraalset lõivu maksmata on raske äri ajada / Priit Jõgi

    Index Scriptorium Estoniae

    Jõgi, Priit, 1970-

    2003-01-01

    Autor arutleb ettevõtjate ning poliitikute sidemete üle Eestis ning leiab, et parteide toetamisele ettevõtete poolt tuleks seada teatavad piirangud, parteide rahastamise keelamise asemel tuleks see muuta läbipaistvamaks.

  4. Märketeatesuusatamine uues kuues Mammastes / Nikolai Järveoja

    Index Scriptorium Estoniae

    Järveoja, Nikolai, 1950-

    2010-01-01

    Märkeorienteerumise ajaloost ning 27. veebruaril 2010 Mammastes uute reeglite alusel toimunud Eesti meistrivõistlustest suusaorienteerumise märketeates. Ajalugu meenutab Arne Kivistik ning võistlust kommenteerivad Tõnis Erm ja Raul Kudre

  5. Taaskasutusest armastusega / Tiiu Suvi

    Index Scriptorium Estoniae

    Suvi, Tiiu

    2006-01-01

    Tuuliki Peili loomingulistest rõivastest, mis kannavad silti "Humana Disain" ning on valmistatud peamiselt second-hand materjalist ja Tallinna Taaskasutuskeskuse tekstiilikojast ning selle meistri Pille Kelleri tegemistest

  6. Inglismaa firma müüb brittidele Eestis asuvat kinnisvara / Raigo Neudorf

    Index Scriptorium Estoniae

    Neudorf, Raigo

    2005-01-01

    Ilmunud ka: Infopress 8. juuli lk. 34. Suurbritannia kinnisvarafirma Churchill Properties tegevusest Eestis ning Eesti kinnisvaraettevõtte OÜ Manutent tegevusest Hispaanias. Eesti ja Hispaania kinnisvaraturust ning hindadest. Lisa: Kalleim korter maksab neli miljonit

  7. Igal mõisal on oma lugu / Mari-Ann Remmel

    Index Scriptorium Estoniae

    Remmel, Mari-Ann

    2008-01-01

    Kirjastuselt "Tänapäev" ilmus raamat "Mõisalegendid. Harjumaa", koostaja Mari-Ann Remmel, kujundaja Angelika Schneider. Kogumik sisaldab ka ajaloolist ning genealoogilist teavet mõisahoonete ning -omanike kohta

  8. Mõista mitte hukka mõista / Mario Sootna

    Index Scriptorium Estoniae

    Sootna, Mario, 1962-

    2004-01-01

    Rahvaliidu põllumajandusministri Tiit Tammsaare tagasiastumisest seoses teraviljavarude vargusega ning rünnakutest siseminister Margus Leivo vastu julgeolekuvarude varguse avastamise ning tema poja narkoprobleemide tõttu

  9. Edgar Morin maailmaühiskonna problemaatikast / Maiki Voore

    Index Scriptorium Estoniae

    Voore, Maiki, 1983-

    2008-01-01

    Rahvusvahelisest konverentsist "Kultuuriproblemaatika keelte ja kultuuride õpetamisel ning õppimisel ning õppimisel ülemaailmastumise ja individiualiseerimise ristumisteel: interdistsiplinaarne käsitlus", mille üheks peaesinejaks oli prantsuse filoloog ja antropoloog emeriitprofessor Edgar Morin

  10. Tee selgeks, mis sind segab / Hede Kerstin Luik ; interv. Aavo Kokk

    Index Scriptorium Estoniae

    Luik, Hede Kerstin

    2003-01-01

    Statoili turundusjuht Hede Kerstin Luik kirjeldab muutusi, mida Shelli bensiinijaamade ostmine ettevõttele ning selle töötajatele kaasa tõi ning kuidas pingelisel ajal tööstressiga võideldi. Kommenteerib Mihkel Reinsalu.

  11. Balti riikide raamatukoguhoidjate avaldus pagulastele pakutavate raamatukoguteenuste asjus / inglise keelest tõlkinud Tiina Büttner

    Index Scriptorium Estoniae

    2015-01-01

    Avalduse koostasid Läti, Eesti ja Leedu raamatukoguhoidjate ühingud ning selle võtsid ühehäälselt vastu Balti raamatukoguhoidjate 10. kongressi ning Läti raamatukoguhoidjate 17. konverentsi osalejad Riias 13. oktoobril 2015

  12. Kuidas püüda hetke / Taimi Elenurm

    Index Scriptorium Estoniae

    Elenurm, Taimi

    2009-01-01

    Olevikule keskendumise positiivsest mõjust eluga edasi liikumisel ning vabanemaks kammitsevatest hinnangutest, samuti inglise psühholoogide Gill Hassoni ja Helena Pozniaki poolt kirjeldatud kuuest sammust, mis aitavad leida kontakti olevikuga ning olla õnnelikud

  13. Protecting the rights of patients in psychiatric settings : a comparison of the work of the Mental Health Act Commission with the CQC / Judy Laing

    Index Scriptorium Estoniae

    Laing, Judy

    2014-01-01

    Tervishoiu kvaliteedi komisjoni (Care Quality Commission) ning vaimse tervishoiu komisjoni (Mental Health Act Commission) töö võrdlusest psühhiaatriliste patsientidega ning vastavatest regulatsioonidest

  14. Elektrijaamade struktuur Eesti energiasüsteemis / Heiki Tammoja

    Index Scriptorium Estoniae

    Tammoja, Heiki, 1947-

    2007-01-01

    Eesti elektrijaamade liigitusest primaarenergia kasutamise struktuuri ning kasutatava tehnoloogia järgi. Elektrijaamade optimaalsest struktuurist ning elektroenergeetika arengukavade koostamisest MARKAL (market allocation) mudeli järgi. Lisatud statistilised joonised ja diagrammid

  15. LEADER-programm toob Jõgevamaale miljoneid kroone / Ardi Kivimets

    Index Scriptorium Estoniae

    Kivimets, Ardi, 1947-

    2007-01-01

    Jõgevamaa Koostöökoja juhatus ja liikmed ning külade esindajad arutasid LEADER-meetme rakendamist maakonnas ning tegevuspiirkonna arengustrateegia koostamist. Oma kogemusi jagasid Soome Turu piirkonna Varsinais-Suomen LEADER-tegevusgrupi esindajad

  16. Ajamere lainetes / Jana Savi

    Index Scriptorium Estoniae

    Savi, Jana

    2012-01-01

    Psühholoogilisest aja käsitlusest - minevik, olevik, tulevik ning teraapiatest (elu)probleemide lahendamiseks. Hetkes elamisest ning neljandast mõõtmest (aeg ja ruum), aegruumi mustritest ja maiade kalendrist

  17. Kaitseliidu kool sai hinnalise kingituse / Kaire Kozlov

    Index Scriptorium Estoniae

    Kozlov, Kaire

    2006-01-01

    Oma viiendat tegutsemisaastat tähistav Kaitseliidu kool sai sünnipäevakingiks kuueteistkümnest sülearvutist ning lisaseadmetest koosneva arvutiklassi, kinkijateks osaühing SmartLink ning Riigikaitse Edendamise Sihtasutus

  18. Kolmkümmend aastat eestikeelset kirikut Washingtonis / Johannes Pedak

    Index Scriptorium Estoniae

    Pedak, Johannes, 1908-2003

    1980-01-01

    USAs, Washingtonis 31. 10. 1949 peetud esimesest eestikeelsest jumalateenistusest. Eripihtkonna kujunemisest ning Baltimore kogudusega liitumisest. EELK Balto-Washingtoni koguduse kujunemisest ning tegevusest 30 aasta jooksul. Kogudusega seotud isikutest

  19. Tondi Sõjakoolist laia maailma / Piret Kuusik ; juhendajad Merike Jürjo, Reet Viikholm

    Index Scriptorium Estoniae

    Kuusik, Piret

    2011-01-01

    Uurimistöö käsitleb Tondi Sõjakooliga seonduvat ning tolleaegseid etiketi- ja käitumisnorme. Töö annab ülevaate aspirant Arvid Tarsi ning temaga koos õppinud nelja kursuslase isikutest ja nende saatusest

  20. Instrument või museaal? / Risto Lehiste

    Index Scriptorium Estoniae

    Lehiste, Risto

    2010-01-01

    Muuseumide ning ühiskonna suhtumisest vanadesse muusikainstrumentidesse. Seoses Eesti Teatri- ja Muusikamuuseumis 30. septembril 2010 toimunud seminariga "Instrument või museaal? Ajalooliste pillide restaureerimine ning kasutamine muuseumis"

  1. Püsiva tegevuskoha mõiste rahvusvahelistes maksulepingutes ja Eesti tulumaksuseaduses / Aare Kurist

    Index Scriptorium Estoniae

    Kurist, Aare, 1974-

    1998-01-01

    Püsiva tegevuskoha mõistest vastavalt OECD 1992. a. tulu ja kapitali maksustamise mudelkonventsioonile ning selle alusel riikide vahel sõlmitud topeltmaksustamise vältimise ning maksudest hoidumise tõkestamise lepingutele

  2. Kambakas Taistole / Janar Filippov

    Index Scriptorium Estoniae

    Filippov, Janar, 1976-

    2003-01-01

    Autoettevõtete Liit ning 19 bussifirma juhti esitasid siseminister Margus Leivole ning majandus- ja kommunikatsiooniminister Meelis Atonenile pöördumise bussiettevõtte Taisto kohta. Küsimustele vastab Tajo Saluste

  3. Voters shrug off upcoming EP ballot / Aleksei Gunter

    Index Scriptorium Estoniae

    Gunter, Aleksei, 1979-

    2004-01-01

    Emor'i uuring näitab, et europarlamendi valimistel osaleb kõigest 33 protsenti valijatest ning valik toimub isikute, mitte erakondade järgi. Soosikuteks ennustatakse Toomas Hendrik Ilvest ning Reformierakonda. Tabel

  4. Telekommunikatsiooniteenuseid pakkuvas ettevõttes integreeritud kvaliteedi- ja keskkonnajuhtimissüsteemi rakendamisest / Laur Lemendik, Kalle Paju

    Index Scriptorium Estoniae

    Lemendik, Laur

    2005-01-01

    Ülevaade standardites ISO 9001:2000 ning ISO 14001:2004 toodud nõuetele vastava integreeritud kvaliteedi- ja keskkonnajuhtimissüsteemi ülesehitusest ning kasutuselevõtmisest telekommunikatsiooniteenuseid osutavas ettevõttes. Skeemid

  5. Hispaania kurk, made in Poland / Gunnel Koba

    Index Scriptorium Estoniae

    Koba, Gunnel

    2009-01-01

    Taimekaitse vahendite kahjulikust mõjust inimese tervisele ning Veterinaar- ja toiduameti andmed Eestis aastail 1998-2007 uuritud puu-, juur- ning aedviljade taimekaitsevahendite ja pestitsiidijääkide seire proovidest

  6. Kultuuriajakirjad sotsioloogi pilguga / Marju Lauristin

    Index Scriptorium Estoniae

    Lauristin, Marju, 1940-

    2008-01-01

    Vaadeldakse "Keele ja Kirjanduse" ning teiste kultuuriajakirjade lugejate arvu muutumist 1950. aastatest kuni tänapäevani, ning mõtiskletakse lugejaskonna suurendamise võimalikkuse ja/või vajalikkuse üle

  7. Walt Disney uus noorus / Silvia Viidik

    Index Scriptorium Estoniae

    Viidik, Silvia, 1972-

    2010-01-01

    Meelelahutuskompanii Walt Disney müüs filmistuudio Miramax ning ostis muusikamänge tootva ettevõtte Tapulous, mille loodud rakendusi kasutab iPhone, ning Facebooki jaoks mänge loova ettevõtte Playdom

  8. Kinnisvaraarendusprojekti hindamine / Signe Liiv

    Index Scriptorium Estoniae

    Liiv, Signe

    2002-01-01

    Kasut. kirj. lk. 36. - Kokkuvõte ingl. k. lk. 36-37. Ülevaade kinnisvaraarendusprojekti hindamise eripärasusest, põhimõtetest ning teooria ja praktika vahelistest seostest ning vastuoludest Eesti kinnisvaraarenduses

  9. Eesti talumaja moderniseerimine 1850.-1920. aastail : elamiskultuur ja hügieen / Heiki Pärdi ; resümee tlk. Tiina Mällo

    Index Scriptorium Estoniae

    Pärdi, Heiki, 1951-

    2007-01-01

    Eesti taluelamu arenemisest traditsioonilisest rehielamust moodsaks elamuks. Elamu arengu osast kollektivistliku eluviisi muutumisel individualistlikuks koos talurahva elulaadi ja mõtteviisi muutumisega ning majast kui omanike jõukuse ning ühiskondlikku seisundi peegeldajast

  10. Polügraafiatesti abil saadud andmete usaldusväärsuse võrdlemine muude tõendite usaldusväärsusega : [bakalaureusetöö] / Ilona Marken-Kruusmägi ; Tartu Ülikool, õigusteaduskond Tallinnas ; juhendaja: Talis Bachmann

    Index Scriptorium Estoniae

    Marken-Kruusmägi, Ilona, 1988-

    2013-01-01

    Polügraafitesti kirjeldus ning selle abil saadava informatsiooni usaldusväärsuse hindamisest, teiste tõendite tutvustusest ning nende usaldusväärsuse hindamisest, võrdlevast hinnangust, tuleviku suundumistest

  11. Keda peaks uskuma investor? / Kaire Uusen

    Index Scriptorium Estoniae

    Uusen, Kaire

    2003-01-01

    Ilmunud ka: Spekter (vene k.) nr. 2, lk. 14-15. Autor võrdleb analüütikuid ning ettevõtete juhte investeerimisinformatsiooni allikana ning selgitab, millest tulenevad erinevused analüüsides ja hinnangutes

  12. I kvartalis vähenes turism Eestis ja kõigis lähiriikides / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2009-01-01

    Eesti majutusettevõtetes I kvartalis 2006-2009 majutatud turistid ja nende ööbimised ning turistide ööbimiste arvu muutus 2009 I kvartalis võrreldes 2008. aasta I kvartaliga Eestis, Põhjamaades ning Baltimaades.

  13. Laimre ja "mina" : Marco Laimre isiknäitus "Küsimused ja vastused" Rotermanni Soolalaos = Laimre and "me" : Marco Laimre solo exhibition "Questions and answers" at the Rotermann salt storage / Anders Härm

    Index Scriptorium Estoniae

    Härm, Anders, 1977-

    2009-01-01

    Marko Laimre unikaalsest ja isikupärasest maailmanägemise ning -käsitlemise viisist, tema raskesti defineeritavast ja irriteerivast loomingust ning isiknäitusest "Küsimused ja vastused" 2004. aastal

  14. Pro god uhhodjashtshii mõ jeshtsho mozhem skazat "neplohhoi". Kak nazovut god sledujushtshii?

    Index Scriptorium Estoniae

    2008-01-01

    Ida-Virumaa suuremate omavalitsuste juhid Jevgeni Solovjov, Niina Neglasson, Jelena Korshunova ja Mihhail Stalnuhhin ning Ida-Viru maavanem Riho Breivel teevad kokkuvõtteid mööduvast aastast ning heidavad pilgu algavasse aastasse

  15. Rahvusvahelise lapsendamise korraldamise õiguslikke probleeme Eestis : [bakalaureusetöö] / Laine Valkama ; Tartu Ülikool, õigusteaduskond ; juhendaja: Edgar Salumaa

    Index Scriptorium Estoniae

    Valkama, Laine

    1993-01-01

    Lapsendamise eesmärk ja tingimused, rahvusvahelise lapsendamise õiguslik reguleerimine, rahvusvahelise lapsendamise organid ja lapsendamisteenistus ning rahvusvahelise lapsendamise etapid Soomes. lapsendamise õiguslikud tagajärjed ning rahvusvahelise lapsendamise korraldus ja tingimused Eestis

  16. Baltic leaders who returned from West to East

    Index Scriptorium Estoniae

    2006-01-01

    Artiklis tutvustatakse kolme Balti riigi presidentide sarnast minevikku eksiilis ning nenditakse, et varasem demokraatlikus riigis elamise kogemus on kindlasti kaasa aidanud Eesti, Läti ja Leedu majanduslikule ning välispoliitilisele edule

  17. Tip Tip Tap / Rasmus Varunov ; intervjueeris Käthlin Mikiver

    Index Scriptorium Estoniae

    Varunov, Rasmus

    2007-01-01

    Laste mänguväljakute atraktsioonidest, nende turvalisusest. Vestlus laste mänguväljakute atraktsioone ja noortele ning täiskasvanutele spordi- ning puhkeväljakuid tootva o.-ü. Tiptiptap tegevjuhiga

  18. Veski - Peegli liinilt / Ellen Uuspõld ; vestelnud Maarja Lõhmus

    Index Scriptorium Estoniae

    Uuspõld, Ellen, 1927-

    2014-01-01

    Juhan Peegel eesti keele kateedri aspirandi ja õppejõuna ning ajaloo-keeleteaduskonna dekaanina. Ka Ellen Uuspõllu õpingutest Tartu Riikliku Ülikooli kaugõppes alates 1945 ning tööst eesti keele kateedris

  19. Külalised 11 riigist tutvusid Eesti toiduturismi võimalustega / Tea Lajal

    Index Scriptorium Estoniae

    Lajal, Tea, 1967-

    2012-01-01

    Kokkuvõte Tartus 2.-9.juulini toimunud Euroopa veini- ja gastronoomia ühingute kokkusaamisest ning 7. juulil Vanemuise Kontserdimajas peetud CEUCO X Euroopa kongressist teemal "Toit on väärtuste kandja" ning gurmeemessist

  20. Media planning at Lillehammer / Oksana Kostina

    Index Scriptorium Estoniae

    Kostina, Oksana

    2005-01-01

    Postimees organiseeris oma reklaamimeeskonnale ning partneritele kümnest reklaamiagentuurist kolmepäevase suusareisi Norrasse, et lähendada inimesi üksteisele ning samas tutvustada sealset meediamaastikku

  1. Hundisilma Edgar, parajalt paks ja parimais aastais / Edgar Savisaar ; interv. Kaire-Külli Kuldbek

    Index Scriptorium Estoniae

    Savisaar, Edgar, 1950-

    2006-01-01

    Eesti Keskerakonna esimees, majandus- ja kommunikatsiooniminister Edgar Savisaar iseloomustab Vilja Savisaart abikaasa ja poliitikuna ning vastab küsimustele, mis puudutavad tema sidemeid usuga, pereelu ning võimalikku kandideerimist presidendiks

  2. Saurix Petroleum valitseb Loksat / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2003-01-01

    Kütusefirma Saurix Petroleumiga seotud ettevõtted teenivad Loksa linna soojamajanduselt ning elektrimüügilt suuri kasumeid ning on sundinud linnavalitsust enda eest ka pangavõlga maksma. Kommenteerib Mihkel Tiks

  3. Ja ne prosto obespokojen. Ja zol / Edward Lukas

    Index Scriptorium Estoniae

    Lukas, Edward

    2007-01-01

    Autor kritiseerib Eesti valitsuse otsust teisaldada pronkssõdur Tõnismäelt ning sellele järgnenud vandaalitsemist, Venemaa käitumist Eesti Moskva suursaatkonnaga ning Euroopa Liidu, NATO ja G-7 riikide mitteadekvaatset reageeringut sellele

  4. Aktsiasoovitus: Tarkvaratootja GigaMedia (GIGM) / Joel Kukemelk

    Index Scriptorium Estoniae

    Kukemelk, Joel

    2009-01-01

    Tarkvaralahenduste väljatöötamise ja nende litsentseerimisega ning Euroopa suuruselt neljandat online-mänguportaali Everest Poker omavasse ettevõtte GigaMedia (GIGM) aktsiatesse investeerimise ohtudest ning positiivsetest teguritest

  5. Avaroni kinnisvaraäri ajab ekspartner koos Kogeri & Partneritega / Kaisa Tahlfeld

    Index Scriptorium Estoniae

    Tahlfeld, Kaisa

    2008-01-01

    Avaron võttis vastu otsuse kinnisvarainvesteeringute ärist väljuda ja keskenduda aktsiafondide juhtimisele ning müüs kogu oma 60% osaluse Avaron Properties Koger & Partneritele ning endisele partnerile Aadu Ojale

  6. Õnnestumised saavad alguse teadmistest / Mihkel Kangur

    Index Scriptorium Estoniae

    Kangur, Mihkel

    2012-01-01

    Edu saavutamisest sporthobuste tõuaretuses Itaalia arhitekti ja riigiametniku ning Donatello hobusekasvatuse looja Federico Tesio ning Belgia veterinaari ja hobusekasvataja Joris de Brabander'i töö näitel

  7. Raudtee erastamine jõudis eile juba eelläbirääkimisteni / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2000-01-01

    Baltic Rail Service, Rail Estonia ning Raudtee Erastamise Rahva AS koos Rootsi riigiraudtee SJ ja Suurbritannia infrastruktuuriettevõtte Sercoga esitasid erastamisagentuurile detailse ärikava koos hinna, investeeringute ning tehnilise ja finantsplaaniga

  8. Kurjade bakterite kõrvalmõju / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2012-01-01

    Alessandra Fogli Minnesota ülikoolist ning Laura Veldkamp Sterni ärikoolist kirjeldasid oma uuringus "Germs, social networks and growth" inimkontakti kaudu levivate haiguste esinemissageduse abil ühiskonna sotsiaalset struktuuri ning selle seost tehnoloogiate levimisega

  9. Grilli & tšilli, lõket & lõbu / Liia Merino & Ants Uustalu

    Index Scriptorium Estoniae

    Maerino, Liia

    2012-01-01

    Kokk Rain Käärst õpetab, milliseid tooteid ja kuidas tervislikult grillida ning mis on barbeque ja grilli erinevus. Ants Uustalu meenutab Eesti toidutraitsiooni paremaid maitseid ning nende valmistamise viise lõkkel ja suitsuga

  10. WHO uuring: vaesed kulutavad enim ravimitele, jõukad hambaravile / Jarno Habicht ; intervjueerinud Liina Ristoja

    Index Scriptorium Estoniae

    Habicht, Jarno, 1976-

    2010-01-01

    Maailma Terviseorganisatsiooni Eesti esinduse juht räägib Eesti inimeste kulutustest ravimitele ning tervishoiuteenustele, Eesti tervisesüsteemi arengust, tervishoiuteenuste kättesaadavusest ja sissetulekute ning tervishoiuteenuste vahelisest suhest teistes Euroopa Liidu riikides

  11. Eesti kool ja õpetaja rahvusvahelises haridusvõrdluses (EKORA) / Anu Toots

    Index Scriptorium Estoniae

    Toots, Anu, 1959-

    2014-01-01

    Ülevaade Eduko programmi finantseeritud projektist, mille eesmärk oli analüüsida, kuivõrd leiavad Eestile iseloomulikud haridusprobleemid kajastamist teiste riikide ja OECD ning EL poliitikadokumentides, ning milliseid meetmeid kasutatakse nende lahendamiseks

  12. The criminal repression of racist rhetoric, racist crimes and race discrimination – The Greek example: towards an effective protection of human dignity? / Maria Kaiafa-Gbandi

    Index Scriptorium Estoniae

    Kaiafa-Gbandi, Maria

    2017-01-01

    Küsimusest kuidas rassistlike kuritegude ja rassilise diskrimineerimisega seotud probleeme käsitletakse rahvusvahelises dokumentides, EL õigusaktides ning ÜRO ja Euroopa Nõukogu konventsioonides ning Kreekas

  13. Kogeja vormistamine eesti keeles : nihkeid SAE perifeerias / Mati Erelt, Helle Metslang

    Index Scriptorium Estoniae

    Erelt, Mati, 1941-

    2008-01-01

    Artiklis vaadeldakse kogeja vormistamist ning alternatiivsete mallide kasutust ajakirjanduskeeles ajavahemikul 1995-2005 eesmärgiga välja selgitada toimunud muutused ning nende põhjused. SAE - Euroopa keskmine standard

  14. Ärimeeste klubid lubavad Eesti ühiskonda paremaks muuta / Kaire Uusen

    Index Scriptorium Estoniae

    Uusen, Kaire

    2005-01-01

    Tutvustav artikkel rahvusvahelistest ärimeeste klubidest ning nende tegevusest Eestis. Oma kogemusi jagavad Riigikogu liikmed Rein Randver ja Väino Linde ning Eesti Round Table liikumise asepresident Primo Annus. Lisad: Rotary Klubi; Lions-klubi; Round Table

  15. Projektfinantseerimine - väljakutse uuendusmeelsele ettevõtjale / Rain Raa

    Index Scriptorium Estoniae

    Raa, Rain

    2005-01-01

    LL.M (Finance) jurist tutvustab enamlevinud lahendusi suurprojektide rahastamiseks ning annab ülevaate projektfinantseerimisega seotud osapooltest, riskidest, finantseerimisvahenditest ning eduka projekti käivitamise eeltingimustest. Lisa: Projektilepingud

  16. Teadmiste lõikepunkt : intervjuu Elmar Mittleriga / Elmar Mittler ; küsitlenud Katrin Kaugver

    Index Scriptorium Estoniae

    Mittler, Elmar

    2008-01-01

    Intervjuu Euroopa Teadusraamatukogude Konsortsiumi (CERL) esimehe ning Göttingeni Riigi- ja Ülikooliraamatukogu endise direktori Elmar Mittleriga, kes oli TLÜAR-i külaline ning pidas Tallinnas loengu "Libraries as worldwide infrastructures for open access"

  17. Ettevõtluskeskkonna ja hariduskorralduse mõnedest majanduspoliitilistest aspektidest / Matti Raudjärv

    Index Scriptorium Estoniae

    Raudjärv, Matti

    2004-01-01

    Autori hinnangul peaks ettevõtluskeskkonna kujundamine ja ettevõtluse toetamine olema suunatud regionaalse tasakaalustatuse saavutamiseks Eestis ning kõrg- ja kutsehariduse regionaalne korraldamine peaks omakorda ettevõtluskeskkonda ning ettevõtluse arengut toetama. Tabel

  18. Tekst ja loodus. Eesti Kirjanduse Selts, 170 lk / Valle-Sten Maiste

    Index Scriptorium Estoniae

    Maiste, Valle-Sten, 1972-

    2001-01-01

    Tekst ja loodus : [seminaride "Kultuur ja loodus" (1996 ; 1999, Tartu) ning "Tekst ja loodus" (1997 ; 1998, Tartu) ettekanded / koostanud ja toimetanud Timo Maran ning Kadri Tüür]. Tartu : Eesti Kirjanduse Selts, 2000

  19. Kaitseväelase ja kaitseliitlase uue sajandi sõjavarustus / Ivar Jõesaar

    Index Scriptorium Estoniae

    Jõesaar, Ivar, 1960-

    2005-01-01

    Tutvustav ülevaade kaitseväelaste ja -liitlaste uuest vormiriietusest, relvastusest ning muust lahinguvarustusest, mis on vastavuses 21. sajandil NATO liikmesriigi sõjaväele esitatavate nõuetega ning kavandatud kaitsejõudude arenguplaanis aastani 2010

  20. Uus eestikeelne logistikatarkvara

    Index Scriptorium Estoniae

    2003-01-01

    OÜ MS Micro poolt välja töötatud Logisticar paketist, mis koosneb tarkvarast ja koolitusest, ning võimaldab optimeerida laokulusid ning materjalihankeid. Skeem: Uus logistikatarkvara ühendab firma eri tegevused

  1. Soome maiustustetootja Leaf saab peatselt uue omaniku / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2004-01-01

    Hollandi kontsern CSM otsustas loobuda maiustusetootmisest, sh. Soome magusatootjast Leaf ning keskenduda pagaritööstustoorme, biokemikaalide ning suhkrutoodete valmistamisele. Diagramm: CSMi kasumlikkus vähenes. Vt. samas: Eestis menukad kurgupastillid

  2. Üldküsimuse vorm ja funktsioonid läbi nelja sajandi ja kuue tekstiliigi / Tiit Hennoste, Helle Metslang, Külli Habicht ... [jt.

    Index Scriptorium Estoniae

    2016-01-01

    Käsitletakse üldküsimuse vormivahendeid ja funktsioone ning vormi, funktsiooni ja tekstiliigi seoseid kirjalikus eesti keeles: 17. -18. sajandi tekstides ning tänapäeva ilukirjanduses ja ajakirjanduses, ka netikommentaarides

  3. Developing the international technology transfer potential of innovative SMEs / Tiit Elenurm, Erik Terk, Alasdair Reid...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Innovaatilise ettevõtluse arendamise projektist, mis keskendub EL-i liikmes- ning kandidaatriikide väike- ja keskmiste ettevõtete innovaatilise ettevõtluspotentsiaali arendamisele rahvusvahelise teabevahetuse ning tehnoloogiasiirde partnerluse kaudu. Tabelid. Skeem

  4. Disainkaminad

    Index Scriptorium Estoniae

    2007-01-01

    Salongides Tulering, Tulepesad ja 12 kaminat ning Tondi kaminasalongis pakutavad kaminad. Kaminad Liina Ainomäe, Annes Arro, Kaire Kemp-Tischleri, Jorma Holmi, Külli Salumi ja Riina Hariku sisekujundusega ning Meelis Pressi prpjekteeritud eramutes

  5. Pension tuuakse jätkuvalt koju kõigile abivajajatele / Tõnis Kõiv

    Index Scriptorium Estoniae

    Kõiv, Tõnis, 1970-

    2008-01-01

    Riigikogu võttis vastu pensioni kojukannet käsitleva seadusemuudatuse, mille kohaselt hajaasustusega piirkondades ning asulates, kus pangateenused pole kättesaadavad, jääb pensionide ning hüvitiste kojukanne edaspidigi tasuta

  6. Eesti saarte parvlaevaühendus : probleemid ja lahendused / Enno Lend, Aare-Maldus Uustalu

    Index Scriptorium Estoniae

    Lend, Enno, 1957-

    2003-01-01

    Eesti saarte laevaühenduse hetkeolukorrast ja kasutatavate reisi- ning parvlaevade vastavusest tänapäevasele teenindustasemele ning veonõuetele. Eesti suuremate saarte ülevaade. Tabelid. Graafikud. Diagramm

  7. Eesti majandustegevuse seaduse eelnõu ekspertiis / Rolf Stober ; tõlk. Pille Vinkel

    Index Scriptorium Estoniae

    Stober, Rolf

    1997-01-01

    Eksperthinnang Eesti majandustegevuse seaduse eelnõule - selle kooskõla GATT/WTO-ga, Euroopa Liidu õigusega ning põhiseadusega, süsteemikooskõla ning korrapoliitiline, seadusloometehniline ja otstarbekuse hinnang

  8. EuroPlus+ Reward / Alar Hammer

    Index Scriptorium Estoniae

    Hammer, Alar

    2000-01-01

    EuroPlus+ Reward on mitmes versioonis ilmunud inglise keele õppeprogramm, milles on ühendatud multimeedia võimalused ning distantsõpe ning mis loob täiesti uued võimalused keele omandamiseks arvuti abil

  9. Õigusterminid ja õigusharidus, erialase oskussõnavara omandamine / Merike Ristikivi

    Index Scriptorium Estoniae

    Ristikivi, Merike, 1973-

    2012-01-01

    Juristide jaoks olulise erialase oskussõnavara omandamisest kolmel perioodil: 1918-1940, nõukogude aeg ning taasiseseisvusaeg. Õigusterminoloogia omandamisest ning õppevahenditest, mille alusel ülikoolis juriidilisi termineid õpetati ja õpiti

  10. The democratic experience in divided societies : the Baltic states in comparative perspective / Geoffrey Evans, Christine S Lipsmeyer

    Index Scriptorium Estoniae

    Evans, Geoffrey

    2001-01-01

    Artiklis võrreldakse vähemusrahvuste rahulolu demokratiseerimisprotsessiga ning osalemist demokraatlikes protsessides kolmes Balti riigis ning kümnes Ida-Euroopa riigis 1990. aastail. Tabelid. Lisa: The surveys

  11. Job analysis and job evaluation systems in the countries of the former Yugoslavia / József Poór, ́Agnes Szlávicz, Anton Florijan Barisic, Zoran Vaupot

    Index Scriptorium Estoniae

    2008-01-01

    Tööanalüüsi ja hindamise teooriates ning praktikas toimunud arengutest ja muutustest riikides, mis tekkisid endise Jugoslaavia Sotsialistliku Föderatiivse Vabariigi lagunemise järel Serbias, Horvaatias, Bosnias ja Hertsegoviinas ning Sloveenias. Tabelid. Skeemid

  12. Eesti Põlevkivi aitab kotkastele GPS-saatjad selga / Külli Kriis

    Index Scriptorium Estoniae

    Kriis, Külli, 1961-

    2006-01-01

    Vt. ka Severnoje Poberezhje 2. aug. Kotkaklubi eestvõttel ning Eesti Põlevkivi ja riigimetsa majandamise keskuse toetusel püstitatakse Narva karjääri taastatud alale kolm kotka pesapuud ning varustatakse kaks konnakotkast GPS-saatjatega

  13. Kes teevad meile süüa? / Vesta Reest

    Index Scriptorium Estoniae

    Reest, Vesta, 1971-

    2007-01-01

    Eestisse kolinud ja siin töötavad kokad itaallane Rocco Russo, belglane Emmanuel Wille, soomlane Juha Rantanen ning tailane Gusisara Tosirisakun räägivad eesti toidust, toiduvalmistamisest ning toitumistavadest

  14. BLRT Grupp ostis Soomes tehase

    Index Scriptorium Estoniae

    2007-01-01

    BLRT Grupp ostis Soome laevaremonditehase Turku Repair Yard Ltd. Tehase põhikliendid on Neste, Tallink, Silja ja Viking Line ning Soome riigi jäämurdjad ning aastakäive ligi 300 miljonit Eesti krooni

  15. Erakondade erastatud Eesti: kuidas edasi? / Peeter Jalakas

    Index Scriptorium Estoniae

    Jalakas, Peeter, 1961-

    2009-01-01

    Autori hinnangul meenutavad Eesti erakonnad üha enam äriühinguid, mille tõttu valitseb riigis erakondlik egoism ning kodanike rahulolematus - olukorra parandamiseks oleks vaja muuta olemasolevat valitsemissüsteemi ning luua kahekojaline parlament

  16. Arendajad asuvad julgelt uute projektide kallale / Tea Taruste ; kommenteerinud Andres Teder

    Index Scriptorium Estoniae

    Taruste, Tea

    2010-01-01

    Arco Vara ehitab kortermaju Tallinnas Kodukolde elurajooni ning on alustanud Kodukolde uue etapi korterite müüki, NCC alustas Vana-Kuuli III etapi ehitust ning jätkab Pärnaõue elamuprojekti arendust

  17. Annelinn - Tartu kuldne kroon, betoonist

    Index Scriptorium Estoniae

    2007-01-01

    Jarmo K otsib Tartu betoonlinnakust väärikust ning poeesiat. Kiitust pälvinud kaasaegsetest elamutest on nimetatud AB Muru & Pere projekteeritud kolmiktorne Luha tänaval ning Ott Ojamaa projekteeritud elamut Kalda teel

  18. US House of Representatives resolution 397

    Index Scriptorium Estoniae

    2008-01-01

    USA Kongressi Esindajatekoja Eesti teemaline resolutsioon, milles väljendatakse solidaarsust Eestiga ning mõistetakse hukka märatsejate vägivald Tallinnas ning rünnakud Eesti saatkonna vastu Moskvas

  19. Patendivolinik - tööstusomandi õiguskaitse osutaja. 1.-3. osa / Jüri Käosaar

    Index Scriptorium Estoniae

    Käosaar, Jüri, 1945-

    2006-01-01

    Patendiameti ülesannetest ning patendivolinikuks saamise tingimustest ja ülesannetest. Euroopa Patendikonventsioonist ja Euroopa patendivolinikust, Euroopa Ühenduse kaubamärgist, Ülemaailmsest Intellektuaalse Omandi Assotsiatsioonist ning Intellektuaalomandi Kaitse Rahvusvahelisest Assotsiatsioonist

  20. Pakkujate võrdne kohtlemine riigihankemenetlusest kõrvaldamisel ja pakkujate kvalifitseerimisel : [magistritöö] / Piia Kulm ; Tartu Ülikool, õigusteaduskond ; juhendajad: Ene Andresen, Veiko Vaske

    Index Scriptorium Estoniae

    Kulm, Piia

    2009-01-01

    Võrdse kohtlemise põhimõtte sisust ja kohaldamisest ning selle põhimõtte järgimise tagamisest riigihangete õiguses, pakkujate kõrvaldamise ja pakkujate kvalifitseerimise etapi erinevustest, pakkujate hankemenetlusest kõrvaldamise ning kvalifitseerimise etapist

  1. Virumaa kooliõpetajast koduloolane August Martin ja Kaukaasia eestlased / Aivar Jürgenson

    Index Scriptorium Estoniae

    Jürgenson, Aivar, 1969-

    2017-01-01

    Virumaa kooliõpetaja ja rahvapärimuse ning kultuuriloo koguja August Martini tegevust Kaukaasia eestlaste organiseerimisel, Kaukaasia eesti asunduste sidemete tugevdamisel emamaa Eestiga ja Kaukaasia eestlaste asustusloo ning muu pärimuse kogumisel

  2. Botaanikud Chamisso ja Eschscholtz Californias / Tiiu Speek

    Index Scriptorium Estoniae

    Speek, Tiiu, 1958-

    2012-01-01

    Loodusteadlaste A. von Chamisso ja J. Fr. Eschscholtzi osalemisest O. von Kotzebue ekspeditsioonidel (1815-1818 ning 1823-1826); reisidel kogutud ja kirjeldatud USA lääneosa ja California taimeliikidest ning neist koostatud herbaariumite saatusest

  3. The concept of text in cultural semiotics / Göran Sonesson

    Index Scriptorium Estoniae

    Sonesson, Göran, 1951-

    1998-01-01

    "Tekstist" Tartu koolkonna kirjutistes ning Roland Posnerþi rekonstrueeritud teoorias. Tekstuaalsuse sellisest hierarhiast, mis nõuab interpretatsiooni ning mis on seejärel omakorda allutatud interpretatsioonile

  4. Riik, ohuallikad ja inimeste hirmud / Ivar Aimre

    Index Scriptorium Estoniae

    Aimre, Ivar, 1941-2009

    2005-01-01

    Autori hinnangul tähendab turvalisuse tootmine hirmude asjatu suurendamise ärahoidmist, ohtudest ja õnnetustest õigeaegset ning efektiivset teavitamist, nende puhul tõhusat tegutsemist ning sootsiumile sellekohase info edastamist

  5. Hiiu murdekeel Jean Baptiste Holzmayeri "Osilianas" / Helmi Neetar

    Index Scriptorium Estoniae

    Neetar, Helmi

    1997-01-01

    Saaremaa muinasusundi ja rahvaluule koguja ning uurija Jean Baptiste Holzmayeri teosest "Osiliana" (II osa ilmus 1873) ja Pühalepa pastori von Segenbuschi kaastööst sellele ning uurimuses sisalduvatest hiiumurdelistest keelenditest

  6. Ametnikud ei jaga maaelu / Viio Aitsam

    Index Scriptorium Estoniae

    Aitsam, Viio, 1955-

    2005-01-01

    Türi vallavolikogu liige Ülo Ormus saatis avaliku kirja valitsusele, majandus- ja kommunikatsiooni- ning siseministeeriumile, milles juhtis tähelepanu maapiirkondade kehvale bussiliiklusele ning vajadusele taotleda Euroopa Liidu tõukefondidest raha maakondade sotsiaalse infrastruktuuri arenguks

  7. Euroopa kuulsaim tippjuht peab Eesti eeliseks Venemaa tundmist / Raigo Neudorf

    Index Scriptorium Estoniae

    Neudorf, Raigo

    2001-01-01

    Euroopa kuulsaim tippjuht Percy Barnevik nimetab Eestit sillaks ida ja lääne vahel ning peab oluliseks, et eestlased kasutaksid ära oma teadmisi ning võimalusi Venemaaga suhtlemisel. EL laienemisest. P. Barneviki eluloolisi andmeid

  8. Valge Laeva hukk : Estonia katastroof meie peas = The wreck of the White ship : on the catastrophe of the Estonia / Anders Härm

    Index Scriptorium Estoniae

    Härm, Anders, 1977-

    2009-01-01

    "Estonia" katasroofist ja meedia osast selle kajastamisel, Juhan Leinbergist ja maltsvetlusest ning "valge laeva" kui priiuse laeva ja lootuse kujundist Eesti kultuuris ning selle tähendusest eestlaste teadvuses

  9. Rõivakaubanduse edu saladused / Marek Maido

    Index Scriptorium Estoniae

    Maido, Marek

    2014-01-01

    H & M, Zara, Mango ja Uniqlol rõhutavad majandustarkvara ERP lahenduste olulist rolli ning kasutavad neid klientide eelistuste kaardistamiseks, varude kiireks täiendamiseks ning tarneketi juhtimiseks

  10. „EU”: short for „ethical” union? The role of ethics in European Union law / Markus Frischhut

    Index Scriptorium Estoniae

    Frischhut, Markus

    2015-01-01

    Eetika ja moraali põhimõtetest ELi esmases ja teiseses õiguses ning institutsioonide tegevuses; Euroopa Kohtu praktikast ning Teaduse ja uute tehnoloogiate eetika Euroopa töörühma (EGE) hinnangutest

  11. Lätti ja Leetu laienev Eesti Post võtab kasutusele pakiautomaadid / Dannar Leitmaa

    Index Scriptorium Estoniae

    Leitmaa, Dannar, 1982-

    2010-01-01

    Eesti Post kavatseb 2010. aastal investeerida 150 miljonit krooni e-teenuste arendamisse ning laiendada tegevust Lätti ja Leetu, samuti avatakse kaubanduskeskustes väiksemaid postikeskusi ning võetakse kasutusele arvukalt pakiautomaate

  12. Õpetaja professionaalne areng laiendatud kogukonnas : õpetaja õppimine ja teadmusloome laiendatud professionaalses kogukonnas e-portfoolio toel / Kairit Tammets

    Index Scriptorium Estoniae

    Tammets, Kairit

    2011-01-01

    Laiendatud professionaalse kogukonna ideest ning teoreetilisest õppimise ja teadmusloome mudelist, mis põhineb Nonaka ja Takeuchi teadmusjuhtimise SECI mudelil ning on kohandatud Eesti õpetajakoolitusega koos tehnoloogiliste võimalustega

  13. Eeluurimiskohtunik kriminaalmenetluse seadustiku eelnõus / Meelis Eerik

    Index Scriptorium Estoniae

    Eerik, Meelis, 1976-

    2000-01-01

    Eeluurimiskohtuniku funktsioonidest uurimistoimingute sanktsioneerimisel, kriminaalmenetluse tagamisel, kohtueelses, väljaandmis- ja kohtumenetluses ning eeluurimiskohtuniku poolt tehtavatest lahenditest

  14. Igra po novõm pravilam / Vladimir Skripov

    Index Scriptorium Estoniae

    Skripov, Vladimir

    2004-01-01

    Investeerimist reguleerivatest seadustest, investeeringute statistika ning erastamine kui investeerimisprotsessi liikumapanev jõud Leedus. Tabelid: Materiaalsed investeeringud; Peamised investeerijad maad

  15. GLOBEì andmebaasi ressursside kasutamine geograafia õpetamisel / Imbi Henno

    Index Scriptorium Estoniae

    Henno, Imbi

    2003-01-01

    Õpilased ja õpetajad võivad tutvuda koolidest GLOBE℗þi andmebaasi saadetud andmetega ning NOAA ja NASA teemakaartide, materjalide ning ressurssidega. Kõige sobilikum on GLOBEì kodulehe võimalusi kasutada geograafiatundide näitlikustamisel, koolide saadetud andmete võrdlemisel ning teadmiste ja oskuste kontrollimisel, GLOBE on abiks ka riikliku õppekava geograafiateemade käsitlemisel

  16. On legal bases and process of accreditation of teaching of law in Estonia (University of Tartu Faculty of Law case) / Kalle Merusk, Raul Narits, Peep Pruks

    Index Scriptorium Estoniae

    Merusk, Kalle, 1949-

    1998-01-01

    Õigusharidust andvate õppeasutuste akrediteerimisest; Tartu Ülikooli õigusteaduskonnast ning selle avaliku õiguse ja eraõiguse instituutidest, õppeprogrammist, magistri- ja doktoriõppest ning teadustegevusest. Lisatud andmed 1993.-1998. a. kaitstud teadustööde kohta, õppejõudude osalemise kohta seaduseelnõude ettevalmistamisel ning publikatsioonide kohta

  17. Riigi sisejulgeolekut tagava jälitustegevuse eesmärgid ja kontroll. [1.-2. osa] / Saale Laos

    Index Scriptorium Estoniae

    Laos, Saale

    2008-01-01

    Ülevaade jälitustegevuse lubatavatest eesmärkidest ning jälitustegevuse üle teostatava kontrolli põhimõtetest. Jälitustegevuse mõistest, kehtivast regulatsioonist, põhiseaduslikust taustast ning eesmärkidest. Riigi sisejulgeolekust, ning vastavast seadusandlusest

  18. Mustvalge linnavilla / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2013-01-01

    Emil Urbeli ja Andrus Margi projekteeritud ning Kristiina Tuulbergi ja Jaanika Sokmani (Boreal OÜ) sisekujundusega villast Tallinnas. Kalle Pruuden on kujundanud baaripukid köögis ning sepispiirded treppidel. Aknakatted-riputussüsteemid ning padjad valmisid koostöös disainer Ange Saarega. Ehitusaeg: 2012 sügis. Elamispind: 454 m²

  19. Via Hanseatica tõotab tulevikus maakonna idaosale uut arenguruumi / Andres Loorand

    Index Scriptorium Estoniae

    Loorand, Andres, 1969-

    2005-01-01

    Jõgeva-, Ida-Viru-, Tartu- ja Valgamaa ning sihtasutuse Lõuna-Eesti Turism ning siseministeeriumi esindajad arutasid Via Hanseatica projekti arendustegevust. Tegemist on Lübeckist algava, läbi Gdanski, Kaliningradi ja Riia Eestini jõudva ning Valga, Elva, Tartu, Mustvee, Jõhvi ja Narva kaudu Peterburini ulatuva transpordikoridoriga, mis ühendab Põhja-Saksamaad Loode-Venemaaga

  20. Koolhaas toimetab / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2001-01-01

    Rahvusvaheline kirjastusgrupp Condé Nast, mis annab välja ajakirju Wired, Vogue, Architectural Digest jt., on palganud arhitekt Rem Koolhaasi ning tema kaheksaliikmelise meeskonna nõustama grupi ajakirjade toimetamist ning turustamist. Sügisel avaldab R. Koolhaas monograafia shoppingust ning selle rollist arhitektuuri suunajana.

  1. Eesti vanausuliste ikoonimaali iseärasustest = Особенности староверческой иконописи Эстонии / Mari-Liis Paaver

    Index Scriptorium Estoniae

    Paaver, Mari-Liis

    2011-01-01

    Gavriil Frolovi elust ja loomingust ning tema Raja külas Peipsi ääres rajatud ikoonimaalitöökojast ning seal tegutsenud õpilastest-ikoonimaalijatest, ka selle koolkonna ikoonide filigraansest teostusest, ikonograafilistest ja maalitehnilistest iseärasustest ning erinevustest

  2. Awareness, knowledge, and attitudes with respect to epilepsy: an investigation in relation to health-related quality of life within a Malaysian setting.

    Science.gov (United States)

    Lua, Pei Lin; Neni, Widiasmoro Selamat

    2011-07-01

    The influence of awareness, knowledge, and attitudes (AKA) on the health-related quality of life (HRQoL) of patients with epilepsy has not been widely established. The aims of this preliminary study were to (1) assess general AKA and HRQoL levels, (2) correlate AKA and HRQoL levels, and (3) compare the HRQoL of patients with epilepsy with different AKA levels. A cross-sectional sample of outpatients with epilepsy were recruited from the Neurology Clinic, Hospital Sultanah Nur Zahirah, Kuala Terengganu, Malaysia. Data analysis was carried out using the Statistical Package for Social Sciences Version 15 employing descriptive and nonparametric statistics. On written consent, included patients completed the Malay AKA Epilepsy and the Malay Quality of Life in Epilepsy-30 (MQOLIE-30) instruments. Across all patients, both AKA levels (median: 80.0, range: 0-170) and overall HRQoL (median 51.5; range 15-97) were moderate. Awareness was significantly correlated only with Seizure Worry (r(s)=+0.29, p<0.05), whereas Knowledge was not significantly linked to any domain. However, Attitudes was significantly correlated with all domains (r(s)=+0.35 to +0.47, p<0.01) except Medication Effects and Seizure Worry. Patients with good AKA levels (Total Score ≥ median) experienced significantly better Overall Quality of Life and Cognitive Functioning (p<0.05). Findings showed that AKA may play an important role in influencing patients' HRQoL, suggesting that epilepsy treatment efforts should also focus on enhancing AKA through epilepsy awareness to improve health outcomes. Copyright © 2011 Elsevier Inc. All rights reserved.

  3. Computation of Propagation Speed and Reflection of Axially Symmetric Waves in Composite Cylinders, with Application to Impedance Tube and Calibrator.

    Science.gov (United States)

    1982-08-25

    hoth real and complex; and () compute the propagation speed in the acoustic cal Ibr:ator. (continued on reverse) DD IARM3 1473 EDITION OF I NOVSSIS...FORMAT (3F15.0) 0131 GO TO 230 0132 690 CONTINUE 0133 END 50 *> SUBROUTINES SUBROUTINE: DET C C SUBROUTINE DET C DECEMBER, 1980 C EDITED BY TINA RUGGIERO...33 AISA =AKDA/BAMS 0008 02A=AKA**’-AKDA**2 0009 S2A=AKA**2-AKSA**2 0010 IF (RHM) 65P65P40 0011 40 AKFA-AKDA/COCD 0012 OF2A-AKA**2-AKFA**2 0013 IF (OF2A

  4. 75 FR 48991 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2010-08-12

    ...; Kingston Technology Far East (Malaysia) Sdn Bhd, Bayan Legas, Malaysia; MiTAC Digital Corporation (aka... to the orders are used in the United States; (ii) Identify any public health, safety, or welfare...

  5. SeaWiFS_L3b_SNSP_RRS

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  6. SeaWiFS_L3b_CU_CHL

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  7. SeaWiFS_L3b_SNWI_CHL

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  8. 75 FR 74769 - Designation of Three Individuals Pursuant to Executive Order 13224

    Science.gov (United States)

    2010-12-01

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... passport; Holder of a Bangladesh passport (individual) [SDGT] 3. RAUF, Hafiz Abdur (a.k.a. RAOUF, Hafiz...

  9. OIL SOLUTIONS POWDER

    Science.gov (United States)

    Technical product bulletin: aka OIL SOLUTIONS POWDER, SPILL GREEN LS, this miscellaneous oil spill control agent used in cleanups initially behaves like a synthetic sorbent, then as a solidifier as the molecular microencapsulating process occurs.

  10. SeaWiFS_L3m_MO_CHL_chlor_a_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  11. Honey Do Franchising Group, Inc. Information Sheet

    Science.gov (United States)

    Honey Do Franchising Group, Inc., a/k/a The Honey Do Service, Inc. (the Company) is located in Bristol, Virginia. The settlement involves renovation activities conducted at properties constructed prior to 1978, located in Bristol, Virginia.

  12. CRED Towed-Diver Fish Biomass Surveys at Johnston Atoll, Pacific Remote Island Areas in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  14. CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  15. CRED Towed-Diver Fish Biomass Survey at Asuncion, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  16. CRED Towed-Diver Fish Biomass Surveys at Nihoa Island, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Lanai Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. CRED Towed-Diver Fish Biomass Survey at Kingman, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  19. Salinity and physical data from TS probe and thermometer in the Southeast Pacific Ocean from 04 December 1956 to 01 May 1989 (NODC Accession 0000329)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Salinity, temperature, and physical data were collected from the AKADEMIK FEDOROV (AKA AKADEMIK FYODOROV), LENA, and OB from December 4, 1956 to May 1, 1989. These...

  20. CRED Towed-Diver Fish Biomass Survey at Tau, American Samoa in 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  1. CRED Towed-Diver Fish Biomass Surveys at Sarigan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. CRED Towed-Diver Fish Biomass Surveys at Pearl And Hermes Atoll, NW Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  3. CRED Towed-Diver Fish Biomass Survey at South Bank, American Samoa in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  4. CRED Towed-Diver Fish Biomass Surveys at Jarvis Island, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  5. CRED Towed-Diver Fish Biomass Surveys at Tau Island, American Samoa in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  6. CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  7. CRED Towed-Diver Fish Biomass Surveys at Alamagan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Survey at Baker, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  9. CRED Towed-Diver Fish Biomass Survey at Guam, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  10. CRED Towed-Diver Fish Biomass Survey at Baker, Pacific Remote Island Areas in 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  11. CRED Towed-Diver Fish Biomass Survey at Sarigan, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  12. CRED Towed-Diver Fish Biomass Surveys at Maug Islands, Marianas Archipelago in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  14. CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  15. CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Maug Islands, Marianas Archipelago in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. GPM, DPR Level 2A Ka Precipitation V03

    Data.gov (United States)

    National Aeronautics and Space Administration — The 2AKa algorithm provides precipitation estimates from the Ka radar of the Dual-Frequency Precipitation Radar on the core GPM spacecraft. The product contains two...

  19. DISPERSIT SPC 1000™

    Science.gov (United States)

    Technical product bulletin: aka SEACARE, ECOSPERSE, this water based dispersant may be applied in oil spill cleanups by aerial or boat spraying. Concentration/application rates depend on type of oil, degree of weathering, temperature, extent of slick.

  20. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  1. CRED Towed-Diver Fish Biomass Surveys at Raita Bank, NW Hawaiian Islands in 2001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. CRED Towed-Diver Fish Biomass Surveys at Midway Atoll, NW Hawaiian Islands in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  3. CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  4. CRED Towed-Diver Fish Biomass Survey at Swains, American Samoa in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  5. CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  6. CRED Towed-Diver Fish Biomass Survey at Lanai, Main Hawaiian Islands in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  7. CRED Towed-Diver Fish Biomass Surveys at Guam Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Surveys at Asuncion Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  9. Ecosystem Monitoring (AL9804, EK500)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ecosystem Monitoring (aka Ecomon) survery uses bongo and CTD sampling to monitor and map the distribution of zooplankton, krill and smaller organisms) and the...

  10. CRED Towed-Diver Fish Biomass Surveys at Molokai Island, Main Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  11. ENGLISH-IGBO GLOSSARY CREATION OF PALM OIL ...

    African Journals Online (AJOL)

    Dean SPGS NAU

    Abstract. The Igbo speaking people are well known for palm oil production ... ventures among other trades or occupations for which the Igbo are known. .... Q na-eme aka ntxtx vii. ..... Professionals – teachers, lawyers, writers, journalists and.

  12. SAFARI 2000 PAI Estimates from Hemispherical Photography, Kalahari Transect

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set was collected during February-March 2000 wet season and September 2000 dry season field campaigns of SAFARI 2000. Mongu in Zambia and Pandematenga (aka...

  13. SeaWiFS_L3b_8D_POC

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  14. SORCE Level 3 Total Solar Irradiance Daily Average V016

    Data.gov (United States)

    National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) data set SOR3TSID contains the total solar irradiance (a.k.a solar constant) data collected by the Total Irradiance Monitor (TIM)...

  15. TCTE Level 3 Total Solar Irradiance Daily Means V002

    Data.gov (United States)

    National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) Calibration Transfer Experiment (TCTE) data set TCTE3TSID contains daily averaged total solar irradiance (a.k.a solar constant) data...

  16. TCTE Level 3 Total Solar Irradiance 6-Hour Means V002 (TCTE3TSI6) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) Calibration Transfer Experiment (TCTE) data set TCTE3TSI6 contains 6-hour averaged total solar irradiance (a.k.a solar constant)...

  17. CRED Towed-Diver Fish Biomass Survey at Asuncion, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  18. CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  19. CRED Towed-Diver Fish Biomass Surveys at Necker Island, NW Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  20. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available mal protein L18 [Kineococcus radiotolerans SRS30216] ... Length = 94 ... Query: 29 ... TELRPRLVVTRSARHVFVQVVDDAQGRTLASASTM...EADLRGFDGDKTAKARKVGELVAER 88 ... T +RPRLVVTRS RHVFVQV+DDA G TLASASTMEADLR ... DK+AKA+ V...G LV ER Sbjct: 1 ... TAVRPRLVVTRSTRHVFVQVIDDAAGHTLASASTMEADLRASGDDKSAKAKAVGVLVGER 60 ...

  1. CRED Towed-Diver Fish Biomass Surveys at Kaula Rock, Main Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. 76 FR 61776 - Designation of Five Individuals Pursuant to Executive Order 13224

    Science.gov (United States)

    2011-10-05

    ... (Pakistan) issued 8 Sep 2008 expires 7 Sep 2013 (individual) [SDGT] 4. ABBASIN, Abdul Aziz (a.k.a. MAHSUD, Abdul Aziz); DOB 1969; POB Sheykhan Village, Pirkowti Area, Orgun District, Paktika Province...

  3. Tartu ehk unbewusste Ängste / Rauno Thomas Moss ; interv. Harry Liivrand

    Index Scriptorium Estoniae

    Moss, Rauno Thomas, 1977-

    2008-01-01

    Rauno Thomas Mossi (1977) näitus "Silent Tartu aka Clinical" Vaal galeriis. Kunstniku eluloolisi andmeid, loomingust, alasti mehekeha kujutamisest. Töötab Tartu Ülikoolis joonistamise ja plastilise anatoomia õppejõuna. Tema lemmikkunstnikud

  4. CRED Towed-Diver Fish Biomass Survey at Jarvis, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  5. CRED Towed-Diver Fish Biomass Surveys at Arakane Bank, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  6. CRED Towed-Diver Fish Biomass Surveys at Kure Atoll, NW Hawaiian Islands in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  7. CRED Towed-Diver Fish Biomass Surveys at Farallon De Pajaros Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Survey at Wake, Pacific Remote Island Areas in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  9. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  10. 77 FR 68207 - Designations of 4 Individuals Pursuant to Executive Order 13224 of September 23, 2001, “Blocking...

    Science.gov (United States)

    2012-11-15

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined..., Mohammad (a.k.a. MINAEE, Muhamed); DOB 1964; POB Iran; citizen Iran (individual) [SDGT] [IRGC] [IFSR...

  11. 77 FR 61051 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2012-10-05

    ..., Distrito Federal Codigo Postal 03020, Mexico; Calle Sor Juana Ines de la Cruz No. 144, Departamento 124... (Mexico) (individual) [SDNTK]. 2. FELIX FELIX, Victor Manuel (a.k.a. CASTRO RODRIGUEZ, Raul), Callejon...

  12. 77 FR 20124 - Designation of 4 Individuals and 2 Entities Pursuant to Executive Order 13224 of September 23...

    Science.gov (United States)

    2012-04-03

    ... Zone 1, Abuja, Nigeria; DOB 1965; nationality Nigeria (individual) [SDGT] Entities 1. YAS AIR (a.k.a..., Tehran, Iran [SDGT] 2. BEHINEH TRADING, Tehran, Iran [SDGT] Dated: March 27, 2012. Adam J. Szubin...

  13. Data Element Registry Services

    Data.gov (United States)

    U.S. Environmental Protection Agency — Data Element Registry Services (DERS) is a resource for information about value lists (aka code sets / pick lists), data dictionaries, data elements, and EPA data...

  14. Ecosystem Monitoring (HB1502, EK60)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ecosystem Monitoring (aka Ecomon) survery uses bongo and CTD sampling to monitor and map the distribution of zooplankton, krill and smaller organisms) and the...

  15. CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Survey at Howland, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  17. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. CRED Towed-Diver Fish Biomass Surveys at Kure Atoll, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  19. CRED Towed-Diver Fish Biomass Survey at Wake, Pacific Remote Island Areas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  20. CRED Towed-Diver Fish Biomass Survey at Guam, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...